5E3BA

Structure of macrodomain protein from streptomyces coelicolor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
156
structure length
148
Chain Sequence
EISYVRGDATAPSVKGVKMIAHVCNDLGGWGKGFVLAVSRRWPQPEAAYRAWHRDRAANDFGLGAVQFVQVEPYVWVANMIGQHGMKPVRYEAIGTALGRVADRAAELEASVHLPRIGLAGGTWSRVEPLISDRLTRRGIPVTVYDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrodomain protein
publication title Disruption of Macrodomain Protein SCO6735 Increases Antibiotic Production in Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor (strain atcc baa-471 / a3(2) / m145)
molecule tags Hydrolase
total genus 52
structure length 148
sequence length 156
ec nomenclature
pdb deposition date 2015-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5e3bA00
3KR4A 1ZR5A 2LGRA 4X2TA 1TXZA 3EWPA 4ZX8A 5AILA 4ESSA 4JLLA 3EKEA 4ZX9A 1BLLE 3H8GA 5CMSA 4ZI6A 1LAMA 3EW5A 5HIHA 2X47A 4ZY0A 2VRIA 3GQEA 3VFQA 3KQZA 4ZY1A 2EEEA 2XD7A 1LAPA 2L8RA 3V45A 5CB5A 3H8EA 3GPQA 3KZWA 4KYBA 4J5QA 5FSUA 1BPMA 2BFRA 3EJGA 4IQYA 4ETKA 3EWOA 4GVVA 5DUSA 5CB3A 3GPOA 3KQXA 4ZY2A 4R6TA 1ZR3A 1TY8A 4J5RA 4JGKA 3Q71A 4J5SA 4KSIA 4R76A 1SPVA 4JVVA 4K0CA 1BPNA 1HJZA 3EWRA 5FSYA 2AFCA 4ABLA 1VHUA 3IIDA 1LCPA 3V2BA 4ETJA 2FG1A 5FSXA 3ETIA 2EWBA 1GYTA 5FSVA 1YD9A 3GQOA 4UMLA 4ABKA 2DX6A 3SIHA 5HOLA 3SIIA 2FXKA 4TU0A 3KR5A 4D86A 2J9AA 2BFQA 3EWQA 4K3NA 3IIFA 5FSZA 3GPGA 1NJRA 3H8FA 2FAVA 4ZYQA 4J4ZA 3Q6ZA 3EJFA 1LANA 4GUAA 3JRUA 4JCAA 5E3BA 3PEIA 4R7MA 4GVWA 2ACFA 3IJ3A 5CBMA 3SIGA 3SIJA 3T8WA 3JZTA 5D8NA
chains in the Genus database with same CATH superfamily
3KR4A 1ZR5A 2LGRA 4X2TA 1TXZA 3EWPA 4ZX8A 5AILA 4ESSA 4JLLA 3EKEA 4ZX9A 1BLLE 3H8GA 5CMSA 4ZI6A 1LAMA 3EW5A 5HIHA 2X47A 4ZY0A 2VRIA 3GQEA 3VFQA 3KQZA 4ZY1A 2EEEA 2XD7A 1LAPA 2L8RA 3V45A 5CB5A 3H8EA 3GPQA 3KZWA 4KYBA 4J5QA 5FSUA 1BPMA 2BFRA 2JZEA 3EJGA 4IQYA 4ETKA 2RNKA 3EWOA 4GVVA 5DUSA 5CB3A 3GPOA 3KQXA 4ZY2A 4R6TA 1ZR3A 1TY8A 4J5RA 4JGKA 3Q71A 4J5SA 4KSIA 4R76A 1SPVA 2JZFA 4JVVA 4K0CA 1BPNA 1HJZA 3EWRA 5FSYA 2AFCA 4ABLA 1VHUA 3IIDA 1LCPA 3V2BA 4ETJA 2FG1A 5FSXA 3ETIA 2EWBA 1GYTA 5FSVA 1YD9A 3GQOA 4UMLA 4ABKA 2DX6A 2JZDA 3SIHA 5HOLA 2WCTA 3SIIA 2W2GA 2FXKA 4TU0A 3KR5A 4D86A 2J9AA 2BFQA 3EWQA 4K3NA 3IIFA 5FSZA 3GPGA 2KQVA 1NJRA 3H8FA 2FAVA 4ZYQA 4J4ZA 3Q6ZA 3EJFA 1LANA 4GUAA 3JRUA 4JCAA 5E3BA 3PEIA 4R7MA 4GVWA 2ACFA 3IJ3A 5CBMA 3SIGA 3SIJA 3T8WA 3JZTA 5D8NA
