5E3BA

Structure of macrodomain protein from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
148
Chain Sequence
EISYVRGDATAPSVKGVKMIAHVCNDLGGWGKGFVLAVSRRWPQPEAAYRAWHRDRAANDFGLGAVQFVQVEPYVWVANMIGQHGMKPVRYEAIGTALGRVADRAAELEASVHLPRIGLAGGTWSRVEPLISDRLTRRGIPVTVYDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disruption of Macrodomain Protein SCO6735 Increases Antibiotic Production in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor (strain atcc baa-471 / a3(2) / m145)
molecule tags Hydrolase
molecule keywords Macrodomain protein
total genus 52
structure length 148
sequence length 156
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5e3bA00
3EWQA 4GUAA 1NJRA 4KYBA 4ABKA 4JGKA 4ZI6A 4KSIA 3KR4A 3GPOA 3V45A 2L8RA 3KQXA 1VHUA 3KQZA 3KZWA 4GVWA 5HIHA 1LAPA 3V2BA 2ACFA 4D86A 3H8FA 2FAVA 4ZX8A 3VFQA 5FSZA 4UMLA 4R6TA 3SIHA 2AFCA 1BPNA 4JLLA 3EWOA 3Q71A 5FSYA 3Q6ZA 4ZY0A 3ETIA 4GVVA 1BPMA 4ETKA 4ETJA 3SIGA 5E3BA 2DX6A 2VRIA 4X2TA 3IJ3A 4ZYQA 1GYTA 4J4ZA 3EW5A 5DUSA 1LANA 4IQYA 3IIFA 4ZY2A 4J5QA 5FSUA 3EKEA 4JCAA 3GQOA 1ZR5A 3SIJA 3H8EA 1SPVA 5CMSA 2FXKA 5CB5A 3EJGA 2XD7A 3GQEA 1ZR3A 4ZY1A 4K0CA 1HJZA 2X47A 5D8NA 1LCPA 4R76A 3EJFA 4ZX9A 2LGRA 3GPGA 4J5RA 4TU0A 2FG1A 3PEIA 5CB3A 5AILA 2J9AA 2BFRA 3EWRA 3JRUA 5HOLA 3H8GA 3EWPA 2EWBA 1TXZA 4ABLA 1TY8A 5FSVA 1LAMA 3SIIA 5CBMA 1YD9A 3IIDA 3T8WA 5FSXA 3GPQA 2BFQA 4K3NA 2EEEA 1BLLE 4R7MA 3KR5A 4J5SA 4JVVA 3JZTA 4ESSA
chains in the Genus database with same CATH superfamily
2W2GA 3EWQA 2KQVA 4GUAA 1NJRA 4KYBA 4ABKA 4JGKA 4ZI6A 4KSIA 3KR4A 3GPOA 2JZFA 3V45A 2L8RA 3KQXA 1VHUA 3KQZA 3KZWA 4GVWA 5HIHA 1LAPA 3V2BA 2ACFA 4D86A 3H8FA 2FAVA 4ZX8A 3VFQA 5FSZA 4UMLA 4R6TA 3SIHA 2AFCA 2RNKA 1BPNA 4JLLA 2JZEA 2WCTA 3EWOA 3Q71A 5FSYA 3Q6ZA 4ZY0A 3ETIA 4GVVA 1BPMA 4ETKA 4ETJA 3SIGA 5E3BA 2DX6A 2VRIA 4X2TA 3IJ3A 4ZYQA 1GYTA 4J4ZA 3EW5A 5DUSA 1LANA 4IQYA 3IIFA 4ZY2A 4J5QA 5FSUA 3EKEA 4JCAA 3GQOA 1ZR5A 3SIJA 3H8EA 1SPVA 5CMSA 2FXKA 5CB5A 3EJGA 2XD7A 3GQEA 1ZR3A 4ZY1A 4K0CA 1HJZA 2X47A 5D8NA 1LCPA 4R76A 3EJFA 4ZX9A 2LGRA 3GPGA 4J5RA 4TU0A 2FG1A 3PEIA 5CB3A 5AILA 2J9AA 2BFRA 3EWRA 3JRUA 5HOLA 3H8GA 3EWPA 2EWBA 2JZDA 1TXZA 4ABLA 1TY8A 5FSVA 1LAMA 3SIIA 5CBMA 1YD9A 3IIDA 3T8WA 5FSXA 3GPQA 2BFQA 4K3NA 2EEEA 1BLLE 4R7MA 3KR5A 4J5SA 4JVVA 3JZTA 4ESSA
