5E3IA

Crystal structure of a histidyl-trna synthetase from acinetobacter baumannii with bound l-histidine and atp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
429
structure length
388
Chain Sequence
b'SSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNAAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine--tRNA ligase
publication title Crystal Structure of a Histidyl-tRNA synthetase from Acinetobacter baumannii with bound L-Histidine and ATP
rcsb
source organism Acinetobacter baumannii
molecule tags Ligase
total genus 124
structure length 388
sequence length 429
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5e3iA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5e3iA02
3VQXA 2DTOA 1USYC 1GGMA 4XTVA 4P74A 3HY1A 2EJ9A 3ICAA 2RHQB 3NELA 3UGQA 4WJ4A 4H2VA 1C0AA 3UGTA 11ASA 3IG2A 3IKLA 3HRIA 4NCXA 3A5YA 4HA8A 2HNIA 1SRYA 4K87A 1SERA 1WQWA 2I4LA 3VQYA 3UFGA 4XTZA 2Q7EA 1QF6A 1QE0A 2ZIOA 1HXDA 2EJFA 3NEMA 1B70B 3L1AA 1H4VB 3QTCA 12ASA 3EFRA 4XU1A 1FYFA 3P8VA 3A7AA 1YFRA 4DPGA 2ZR3A 2ZNIA 5K1PA 1SESA 4UPAA 2PMFA 2EJGA 1EFWA 3HTZA 1JJCB 3VQVA 3P8YA 1X2GA 3UH0A 3V7RA 4YRKA 4TQFA 1LYLA 4XTXA 4P72C 4WI1A 4PHCA 4EO4A 4YRTA 3BJUA 2IY5A 1L0WA 1NYRA 4LNSA 1X01A 1RIQA 2ZR2A 4HWTA 4PG3A 5E3IA 4G84A 4WJ3M 1ADJA 2CJAA 3REUA 2CGHA 3TEHB 2ODRD 1EVLA 4XU0A 4O2DA 4RDXA 1J5WA 4Q15A 1B7YA 4YRNA 4P75A 2ODRC 4YPFA 3M4QA 3OD1A 3REXA 3A7RA 4P71C 1V95A 3FJPA 3MEYA 2DVEA 2LW7A 2AMCA 3I7FA 2RHQA 4H2UA 4YRMA 3A74A 3E9HA 2P0LA 3RKXA 1BBUA 2QHUA 4UP9A 2ZXFA 2ZT6A 4J15A 4XEMA 1NYQA 1W66A 2J3LA 2P5IA 4P71A 3RKWA 1NJ1A 3HRKA 1WQ7A 4TQDA 4YRPA 4UP7A 4AH6A 3DSQA 2E65A 4H02A 3KFUA 4H2SA 4TVAB 4CH3A 4XTUA 1X55A 4EX5A 1NJ5A 2Q5IA 2DZCA 4TVYA 1USYA 3IKMB 4HWOA 4HWSA 1JJCA 4YCVA 4HWRA 2AKWA 1KOGA 3VQWA 4ZIBA 3P8TA 2FYKA 3HXVA 3HFZB 4YRSA 1WLEA 1E1OA 2ARUA 4DQ2A 2QHTA 1IL2A 4BW9A 3NETA 1G51A 1YGBA 3A31A 3MF2A 4E51A 3V8LA 1B8AA 1BIAA 1H4QA 3QO5A 2DJZA 3TEGA 3L4GB 1ASZA 3BFMA 4OLFA 4YRJA 1WYDA 2DXTA 2ZZGA 5C51B 2E3CA 4CS2A 4XTWA 4BWAA 3TEHA 2DEQA 2ALYA 2RHSB 1H4TA 2EL9A 4H2WA 2XTIA 1PYSB 2Q7HA 3QNEA 2CJ9A 3HXXA 4H2XB 1YFTA 4P72A 3VBBA 3L2ZA 1NJ6A 4KR2A 2QHSA 4CS4A 3RACA 2I4NA 3PCOB 4RQEA 3A7UA 1B76A 3V7CA 3TUPA 3RIRA 4CS3A 4RMFA 2C8MA 4P73C 1NJ2A 1EVKA 4P3OA 4YROA 4CH6A 2DU7A 3M4PA 2E41A 4KQEA 3HXWA 4YREA 2ZINA 2ZIMA 2ZZEA 3RL6A 4HVCA 4YCWA 2DZ9A 2CJBA 3IALA 2E1HA 1BBWA 4YP0A 1YFSA 1B70A 2Q7GA 4RQFA 1B7YB 1HTTA 2CIMA 4WF2A 2DTHA 3L4GA 3V8KA 4YRIA 4YRFA 1HC7A 1VQZA 4K88A 3ERRA 1X2HA 1EIYB 3W3SA 2AMCB 1ASYA 4H2YA 3HFVA 5ELOA 4G85A 2E5AA 4UP8A 1E24A 2ZGWA 3WQZA 2XGTA 2ZT7A 2RHSA 4YYEA 1NNHA 1WPYA 1E1TA 4HWPA 4X5OA 3HXZA 5C53B 4Q6GA 3V7SA 1PYSA 4CH5A 4TVWA 5KNNA 1ADYA 2EAYA 1WNLA 2J3MA 1X56A 1Z7MA 1E22A 4YDQA 4H2XA 2E64A 3RGLA 2E10A 1EQRA 4CH4A 4XEOA 2ZT8A 2ZZFA 2ARSA 3HXUA 4YRGA 3PCOA 4XU2A 2AKWB 3QO7A 4YRRA 5F5WA 5HGQA 4YCUA 3A32A 3LSQA 2C7IA 3G1ZA 1WU7A 4YRQA 2DDZA 5C52B 1G5IA 2I4MA 3CMQA 2ARTA 5K1XA 3EFSA 4TWAA 1KMMA 2DQ0A 4P75C 2DTIA 1SETA 3LC0A 2QHVA 1NJ8A 1BIBA 2DXUA 4P3PA 1YB3A 3QO8A 2Q5HA 4OP0A 3RF1A 3R07A 4YRLA 2G4CA 2ZTGA 4L87A 2ALYB 4ZTZB 1G5HA 3A5ZA 5ELNA 4YRCA 2IY5B 1Z7NA 4KR3A 4P3NA 3MF1A 1KMNA 3LSSA 4TVAA 1N9WA 2DQ3A 2PMEA 3RUXA 4XU3A 4P74C 4ZTUB 1H4SA 2ZCEA 2ZNJA 3HY0A 3E9IA 1X54A 4K86A 2ZT5A 3PZCA 1EIYA 3RKYA 4P73A 4TTVA 3HXYA 3NENA 4H2TA 4XTYA 1ATIA 3HFZA 1EOVA 2DKGA 2I4OA 2EWNA 2DU5A 3V8JA
chains in the Genus database with same CATH superfamily
3VQXA 1HEIA 1DUIA 1K5PA 1V11B 3Q8KA 4JXZA 1M1NB 4TMTA 1M73E 3LPMA 4AO7A 1LW7A 2GF9A 3QMPA 4RULA 3HY4A 4ZJYA 1Y8RB 3DBHB 2WJ6A 3LPNA 4JEMA 4JZYA 2CLDX 4XTVA 4TS1A 4D3ZA 5CGZA 1CUDA 3FCCA 2WWXA 2HLNA 4C05A 5CAEB 4DPMA 2RHRA 3PFIA 5HRCA 1WP4A 4WZAE 2VP5A 4A6EA 1T91A 4DIBA 5ALFA 2JAWA 1P18A 2VXCA 1TVCA 4MR9B 1PW5A 2GK6A 3DV2A 4EJMA 5JZ9A 3I6ZA 1GQ2A 5CA0A 2PR2A 4D46A 3STWA 1M67A 1S0UA 4M9CA 5KCMA 1I94B 1MXHA 3I04M 4OX9Y 1PVDA 2GBLA 3FLAA 3Q3HA 1MP0A 2OZLB 1QHGA 4HWKA 1NVFA 1RJDA 3LT0A 4PYIA 2H2HA 5KDDA 3EGVA 4M8NE 1Y9JA 1HFJA 1MB0A 1ZJ6A 2NU9A 3CSUA 1YTUA 4PNPA 2M9MA 1WOYA 3BTVA 1XSEA 1DIRA 2V45A 4QBGB 1UBKS 4EFMA 4KWIA 5AKKA 3KE9A 2DECA 3GH1A 3CG4A 4JAVC 4A7PA 2P2GA 3BQNB 4BV3A 4D9HA 4TV9B 4G5YA 1G59A 2K87A 1C81A 1Q83A 3VU9B 2W8ZA 3KHKA 3KXDA 4GVPA 4Q7MB 2AN9A 1M2JA 4FTWA 4I8IA 1NIPA 2VHZA 4OD0A 2DUNA 4IOLA 4ONEA 1EM8B 3UHFA 3UJPA 2GAIA 1PFWA 5JH7B 4EMUA 4MQFA 1LW6E 1QHHA 3QFFA 1FYFA 5FFNA 2CNWA 3HCNA 3I6YA 4KR9A 4HUTA 2ZR3A 1NUUA 1RBZA 3HJCA 4AQYB 1JYEA 2UXCB 1FRQA 2DT5A 2WRZA 1SKMA 3M7IA 1PUIA 2PWPA 1N6KA 4QUDA 4Q48A 2BISA 4AW9A 4RNCA 1TPYA 3MD9A 2C29D 1VXRA 4EW2A 1G98A 3B60A 2PS1A 4LDJA 4RCZA 5CFZA 2BM8A 2HSEA 4BVKA 2QY9A 4MVJA 4QTXA 1RD4A 521PA 1NFFA 4WNYA 4AXBA 3G5UA 5BVHA 1JLRA 3JALB 1K6JA 4FZ3A 4XH9B 2Q4EA 1H0HA 2XWSA 1U65A 3COWA 1TQ8A 4IY1A 2OG1A 1TO2E 4FFOA 4WUTA 4ZN6A 5EGNA 1GUAA 2IY5A 1CR0A 2QLBA 3AVOA 4C6SA 1L0WA 3IL2A 3UPDA 3D0RA 1FFEA 1G66A 2HV8A 3ET5A 3P8ZA 4JDUA 3O4GA 1PKXA 3RS3A 1TAQA 4PWYA 4C0SA 4M0KA 1NU6A 3KB2A 2NO1A 2XUAA 3H3JA 2I1VB 5FEUA 1LV8A 1R0CA 2G83A 2V0NA 1JLHA 2XB8A 3LAWA 4O1HA 