5E3IA

Crystal structure of a histidyl-trna synthetase from acinetobacter baumannii with bound l-histidine and atp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
429
structure length
388
Chain Sequence
SSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNAAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine--tRNA ligase
publication title Crystal Structure of a Histidyl-tRNA synthetase from Acinetobacter baumannii with bound L-Histidine and ATP
rcsb
source organism Acinetobacter baumannii
molecule tags Ligase
total genus 124
structure length 388
sequence length 429
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2015-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5e3iA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5e3iA02
3VQVA 1BBWA 4ZTUB 4UP8A 3A7RA 4XTVA 2RHSA 1B70B 4UP9A 4YRFA 4H2VA 3UH0A 2ALYA 3A32A 4CS3A 4YRJA 1NYRA 1EIYA 2DU7A 4TWAA 2Q5HA 4XU0A 1KMMA 2ZGWA 1IL2A 3HXWA 1PYSA 2DZCA 1ADYA 1NNHA 1J5WA 3EFSA 2Q7HA 1NJ5A 3MF1A 4H2UA 1NJ1A 1WU7A 4XU1A 4YCUA 1G5IA 2DXUA 4TVAB 1H4SA 2ZNIA 1EVLA 4YRNA 2DTIA 3HRKA 4ZIBA 4CS4A 4P3NA 4H02A 1NJ2A 1E24A 3REUA 4YRRA 1B76A 1H4VB 1YGBA 4CH4A 4YRQA 4EX5A 4P75A 4XTYA 3RUXA 2AKWA 4WJ4A 3RKWA 4L87A 3P8TA 4YP0A 1ADJA 4TQDA 5ELOA 2ZT5A 2QHSA 5ELNA 3R07A 2DKGA 2ZR2A 3V8JA 4YDQA 3TUPA 3NETA 3QO5A 3BFMA 4WJ3M 2P5IA 3TEHB 3V7CA 4TVWA 1SESA 4YRLA 1VQZA 1E1TA 3A31A 3L4GA 2ARTA 4CH6A 1BIAA 3QO8A 1EOVA 4Q15A 2RHQA 4XTXA 1G5HA 1ATIA 3W3SA 4XTWA 3L2ZA 4P73A 2DQ3A 3I7FA 3UGTA 4P3OA 4G85A 4H2TA 1X54A 2ZZGA 1LYLA 4H2SA 2IY5A 4K86A 4XU3A 2E1HA 2PMFA 4YRIA 3RGLA 1WPYA 4TTVA 4HWOA 3KFUA 2ZIOA 3VBBA 2EWNA 3PZCA 1WLEA 3RL6A 5C53B 4UP7A 2DTHA 3A5YA 1WQ7A 4YROA 3M4QA 