chains in the Genus database with same CATH topology
3EWQA 4GUAA 1NJRA 4KYBA 4ABKA 4JGKA 4ZI6A 4KSIA 3KR4A 3GPOA 3V45A 2L8RA 3KQXA 1VHUA 3KQZA 3KZWA 4GVWA 5HIHA 1LAPA 3V2BA 2ACFA 4D86A 3H8FA 2FAVA 4ZX8A 3VFQA 5FSZA 4UMLA 4R6TA 3SIHA 2AFCA 1BPNA 4JLLA 3EWOA 3Q71A 5FSYA 3Q6ZA 4ZY0A 3ETIA 4GVVA 1BPMA 4ETKA 4ETJA 3SIGA 5E3BA 2DX6A 2VRIA 4X2TA 3IJ3A 4ZYQA 1GYTA 4J4ZA 3EW5A 5DUSA 1LANA 4IQYA 3IIFA 4ZY2A 4J5QA 5FSUA 3EKEA 4JCAA 3GQOA 1ZR5A 3SIJA 3H8EA 1SPVA 5CMSA 2FXKA 5CB5A 3EJGA 2XD7A 3GQEA 1ZR3A 4ZY1A 4K0CA 1HJZA 2X47A 5D8NA 1LCPA 4R76A 3EJFA 4ZX9A 2LGRA 3GPGA 4J5RA 4TU0A 2FG1A 3PEIA 5CB3A 5AILA 2J9AA 2BFRA 3EWRA 3JRUA 5HOLA 3H8GA 3EWPA 2EWBA 1TXZA 4ABLA 1TY8A 5FSVA 1LAMA 3SIIA 5CBMA 1YD9A 3IIDA 3T8WA 5FSXA 3GPQA 2BFQA 4K3NA 2EEEA 1BLLE 4R7MA 3KR5A 4J5SA 4JVVA 3JZTA 4ESSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWQ A;  4GUA A;  1NJR A;  4KYB A;  4ABK A;  4JGK A;  4ZI6 A;  4KSI A;  3KR4 A;  3GPO A;  3V45 A;  2L8R A;  3KQX A;  1VHU A;  3KQZ A;  3KZW A;  4GVW A;  5HIH A;  1LAP A;  3V2B A;  2ACF A;  4D86 A;  3H8F A;  2FAV A;  4ZX8 A;  3VFQ A;  5FSZ A;  4UML A;  4R6T A;  3SIH A;  2AFC A;  1BPN A;  4JLL A;  3EWO A;  3Q71 A;  5FSY A;  3Q6Z A;  4ZY0 A;  3ETI A;  4GVV A;  1BPM A;  4ETK A;  4ETJ A;  3SIG A;  5E3B A;  2DX6 A;  2VRI A;  4X2T A;  3IJ3 A;  4ZYQ A;  1GYT A;  4J4Z A;  3EW5 A;  5DUS A;  1LAN A;  4IQY A;  3IIF A;  4ZY2 A;  4J5Q A;  5FSU A;  3EKE A;  4JCA A;  3GQO A;  1ZR5 A;  3SIJ A;  3H8E A;  1SPV A;  5CMS A;  2FXK A;  5CB5 A;  3EJG A;  2XD7 A;  3GQE A;  1ZR3 A;  4ZY1 A;  4K0C A;  1HJZ A;  2X47 A;  5D8N A;  1LCP A;  4R76 A;  3EJF A;  4ZX9 A;  2LGR A;  3GPG A;  4J5R A;  4TU0 A;  2FG1 A;  3PEI A;  5CB3 A;  5AIL A;  2J9A A;  2BFR A;  3EWR A;  3JRU A;  5HOL A;  3H8G A;  3EWP A;  2EWB A;  1TXZ A;  4ABL A;  1TY8 A;  5FSV A;  1LAM A;  3SII A;  5CBM A;  1YD9 A;  3IID A;  3T8W A;  5FSX A;  3GPQ A;  2BFQ A;  4K3N A;  2EEE A;  1BLL E;  4R7M A;  3KR5 A;  4J5S A;  4JVV A;  3JZT A;  4ESS A; 
#chains in the Genus database with same CATH topology