4BWFB 4QTUB 2AW5A 4J9UE 4P4NA 3E23A 3CB2A 5JD4A 2DU8A 3QXCA 4WK6A 2XXAB 1MDFA 1L7MA 2P4HX 2ZR0A 3W5UA 4AZVA 4DUGD 4C7OB 4C7BA 1SU8A 2VK1A 4LXGA 5CXQA 3GJSA 3ZU2A 5ALZA 3M6LA 5KQPA 2PWZA 3A6JA 2JCGA 4H0FA 3RG8A 1EVLA 5D6NA 4NYJR 3CSDA 3O92A 4LRUA 4YT5A 3SY8A 4JR2A 4FW9A 1EX6A 1GSIA 4HFRA 4LA4A 4P4GA 2XYGA 1GZ4A 1DRVA 5EJMA 2H65A 1V11A 3A6KA 2H4XA 1M1NA 4KCGA 4FONA 5EKDA 4C7JA 4MRMB 4UHKA 3UXYA 3RHZA 1UT8A 3ZIAA 1MRNA 1U0LA 2C1XA 3GJ7A 4N5NA 3R5SA 3H9QA 4MULA 1RI3A 3HSSA 1OH6A 2FRVA 1V8FA 1AUXA 4H0CA 4INJA 3DPSA 4DLRA 4C9BA 1QLWA 2V96A 4KN9S 3STVA 5JZSA 3ZGZA 3AKEA 3OJ0A 5HF9A 1P2FA 2D3TA 2OV8A 2Q2NA 3RUPA 1Y82A 2PX6A 4UBLA 3EQ7A 3BKWA 1WOMA 1XCGB 3EJ6A 1AK9A 1ULAA 1ZN2A 2MR5A 2YUTA 1CP3A 4GOND 1WPRA 3GZTB 3HWSA 1EJ6A 2D4AA 5JFGA 1Q0TA 4W9NC 1I7LA 2OZLA 2F1IA 4JP3A 3QNUA 1WEHA 2XGGA 5HCIA 5BQ5A 2CCGA 5FL3A 3LQKA 4RSGA 5B1HA 5A4IS 1I2ZA 1N3BA 1EWQA 1KOFA 1KOLA 1ISPA 2XTMA 2DR0A 5F78A 1LNZA 1B4DA 1SKAA 3UA4A 5LC1A 3L79A 4P71A 2J7KA 5IZ4A 5GONA 5AI4A 2CVQA 3CISA 3DZBA 3QU9A 1DCKA 1JJIA 2ZUCA 1YSCA 3VPFA 2O1EA 4FGJA 1Z15A 3ETHA 4G6ZA 1MXFA 2XTZA 3UIEA 1HUQA 1V43A 1W0KA 3DGFC 1JU9A 1OX6A 3H18A 3IULA 3KBBA 3QFCA 5JPIA 3VUFA 5B6PA 5DNWA 2QB5A 4YJFB 4EB0A 4RESA 2HK7A 2D13A 3HSKA 2BFNA 3CCBA 5AHKA 3BQMB 3DE2X 4ER0A 1G41A 2XMQA 3H9GA 4E0BA 2WUGA 3PENA 5TT1A 4YN3A 3ZHXA 1IM5A 1PFGA 3HGMA 3V1TC 4FE4A 4D9NA 3CU5A 3W5JA 4NSNA 4KVAA 5L3SA 2AKWA 4E1VA 1JEEA 1WXGA 4PM4A 5ESRA 3ESZA 1KA9H 3B1VA 1Z4NA 4G07A 3TW8B 1VJ5A 2BM0A 2PA3A 4RORA 1WQ4A 5FBQB 1Q0SA 1YU9A 1A8SA 3QVXA 1I0LA 5EJ6A 1YQQA 3QNWA 2PVPA 4IMIB 3F73A 4XGRA 3K1TA 1U99A 3HFJA 4FZ5A 2DUMA 3AW8A 3AJ8A 3FNBA 1SC4A 3UMCA 3AKZA 3UMYA 4Q16A 1W87A 1IMOA 2O4UX 2UDPA 4RUKA 3ISVA 4HMOA 3CVVA 3OMXA 2P79A 1VBFA 4TT8A 4E4TA 4F2HA 3BFMA 4D97A 3Q2KA 2CVFA 2JIMA 2PKEA 3ZWBA 1WYDA 3NRBA 3RBAA 4L8GA 3TL2A 3ZE0B 1K08A 3H6HA 2NACA 3B1YA 3WGMA 1N2HA 5HILA 1KY3A 1OIXA 1OJ7A 4Q1DA 2XGJA 4B7UA 4EDFA 1D03A 3QU2A 1QTRA 1O1YA 5E8RA 3AL0C 4H08A 3UENA 2UUAB 3Q3JB 2X15A 5EOVA 1VMIA 1P19A 3TRKA 4LPKA 4D9IA 1NXSA 4C2UA 2YXDA 4J0FA 5A71A 1QGED 4A5SA 4C88A 3K72B 5IJ0B 2X6TA 3R0ZA 2FQXA 3U1TA 4R8LA 1P31A 3DZ8A 3IP5A 5DTMA 3N2LA 1E9VA 3K9FC 1Z35A 1AGYA 4JROA 1KFJB 1U9IA 2A67A 3OY7A 1ORVA 3D7NA 3LX5A 2OK7A 1LTHR 3AF1A 2FEOA 3BKXA 3NOOA 3QPCA 1R4AA 3S29A 3TRIA 4CMIB 4EECA 5BT8A 3OTOB 1W1UA 2UUBB 3SJZA 1H5UA 4NCNA 2HWKA 1A7KA 4P72A 1CYDA 1G3RA 4J94A 1YMQA 2PR7A 4NH4A 3VBBA 1RLOA 3DOJA 2ZJBA 2ZUVA 4AZ3B 3VBEA 5I3CA 1SIOA 3GRAA 3OWHA 4W99A 4Q4LA 1D2HA 3VSBA 4HTAA 4CS4A 5IJZA 2VDUE 1J8VA 2YZMA 3EXHB 1G4HA 2JFQA 3I83A 3LKDA 3GEHA 4GKBA 1Y3HA 3PEFA 3O7WA 2YVAA 4EF6A 3GQVA 2PX5A 5CDGA 5BYBA 4OM8A 2ODBA 5FWYB 2X5JO 1YA6A 4DMHA 2C2KA 2PX2A 3O9VA 1M2VB 3BMNB 1CE8B 2AT1A 3D4IA 4QGSA 4XB6B 4XUGB 4YMLA 3A2KA 1F7UA 4YLGA 3WNBA 2ZU6A 4I9FA 5KTPA 1JLKA 2FN7A 2VH1A 3OQJA 3X44A 2WMDA 2NOAA 1BXGB 3UC5A 4A92A 1ZC3A 4YJFA 2O8FB 1LY1A 4YWHA 3AT1A 2OCBA 4MLCA 3AB8A 5KDOA 5F5NA 1BE1A 3IOBA 3V4VB 2GM3A 4RV5A 5F5LA 4TS4A 1NLYA 4FUTA 3IIEA 2GH1A 2IX9A 1C4OA 4EG7A 1TZCA 2DZ9A 2OBFA 3B53X 3NHUA 3TNYA 3TYXA 1JG4A 2ID7A 3GT4A 3K20A 4JX9A 2BGWA 4MQUA 4YGXB 4LZWA 4CF4A 4IVNA 3SF0A 1KOJA 2XWBF 1UBNA 1J8YF 2XKAA 5THXA 3T34A 1KWGA 1ESNA 2XBLA 3CLTC 1YZUA 2X2FA 3F6CA 4X3PA 4HDQB 3A9RA 4GX1A 4H27A 1AQ6A 3IMEA 3LUCA 4JP1A 3H5LA 4JH0A 4TKVB 3L1UA 3STHA 4BKMA 4L0QA 4QOJA 1P2UA 1CVRA 3R5HA 4LV8B 2GJ4A 1F9EA 3CX3A 2G5CA 4DVGA 5TMBA 3FRHA 2CHFA 4IIUA 4AJHA 2JLZA 1RABA 1A9RA 2W8BB 2ZYWX 2XTNA 1EIYB 4Q4HB 1WUKS 1AQJA 3R3JA 4UU7A 3TE6A 4RKRA 1QDLB 1Z8FA 2VIIA 4GU5A 5ER9A 1ASYA 4CT0A 4YXWA 3C7TA 3ZJUA 4H6WA 3HKCB 3A1DA 3M6IA 2WTUA 3DEHA 3K9LA 4LISA 1ISSA 1U0JA 2C4WA 2E4YA 2RH5A 5JC1A 1J2YA 5K0ZA 2GCEA 2PVSA 3PQFA 4D99A 4C78A 2BEKA 2H18A 2YY5A 1UPCA 1ZJ4A 4Q4JB 5F2KA 1OLOA 3TQRA 4HL6A 3T5BA 4RQAA 1T9GR 1NQXA 5IK2D 4ZV7A 1Y5RA 3PGMA 4LVCA 4EI7A 3AVTA 2MHCA 3QX8A 2YWBA 1KQ3A 4TUYF 3GX1A 2BFFA 3ABIA 4Z0HO 3R1IA 3HFRA 5DMHA 5ADHA 1QK4A 5LLSA 2QNIA 2PL3A 3RAJA 4RIIA 4LX8A 2JZNA 2XY4A 3DB1A 4WBSA 4BFSA 5CX4A 4UVDA 5JYCA 1MIOB 1XCOA 4DNQA 5L7YA 5DHFA 4PIPA 4M8LA 3WDKA 5FUBA 4CRWB 1V3TA 5AIAA 3RRYA 4NBTA 1BRTA 1JILA 1H66A 1XRJA 3I72A 3T0FA 3X2FA 8LDHA 4CM9D 4UQLA 3IDSA 3U7EB 3ILXA 2M6SA 4Y2XA 5FHQA 4F60A 5BYAA 5SICE 3K0FB 4YCSA 4JI2B 1CRQA 1PS9A 1WZCA 3KZKA 4RA9B 1Y6RA 3GZJA 3EXHA 1C30B 2NU6A 5AJHA 2J85A 2Q46A 3VZPA 2HIHA 3PFFA 1IHPA 4J0DA 1IPEA 2O2ZA 5FWYA 5SYAA 1ZAYA 3EIOA 2R62A 1DEOA 2OLJA 3B1XA 1BMTA 3LSQA 1YV9A 1IFXA 1M2VA 2CXPA 1YE3A 1CE8A 1TZKA 2WE8A 1E3TA 3BMNA 3GBSA 1ULUA 3KZ1E 4DJJA 3ABRB 3QX3A 1E0SA 2I62A 4PPFA 5C52B 2WIJA 3R23A 4NDNE 4BWVA 5JJ5A 4P33A 3SJUA 2IXBA 4ZD6A 3EXG1 3EGDA 3CT4A 4LYAA 4PZ0A 2P62A 3AG5A 3L0SA 3VPXA 3KLNA 3ZWOA 4L02A 5DHTA 3AF3A 1Q74A 4CIXA 1QH8A 4LFAB 4UEOA 4J9VA 4XFKA 3X1DA 5AUOB 1KMMA 3SZLA 1YR2A 1EGVB 2P1ZA 2PBFA 3ZYZA 3C7CB 4KXLA 1E58A 2KSQA 3IAS6 2CHEA 4ENWA 5C8YB 2PUWA 3AF4A 2RBKA 1NSYA 3TPZA 1E6EA 3R07A 1KEPA 1JA1A 4Q9KA 3VPSA 1R8XA 2NZXA 3F6BX 1W0JD 3KL2A 3O73A 3JQBC 3TNDA 4ARUA 5IBCA 2F3SA 2XVAA 3GYGA 1SKUA 3RO7A 2QTHA 5CVEA 4BAZA 4DE5A 3PR3A 3LOUA 4B7CA 