2ZZEA 1EQRA 2Q5IA 2E5AA 2CJBA 3NENA 1WNLA 3IG2A 1V95A 3UFGA 3LSQA 1JJCA 3A74A 2DQ0A 2ODRC 4LNSA 3DSQA 3PCOA 3IKMB 2AMCA 3NELA 1HC7A 3HFZA 1WQWA 2ZXFA 2DVEA 1KMNA 2ZTGA 3MF2A 4YRPA 2FYKA 3RIRA 1YFSA 4CH5A 4P3PA 2J3MA 4TQFA 3RACA 1Z7MA 3RF1A 2EJFA 3LSSA 1B7YA 2Q7GA 2RHSB 1X55A 3HXXA 3L1AA 2ZZFA 4H2XA 4YRGA 4KQEA 3P8VA 1NJ6A 4CS2A 2ALYB 2XGTA 5E3IA 2CIMA 2I4MA 3HXVA 1YFRA 1EIYB 4K87A 1NJ8A 3HY0A 1PYSB 3LC0A 1USYC 4RQEA 4J15A 4OLFA 3UGQA 1FYFA 3TEGA 1X01A 5C52B 2LW7A 3BJUA 3A5ZA 2EJGA 4HWPA 1GGMA 3VQWA 3G1ZA 2ARSA 2ARUA 4PHCA 1RIQA 1C0AA 1SETA 4X5OA 1SRYA 1NYQA 3HXUA 2ZIMA 2AKWB 4EO4A 5K1XA 3V8LA 2CGHA 2E10A 4YCWA 2CJ9A 2XTIA 2ZR3A 5KNNA 4YRCA 4BWAA 1W66A 3A7AA 3QTCA 4NCXA 4K88A 3V7SA 1H4TA 4P71C 4YRSA 4AH6A 1B70A 3CMQA 2QHUA 3L4GB 1USYA 5C51B 4RQFA 2DTOA 2RHQB 3QO7A 4XTZA 4CH3A 5K1PA 2EJ9A 5HGQA 1B8AA 4HWTA 5F5WA 4DPGA 4E51A 4BW9A 3HXYA 3FJPA 11ASA 4DQ2A 2E64A 4YPFA 3V7RA 2QHVA 1SERA 2ODRD 1YB3A 2IY5B 4TVAA 2DJZA 1G51A 4RDXA 2DZ9A 2ZT8A 3HTZA 2QHTA 3IKLA 1QE0A 2C8MA 3VQYA 4YRMA 2EL9A 4YRKA 1BIBA 3HXZA 4XEMA 3WQZA 2I4LA 4HWSA 3HFVA 1H4QA 2ZINA 3E9IA 4TVYA 2I4NA 1QF6A 4P74C 1HXDA 4HVCA 3HY1A 1JJCB 2E41A 4Q6GA 3PCOB 2G4CA 4P71A 2E65A 2AMCB 2ZCEA 4PG3A 4XTUA 4WI1A 3HFZB 4P73C 12ASA 4P72C 2J3LA 1X2HA 3M4PA 2CJAA 1X2GA 2DXTA 3QNEA 3TEHA 4H2WA 1EFWA 4ZTZB 2E3CA 3REXA 1N9WA 2P0LA 2DEQA 1BBUA 1WYDA 3OD1A 1B7YB 4UPAA 4HWRA 3HRIA 1L0WA 1ASYA 4G84A 4H2XB 4XEOA 2EAYA 2PMEA 1X56A 2I4OA 2C7IA 2ZNJA 1YFTA 1E1OA 4YCVA 1HTTA 4YYEA 3V8KA 3A7UA 3ICAA 1E22A 3NEMA 4OP0A 4P74A 3EFRA 1Z7NA 1ASZA 3VQXA 3MEYA 1EVKA 3RKYA 4KR3A 4O2DA 2DU5A 4P72A 4XU2A 4KR2A 3IALA 3P8YA 4H2YA 2DDZA 2Q7EA 4YREA 4HA8A 2ZT7A 3E9HA 1KOGA 2HNIA 3RKXA 4WF2A 2ZT6A 4RMFA 4YRTA 4P75C 3ERRA
