5E3BA

Structure of macrodomain protein from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
148
Chain Sequence
EISYVRGDATAPSVKGVKMIAHVCNDLGGWGKGFVLAVSRRWPQPEAAYRAWHRDRAANDFGLGAVQFVQVEPYVWVANMIGQHGMKPVRYEAIGTALGRVADRAAELEASVHLPRIGLAGGTWSRVEPLISDRLTRRGIPVTVYDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disruption of Macrodomain Protein SCO6735 Increases Antibiotic Production in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor (strain atcc baa-471 / a3(2) / m145)
molecule tags Hydrolase
molecule keywords Macrodomain protein
total genus 52
structure length 148
sequence length 156
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5e3bA00
3EWOA 4X2TA 4R76A 4ZY2A 2EWBA 3EWPA 5CBMA 1LANA 2BFRA 3KQZA 5HOLA 4ZI6A 1BPMA 4D86A 5FSUA 1HJZA 4ZY0A 3GPGA 3Q6ZA 3EJGA 3GPOA 5E3BA 4J4ZA 1BPNA 3IJ3A 5HIHA 5CB5A 3EJFA 3VFQA 4GVVA 4R7MA 4ETKA 3SIJA 3KR4A 3ETIA 5D8NA 3JZTA 4JVVA 4ZX8A 1VHUA 4JLLA 4ZYQA 2X47A 4IQYA 4ABKA 3KQXA 4GUAA 2ACFA 3JRUA 1NJRA 3EWRA 3EWQA 4J5SA 2FAVA 2FXKA 2AFCA 5AILA 3GPQA 4J5RA 3V2BA 2EEEA 1BLLE 3IIFA 3SIHA 4K3NA 2DX6A 2J9AA 2FG1A 1YD9A 3EKEA 3GQEA 3EW5A 4J5QA 4ABLA 4ZY1A 4ZX9A 1LCPA 3H8FA 2LGRA 4UMLA 1LAMA 5FSZA 3T8WA 1GYTA 3H8GA 3IIDA 1ZR5A 2L8RA 4KSIA 3KR5A 1LAPA 5FSYA 4ETJA 3GQOA 1TY8A 4JCAA 4ESSA 5CMSA 1ZR3A 3V45A 1TXZA 4GVWA 4K0CA 5FSVA 4TU0A 2BFQA 4R6TA 3PEIA 3Q71A 4JGKA 5CB3A 3H8EA 2VRIA 5DUSA 5FSXA 3KZWA 3SIIA 1SPVA 4KYBA 2XD7A 3SIGA
chains in the Genus database with same CATH superfamily
3EWOA 4X2TA 4R76A 2KQVA 4ZY2A 2EWBA 3EWPA 5CBMA 1LANA 2BFRA 3KQZA 5HOLA 4ZI6A 1BPMA 4D86A 5FSUA 1HJZA 4ZY0A 3GPGA 3Q6ZA 3EJGA 3GPOA 5E3BA 4J4ZA 1BPNA 3IJ3A 5HIHA 5CB5A 3EJFA 3VFQA 4GVVA 4R7MA 4ETKA 3SIJA 3KR4A 3ETIA 5D8NA 3JZTA 4JVVA 4ZX8A 1VHUA 4JLLA 4ZYQA 2X47A 4IQYA 4ABKA 3KQXA 4GUAA 2ACFA 3JRUA 1NJRA 3EWRA 2JZEA 3EWQA 2WCTA 4J5SA 2FAVA 2FXKA 2AFCA 5AILA 3GPQA 4J5RA 3V2BA 2EEEA 1BLLE 3IIFA 3SIHA 4K3NA 2DX6A 2J9AA 2FG1A 1YD9A 3EKEA 3GQEA 3EW5A 4J5QA 4ABLA 4ZY1A 4ZX9A 1LCPA 3H8FA 2LGRA 4UMLA 1LAMA 2W2GA 5FSZA 2JZDA 3T8WA 1GYTA 3H8GA 3IIDA 1ZR5A 2L8RA 4KSIA 3KR5A 1LAPA 5FSYA 4ETJA 3GQOA 2RNKA 1TY8A 4JCAA 4ESSA 5CMSA 1ZR3A 3V45A 1TXZA 4GVWA 4K0CA 5FSVA 4TU0A 2BFQA 4R6TA 3PEIA 3Q71A 4JGKA 2JZFA 5CB3A 3H8EA 2VRIA 5DUSA 5FSXA 3KZWA 3SIIA 1SPVA 4KYBA 2XD7A 3SIGA