3A5ZA 1F0NA 3ZV6A 4BFLA 5KSWB 1JG7A 2JFYA 3VTFA 2V3CC 3ZZ1A 1E2NA 3K5IA 4Q4CA 1NX9A 2ZWMA 2AFHE 4NY1A 3H4VA 4Q4AA 2OHXA 3CVXA 1ZW6A 3ECSA 4DUZB 1DOHA 3OQ1A 4KR3A 1KSGA 1XPUA 1CRPA 5GAJA 2RGYA 4YEDA 4TKVA 1N8NA 2ZSJA 4RXUA 3UHOA 2MT9A 1QHSA 4ZCIA 4B3CA 4JELA 4X0EA 5KINB 1BU5A 1YZHA 5EIOA 5JSZA 2F90A 3E9IA 3GI1A 1YDGA 2O52A 4LN1A 1KVQA 1WF6A 3FPFA 1EIYA 1QKIA 3NI2A 4H7PA 4JOSA 3VYWA 4QGAA 4DV4B 1UKVY 2B6NA 5D5PA 1O87A 4MR8B 4XTYA 1TMOA 1JJ7A 1W46A 3GJ8A 4I0WB 2OV4A 3HKCA 4XDYA 4PNEA 3BXHA 5G0VA 1JSRA 1TCAA 2FDRA 1HBJA 4H7HA 5A4MS 1BTOA 2DU5A 3V8JA 3HA2A 3Q1KA 5E9QA 4D9CA 4JCCA 1FUKA 3O0DA 1T0JB 2PZGA 4IDFA 1DXQA 1RC0A 1ENYA 4F9EA 3ZG6A 2BP7B 3F6PA 4RJLA 5JYBA 2BEJA 1H1LB 5IKEA 3KWMA 4AROA 1HT2E 2ZYHA 3D5TA 4KHZA 1KAQA 3NIGB 4BS9A 4LJ4A 1XEFA 4A16A 2P90A 3INTA 1QVWA 2XUIA 2G8NA 3ESYA 1OBFO 3T94A 3EVAA 3Q41A 3ZCTA 3VTZA 2WKQA 1MIOA 3CRMA 3W06A 2JFGA 3TKAA 3HCAA 4BJ6A 4L8WB 5HDBB 1ND5A 1I6LA 4C7XA 1CZOA 1G20E 4MITA 4TWZA 1KYIA 2WTBA 4MO9A 4ZRDA 5BSWA 2JIPA 1O77A 1QRUA 3K0FA 1E6LA 2G04A 2ZG6A 1ONBA 3HLKA 4MLPA 5KJ6A 1W8IA 2ZS9A 3OI7A 4RA9A 1PJ2A 1FMCA 4AZTA 1WF3A 2DLDA 1IRXA 1LDBA 1XQXA 3BXOA 3QYJA 2CKMA 3ED1A 2VT7A 4M4SA 4RK1A 5IAJA 3I1IA 4HRYA 4JVSB 2ZR8A 4EITA 2CZGA 2NYUA 4JIGA 3JD2A 4WBNF 3T7TA 2O6HA 1HT1E 2R8RA 1Y1LA 3U3XA 4MW2A 4HATA 1ZUD1 1UUFA 3KJNA 1T8TA 2VTKA 2Q3LA 4UAJA 3C70A 1H23A 3LQYA 3QTCA 1JEYA 3BZBA 4IXMA 2DOKA 3P8VA 3AM5A 4O3FA 4I3FA 4QPJC 3LUAA 2D5AA 1B0ZA 5IVKA 3TOVA 3LYUA 1EZ1A 2PJUA 1Y9ZA 2XUKA 1WKVA 2Q0QA 3OEED 1K92A 1JT2A 2AI1A 1R0LA 3EGXA 5DN9A 5AVJA 4Q7QA 2IYUA 5JV5A 5LJLA 4DGSA 3BE6A 1X94A 4WOPA 4WL0A 2R8EA 1KFBB 3VISA 2J5KA 4D7AA 4N7MA 1X8KA 4OF4A 5EZQA 5FIUA 2VJMB 3AR9A 3QLUA 1N6NA 1IUNA 1NMEA 3QLTA 3EASA 4KGVA 1AN0A 3QGMA 2R4QA 5FR1A 1U9CA 1SM4A 2PCJA 2WV9A 2ZIGA 5AJVB 5BWBA 1L7BA 3G0DA 1AVTA 1YI1A 3K6KA 3LBNA 3VR3A 1UOOA 2HHHB 1KC3A 4TMFA 1GKKA 3MLBA 4NBRA 1LK0A 5HMLA 4V1CB 3FHCB 1XTRA 4MB6A 1JQEA 4JKIA 2GZDA 2P77A 1Z3IX 1E1CB 4UMEA 4URZR 5KYKA 4ZU3A 1U63A 4TS9A 2CD9A 3L6DA 1GPNA 5JVDB 2CJFA 3PDUA 3IBCA 4OKNA 3PGJA 4QA9A 1T4MA 4V0NA 3CZPA 4TQ9A 5I9BA 5KNCA 3OE5A 4KLNA 2AK3A 4ZQCB 2LBPA 4C2BA 1FSFA 4OI1A 3C3CA 2ISQA 3DFIA 4PG3A 3QWBA 3MQZA 3CA8A 3G13A 3NHFA 1XEXB 5LQDA 3N0WA 3T99A 1XTVA 2UZIR 3LMKA 4TKLA 1JKJB 4XWAA 1F6DA 2QLFA 3DG9A 3MTGA 4NWIA 4ML3A 4EI2A 1DAEA 4BC1A 3HCDA 1IDN1 1DAOA 2H85A 1IC6A 4HZUB 1GRRA 4LBYA 1SCUA 4LYEA 1R64A 3DCIA 1SKBA 1B73A 1RM5A 4BRUA 2VHCA 5K8JB 1VLVA 1XMXA 3ZY4A 2PDAA 1EK1A 1QKKA 2CXNA 2ES4A 3N07A 5KKCA 1ODJA 3KWFA 3FZQA 1EE1A 4JJ7A 3U7HB 5JJIA 3JS5A 3R3ZA 3MGGA 3E22A 4FHFA 3H5VA 4N47A 3PX7A 1KSHA 4KN8A 5CVUA 1QR6A 3G2PA 1C1YA 1CDDA 1OAKA 3JQCA 5JCXA 2EBHX 5DNYB 4IGEA 5DB4A 5LYJB 1GV0A 4A27A 1IY8A 1TQHA 2IWHA 3LDFA 2ZI6A 2ZB2A 2VYNA 2BHSA 4YVFA 1X7YA 4NYIQ 2RARA 3ZU4A 3GP3A 1DIAA 4ZANA 4YLYA 3REQA 1HF3A 1SQSA 1XXHE 2FMUA 1LA2A 4GE0A 5K8IA 4PX2A 4F9GA 5H9VA 3GDFA 1DV2A 4LE1A 1WDMA 4J15A 2WFLA 3AHHA 4R1TA 1R0RE 1U1CA 4PLZA 3KTOA 1Z0IA 4F04A 4P81A 5A6VA 4CKZA 1C0IA 1E7RA 2Q1WA 2IHUA 4KKVA 3EDMA 4QELA 3JQ8A 4MW1A 2WMYA 4RD3A 3ZJ4A 2YIJA 2PBRA 3EG9B 3VOTA 3IPLA 4JOBA 4OEHA 4OIMA 1UXKA 1KYYA 1C8KA 1KH1A 4G1VA 4IZIA 4KBFA 1A3CA 4HUQB 3LSTA 3M6MD 1MTOA 5H3LA 4AH6A 4H02A 1KAEA 2I6QA 5A03A 5DCYA 3C8MA 4LRXA 3EPLA 3ZXXA 1P1FA 4IS2A 4TVAB 3A4VA 3OPNA 3S2EA 3HU1A 1ZM7A 5HZGA 1OQAA 4KVFA 3KETA 3RYCA 4KK3A 3O9MA 2VJDA 3OT5A 2ZSBA 4HAYA 1HDXA 1XMJA 4FSDA 2C2ZA 4EY3A 1M1YE 5K0TA 1ZIYA 3FG9A 2IJGX 1WLSA 5IPFA 1JIXA 2VJMA 1DJOA 2AJCA 1YBVA 3KXIA 1KXJA 3RJTA 3LWZA 2OILA 3NT2A 4RACA 1DKRA 1N7GA 2IUUA 3OZRA 4YJGB 3FKSD 3NWOA 1M66A 5JS7A 2QYSA 1R0ZA 2WIKA 3P4XA 2DR2A 2FF5A 5LL6P 3KUUA 3L6RA 5CJJA 4YJ2F 3T3DA 4EJFA 1IL2A 1P6XA 2B78A 2GN4A 4QYXA 2WJJA 4IDEA 4E51A 2EJTA 4B6FA 4XWWA 1H2ZA 3OQNA 1D4AA 5JVDA 1T9DA 4IL5A 4Y1FA 3G8AA 3HCWA 3QO5A 3RIGA 2UKDA 3THXB 2YOHA 1T35A 2C97A 2EX0A 3L9WA 1DMRA 3M6UA 4PC2A 3UJDA 3RJ9A 5CA0F 3ZS8A 1M2FA 2YMLA 2FUKA 1IOWA 2IUTA 3A58B 5HKOA 1CY8A 3FZGA 2VPWA 2QPTA 4FFMA 1LX6A 5CURA 2C0PA 1SBTA 3LBIA 4IZHA 3SLRA 3EX7C 2X0JA 3T7EA 4BMSA 2ZVJA 1ZUIA 3HDGA 1Q1QA 4E09A 1PR1A 1FP4A 1UZAA 1XGKA 4HHEA 2Z6VA 4U9HS 5DYTA 2HU7A 4WWHA 4MR7B 1HWYA 2GCPA 1C1XB 1E1QA 2AG5A 2NT3A 3AXSA 2BJVA 3F3YA 4G4JA 3OPYB 4MCJA 1O6FA 1GDDA 1KWKA 2Y68A 1YTLA 2XQGA 3E15A 2A9VA 4IGKA 4M1KA 3GG2A 3RBZA 2PEYA 3UCFA 3WSWA 3HUUA 3M3PA 4CL3A 3H2YA 1EXMA 1YQEA 2QYOA 1JEAA 1YUNA 2HFJA 3QNEA 4YAKA 3EVGA 5MDHA 2PU7A 1CUSA 3UFBA 4E70A 5LDGA 3AWDA 1IL0A 1UBRS 3CF4G 2PT9A 3NYIA 3SIXA 2FSPA 1H3FA 3ZZNA 2CNBA 1A50B 2ZRCA 3CWQA 4OJYA 4RXTA 4G1FA 1KORA 1PIWA 1IN4A 2NZYA 1B00A 2C3MA 4MV3A 2CWDA 4C76A 4LC9A 5IANA 1OLSB 4CV2A 4XYLA 3U4QB 3ILSA 5IXJA 3CYFA 1J9ZA 3IDQA 5KNBH 2QYHA 2A58A 4MVJF 3KSMA 2IOFA 1YQDA 3KKQA 4S0XA 1JIKA 2XNDA 4ZT7A 2VJCA 1V16B 2QAJA 4HMQA 2W6CX 2H06A 4PO1A 3V42A 1BAPA 1VE1A 1SUFA 3I9KA 3WYCA 4RQEA 4E5SA 4CEJB 4KQWA 1B76A 1A5ZA 2BGGA 5CFOA 2PYIA 4UFPA 3JPYA 1HG1A 4JJ8A 2C8MA 1KZHA 4EKIA 1VHQA 1QU2A 3MXOA 3G7SA 5EAIA 5JSKA 1BHO1 1V6CA 1E9AA 2OZVA 3LUBA 3MMZA 4W9MC 1CQXA 2VBFA 3LLUA 3WFIA 4RMJA 4PRZA 2KPOA 1V5EA 