chains in the Genus database with same CATH topology
3KR4A 1ZR5A 2LGRA 4X2TA 1TXZA 3EWPA 4ZX8A 5AILA 4ESSA 4JLLA 3EKEA 4ZX9A 1BLLE 3H8GA 5CMSA 4ZI6A 1LAMA 3EW5A 5HIHA 2X47A 4ZY0A 2VRIA 3GQEA 3VFQA 3KQZA 4ZY1A 2EEEA 2XD7A 1LAPA 2L8RA 3V45A 5CB5A 3H8EA 3GPQA 3KZWA 4KYBA 4J5QA 5FSUA 1BPMA 2BFRA 3EJGA 4IQYA 4ETKA 3EWOA 4GVVA 5DUSA 5CB3A 3GPOA 3KQXA 4ZY2A 4R6TA 1ZR3A 1TY8A 4J5RA 4JGKA 3Q71A 4J5SA 4KSIA 4R76A 1SPVA 4JVVA 4K0CA 1BPNA 1HJZA 3EWRA 5FSYA 2AFCA 4ABLA 1VHUA 3IIDA 1LCPA 3V2BA 4ETJA 2FG1A 5FSXA 3ETIA 2EWBA 1GYTA 5FSVA 1YD9A 3GQOA 4UMLA 4ABKA 2DX6A 3SIHA 5HOLA 3SIIA 2FXKA 4TU0A 3KR5A 4D86A 2J9AA 2BFQA 3EWQA 4K3NA 3IIFA 5FSZA 3GPGA 1NJRA 3H8FA 2FAVA 4ZYQA 4J4ZA 3Q6ZA 3EJFA 1LANA 4GUAA 3JRUA 4JCAA 5E3BA 3PEIA 4R7MA 4GVWA 2ACFA 3IJ3A 5CBMA 3SIGA 3SIJA 3T8WA 3JZTA 5D8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KR4 A;  1ZR5 A;  2LGR A;  4X2T A;  1TXZ A;  3EWP A;  4ZX8 A;  5AIL A;  4ESS A;  4JLL A;  3EKE A;  4ZX9 A;  1BLL E;  3H8G A;  5CMS A;  4ZI6 A;  1LAM A;  3EW5 A;  5HIH A;  2X47 A;  4ZY0 A;  2VRI A;  3GQE A;  3VFQ A;  3KQZ A;  4ZY1 A;  2EEE A;  2XD7 A;  1LAP A;  2L8R A;  3V45 A;  5CB5 A;  3H8E A;  3GPQ A;  3KZW A;  4KYB A;  4J5Q A;  5FSU A;  1BPM A;  2BFR A;  3EJG A;  4IQY A;  4ETK A;  3EWO A;  4GVV A;  5DUS A;  5CB3 A;  3GPO A;  3KQX A;  4ZY2 A;  4R6T A;  1ZR3 A;  1TY8 A;  4J5R A;  4JGK A;  3Q71 A;  4J5S A;  4KSI A;  4R76 A;  1SPV A;  4JVV A;  4K0C A;  1BPN A;  1HJZ A;  3EWR A;  5FSY A;  2AFC A;  4ABL A;  1VHU A;  3IID A;  1LCP A;  3V2B A;  4ETJ A;  2FG1 A;  5FSX A;  3ETI A;  2EWB A;  1GYT A;  5FSV A;  1YD9 A;  3GQO A;  4UML A;  4ABK A;  2DX6 A;  3SIH A;  5HOL A;  3SII A;  2FXK A;  4TU0 A;  3KR5 A;  4D86 A;  2J9A A;  2BFQ A;  3EWQ A;  4K3N A;  3IIF A;  5FSZ A;  3GPG A;  1NJR A;  3H8F A;  2FAV A;  4ZYQ A;  4J4Z A;  3Q6Z A;  3EJF A;  1LAN A;  4GUA A;  3JRU A;  4JCA A;  5E3B A;  3PEI A;  4R7M A;  4GVW A;  2ACF A;  3IJ3 A;  5CBM A;  3SIG A;  3SIJ A;  3T8W A;  3JZT A;  5D8N A; 
#chains in the Genus database with same CATH topology