chains in the Genus database with same CATH superfamily
2QRQA 3C6XA 4FYPA 4C7OA 2IHZA 2WM2A 1A9PA 5CP8A 1P33A 3B9RA 4RYLA 4N1AA 2XXAB 2CLDX 3VPHA 4I4LA 1MO6A 2GEKA 3TO5A 2RHSA 4IDDA 221PA 4Y30A 1Z2NX 2ZRLA 1IEVA 2VWQA 5LZ5A 1KFCB 2XMCA 2ZE8A 4BO2A 1FU8A 1WU8A 1G1MA 3AEYA 3HJGA 4H2VA 2XYQA 3NONA 2V4UA 1C1DB 3OURA 3RIGA 5KVAA 1F6DA 3ETJA 4LMPA 2OBLA 3DDUA 1UBNA 1LGYA 1CTQA 4LE0A 3ZWBA 1SHTX 3SF8A 4I8DA 2ID8A 3KAJA 1FVFA 2EV9A 2FK7A 1KSJA 3NV7A 2KW5A 1N6LA 1VL5A 3AR9A 2Q5HA 3MN1A 3PDIB 3ROMA 1VPEA 4IINA 4XJXA 2NGRA 4IDAA 4JITA 5TQVA 3R7FA 4ZCRA 4JOSA 1YS1X 4TLMB 1MA3A 3MEQA 3EFOB 4M83A 4NU5A 4W7IA 4KLNA 2C42A 2VNJA 3G0OA 4PZ9A 5KNDH 4HP8A 2OD2A 1IZ8A 2DSNA 2FN4A 3IOBA 4ZCPA 5KEIA 5LOVA 1OBFO 4CKYA 2NTEA 4JVSB 4O4JA 3MF1A 4JLJA 5J2TF 4FW8A 3PFGA 4Y1RA 4ICIA 3UKOA 2O59A 4ADSG 1I13A 4ZK6A 3WB0A 4TMTA 1UC5B 4KK4A 3QELB 3SDBA 1SIWA 2IDJA 1XAJA 2OHFA 2NZVG 3P96A 1POWA 4HLDA 4RHUA 3HKEA 3KXIA 4RE6A 3ITNA 3WIOA 4Z3OA 3HRKA 4DLUA 5DF1A 1XZMA 1OUMA 4DMCA 3OM1A 4KWTA 2PZBA 2WTXA 4TUYF 121PA 1I80A 1WHSB 2CK3A 3C15C 3LJKA 3M49A 3NTOA 5BMVB 4TZ6A 5I7VA 1FMJA 4ZAXA 1CQIA 1E5DA 2ETVA 1JHAA 3GJ0A 4HAXA 3W1EA 5JARA 4B3XA 2BCEA 2CMGA 3WIEA 2CKDA 2G5GX 3IQXA 3Q3JB 3V8RA 1J21A 3WADA 1ISSA 4C5BA 4HN2A 1HFKA 3ZWVA 2FEXA 1QHIA 1EFCA 1ORWA 3A1FA 1ZCJA 2DJIA 5H83A 4B46A 3TJMA 2YYAA 1T35A 5DTRA 2EJVA 4KSYA 2XLCA 3HGQA 3LDUA 4FGZA 1QDUA 5HR5A 3QVTA 5KBYA 5BNFA 3GEPA 4N0PA 2B37A 2W2XA 2ZSBA 1EYZA 4LSGA 3JYNA 4RZIA 4CM4A 4RF2A 2ZM5A 2G1PA 1REQB 1T0PA 3IT1A 1Q5PA 1U1CA 5JMTA 1G5RA 2HY7A 3ESYA 2X0IA 3N8NA 3WX0A 5EVJA 1KORA 5IT9A 1IOLA 1U8YA 1P9WA 4DQLA 4YFVA 4Q1EA 1GNPA 2ZU0C 3R5SA 1F8UA 5DN9A 1V8BA 4DGSA 3NFYA 5E0KB 2VBFA 2WWGA 