3CH6A 3VO2A 3CNOA 3OFKA 4CH6A 1NMYA 2W4IA 2ZSIA 1TD9A 3E84A 4KIGA 1U1IA 3CSSA 4ZAYA 4M1TA 5IBPA 4QDZA 1KVUA 1JXOA 4DG5A 3L8MA 4DCPA 1KF0A 1KQNA 3WWCA 4P80A 1W5TA 4U7FA 4RV9A 2C83A 4M1QA 1EESA 1L3IA 1BMQA 4YQZA 4TTAA 3GWGA 1O97D 3W3AA 1CUVA 3RTDA 4FYPA 3WIVA 1UM8A 3EB9A 1A5SB 2WKRA 4YCWA 5MFZA 4HEA6 3NATA 5JNWA 5ALXA 4DA8A 2B2NA 1FDVA 2VF5X 5I5GA 5I3ZA 3KAJA 3BXZA 5ES3A 1A1SA 1NL3A 3NDJA 3LCUA 2EYQA 3AESB 4FBLA 3RDPA 5C7YA 5KIAA 4A0FA 3C98A 4DM3A 4YJGA 4COOA 4DBVO 3CNHA 1ZIOA 4GP9A 2WJWA 2O2HA 3M4NA 4I1UA 3JARA 4K46A 3I23A 3REOA 3DZKA 4GDMA 3VV2A 3KCQA 1VHLA 4E21A 5JXGA 2VYCA 3H42B 5EQJB 1GRNA 3ORYA 1R0WA 1RLJA 3FLMA 5FJJA 4QEZA 1Q2UA 3UWKA 3JX9A 3BHNA 5AW2A 4CN8A 3N70A 4D41A 3LY8A 1Z6PA 4GR4A 2PT5A 4TM8A 3VH1A 2VDJA 5JAPA 3M9WA 3JD3A 3FNFA 5A4AA 1SOWA 3QVTA 3IV7A 4I55B 1F4LA 2ERYA 3I1YA 4BMVA 3NVAA 1P9LA 1NZJA 3OLXA 1DDIA 1EDZA 1RDFA 3F96A 3R3UA 4RF3A 1EG7A 4WESB 1KO8A 2B5WA 1JXMA 4P22A 3BIFA 1YHNA 1GUYA 5CLHA 5K3BA 3S8EA 5G4LA 3QWHA 4MR7A 4R16A 4MQLA 1HK7A 2Q7DA 5FOVA 5KS2A 2ZRKA 3G17A 3PKZA 5E1DA 1C1XA 2QD2A 5GONF 1Z74A 2VP4A 4PW0A 1JHVA 2MSDB 1Z6XA 2RBEA 3A4NA 3WLFA 1LCIA 1ZVKA 2DSNA 1U7PA 1XE3A 3KVOA 4G0VA 1CQPA 2N3ZA 2RHDA 2O7QA 3KDPA 4ZYUA 2OHOA 3CRQA 3NTRA 3K32A 5EZ5A 1PDVA 5DBOA 4MA0A 2J4FA 1QTNA 1VE7A 4OI4A 1CEYA 2VJQA 4AY5A 3WGUA 1TX4B 5CFPA 2R7KA 1F3OA 5CB4A 4BO9A 1TEZA 2HYIC 3ZDDA 1Y9AA 1RMQA 1Z8HA 2JANA 2OR3A 2ZIFA 2AMLA 5SY4A 3FWZA 1E92A 4FDVA 3ENVA 4BNUA 3NX4A 3GLFE 3VNSA 2QRQA 1LKZA 1SN7A 1X1RA 3LQ1A 1EQRA 3OO1A 4IJ5A 2AZMA 2C9CA 4Z0NA 1U7XA 2BKEA 2D74A 1JR3D 1QHIA 4EJ2A 5LD2C 4FHCA 3SYTA 2JD2A 2V7QD 2XRYA 3OPXA 1D4FA 4J7AA 1DQPA 1EFTA 3TQQA 4J1SA 4KQKA 1D2MA 1W96A 3OZXA 4DHEA 4OQZA 2Z2KA 4LOJA 4EELA 5L3RA 4Z99A 1YASA 4R68A 1K89A 4FHZA 2BHRA 3TEJA 2XB9A 4DY6A 2OKCA 4UUBA 3IBFA 5I01A 3HP7A 3IUPA 5JNLA 4R1UA 5CJ2A 2IIVA 5CVCA 2C7IA 4ZCQA 4WY5A 1U0OC 3L0YA 4RAOA 4D9FA 3AJEA 2DDZA 5BNIA 2DEUA 3KQSA 1CQZA 1D2CA 3SR0A 2Y1OA 3I39X 4Q9IA 2AUMA 3CMQA 4L50A 3TDNA 4BNTA 5CH8A 3N58A 3UJHA 3B3QA 2ARTA 2Y6UA 4Q3LA 3HR4A 5HBGA 3RTCA 1Z5UA 3EXIA 4MEAA 2ZRJA 3VSAA 2W93A 2FPIA 5K0JA 1CJBA 1COWD 4URHA 4Y6RA 3B70A 4Q3DA 4KFTA 3PNLA 1BIBA 2IE8A 4E2FA 2JH8A 4HT4A 4CLHA 4X94A 2O8DB 3VZDA 2QRGA 3HUEA 4WFKA 2CFIA 5DISB 4EGCB 3GWZA 5EZYB 2X0DA 4Z54A 4L7VA 4BNXA 3ZY5A 2FQQA 2HIGA 3AESA 4QFBA 3DCYA 2ALYB 3GDOA 4NV1A 5KI6A 1Z4IA 4PRYA 3DLAA 2WAYA 1RM4A 2Z8XA 4MV4A 1LC0A 3BB1A 1ZN8A 1DT5A 5FOWA 3A3OA 2FWRA 1EWKA 2EEPA 2QR5A 1LVGA 2V4MA 3DFUA 1PBTA 1G8MA 3FRJA 2VKTA 3B9RA 3PWSA 4MB0A 4JGBA 4I1OA 1JJBA 4RTLA 4DILA 3FA2A 1YOVB 3WL7A 4JLDA 2R2GA 3A6LA 1SEVA 3EEBA 5CITA 1LRJA 4HRVA 1H9BA 3IKTA 1YJAA 4EX7A 4MSUA 5EWLB 2VA8A 1CR2A 2DWOA 3TLJA 4UEJA 4RTJA 5AJZA 4D98A 2MTBA 2VHTA 3Q15C 4CF6A 2VK2A 3TLGB 4RXMA 2BTEA 1JYFA 3IAM1 3EGWA 4P73A 2IW3A 4I55A 5TS3A 2AOUB 3O4RA 5DCUA 5H7XA 1EVZA 4AG5A 3OZAA 1QSGA 3KDAA 4AAYA 3V7NA 2WLSA 3RYHA 3T9BA 3ZWAA 3ZCVA 1XTUA 3DD5A 4ZDJA 2ZRHA 5JBQA 2VZLA 4Q9HA 5HNKA 3GPLA 1LUAA 2V1UA 4JGIA 1KAMA 1UPBA 2R48A 3AFOA 4LDRA 1ZD1A 2V8BA 1RYBA 3MA0A 3VZBA 2VG8A 3BCRA 4H7EA 3G5LA 3GQBB 5DI9A 3JVDA 2ECOA 1FTWA 1PBNA 1FU7A 2GYVA 3AEQB 1E7YA 3HY1A 1PEAA 3HWX1 4I99A 2QL7A 1L5VA 1L5YA 421PA 1ECCA 1MB9A 2MYTA 3KKKA 1NV8A 4HEHA 3L7CA 1HM5A 4YONB 3R7NA 3O8CA 5B7GA 2R4UA 1KGSA 2Y2VA 3BE8A 1Z26A 2W4QA 2D1TA 3VDXA 1L5HB 5EE9A 3RTGA 1I4DD 2PXXA 2F59A 4DQVA 2JJ2D 3W1EA 2FRDA 3HCPA 4RJ2A 5EMHA 4CMGA 5F9HA 1W30A 4I50A 2V6GA 4NS4A 3IG2A 2NVOA 1YGPA 3EK2A 3H4MA 1TLTA 2JVJA 3VMFA 1L1RA 3NP9A 2RE8A 3MOGA 2H2FA 4DLYA 4GBMA 4PGAA 5A9SB 4NAUA 5KOHB 1AKQA 3L7BA 5LLDA 1HY3A 4IIHA 1UC4B 4IH9A 1X1BA 4R9UC 4AK9A 3TOSA 5L3ZA 4AJJA 3KO8A 1A69A 1YDEA 2I4TA 2JGMA 4CU2A 1M6WA 5CG1A 3L7IA 2V4UA 3PLRA 4IIBA 4ANFA 4B81A 4JXXA 3VQYA 4FNGA 4NIMA 3NV9A 1OROA 1QDEA 4XWOA 4P36A 2C9BA 1UPUA 2F6RA 2O2SA 2R8XA 3K4HA 3OQPA 4IR7A 5EFOA 5EMJA 3UHPA 2ZUEA 1AX9A 2QXUA 1Z4MA 4Y1RB 3MHPA 3TTYA 3K1AA 1QE0A 1Z0ZA 2AQKA 3T12A 3LBYA 4BZQA 4KMOA 4DCNA 4EHBA 1YB6A 4JT4A 1XU9A 1TGYA 4MUGA 4Z49A 5TXGA 1OX5A 4BP3A 3O95A 3VMMA 1SRRA 4C4SA 1PFQA 1YFRA 1Y8CA 1ZXBA 2F1RA 2O14A 2I2CA 4TSFA 2PMFA 1BKYA 2AXQA 2EKZA 2W2LD 2F1KA 2ZCVA 2HF9A 4LNAA 2BZ1A 3NXKA 3RS7A 3SBXA 1U8XX 4DXAA 3C3WA 3EXEB 3L8ZA 2HMVA 4BFUA 1N2CB 4GYKA 1GILA 2P9YA 3A27A 4R7ZA 4RCYA 5HPYB 4RW0A 1SXJB 4QFCA 1JJCB 3BD8A 4IXWA 3P1JA 1SVMA 3UJBA 3W5IA 3P8YA 1T2AA 3NYWA 1TU3A 4JL8A 3OJWA 4ZVMA 2NU8B 3I58A 4BZWA 4RK4A 3UPUA 2NSHA 5JCOA 3G2OA 4UBNA 4PV7A 1T5IA 1OREA 3OHPA 5EZYA 1U2RA 2C31A 4RLSA 4NFHA 3GK3A 5LZ2A 1IHDA 2NVUB 5IUKC 5JDIC 2H4YA 2JFNA 1I7PA 2DH5A 1OHHD 1JTEA 3OEHD 4OB8A 4UAUA 3P9RA 2LCQA 3SLKA 3SXPA 2W2VA 1N9ZA 4NOMA 2FG5A 4FLEA 3VOSA 5TQ0B 5HEKA 3U62A 3RUIA 3NDBB 3LX6A 4FDAA 3L93A 4ZI5A 4D43A 5BY2A 4V39A 1J09A 4UBKA 1Q57A 3RPEA 2XNHA 1YOVA 1N6OA 3QMMA 4KWTA 2H9AA 4D8YA 1B8UA 4YPOA 1SKYE 3E2PA 3FUCA 5AOAA 2DT8A 1AXRA 2CY0A 3EUWA 3WSTA 2ZR2A 5T4EA 2QPAA 4WZZA 2WP0A 4ZAXA 1OX4B 5KWVA 3A6EA 3E5NA 2ZRDA 1XTBA 3OQIB 4WJ3M 3FNHA 4AM8A 1JHUA 2GJ9A 1ZW1A 1Q17A 3WYEA 4FLMA 2AOUA 3KVRA 2AXEA 4WVFA 5TJ9A 4OK3A 1UBLS 1LS6A 4XU0A 2ZWAA 3HO8A 3A0RB 