 3KR4 A;  1ZR5 A;  2LGR A;  4X2T A;  1TXZ A;  3EWP A;  4ZX8 A;  5AIL A;  4ESS A;  4JLL A;  3EKE A;  4ZX9 A;  1BLL E;  3H8G A;  5CMS A;  4ZI6 A;  1LAM A;  3EW5 A;  5HIH A;  2X47 A;  4ZY0 A;  2VRI A;  3GQE A;  3VFQ A;  3KQZ A;  4ZY1 A;  2EEE A;  2XD7 A;  1LAP A;  2L8R A;  3V45 A;  5CB5 A;  3H8E A;  3GPQ A;  3KZW A;  4KYB A;  4J5Q A;  5FSU A;  1BPM A;  2BFR A;  2JZE A;  3EJG A;  4IQY A;  4ETK A;  2RNK A;  3EWO A;  4GVV A;  5DUS A;  5CB3 A;  3GPO A;  3KQX A;  4ZY2 A;  4R6T A;  1ZR3 A;  1TY8 A;  4J5R A;  4JGK A;  3Q71 A;  4J5S A;  4KSI A;  4R76 A;  1SPV A;  2JZF A;  4JVV A;  4K0C A;  1BPN A;  1HJZ A;  3EWR A;  5FSY A;  2AFC A;  4ABL A;  1VHU A;  3IID A;  1LCP A;  3V2B A;  4ETJ A;  2FG1 A;  5FSX A;  3ETI A;  2EWB A;  1GYT A;  5FSV A;  1YD9 A;  3GQO A;  4UML A;  4ABK A;  2DX6 A;  2JZD A;  3SIH A;  5HOL A;  2WCT A;  3SII A;  2W2G A;  2FXK A;  4TU0 A;  3KR5 A;  4D86 A;  2J9A A;  2BFQ A;  3EWQ A;  4K3N A;  3IIF A;  5FSZ A;  3GPG A;  2KQV A;  1NJR A;  3H8F A;  2FAV A;  4ZYQ A;  4J4Z A;  3Q6Z A;  3EJF A;  1LAN A;  4GUA A;  3JRU A;  4JCA A;  5E3B A;  3PEI A;  4R7M A;  4GVW A;  2ACF A;  3IJ3 A;  5CBM A;  3SIG A;  3SIJ A;  3T8W A;  3JZT A;  5D8N A; 
#chains in the Genus database with same CATH homology
 3KR4 A;  1ZR5 A;  2LGR A;  4X2T A;  1TXZ A;  3EWP A;  4ZX8 A;  5AIL A;  4ESS A;  4JLL A;  3EKE A;  4ZX9 A;  1BLL E;  3H8G A;  5CMS A;  4ZI6 A;  1LAM A;  3EW5 A;  5HIH A;  2X47 A;  4ZY0 A;  2VRI A;  3GQE A;  3VFQ A;  3KQZ A;  4ZY1 A;  2EEE A;  2XD7 A;  1LAP A;  2L8R A;  3V45 A;  5CB5 A;  3H8E A;  3GPQ A;  3KZW A;  4KYB A;  4J5Q A;  5FSU A;  1BPM A;  2BFR A;  3EJG A;  4IQY A;  4ETK A;  3EWO A;  4GVV A;  5DUS A;  5CB3 A;  3GPO A;  3KQX A;  4ZY2 A;  4R6T A;  1ZR3 A;  1TY8 A;  4J5R A;  4JGK A;  3Q71 A;  4J5S A;  4KSI A;  4R76 A;  1SPV A;  4JVV A;  4K0C A;  1BPN A;  1HJZ A;  3EWR A;  5FSY A;  2AFC A;  4ABL A;  1VHU A;  3IID A;  1LCP A;  3V2B A;  4ETJ A;  2FG1 A;  5FSX A;  3ETI A;  2EWB A;  1GYT A;  5FSV A;  1YD9 A;  3GQO A;  4UML A;  4ABK A;  2DX6 A;  3SIH A;  5HOL A;  3SII A;  2FXK A;  4TU0 A;  3KR5 A;  4D86 A;  2J9A A;  2BFQ A;  3EWQ A;  4K3N A;  3IIF A;  5FSZ A;  3GPG A;  1NJR A;  3H8F A;  2FAV A;  4ZYQ A;  4J4Z A;  3Q6Z A;  3EJF A;  1LAN A;  4GUA A;  3JRU A;  4JCA A;  5E3B A;  3PEI A;  4R7M A;  4GVW A;  2ACF A;  3IJ3 A;  5CBM A;  3SIG A;  3SIJ A;  3T8W A;  3JZT A;  5D8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...