chains in the Genus database with same CATH topology
3EWOA 4X2TA 4R76A 4ZY2A 2EWBA 3EWPA 5CBMA 1LANA 2BFRA 3KQZA 5HOLA 4ZI6A 1BPMA 4D86A 5FSUA 1HJZA 4ZY0A 3GPGA 3Q6ZA 3EJGA 3GPOA 5E3BA 4J4ZA 1BPNA 3IJ3A 5HIHA 5CB5A 3EJFA 3VFQA 4GVVA 4R7MA 4ETKA 3SIJA 3KR4A 3ETIA 5D8NA 3JZTA 4JVVA 4ZX8A 1VHUA 4JLLA 4ZYQA 2X47A 4IQYA 4ABKA 3KQXA 4GUAA 2ACFA 3JRUA 1NJRA 3EWRA 3EWQA 4J5SA 2FAVA 2FXKA 2AFCA 5AILA 3GPQA 4J5RA 3V2BA 2EEEA 1BLLE 3IIFA 3SIHA 4K3NA 2DX6A 2J9AA 2FG1A 1YD9A 3EKEA 3GQEA 3EW5A 4J5QA 4ABLA 4ZY1A 4ZX9A 1LCPA 3H8FA 2LGRA 4UMLA 1LAMA 5FSZA 3T8WA 1GYTA 3H8GA 3IIDA 1ZR5A 2L8RA 4KSIA 3KR5A 1LAPA 5FSYA 4ETJA 3GQOA 1TY8A 4JCAA 4ESSA 5CMSA 1ZR3A 3V45A 1TXZA 4GVWA 4K0CA 5FSVA 4TU0A 2BFQA 4R6TA 3PEIA 3Q71A 4JGKA 5CB3A 3H8EA 2VRIA 5DUSA 5FSXA 3KZWA 3SIIA 1SPVA 4KYBA 2XD7A 3SIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWO A;  4X2T A;  4R76 A;  4ZY2 A;  2EWB A;  3EWP A;  5CBM A;  1LAN A;  2BFR A;  3KQZ A;  5HOL A;  4ZI6 A;  1BPM A;  4D86 A;  5FSU A;  1HJZ A;  4ZY0 A;  3GPG A;  3Q6Z A;  3EJG A;  3GPO A;  5E3B A;  4J4Z A;  1BPN A;  3IJ3 A;  5HIH A;  5CB5 A;  3EJF A;  3VFQ A;  4GVV A;  4R7M A;  4ETK A;  3SIJ A;  3KR4 A;  3ETI A;  5D8N A;  3JZT A;  4JVV A;  4ZX8 A;  1VHU A;  4JLL A;  4ZYQ A;  2X47 A;  4IQY A;  4ABK A;  3KQX A;  4GUA A;  2ACF A;  3JRU A;  1NJR A;  3EWR A;  3EWQ A;  4J5S A;  2FAV A;  2FXK A;  2AFC A;  5AIL A;  3GPQ A;  4J5R A;  3V2B A;  2EEE A;  1BLL E;  3IIF A;  3SIH A;  4K3N A;  2DX6 A;  2J9A A;  2FG1 A;  1YD9 A;  3EKE A;  3GQE A;  3EW5 A;  4J5Q A;  4ABL A;  4ZY1 A;  4ZX9 A;  1LCP A;  3H8F A;  2LGR A;  4UML A;  1LAM A;  5FSZ A;  3T8W A;  1GYT A;  3H8G A;  3IID A;  1ZR5 A;  2L8R A;  4KSI A;  3KR5 A;  1LAP A;  5FSY A;  4ETJ A;  3GQO A;  1TY8 A;  4JCA A;  4ESS A;  5CMS A;  1ZR3 A;  3V45 A;  1TXZ A;  4GVW A;  4K0C A;  5FSV A;  4TU0 A;  2BFQ A;  4R6T A;  3PEI A;  3Q71 A;  4JGK A;  5CB3 A;  3H8E A;  2VRI A;  5DUS A;  5FSX A;  3KZW A;  3SII A;  1SPV A;  4KYB A;  2XD7 A;  3SIG A; 
#chains in the Genus database with same CATH topology