1FP1D 4IKPA 3MPUA 3BE6A 3KKPA 3OQHA 3P0IA 5DJ5A 5IW8A 2FKAA 1Q92A 4GZ3A 1BQ4A 2GBGA 3KBBA 3L04A 3JWEA 4IXWA 1N7IA 1M7HA 4IHJF 4KU4A 4GPD1 1URPA 2ZGVA 4UD6A 4ETMA 1JHRA 1GITA 2HV9A 1Z88A 4A27A 3RK4A 2XTJA 1WDTA 3SNKA 2I76A 1R4MB 1KAQA 3GDFA 3FIUA 1CUCA 1K6XA 2O8VA 1FP4B 2D5AA 5SYNA 3AR2A 2Q4EA 1E3DA 2QRMA 1CY8A 2FQQA 2ZTLA 4LVJA 3KHSA 4LC1A 4NMMA 3CNQS 4XX1A 1FCJA 3SQOA 4I2VA 2DQ3A 3ZQ6A 4DVGA 4EB3A 2WF8A 4INJA 1LW6E 3GHHA 3V1NA 1TZKA 2ZITA 2VN8A 3INNA 1E2GA 5LP6F 1XDSA 3T35A 5CYPA 1LYLA 1Y89A 3QI7A 3G68A 3DONA 1KYQA 3HR8A 1IRXA 2YHBA 2YOHA 3OA2A 2Q7OE 2CNKA 5IVHA 1PR9A 4KTVE 3W8EA 2OECA 5KX5F 2G67A 2QTVB 2IYTA 1PVVA 3A11A 3DWGA 4OXXA 4XDHA 2X2EA 4N39A 2ZBQA 4LYYA 3AINA 2IXEA 4Q6WA 3Q6NA 5BN1A 3T7RA 1ES9A 1NATA 3SXUA 3N2GA 2CUZA 3MT9A 4XQ9A 2CXNA 3HE3A 4ZTBA 3SC4A 3UHFA 3R4CA 4RJ2A 4RK7A 2QP9X 1GPMA 4PZLA 4XDZA 3TZLA 4EUFA 3LTNC 4MA0A 1W34A 3QRWA 5BW5A 5LJLA 3C5HA 2EWNA 3OUUA 3GFFA 1PFGA 2WAYA 2WW8A 2CVHA 3KJFA 1Y8RA 5HGXA 2QLMA 1Y7HA 4OAQA 2Q07A 2D2IA 2ZOSA 1GKYA 2GZDA 4OMFG 1UBEA 1RRCA 1AF7A 3SBOA 1P17A 4D3SA 4DZRA 2I78A 2VAXA 5EGSA 1M7GA 1D6SA 4LUCA 2PS0A 3ULKA 1ICIA 1T6XA 2QYSA 3IBTA 5BN5A 2O5RA 5JYEA 4AQ7A 4WD3A 1M75A 2LKCA 2X0DA 2QRVB 3FY4A 4PGFA 5AXBA 5TQ2B 4CMJA 4RBNA 3I0NA 4CEJB 3ELYA 4DG9A 3MUFA 4FHZA 1U2RA 4Y67A 5C5CA 5CITA 4ABYA 4E15A 1NIPA 1QCZA 5C4GB 3U44B 2D2EA 4KIGA 4Y2PA 4E5YA 1OLSB 2QPLA 3GFVA 3MWEB 2ZTGA 2Q28A 1NBWB 4WE3A 2PG3A 4OHKA 2Z8YM 3CUUA 1TECE 2BAGA 4U8HA 4C4OA 4DZZA 1GSHA 1QGDA 1XYYA 2WPDD 3B1KA 4H6PA 1N6PA 4Q47A 1TK3A 2BGUA 1CUAA 1UXOA 4RABA 1NKVA 4F21A 4Y1FA 2QMUA 1NL3A 1TU0A 2YWJA 1G7SA 3NMUF 1EE1A 4BB6A 1OWOA 3PEYA 2AYYA 2WTNA 3W2EA 1VB5A 3TL2A 4BHTA 4NV3A 2CNBA 4Y3UA 1ZCBA 4X7PA 