 2W2G A;  3EWQ A;  2KQV A;  4GUA A;  1NJR A;  4KYB A;  4ABK A;  4JGK A;  4ZI6 A;  4KSI A;  3KR4 A;  3GPO A;  2JZF A;  3V45 A;  2L8R A;  3KQX A;  1VHU A;  3KQZ A;  3KZW A;  4GVW A;  5HIH A;  1LAP A;  3V2B A;  2ACF A;  4D86 A;  3H8F A;  2FAV A;  4ZX8 A;  3VFQ A;  5FSZ A;  4UML A;  4R6T A;  3SIH A;  2AFC A;  2RNK A;  1BPN A;  4JLL A;  2JZE A;  2WCT A;  3EWO A;  3Q71 A;  5FSY A;  3Q6Z A;  4ZY0 A;  3ETI A;  4GVV A;  1BPM A;  4ETK A;  4ETJ A;  3SIG A;  5E3B A;  2DX6 A;  2VRI A;  4X2T A;  3IJ3 A;  4ZYQ A;  1GYT A;  4J4Z A;  3EW5 A;  5DUS A;  1LAN A;  4IQY A;  3IIF A;  4ZY2 A;  4J5Q A;  5FSU A;  3EKE A;  4JCA A;  3GQO A;  1ZR5 A;  3SIJ A;  3H8E A;  1SPV A;  5CMS A;  2FXK A;  5CB5 A;  3EJG A;  2XD7 A;  3GQE A;  1ZR3 A;  4ZY1 A;  4K0C A;  1HJZ A;  2X47 A;  5D8N A;  1LCP A;  4R76 A;  3EJF A;  4ZX9 A;  2LGR A;  3GPG A;  4J5R A;  4TU0 A;  2FG1 A;  3PEI A;  5CB3 A;  5AIL A;  2J9A A;  2BFR A;  3EWR A;  3JRU A;  5HOL A;  3H8G A;  3EWP A;  2EWB A;  2JZD A;  1TXZ A;  4ABL A;  1TY8 A;  5FSV A;  1LAM A;  3SII A;  5CBM A;  1YD9 A;  3IID A;  3T8W A;  5FSX A;  3GPQ A;  2BFQ A;  4K3N A;  2EEE A;  1BLL E;  4R7M A;  3KR5 A;  4J5S A;  4JVV A;  3JZT A;  4ESS A; 
#chains in the Genus database with same CATH homology
 3EWQ A;  4GUA A;  1NJR A;  4KYB A;  4ABK A;  4JGK A;  4ZI6 A;  4KSI A;  3KR4 A;  3GPO A;  3V45 A;  2L8R A;  3KQX A;  1VHU A;  3KQZ A;  3KZW A;  4GVW A;  5HIH A;  1LAP A;  3V2B A;  2ACF A;  4D86 A;  3H8F A;  2FAV A;  4ZX8 A;  3VFQ A;  5FSZ A;  4UML A;  4R6T A;  3SIH A;  2AFC A;  1BPN A;  4JLL A;  3EWO A;  3Q71 A;  5FSY A;  3Q6Z A;  4ZY0 A;  3ETI A;  4GVV A;  1BPM A;  4ETK A;  4ETJ A;  3SIG A;  5E3B A;  2DX6 A;  2VRI A;  4X2T A;  3IJ3 A;  4ZYQ A;  1GYT A;  4J4Z A;  3EW5 A;  5DUS A;  1LAN A;  4IQY A;  3IIF A;  4ZY2 A;  4J5Q A;  5FSU A;  3EKE A;  4JCA A;  3GQO A;  1ZR5 A;  3SIJ A;  3H8E A;  1SPV A;  5CMS A;  2FXK A;  5CB5 A;  3EJG A;  2XD7 A;  3GQE A;  1ZR3 A;  4ZY1 A;  4K0C A;  1HJZ A;  2X47 A;  5D8N A;  1LCP A;  4R76 A;  3EJF A;  4ZX9 A;  2LGR A;  3GPG A;  4J5R A;  4TU0 A;  2FG1 A;  3PEI A;  5CB3 A;  5AIL A;  2J9A A;  2BFR A;  3EWR A;  3JRU A;  5HOL A;  3H8G A;  3EWP A;  2EWB A;  1TXZ A;  4ABL A;  1TY8 A;  5FSV A;  1LAM A;  3SII A;  5CBM A;  1YD9 A;  3IID A;  3T8W A;  5FSX A;  3GPQ A;  2BFQ A;  4K3N A;  2EEE A;  1BLL E;  4R7M A;  3KR5 A;  4J5S A;  4JVV A;  3JZT A;  4ESS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...