3LQ4A 2QJOA 4TVBA 1WWKA 5IVIA 4XPIA 5CA1B 1QPBA 7ADHA 4HN9A 2OYSA 3H04A 3SZUA 1QPGA 3W7VA 2PUVA 5BUCA 2XYQA 5IT5A 2BVNA 2AX3A 2B7BA 4UHHA 1B7YA 3STUA 1RBQA 1UMDB 1IVSA 2YL2A 5LDDC 3I4CA 4RLHA 3LIIA 4WZAB 5BN1A 3LQFA 5FHRA 2I91A 5C7LO 3AEQA 1JQAA 1K5GA 1SQFA 2HIMA 3RV4A 5LMZA 4YR7A 4P71C 1S4MA 2R44A 2OCGA 1T3TA 4P93A 4KWEA 2WJPA 4S24A 2OTCA 5I48A 3UC9A 1U5BB 3KK0A 4IO1A 5A1JA 4W1RA 5H16A 4HQOA 2I6UA 4MYUA 2PO7A 3DC7A 4PX5A 2O50A 2P0LA 4M76B 4W8OA 3DOFA 1U0RA 5GADl 4HNUA 4A8JA 4CDGA 4UUMA 2CV2A 4OUDB 4D4HA 5A9SA 2ZIWB 5KOHA 1IN7A 5K4AA 1ZMOA 1QIMA 4XAQA 5HK9A 4RETA 4EM6A 3OTWA 1TKRA 3FNRA 3SXUA 3GFPA 1VMEA 4U3JB 4M6WB 4XDHA 2WSBA 4UTPA 2FX2A 1EFRD 1WTCA 5FA6A 4R05A 3HYSA 1L4LA 2A0UA 2H7VA 2Q0XA 3DW3X 3KQYA 1BQ4A 4JB2A 4KBGA 4NMMA 3WO1A 1D8TA 1E3DA 1G8AA 2JHCA 3KPUA 4GR5A 3SBEA 2J3LA 4AUMA 4NE9A 1U6IA 4BEJA 4GXTA 1X92A 4KAFA 5JNSA 1TGVA 2WEKA 3A9VA 1OXMA 4N5MA 5IC5A 1P2BA 3V7WA 4MWSA 4YHBA 4AICA 1KKUA 2B4AA 3FNEA 3GRFA 1UPFA 5B6IA 2VDLB 3GA5A 3VU3A 5JLAA 3OU7A 3CZ9A 3CGGA 4IIJB 4KN6A 2D2FA 3B7GA 4QNMA 2IH5A 1IBSA 3RQSA 2YTZA 2A4KA 2QQFA 3G9QA 4PS0A 4RFVA 4DPKA 4UUQA 5HQ3A 4RFSB 3EIFA 4QD3A 1DWQA 4TYMA 4ZAGA 3OF5A 5A0VA 4WRRA 2DZCA 4LKRA 1T3GA 2J6CA 3MJDA 3TPFA 1Z45A 2F00A 4IINA 1N2CA 1PE0A 4MA5A 1SXJA 1JJCA 2C8KA 3LGAA 2GN6A 1LZKA 3ZEAA 2NU8A 4AL4A 4MRVA 4OIFA 1QF7A 1YBMA 3PDHA 5CT8A 4LF6B 3IUQA 1CS0B 3QENA 4ZVQA 4FGUA 5HOQA 3NRJA 4J0CA 2BMDA 3KD3A 1A4XA 1PL0A 2QORA 1IUKA 2GEFA 2J5QA 2NVUA 2R1TB 3H11B 4MW9A 2AF4C 4F92B 1OI7A 3LO8A 3MBKA 4B4KA 1E9CA 2WB2A 2ILTA 5JSQA 1NATA 2ZS8A 5F1PA 5A3QA 5TQ0A 1W44A 2OP0A 2HMWA 3CTPA 4O4LB 3ZHBA 4ZCMA 1G6KA 5DCLA 1EUZA 4MKFA 1SBQA 5A2QA 1T3SA 2EXXA 3JYOA 3QXXA 2IUEA 4ZV4A 3H8VA 4PFSA 1E4EB 2V98A 3RUFA 5LXTA 1U9IC 1G21E 2E0IA 2HF8A 2Z30A 4W5QA 2ACVA 3I52A 3A1TA 2H63A 3VAZA 1OX4A 1X86B 2J6HA 2OB2A 3AH8A 4ZOLA 2HRRA 2OCPA 1F5NA 2JLRA 3OQIA 3ZWWA 4EPWA 2P0AA 3I1FA 1H94A 3AWIA 3PE4A 4INOA 5T8KC 1FSZA 3RHSA 4AN1A 1KY4A 3HVRA 1T9CA 4ER3A 3E2IA 4I4CA 2O3RA 2Q45A 4LVKA 2XKJE 3L40A 3FYTA 2XMGA 1U5AA 4GG1A 2LRHA 3I6IA 5CA1A 4LWOA 2ZQZA 4IMPA 3EGEA 2J9XB 4UMVA 1NF8A 2P41A 4IDGA 4FI3F 2A1UB 3AGPA 1NLZA 4EGFA 5AKJA 5BRNA 1C3LA 1YJ5A 3NW9A 2ZI3A 4LZOA 2IP4A 4B7XA 1PYSB 2ZJAA 3QKRB 1N1MA 3ZE9A 3MT9A 4LGYA 3HM2A 2NAFA 3SC6A 1RXIA 6Q21A 1B3BA 3A6DA 3PGKA 1PWXA 1BMFA 3GL9A 4J6EA 4KUGA 1RZVA 4Y30A 5DYGA 3T3IA 2CMDA 2VYFA 3IRVA 4UDYX 2G06A 1M6NA 3HXXA 5TMPA 1X7WA 1U3DA 3V55A 3NJ4A 2R8YA 4QBFA 2OCYC 3EIHA 3F5QA 3EF1A 1PJSA 2ISSD 3K9BA 1EFPB 4WECA 4TZ6A 4QHYA 2HMAA 2HKIA 3DE0X 5BWOA 2NT4A 1NV9A 2CFTA 4IVRA 5HWSA 1L6IA 2MCFA 3GBPA 1R9JA 4A8TA 5DGIA 1TCUA 2LPMA 3DZHA 2PHZA 1J7KA 4YMGA 4Q9LA 8MHTA 1CXZA 3O75A 2HO4A 1P17A 3QUTA 4W6ZA 1XDWA 5TEWA 1XLTA 4D6PA 2C8LA 2W0SA 4URYR 1FVXA 5AW3A 4RZQA 2NGRA 5JANA 2Q4DA 3TTTA 3R6TA 2EDAA 2EYUA 2YS6A 2BM9A 3DEIA 4INZA 4AZ0B 4B4DA 1ECLA 4WDRA 2B99A 4GVLA 3RAFC 4JL5A 4FJ0A 1YJBA 1RXWA 3FSGD 1JGTA 2EQ5A 3FUUA 2P67A 4JJFA 1U0NA 2IEDA 1ACLA 4IIJA 3OBBA 3WGYA 2E41A 4R8RA 4GRAA 3RSCA 2EG5A 2ZYRA 4KGXA 1XVVA 3EAFA 4P4SB 4S1OA 5IKMA 3T3NA 4X3OA 3CINA 3UAGA 1P4HA 1RQXA 3SD7A 3IVRA 3D9QX 3VR6D 2IOYA 4QOHA 1CY0A 5G3ZA 5HIAA 4G0ZA 2I2DA 3R0XA 4YCNA 2O8CA 1HTWA 1B0PA 1FFXA 2BI7A 2IDJA 2Z3VA 4OHZA 2H5IA 3KZMA 3S1AA 3TGWA 3UT5B 3GFSA 3JSXA 3QY9A 3VTAA 2VJPA 3BA1A 2FY8A 3L04A 3L5OA 2W2MA 3PPYA 3VPHA 4HDMA 1X38A 2VAWA 2HRCA 2GEVA 2VAVA 3EUEA 5K51A 3D64A 3F6RA 3OTIA 3IQWA 2G6BA 4L0MA 5BW8A 3U13A 4PLCA 2O8BA 1C9YA 3CBGA 3HLTA 2FPMA 4C0KA 3DEFA 4A1OA 4E11A 3ZC3A 3BF7A 4XRGA 1AF4A 3RS0A 1YR7A 2V7WA 2VDPB 4C4RA 2QMQA 1PZFA 2ZUWA 4NNJA 3OZDA 3KQPA 3PCTA 3BIWA 4MAAA 3DMFA 1JZSA 1MVLA 1P2GA 4WGGA 3H1TA 1UP6A 2LP4Y 3GNLA 3QEMB 4XGKA 1KYQA 3GDHA 1FL9A 3W3SA 1JFTA 4W7SA 1MDBA 2AMCB 1KI9A 5B36A 1QJCA 4GUAA 1MFZA 3WC4A 3C8DA 5EWJA 4ZT4A 1CQJA 1MJNA 2H52A 4TRRA 2C99A 3ANNA 4D1YA 4BMPB 4HT3B 1N5RA 1UAAA 1C50A 4XIIA 1NXOA 1X1QA 2JH9A 3IDOA 4C0XA 4UP8A 1E24A 2QLMA 2JGKA 5EL0A 1Y5NA 3LFHA 3OQ6A 1Q19A 4R1PA 4BUZA 1YJ8A 1ZOPA 3VUEA 1M8JA 4GPTA 4AKSA 1EEXB 1WUJS 1RJEA 3EXHC 1BVYF 4L9AA 3VH3A 1N78A 1L8QA 2XT6A 1RZRA 1X1TA 2NTYC 4S1TA 1O6GA 4KQGA 4HFMA 4L5JA 1U80A 1PYSA 3IVAA 1XLVA 4QSHA 4BN5A 1N1DA 4O33A 1I13A 2KBEA 3F5FA 3INNA 4V24A 4WPGA 1KEUA 2ZITA 3SJ7A 4N40A 1V6SA 3D1JA 3V3TA 1KYTA 3PTLA 4ZOCA 3VZQA 1NP7A 2PNFA 2WU3A 3KOYA 2RONA 3TOZA 3VAAA 1GCIA 1CJUC 4H4EA 3BULA 3NHAA 3DDSA 5HK8A 1JKMA 3P9CA 1T4CB 4ZDWA 1AK1A 2R60A 3KAQA 3NB0A 4Y3UA 3TI7A 4Y98A 3C6BA 2AJTA 1XCLA 1YRLA 3IBSA 3PQ7A 1UODA 1BD4A 4IGAA 2GBGA 4MVWA 4CH4A 1CULC 4XEOA 4L0DA 2VLBA 3TSWA 4Q3KA 4EQZA 2ECFA 1GG9A 1CUHA 3QBJA 2O1WA 4OK5A 5BPFA 3QPDA 3WK9A 1KP2A 1PNQA 3I0ZA 1TJ3A 2P6MA 3H8SA 3WLQA 2I6SA 1WCXA 1H2RS 2GCOA 4XU2A 3GLHE 4UXJA 3ZY6A 3X0DA 1L9KA 4G65A 2JGLA 4UASA 5DNCA 5MN5A 2PE5A 3VPAA 4PLFA 4AZ0A 2HIAA 5JVDF 1QK3A 5B55A 3ABQB 1LPBB 1IY1A 3QYFA 2PJDA 1T4DA 1EUCB 1GA4A 3I6BA 3Q7TA 5LSAA 3ADPA 3BK1A 1JH9A 4FJ1A 5REQB 1MT3A 2BHLA 5JJBA 3G59A 3DBRA 3TF5A 3HN7A 5HG0A 4M0CA 5BR4A 5BPHA 2XX3A 4LRSB 1DJPA 1GVNB 2Y2UA 1VIVA 4NP6A 5J5AA 2Z83A 1JAXA 8GPBA 1UEJA 4EZBA 1KH3A 