1BYIA 1CNMA 1W94A 1B26A 4JBNA 4R40A 4AD8A 2ZWVA 4XLTA 2EJFA 1RWPA 3L84A 1G55A 4GL2A 2HU2A 2P41A 3SR4A 5K6AA 1R6BX 3ETCA 4TGLA 1GFSA 4FCCA 3GMTA 4A8JB 3ZBTA 2VK2A 1L3BA 1SC1A 4HVLA 4G8BA 1JNYA 1FTQA 1B1AA 1H6BA 1X38A 3MJ4A 1Z16A 2CDAA 1GPBA 1M5TA 2R6CA 5AI9A 4C76A 1Z7YA 4IDFA 3WK4A 3KQUA 1V8FA 3KVOA 3K1YA 3O0DA 4KBFA 4QYIB 1Q57A 3CNNA 3RSQA 5TDHA 1IM2A 5DGCA 3SS7X 3BJMA 4CDRA 3L07A 4YMHA 4IO0A 4JY7A 4CL2A 4H1UA 1RWWA 5ELXA 5EXSA 1PYSB 1EDBA 3IAAA 1USYC 3FTNA 1WXWA 1JDUA 4QHYA 3U6BA 3BOSA 3I0MA 2CHQA 2VAVA 2VVTA 2IU0A 4IQ8A 3K2IA 4QWMA 3FSGA 4KBGA 1PDVA 1V1JA 5E7IA 3U3KA 1US8A 3ABQB 2P9CA 1AKRA 2Q21A 2WINI 3AP2A 3LUKA 4UNNA 1JB1A 3EZNA 2Y1EA 3VSEA 2FG5A 4BKMA 4BNKA 4ENRA 1LPMA 5AVQA 3HXQA 1T2UA 3STVA 3TLZA 4Z99A 1G18A 4BN4A 3ZR4B 2VT2A 3PP8A 3S1AB 5EJGA 3JQBC 3QLJA 3PXBA 4ZXFA 1UJ4A 4GX2A 3KYCB 4Q7LA 4EGQA 2RE8A 1E3LA 1UPXA 4EJ0A 5AKLA 1JHZA 1V3UA 3B7WA 2C99A 5JVDF 1LD3A 1FLDA 3CY6A 3LVBA 2ENUA 1C7FA 2YRWA 1H6DA 4X5OA 2OHIA 3PJEA 4B3JA 1QVZA 4DQVA 1Q7EA 3PC6A 4R1NA 5AKJA 1NYQA 1HWYA 1U04A 3K20A 2P4QA 3PQEA 2A8YA 4HWGA 4WMLA 2XCLA 1T91A 4HGQA 1J42A 3GW8A 1P1IA 3D6FA 2Z5VA 4FFMA 4EIWA 5TF4A 4X8HA 2CGHA 1VDMA 2PL5A 3FM9A 1QHFA 4P2BA 3ZDXB 5GOZA 5EG5A 1Z0AA 3ZU5A 4AG6A 3OAAD 2V59A 4NECA 5JROA 1J70A 1T8RA 4J0KA 3V00A 4RCYA 2NO6A 5CIQA 3SN6A 4D3XA 4BWAA 4NK5A 3UENA 5KYWB 4BMSA 3GRAA 3MBOA 4Q3NA 2ZPAA 4IHKA 3T3EA 4BVHA 5F33A 2HK6A 4RKQA 1WVMA 1F5SA 3KT8A 2I2FA 5KMGB 2BMWA 2HD4A 2IT1A 3A8TA 5TQJA 5C8YF 4F92B 1C3EA 5DSTA 1LLQA 2OV4A 2D1YA 3DXZA 2WWVD 3HMKA 3NOXA 4PQGA 8ADHA 2BFFB 3OTQA 1FDIA 2JI4A 3M6LA 2BBSA 2WM3A 3DA8A 4IFEA 4Q48A 1A1VA 1RACA 1ZJYA 1T2CA 4MCHA 5B3AA 2UZAA 1IEWA 2QVBA 1F0NA 1K8RA 4G5QA 3DAOA 1W59A 5H4HA 5GOTA 