 3EWO A;  4X2T A;  4R76 A;  2KQV A;  4ZY2 A;  2EWB A;  3EWP A;  5CBM A;  1LAN A;  2BFR A;  3KQZ A;  5HOL A;  4ZI6 A;  1BPM A;  4D86 A;  5FSU A;  1HJZ A;  4ZY0 A;  3GPG A;  3Q6Z A;  3EJG A;  3GPO A;  5E3B A;  4J4Z A;  1BPN A;  3IJ3 A;  5HIH A;  5CB5 A;  3EJF A;  3VFQ A;  4GVV A;  4R7M A;  4ETK A;  3SIJ A;  3KR4 A;  3ETI A;  5D8N A;  3JZT A;  4JVV A;  4ZX8 A;  1VHU A;  4JLL A;  4ZYQ A;  2X47 A;  4IQY A;  4ABK A;  3KQX A;  4GUA A;  2ACF A;  3JRU A;  1NJR A;  3EWR A;  2JZE A;  3EWQ A;  2WCT A;  4J5S A;  2FAV A;  2FXK A;  2AFC A;  5AIL A;  3GPQ A;  4J5R A;  3V2B A;  2EEE A;  1BLL E;  3IIF A;  3SIH A;  4K3N A;  2DX6 A;  2J9A A;  2FG1 A;  1YD9 A;  3EKE A;  3GQE A;  3EW5 A;  4J5Q A;  4ABL A;  4ZY1 A;  4ZX9 A;  1LCP A;  3H8F A;  2LGR A;  4UML A;  1LAM A;  2W2G A;  5FSZ A;  2JZD A;  3T8W A;  1GYT A;  3H8G A;  3IID A;  1ZR5 A;  2L8R A;  4KSI A;  3KR5 A;  1LAP A;  5FSY A;  4ETJ A;  3GQO A;  2RNK A;  1TY8 A;  4JCA A;  4ESS A;  5CMS A;  1ZR3 A;  3V45 A;  1TXZ A;  4GVW A;  4K0C A;  5FSV A;  4TU0 A;  2BFQ A;  4R6T A;  3PEI A;  3Q71 A;  4JGK A;  2JZF A;  5CB3 A;  3H8E A;  2VRI A;  5DUS A;  5FSX A;  3KZW A;  3SII A;  1SPV A;  4KYB A;  2XD7 A;  3SIG A; 
#chains in the Genus database with same CATH homology
 3EWO A;  4X2T A;  4R76 A;  4ZY2 A;  2EWB A;  3EWP A;  5CBM A;  1LAN A;  2BFR A;  3KQZ A;  5HOL A;  4ZI6 A;  1BPM A;  4D86 A;  5FSU A;  1HJZ A;  4ZY0 A;  3GPG A;  3Q6Z A;  3EJG A;  3GPO A;  5E3B A;  4J4Z A;  1BPN A;  3IJ3 A;  5HIH A;  5CB5 A;  3EJF A;  3VFQ A;  4GVV A;  4R7M A;  4ETK A;  3SIJ A;  3KR4 A;  3ETI A;  5D8N A;  3JZT A;  4JVV A;  4ZX8 A;  1VHU A;  4JLL A;  4ZYQ A;  2X47 A;  4IQY A;  4ABK A;  3KQX A;  4GUA A;  2ACF A;  3JRU A;  1NJR A;  3EWR A;  3EWQ A;  4J5S A;  2FAV A;  2FXK A;  2AFC A;  5AIL A;  3GPQ A;  4J5R A;  3V2B A;  2EEE A;  1BLL E;  3IIF A;  3SIH A;  4K3N A;  2DX6 A;  2J9A A;  2FG1 A;  1YD9 A;  3EKE A;  3GQE A;  3EW5 A;  4J5Q A;  4ABL A;  4ZY1 A;  4ZX9 A;  1LCP A;  3H8F A;  2LGR A;  4UML A;  1LAM A;  5FSZ A;  3T8W A;  1GYT A;  3H8G A;  3IID A;  1ZR5 A;  2L8R A;  4KSI A;  3KR5 A;  1LAP A;  5FSY A;  4ETJ A;  3GQO A;  1TY8 A;  4JCA A;  4ESS A;  5CMS A;  1ZR3 A;  3V45 A;  1TXZ A;  4GVW A;  4K0C A;  5FSV A;  4TU0 A;  2BFQ A;  4R6T A;  3PEI A;  3Q71 A;  4JGK A;  5CB3 A;  3H8E A;  2VRI A;  5DUS A;  5FSX A;  3KZW A;  3SII A;  1SPV A;  4KYB A;  2XD7 A;  3SIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...