2QMOA 4LRYA 3TIXB 1VG1A 4PX9A 4LZNA 2VJNA 1QRSA 2I78A 3CZ5A 2B1GA 3IBTA 5GJVC 1E3MA 3FMOB 3OU6A 1OWNA 2B25A 2DG2A 4LDAA 3ZLBA 4CKXA 4DLKA 5K7SA 3LLVA 4J43A 3KU1A 1DEXA 3TIFA 1SB9A 4KJZA 4NZYA 3N8GA 3BD6A 3W1VA 4HPXB 3A70A 2PMWB 3LT1A 4U7PB 1XWIA 4PPYA 4O4HA 1AKEA 3M49A 5EJFA 2N47A 4F4FA 2O0MA 2Q5CA 4HYYA 1W4LA 1ACMA 2RHCA 3NFRA 4JVNA 4ALMA 1Q91A 3JWJA 1KDYA 1O54A 4G89A 1ZHHA 3EMDA 4DMCA 4FFVA 1N9WA 2ONCA 1MQSA 1GQSA 4DLSA 3NHWA 1FIUA 4ZTUB 5H70A 2ZCEA 1J00A 3OFSA 1D5CA 3B6MA 5EPEA 1F6WA 3QY0A 3H3XA 4LWZA 4E88A 3K0SA 1XJ5A 4WLUA 3QEOA 4MDFA 3ZU5A 1EH5A 2QVLA 1DAFA 4RY2A 4I6EA 4BY9E 3BH0A 2R87A 4HB2A 3PJGA 2C2XA 2ZAIA 3CUUA 4O08A 1EOVA 5L8VA 3RRMA 2VJKA 3CNBA 4HB0A 5G0WA 2V9CA 2D1SA 4JYCA 2CXTA 4QJ5A 4KXVA 4WQMA 1XC7A 3DONA 3IERA 5BR7A 1CHNA 3GNSA 4CGYA 1QONA 1YRHA 1WB9A 4UFNA 4EPTA 4PZDA 2E37A 2ZUBA 4K05A 3V5NA 3PHHA 3S44A 3S68A 3A2MA 1EFHA 1Y6QA 1A9PA 2ZB3A 2OCIA 3O7MA 3CN7A 4PG8A 3E9DA 2PCLA 5AHWA 1OC4A 5U1PA 2JLXA 2XE7A 4E12A 2SCUB 2OVBA 2GETA 2Y0DA 3ICWA 4QVKA 5COQA 4X6UA 4N4AA 3EBLA 3OC6A 4BLPA 4EEXA 4FQ7A 1KI6B 4BV2A 3PI6A 3TR0A 3LPAA 3UMBA 4WJ4A 1PRYA 2ZSEA 3N3AC 1VIDA 2Y66A 3KLMX 2ZVDA 5AVRA 1ICIA 4Y6PA 2HGSA 4O8ZA 3OUUA 2GPWA 2C3YA 4DF3A 4RY8A 3HRIA 3A4MA 4C7MA 4MAMA 4I2NA 4AUEA 3NIBA 3EYAA 3F0TA 1JPJA 1NOKA 4OQDA 1NJSA 4YT2A 3L7YA 2HEGA 5I4BA 4QDOA 4QRIA 1U0FA 5L3QB 3H5RA 1EUQA 1E59A 3KJIA 4M1SA 3G85A 3VKUA 4N1AA 1PJQA 3B7PA 2F1JA 2ZB4A 3P2OA 1OR8A 2VTBB 3CMMA 1NVVQ 4NE2A 1HYBA 4MGIR 1CZNA 3SDBA 3L4BA 4DA6A 2WM8A 3I45A 1R6TA 2NXJA 3KJFA 4CLOB 2YV4A 1JFLA 5A3VA 1ODLA 4ERXA 1N4DA 2WHXA 4R40A 5IBRA 1EAMA 1RHJA 1KDZA 5C31A 2G0NA 2ZIOA 4HVTA 5AW7A 5JWOA 5K6AA 4RMGA 2CJYA 1EUCA 3CW9A 4BLOA 3K4QA 1WS6A 5DI3A 4BO7A 4XLLA 1YQTA 1KJ9A 5K1PA 3OKFA 3I2IA 3D0QA 4JBLA 1D04A 1RWNA 4B8WA 1LWOA 2BL4A 2I3ZA 3VPBA 3E0QA 2CL7X 4DRXA 2HY7A 3GPIA 4X7PA 1OIWA 1DKUA 2C57A 4EGSA 1OD6A 3L4SO 1MAUA 2FFAA 2SICE 4V0ME 4BEWA 1W94A 2QD5A 1EBBA 4RVDA 3VQVA 2RHHA 3BWBA 1SB8A 1SZPA 1F20A 2AGVA 3K53A 2DHQA 1VGRA 3V7RA 3LK7A 4L27A 2OECA 1NFQA 2QRLA 4TL8A 4GI3A 2YXBA 4RX1A 5LZ9A 4YT4A 3GLGE 1OSNA 4ZOQI 4B79A 5CEJA 1MAVA 3CH4B 4DRYA 2AFHB 1V41E 5L9AA 3QU5A 4WI1A 4OXNA 4C01A 1RWXA 2W2TA 4EEZA 4PQFA 5TIIA 3LV8A 3TIIA 3E5HA 1TK2A 2Q5FA 3EF0A 5ILOA 1JB1A 3L0IB 2PSEA 4QUIA 4D82A 1GVHA 5JNTA 3CPHA 3ND5A 2EWWA 1L3BA 1IH8A 1XTQA 3IB3A 4GW3A 3ER6A 3MF4A 1HDCA 1NU8A 1QFSA 1K5HA 2YZ7A 3MCUA 2VH2A 4GO1A 3RUHA 1S96A 3RVRA 3X43A 2WYWA 3H16A 3T7AA 2B4TO 2OXIA 5DNUA 1IQPA 1Y6ZA 1XDSA 4ZOEA 1L8XA 2DQ4A 4EYEA 5IM4A 4CEHA 2YJ5A 3FOZA 1OCEA 1SBNE 3IAUA 5E3IA 5JNVA 1QVAA 3E8SA 3QHAA 1SFRA 3QX9A 4TKUA 1ISHA 2UYGA 3JD1A 4H3KB 4RCVA 4TTIA 1M6HA 4E03A 2X13A 1OB2A 2C5SA 2O4CA 4OFBA 4ZIRB 1EBUA 4AX8A 1ZZEA 4G4GA 3U3ZA 4OKSA 1ZCAA 3NBXX 2GHQA 1GNPA 3E58A 5COAA 2MYPA 3X1JA 4DQXA 1O7JA 2PG3A 3PNVA 1TIBA 3PYLA 2ARKA 1V3VA 1ECGA 1QQ7A 1BKDR 2VF7A 4LVMA 4JD5A 4AB1A 3QMVA 4M8SA 4L7QA 4LCEA 3ZX5A 3DFZA 5JZOA 1R6AA 1GGJA 2WSLA 1D0VA 1QB8A 4PANA 2AYZA 4NXMB 5HKBA 3MK31 5FUVA 1V7QA 1I1QB 1P72A 5E6RA 1NXPA 2X1LA 2IXDA 1ZK1A 1G20B 1KI6A 2FWAA 2LW7A 3O90A 2OGTA 5KQLA 4YA6A 2ZI9A 2HEIA 2PGNA 4E1BA 5DGTA 1PG0A 1TT7A 1XDBA 2HLDD 3ASYA 1XP5A 3H13A 3N6RA 1YI0A 4AN4A 3G0HA 3N2ZB 5L4LA 3DMRA 2ZXFA 2DTDA 1ADBA 3TH5A 4Z4CA 3WA7A 2R7LA 4XIGS 4O0MA 5FEMA 4FFNA 2XEXA 4Y67A 1UFQA 1OB5A 4PE5B 2VTBA 1VPVA 3OLQA 1GUFA 3HKBB 2EZ4A 2I1QA 4M0MA 3NTVA 4IEEA 4YAJA 2GXAA 4L22A 2QZ9A 1K8QA 4M37A 2XE4A 1XAGA 4YYZA 3SVTA 2DPLA 1T6ZA 2QZJA 4GM0A 2J6BA 1B8VA 1XZGA 2R00A 3W77A 1PO7A 4NJEB 1SIWA 2DJIA 3AM3A 2IWRA 3AEKB 4CL8A 4C0LA 2E21A 4GRIA 3AQ4A 4XM0A 1M34E 2PFKA 2WK1A 4GOJA 5FI3A 1SD5A 3VR1A 3WRVA 4RZIA 1VDMA 2V9PA 4PXYA 1NXTA 2YFHA 3OE1A 2D6FA 5FR2A 3RGWS 2P4EA 1Y63A 1C7JA 2I9KA 3WYGA 1HL3A 5F4BA 1GG2A 5FTLA 4C43A 2HAEA 4TVYA 2XD4A 5KVCA 3IKMB 4Q66C 4EL0A 1N36B 1CUYA 2BZSA 1HE3A 4FIZA 2E49A 4QT0A 2P0YA 3IVXA 3FDJA 2AN1A 4G9EA 1KOGA 2PS0A 4Z3OA 5HYVA 5T5QA 3LQQA 3DOIA 5CFRA 5IEBA 2OHVA 3QFRA 4ETIA 2G0AA 1SVUA 3K6JA 5CDYA 1UJNA 4UHCA 4BFVA 1LDGA 1NLUA 1ACJA 3QVVA 4I66A 3HJNA 2XT9A 3M4ZA 5GJWC 1NUTA 3ZQUA 5AVYA 2GEKA 3GPBA 5D87A 1BIAA 4ZJPA 2BH2A 1Q1BA 2VJLA 4K6FA 1KMCA 3VR0A 4PR0A 1Q7RA 5D00A 1ASZA 3BJZA 3MAGA 3RIMA 3LY7A 4I50F 1DJQA 2I5PO 3LWNA 2P4QA 1L5ZA 4QQFA 1YFJA 2IIQA 1AM4D 3LPCA 1J49A 1ZGCA 1KDTA 2VRCA 1CG6A 1KFEB 1JKXA 1LQTA 3CE9A 3MSXA 3EDQA 3QXSA 4F2GA 3CUKA 2CSUA 4MWTA 4JFAA 3S2SA 4KFRA 2I2FA 2DEQA 3C6QA 4XYMA 7MHTA 4KR6A 2P3LA 3CRW1 5E9JA 1X7ZB 2GM5A 4JLNA 3LIPA 2IEZA 3B13B 1NN5A 2HF7A 2SECE 4UC0A 2ZWPA 2RHSB 2HQRA 1H4TA 4H2WA 3K4PA 2ET6A 1R50A 2DYKA 3H9CA 3OTHA 1PWZA 4Y6LA 1X7GA 4K1XA 2H54A 4AJ1A 1ECJA 3TM5A 1U90A 4PAOA 3ZE1B 1M7BA 3WZMA 3G0BA 5I8PA 1K3UB 2P1DA 3TLCA 2GYUA 2ZJ5A 4LQ4A 4Y2HA 2Q27A 4JQCA 4YMSA 4DS3A 4E14A 2UZ0A 5C1BA 5JEDA 1ZMBA 3UOAB 2Q6OA 4DSAA 2Q2QA 4OYHA 5IKXA 3KVYA 4XWGA 2ZSFA 5CX1B 2JASA 1TRKA 1BFUA 1UFOA 1MV5A 1OLUB 1XXHB 3QJYA 3UICA 4D25A 2V7XA 3ODGA 4JLOA 1HGXA 2XH8A 1CYEA 1O2DA 4TTSA 2B2CA 2R5NA 4WOKA 3FW1A 3UW3A 3MXTA 1NTOA 4LSWA 5EZYF 4DJDC 2IOQA 2ZE8A 4LUCA 1UKYA 2BI8A 4L0CA 2NP7A 3O84A 3QSGA 1Y9EA 