1I7NA 1LV8A 1Z73A 1Y3DE 4HQKA 2VEDA 2BTQB 2WIAA 3MB8A 1KI6B 1YU6A 3T1NA 3FD8A 4S2UA 4RORA 2ONZA 3VZBA 3OE1A 3Q7PA 4FYHA 4J1QA 4P6VF 1UBTS 2E5WA 4KOEC 3RS0A 1RCUA 1J5XA 2F90A 4DV0B 2FWMX 1WMDA 3KWJA 1TCAA 1RT9A 2WKRA 3DKPA 4XM0A 2HSDA 4FR2A 5BT9A 3PQFA 4LBVA 2YJGA 3OCCA 2C9DA 2QT0A 3MWJA 4U2BA 1JZQA 2RI0A 4HLCA 2FPIB 2HMVA 3TPZA 4B47A 4DUGD 3LCJA 4NPAA 1H2HA 1Z0ZA 4FR0A 3UJNA 2AE2A 2YFYA 1VKRA 4DG8A 3L3BA 1W46A 5EIBD 1OIXA 1HQCA 3NDBB 4D97A 1QE0A 3T9CA 3RLIA 1P61B 2ZRCA 1ESEA 1DJQA 1KAMA 3K1JA 1ZU4A 3IMKA 4G1MB 3OAAA 4O2AB 3T7AA 2VJYA 1V8ZA 6PFKA 1B14A 3UK2A 3ORYA 3S81A 1V1RA 3RYHB 1WCV1 4OGGA 1E61A 5K4HA 3D4IA 1YR3A 3F4KA 4BCDA 3HFVA 4ID9A 1RP7A 3WLMA 2OPBA 3WV5A 3G2PA 4GI7A 2ZI9A 2G1AA 4LGCA 5B7GA 4G1BA 2VQDA 4BX2A 3BSFA 2FK8A 4FYIA 3BWXA 4J16C 4CM9A 3SJCA 4QREA 4BO3A 4Z49A 4F93B 5A04A 3U16A 3C3AA 4XLLA 4FK8A 4B6PA 1J8VA 1G8MA 1UJ6A 3O75A 4PG3A 1Y82A 3QKWA 5DEIA 4F3KA 5C7OO 8ABPA 1P5JA 4MMZB 3ENNA 1YQDA 5E9QA 2P9FA 3D5QA 3GZNA 2J9GA 3LGSA 3S7TA 1XVVA 3HYTA 3VYWA 1N9GB 2CMFA 3DL0A 2WHPB 3NP7A 4BLOA 1TIPA 4DKXA 1DEKA 1S7CA 1YL5A 2IRWA 3BH6A 4I1UA 3JD3A 2P91A 3G5UA 4UUOA 1DG3A 1T8TA 4DC9A 4NXMB 2XCOA 1R2QA 2P40A 3TTWA 3SYRA 1GAXA 1L6IA 3ISTA 3JRXA 4WFKA 4RH1A 4IICA 3ZWXA 4DFDA 5ISMA 2VPQA 5JISA 2C54A 3DT8A 3KKKA 3AVQA 2ANBA 3ET4A 3TKLA 4Q9IA 1CJKC 3LCRA 1NR1A 3TN7A 4BWYA 5J58A 4IOKA 2L17A 5MFPA 1K88A 1MRNA 2GMWA 3INGA 1ZR4A 1YZYA 4CEHA 4URWR 2AMVA 2DXIA 1V41E 2NVWA 1VP3A 1FFAA 1SU7A 1B8UA 3OZ7A 3QYAA 1SK9A 4DUGA 4DMFA 1ZJWA 2RBEA 3HRIA 1GG5A 2YHUA 5FXMA 2YV4A 5B1SA 3H87A 3R5JA 3KPUA 2GUGA 2WWXA 5I5GA 3KV3O 3F0TA 4B32A 2O07A 4IMJB 5ALKA 2E5LB 3IO3A 3BJEA 2A5DA 4HDKB 2EBFX 5L40A 1E6EA 3RGWS 5IANA 1WSAA 3C3PA 4LOLA 