5EN4A 3TW6A 2XOKD 3LFUA 2IEIA 3PIDA 3TW0A 4N03A 4KPUA 1XI2A 4M0EA 4Y9RA 3A7UA 3D3KA 3OF3A 3TUPA 4OP3A 1WW3A 5FA8A 2VR1A 1JALA 1ADFA 1XX6A 2YVKA 4BMOB 1R10A 3PNSA 4LZJA 1M1ZA 3G02A 4QUGA 5EINA 4WY2A 3L18A 3KKNA 4YROA 4M3NA 4KQHA 1ISRA 2H7CA 5BW4A 2NSDA 1Z56C 1NW7A 1X19A 4GGPA 1K7EB 3JWHA 4NBNA 5C1OA 1F0PA 2ZYVX 3BHIA 3FR7A 2XR1A 3AVWA 1YAHA 1PNOA 1Z6ZA 2ZTMA 3OX4A 1E69A 4FOTA 5TGTA 4A36A 1M1YB 5HR5A 3ZHCA 2IF0A 3C6KA 3UB2A 3PC7A 4LG1A 4RKEA 1LNQA 2FK8A 1MORA 3H0EA 3HYCA 1E3QA 3K15A 4BWGA 1TTHA 1NAIA 2ZVQX 3G1UA 3H7AA 5BWNA 3MNFA 2HC9A 13PKA 3RC3A 4DNXA 1RRFA 2R6HA 2X14A 2B69A 4M36A 5KVAA 5GWXA 3T1NA 2W58A 2V5UA 2BBSA 4R1QA 3PDIB 3M9LA 3D5EA 3RU9A 4UCQA 1EBFA 3KTDA 3T5AA 2FXVA 1N2EA 4HLQB 4NTZA 1P1BA 3B9BA 4UU1A 4FZVA 3DYIA 3N75A 1I3MA 1YIOA 2IGTA 4YP0A 1FDOA 1OIVA 1U98A 1XQYA 3ESRA 4LQDA 4MJXA 4QEKA 2J6IA 3SE7A 1A82A 3Q9UA 1QHYA 2IODA 2RGWA 5DH9A 2AZTA 2PMKA 1Z07A 1EDEA 1GAWA 1PJ8A 5ALWA 4CMEC 2ZJOA 2CGEA 2AQHA 2ACKA 2VXOA 3IUYA 2W71A 3V33A 1OGIA 5KSZA 2G9QA 1VPTA 4FYIA 1OFGA 3B8HA 3KUKA 2FI1A 3GUVA 1P0QA 3PQ3A 5CDSA 2C2YA 4TT3A 2H1CA 1WMSA 1GFSA 3BT7A 4R7GA 2I8LA 1T2NA 3OSZA 2QN7A 3ACBA 1V5WA 3IAXA 1S2LA 2Q3FA 3OE4A 3Q10A 3VSCA 2JGDB 3V1UA 1XTPA 1EB8A 3N8HA 1R2QA 1WMBA 1PR2A 4HNRA 2ZIUB 4WLVA 3FRIA 3RODA 1IQUA 1I14A 1YOBA 2LZ0A 2I9PA 3TG2A 4YAFA 1X7ZA 9LDTA 4YMHA 1UDXA 1KFKB 3WQZA 2A57A 2GKOA 2PZFA 2SKCA 3N5CA 1Y4UA 4GKAA 4KI0A 4RPHA 5EEGA 1T5BA 2WE7A 3RASA 2RHSA 2N9UA 2PL1A 5F4ZA 3C3PA 3UCXA 1F8GA 4YP9A 4BAUA 1WVGA 3RARA 1TJYA 3V46A 1JAHA 4K3VA 5UKDA 2PD4A 4MYTA 5BOSB 3ZDBA 3IDZA 4W9RA 1LBTA 3QJ5A 5EQDA 4S0ZA 1RCUA 2AWNA 4JQYA 1P0MA 1PAUA 3I76A 5T3YA 1WXXA 2VPPA 3BWVA 4KB5A 1VJCA 1PS0A 1C9NA 1JW9B 1SWWA 3ELUA 3IPRA 4L2IB 3RVDA 2RGEA 1ZGBA 5K3CA 4TTTS 2O7SA 4BJHB 2WWWA 1SUIA 1FNBA 3K0BA 3JWIA 5CVDA 3U80A 1WDKA 3KDSE 5CX1A 4A73A 1Y3IA 1XXHA 1OLUA 3BG5A 4JJGA 4RTKA 1PEKE 2Q2OA 2QR2A 1V5GA 2I6TA 4I5FA 2CHUA 3I9MA 5TY0A 4IJUA 2JI9A 3ORHA 1FVOA 3RYFB 3VU1A 3R7WA 3T7CA 1LPMA 5FBRB 1E9FA 1GG5A 3OM0A 3D4OA 3U17A 4DREA 4HX9A 3U4CA 4EHIA 2ZT8A 1E6CA 4CHTA 5CDHA 3TFOA 2NVWA 4C6TB 3ANTA 4D9EA 1KK2A 4CVNA 1C8VB 4RVGA 2CJWB 5ECWA 4IFBA 3C3KA 3U7GA 3O4HA 3NHRA 2VRBA 5C1IA 2ON6A 1ZN7A 1MEOA 3MRSA 1DMSA 2ERCA 1O8CA 2LV8A 4AO6A 3PVZA 1JE1A 1XR3A 4RM2A 2G72A 2Z6AA 2P2CA 1XKXA 3UMGA 5ED0A 1MEJA 3GT3A 5FPTA 5LXTF 2NQTA 5MFPA 5DJ5A 3ZJYA 2FSUA 4ND7A 3VZRA 2Z8YA 3AB7A 4JYBA 3WLLA 1ZNXA 3I4LA 5IC4A 1X39A 2CK3A 2PBZA 4ZOLF 1T2DA 1HLPA 1M1YA 4G81A 1VJGA 3OCVA 1YZVA 4F97A 3ZK8A 5FUYA 2TRSB 4EX6A 5IVPA 1F5SA 3HKDB 4ENSA 5J4VA 3NM6B 3BZWA 1OXUA 5JIBA 2UZ1B 4W8HA 2X1MA 3DB2A 1ICEA 2NZ8A 5ESWA 1HETA 1C0EA 1T36B 3WNZA 3ZIUA 4F1WA 3OIGA 4ZVVA 2ZWIA 3AHEA 4HRXA 1PU2A 5LCXA 2P91A 3IQEA 1Z08A 4HDKA 3ZXYA 4QE3A 2YHIB 4UTXA 2JFBA 4MPDA 3T7JA 4V0OA 3RC1A 3V4OA 3E1KA 5C35A 5KREA 3AGQA 3OOSA 2YXNA 3PNKA 4MINA 4QOSA 3THWB 1SPBS 1MJGA 1DXYA 3RREA 2EWVA 2WVGA 5EJIA 3HNPA 3IMCA 1E6KA 5CCDA 2V58A 5B57C 2PRYA 5T67A 3QSYA 2K2QB 3DTNA 4RZHA 3WXBA 4FU0A 4HQ6A 1ZISA 1AC5A 4U8GA 2BE7A 1MUUA 3M6XA 2C2BA 3TTWA 2Y71A 1H0KA 1VA4A 4Y2RA 1N75A 3PVCA 2ZI4A 4Q5IA 2D2VA 4ZMSA 1GOTA 1Z5PA 4UEQA 2LUOA 1YE8A 3ENKA 3K70D 1J0BA 2JGDA 4M7WA 3HY0A 1LF0A 5GOTA 4F4IA 2AUTA 8ATCA 1G2IA 2J7PA 2NPFA 2W6ZA 4DOMA 4FMPA 1BYUA 4R8SA 3QUQA 3BJRA 5KX5B 4FEYA 3I9FA 3TL6A 3WG9A 4CF5A 5H82A 3GFQA 3WWDA 2ZUUA 4D8UA 5K3EA 2FJ0A 1E2PA 2IDMA 1B15A 2QYTA 4LXQA 1ATIA 2IX3A 3MQFA 4UEKA 1Y7LA 3LBAA 5H83A 1BEUB 1NTRA 4YI3A 1HDIA 4B0OA 2QTBA 3PUXA 4DDKA 3OFNA 4FCTA 3PRYA 2XCRB 1E9DA 4GX2A 4L15A 1USYC 1UF9A 3NTUA 3WBKA 1RQ7A 4G67A 4NOKA 4QU0A 4GMHA 1Q6YA 1QHFA 5DBIA 1J9EA 1KZ7B 1P0IA 2JCBA 1P74A 2VHYA 4IIJF 2GO1A 1MTZA 4ID9A 1XDZA 1X8JA 2WJ3A 1I7QB 1Z7EA 3OCJA 3RRZA 4IJMA 1Y4DE 4KRGA 2PANA 4TLMB 5CK4A 3S1SA 3PTAA 3GLFB 3OWOA 3RVNA 3UGTA 2CE7A 3IT1A 4WAUA 5FUQA 3GIWA 3KYJB 4E33A 2JCYA 3CKYA 3C5EA 4JB0A 4PZYA 5TPWB 3OU2A 1ZNZA 3A3PA 5KYYB 2C2GA 3M6FA 2ZEJA 4EG1A 4L73A 3R0VA 3G7UA 3KAPA 4ARSA 1MV8A 1NC3A 3HI6A 1Z28A 2AQ8A 4NF2A 4Q12A 2BFCB 2A8EA 3F78A 2WWTA 5KTTA 3Q87B 4B0PA 1XELA 2LGJA 4YJ3B 1WQWA 2CJWA 1HV8A 2PT7A 5FFMA 2XUQA 3FPLA 3OT4A 1DQYA 1JRLA 1PG2A 2XZTA 2YZKA 1E5LA 3DUFB 1T0UA 3Q7PA 3PA6A 1DL5A 2DMRA 2ZCJA 2P2DA 4PG7A 4ZCTA 5J4LA 4C4ZA 3MGCA 5JNUA 5EE0A 4F11A 1V8BA 2PGOA 5KSPA 2JI6A 3NORA 4KDFA 1B70B 3L1AA 4F38A 3M4JA 1RXSA 12ASA 4AUKA 4PXAA 5FNVA 3OESA 3A3YA 4G1UC 4PG5A 4QLOA 3F9IA 3W4KA 4UPAA 1A2KC 1OKKD 1VBNA 3NYRA 3OJEA 1WAMA 4MV7A 1FFBA 4XCXA 5A6SA 4DCVA 4CTJA 5M3BA 1V26A 2W6MA 4MKZA 3W4IA 3A1SA 1ZUHA 5I5EA 3R0IA 1DWOA 1LI5A 1ZAKA 2JDIA 3CZMA 3H9UA 3LY5A 5LA6A 1JDSA 1BU8A 3HN6A 3V2GA 2Y8EA 2PU5A 3JVIA 3HDHA 4LWPA 4HH3C 2P9TA 3M4XA 4CNQA 3B85A 3D6JA 4NOJA 5H81A 4F5DA 4GIBA 1W88B 4JNCA 2X9QA 3MCTA 2XMDA 4PLVA 3OLZA 3GFVA 2CSXA 3R3YA 2XHZA 2X0EA 2O5CA 3BIOA 1M0TA 5HIJA 1BKSB 1QIGA 2HHJA 2PO5A 4HQRA 4I7EA 3W7BA 3O1HB 2XYPA 4M86A 3C6MA 4FGZA 1D4OA 3I42A 5B1DA 3AUAA 4GICA 4Q1VA 2NAPA 2A9KA 4QGHA 1QTQA 1AKWA 1S01A 3REGA 1T0BA 2GN0A 4J0HA 4CG1A 3T1TA 3KJGA 2E82A 1OWPA 1XO1A 2Y4OA 3EY4A 3LYAA 4GX0A 5TR9A 2O19A 2ILVA 4BKUA 3E7PA 4BQSA 5A02A 1E1DA 2B21A 1NRIA 4MMZB 4Y1EA 4M49A 2HI0A 1PN3A 3L02A 2C7BA 3F5MA 3V32A 4C0BA 3P4UA 5KX5A 2X7JA 4B43A 3RT1A 4ZZ0A 1H2HA 4BP9A 4D4KA 1XK6A 2J0UB 3HVUA 5EJ2A 3FSJX 1JDJA 4R7TA 4CQLB 4KQ6A 3SJCA 2FWIA 1IWPB 1AZLA 1RRVA 4IKPA 1NLFA 1X1EA 2EFYA 4C22A 4B82A 4UDOA 4WDQA 1J4AA 2GFHA 1C3VA 1NXVA 2W22A 3VOBA 3I2YX 4OU4A 5FL7D 3E6AA 3EJWA 1ZU5A 2JD0A 1G291 3N05A 1N7JA 1SG6A 3NT4A 3D8NA 3FCAA 2PSHA 1HRKA 3RU3A 1L1FA 1LTKA 2CBZA 4OBBA 2GTIA 4FDMA 4MYRA 1TYEB 4UJ3A 4X8LA 4L3WA 3WMGA 2E9SA 5CXUA 5MN4A 4WCFA 2OGSA 1BOOA 2WF8A 3CEPB 3R6DA 1WNFA 4ND5A 2APJA 2GA9A 4ZI7B 4G5SA 4B6PA 1J0CA 1UM9B 3T3OA 4NVRA 3UJAA 1J2RA 2ZE6A 3DP9A 4ZZ3A 1TUEA 2BFCA 5EIAA 5EHQA 3QBDA 2EZTA 2ZRBA 3AG6A 4O4HF 1H2WA 4R2WA 4A6PA 3ZDYB 1CUJA 1GV1A 1X1CA 2R7MA 5D86A 1QMPA 2ATXA 5I7EA 2C9ZA 3C5CA 3TD2A 2P68A 3PLNA 4R9RA 2P0EA 5L3VA 2B4YA 3NBYC 1P5HA 1WG8A 3GPDG 4XDZA 3UH1A 4EMSA 5DN6A 5ARBA 1X1DA 4MVJE 2W6PA 2AOVA 4DG8A 1MO6A 4PY2A 5LP1A 2PWYA 4U0KA 3RSSA 1XTSA 5LMNB 2VWHA 1TVMA 2YW9A 5E4FA 1I1HA 5CW1A 4TZTA 5HJ7A 4UPEA 1KJZA 4K6KA 1CQIA 2ZIVB 3AR5A 3NWEA 1JQ5A 2RKBA 1NW9B 1R8SA 3NC1C 3E3MA 4IVQA 2YJ6A 3GRRA 2CDAA 3GW8A 3E27A 3TUJC 3ZLTA 4B5KA 1D5WA 4ARCA 4Z86A 1GADO 3MJTA 2GCIA 4IDNA 4PU0A 4QARA 4YB8A 1T9AA 4ZYXA 2IZOA 5FWAA 3SQOA 3RROA 4LF7B 5GVRA 2H51A 3QHQA 1FLVA 3WFZA 1XALA 1ODKA 1S1CA 3NOQA 3IPCA 4RENA 4KIWA 2G8LA 4D4GA 1GSOA 2Y99A 2AEFA 3P8TA 1AS3A 2FW1A 2YJTD 2X2OA 2FYKA 3M89A 1CJTC 3R5XA 4LJ7A 3TI9A 2P9HA 5CVJA 3CH7A 2FPPA 4RC9A 3T7RA 2JAOA 4W7IA 5T3UA 3R7AA 1BWPA 4EP1A 4M1YA 5F7JA 1SKYB 1OTHA 1VIMA 1XDUA 2Q5EA 3N28A 4I4NA 2G17A 3MF2A 1I4OA 1DU4A 4N9QA 1SC9A 1B8AA 3EMVA 1H4QA 5ECGC 1KRXA 2C5LA 3BDIA 3CFYA 5KOYA 4QXQA 3PFNA 1HG0A 1E2GA 1JBKA 3CLKA 1N0HA 1GZVA 4B47A 5AQEA 1ABBA 4U1RA 1K2WA 1AOXA 4NFSA 2FW8A 1KI2A 3BWXA 4PPGA 1YE5A 1ONNA 3DMDA 3PYMA 4ND1A 4Z9AA 2FFBA 3UJCA 5LR6A 5C51B 1KK3A 1IONA 3GEMA 4Z4GA 5AYVA 4NBUA 1T3HA 5K05A 2YDYA 1Z36A 3AXTA 2DQKA 1ISGA 2XADA 2J0UA 2CNOA 3E7XA 3EVFA 4DLAA 1IB6A 4MV8A 5C1DA 3RSFA 1ORRA 3GJ5A 4ZVTA 4AN0A 4CQLA 5K0GA 3DL2A 1DC4A 1L7OA 1BXKA 4BX8A 3LUKA 3NBZC 4FR2A 3HVKA 4KWCA 4TPKA 3SHOA 4BCDA 3UKDA 4RD2A 1P62B 1HTBA 1RKUA 5EWMB 2BSXA 1N0WA 1C3OA 2RD2A 2GF2A 3NANA 4V2UA 4BX0A 1SXIA 1J21A 3SOPA 1V1RB 2FPGB 1DKPA 2PMBA 1LSOA 4E5YA 1QAMA 3P2MA 1K7FB 3IE0A 3MWGA 3Q5DA 3AEXA 2AR0A 5LNK6 2DKNA 2RHGB 3WL6A 1UPXA 3R9XB 3SYKA 1DPGA 5T64A 4BATA 5AVTA 3H6GA 1OPXA 2DWUA 3HJGA 1Q16A 3HR8A 2F8LA 1Y37A 4Z7NB 4P6VF 3WGHA 3MBOA 3VJLA 2FDXA 2YRXA 1UM9A 1YKGA 2R96A 1XUOA 2A3RA 3LGXA 4QHTA 1SVIA 4G4SO 1CZLA 4A6DA 1XQ1A 4PAMA 5CW2A 4GM1A 3UJ3X 1H6AA 1OFIA 3ODPA 4ARZB 4DDWA 3RB8A 2X8AA 4LOIA 5J2UA 1QE3A 1YUMA 1V9CA 3OOHA 4EWLA 3U5TA 4BBZA 3PFCA 4A26A 4XOUA 3G5TA 4MV9A 3VHLB 1MVOA 2BDEA 3VR4D 3AIIA 4E3ZA 3MUEA 1IOLA 1KRWA 1ZK2A 2W2PA 1IAVA 4RPCA 2ZXEA 4FT2A 5FP0A 1I51A 4JI1B 5H0IA 4BECA 3OUTA 3KZCA 3NUGA 1JR2A 1U94A 3AJDA 1NJ2A 5DIFA 3SJBA 2B8TA 3MAAC 3KD2A 4OQQA 2C1ZA 4HEA1 4UCWA 3RYTC 3ZCSA 2KM1A 3BDVA 1KYZA 5EQTA 2DVMA 3H99A 2BE9A 2HNAA 2A7XA 2GRAA 5IM4F 3D3JA 4U0JA 3ZKWA 4PCAA 1TVEA 4MARA 3JATA 4C08A 4DJ5X 2WPNA 2PJRA 1CS4C 1TMGE 2H29A 2H8KA 3DYVA 3IT3A 4FDTA 4JLUA 4P38A 3ZGNA 1PUXA 5KTOA 4F91B 1RVDA 2QUIA 3GRCA 3JASB 2YYSA 1EK2A 3OCYA 4IQ8A 1KXZA 2O2GA 1K97A 4F9FA 1P81A 3IAAA 4B3SB 1EFVB 1ZL2A 2BUCA 2O1XA 1THMA 2PRSA 2VNSA 4JI0B 1OZFA 4RGBA 4DBLE 2JFPA 5K3DA 2CNKA 3FOBA 1ZGHA 1QGUA 1XEWX 3BJIC 4IH1A 5CB0A 2HTFA 5IAOA 1JDUA 1GLGA 2E1HA 3AUUA 3I9JA 3EIUA 3K8OE 2B36A 1X7XB 3B9PA 1A1VA 2BW0A 4O29A 3EZGA 3KQMA 3SEQA 3HMQA 3SS8A 4C6RA 2N1MA 1VKNA 4LHVA 3WBJA 2D3WA 3D2AA 1WW8A 4LJ5A 3ZHUA 1TDJA 1AA9A 2FXIA 1QG2A 2R6JA 5AK0A 1O97C 2DF8A 5FBHA 1K75A 3V4ZA 1UWVA 3O4VA 1GPBA 4F72A 4EKEA 1G21B 5C81A 5KNLA 1NVKA 4WZ6A 4RQFA 5G1NA 1C7QA 4ZKDA 4MQEB 2I76A 1JAIA 3FETA 1GQOA 5CT4A 2UYHA 1UXGA 3A28A 4WK0B 3WIUA 3ZWPA 2HJHA 1DDOA 2YV1A 3UAWA 4EYQA 5M7EA 1JQ3A 1AQUA 1O94A 3DTTA 4NFYA 3L7MA 3K05A 1Y3FE 3DULA 1MO4A 3JZDA 4JLBA 3HVHA 1KKLA 2HRQA 5DHAA 3ZHSA 3PQ5A 2ZIEA 2O2XA 2XNCA 4DR6B 4J29A 1V8ZA 4TXLA 4D3YA 3B1JA 3PXCX 4AULA 2YQZA 3TSZA 1QYDA 1P9RA 2H00A 1ZUNA 2Q1UA 2UZ3A 1QIKA 1RPAA 2WC1A 1II8B 1OJLA 2HN9A 3EZNA 2H2IA 3G8YA 3IV9A 4YBZA 3D5QA 1E6UA 4Z8YA 3EIXA 2KW5A 2XGTA 2P3SA 3N39C 4NMWA 5ALUA 4A0SA 4ALLA 4DZRA 2FKAA 2JNWA 4G3XA 2DFVA 3SSOA 1NNUA 1QG4A 3ZE2B 5E2IA 1W48A 3FFXA 4J07A 2AZ4A 2CUKA 3DWFA 1JFFB 1Q2XA 2DBZA 1OU4A 3BRWA 4H1TA 3D8RA 3MQ4A 3PE3A 2ACEA 2IKQA 2R6GA 3A14A 2RBGA 3JV7A 4AU1A 2BDTA 2RGRA 3H5IA 4I4LA 1V1RA 2FPGA 1NF3A 2FWJA 2O07A 1F3LA 4RMHA 4XE5A 1S2GA 4ZA2A 3PEYA 1ADYA 3EXAA 1PVOA 1QP0A 2PGAA 4PTZA 3R9XA 3SQWA 1X56A 1IY0A 2YHAA 5C32A 3QRWA 5HM6A 2IYRA 1E9SA 1R4MB 2VJOA 2W48A 5FAKA 4LTDA 5JATA 4C14A 1DTWA 3JD0A 3WGGA 1R8JA 2BUAA 4RL6A 4C4TA 4YV7A 2AMYA 3K70B 4OK6A 2EEZA 1P4JA 2P2YA 2YRWA 5HBRA 2PUFA 4GP7A 4A8HA 1W36D 4HV4A 1YFLA 2JLVA 3PGA1 3EHDA 2DLCX 4E5KA 4DV7B 2I22A 1OYWA 2C78A 2F3QA 3QO7A 1E3IA 2FQ1A 5EZ6B 2BKUA 3RTAA 4DABA 2ZPAA 1DAHA 3CNQS 2FPLA 1BSVA 3D3QA 4DL9A 1OWOA 1SG0A 5JRJA 4K2HA 1BYIA 1TL7C 5TGZA 5EP1A 2DULA 2GZRA 3D3WB 3E9ZA 3GT0A 3NTLA