2EKPA 3HWSA 4TTJA 3TTYA 4C04A 3E5MA 3ZG6A 2HQ1A 4LDQA 4PC1A 2A86A 1FYWA 5AK5A 4CF6A 3UV6A 1PZMA 2ZULA 4Z0PA 2ATCA 5JPCA 1SCNE 3BMQB 3DQPA 2OCGA 1HK7A 1T3GA 3T1YB 1BMDA 1TUBA 2ZIZA 3TQTA 3T5PA 4P4SB 4NZZA 1DE0A 4UHBA 1JHYA 1GJRA 5BW4A 5IHPA 2P2SA 1BJRE 3T9DA 4ARIA 1B2RA 3OTOB 4LF5B 1NQOA 1FSGA 3FWHA 2DG2A 4KI0A 1MZPA 2WTAA 3OG9A 3MEYA 4Z4IA 1VYVA 4GE3A 2X42A 2OHJA 2X4DA 5AOCA 3S7ZA 3WIBA 4M0MA 3QVWA 5JECA 1G8KA 1NULA 2H2FA 3JYHA 3ANSA 1GUDA 3N2YA 4UZSA 3DW3X 2X1VA 3O7MA 2AG0A 4G01B 1DLIA 2BI7A 2D06A 2CLFB 3L4BA 1ZG3A 2H3HA 2BMEA 3UMSA 1J9EA 5FLKA 4X71A 1FBTA 4GC9A 4DANA 2I4RA 3KTDA 2QE6A 3QNWA 2P9ZA 3WFJA 2REBA 1AMNA 1HPLA 1RHRA 1UBRS 3DMPA 3JQAB 3K7EA 4GKVA 1AQUA 1E5LA 5JWOA 3TZEA 4OG2A 1QWSA 2AW3A 1UJBA 4CF5A 4J29A 4WINA 1KPHA 1JLLA 1WABA 1P5RA 4GMGA 1KIFA 4R6WA 3HP1A 4RS4A 3U81A 3HGTA 4JU9A 5H4GA 5I7UA 1VHDA 3I9FA 2Z3ZA 1N7HA 3LMKA 5IKPA 5A4MS 2CMDA 3ZLBA 1T26A 3HC7A 3JATA 3KYBA 1H8EA 1JTFA 4RVCA 1GWNA 1DO2A 2FG6C 2IBMA 4WESB 5JZVA 1J22A 5AM0A 2WMDA 4BPBA 1KMHB 3FZEA 1O3YA 1G6KA 1W4AA 2BUAA 1VM6A 2XADA 5HCIA 3E4DA 4UPDA 5LFAA 2Z0MA 4M8NE 4R6XA 1Z0IA 3CUEF 2BN4A 3GGDA 5CJ2A 1BSVA 3RFFA 2P3QA 1D2GA 2QJWA 3EGVA 4H7EA 4OQEA 5AD1A 2J7PD 3VYVA 1RTKA 5E6UB 4K9SA 2ODEA 3RWMB 5IF3A 1WX1A 1Z8FA 3QFHA 5LSAA 2QTAA 4WKPA 4CGYA 2WC1A 4G0WA 2R6ZA 2GK6A 4PZ0A 2RHWA 4XW2A 3BH0A 4XIFA 5EESA 1K3UB 2Z6AA 5JTUA 3A32A 4RVDA 2H1LA 4GWKA 1NRIA 2IYPA 3IEIA 3O90A 3UWOA 4KITB 5BURA 1FW6A 4CMIA 3UMFA 5GZ6A 3R40A 4OOFA 1OXKB 2CJXA 2HX1A 3Q87B 1DWOA 1E2NA 3MF4A 4B75A 2LTAA 4H0FA 4FONA 2Z8XA 5TJ9A 4GZLA 5EZQA 1FQKA 3PWZA 4AYTA 4X7BA 5IT5A 4EEZA 2NP6A 1AMOA 4BXOA 2PGXA 1PR4A 1RD4A 2FFBA 4D8TA 1G5IA 2WTUA 3INRA 2YVLA 2J7KA 2VP0A 3S44A 3OOHA 1WXGA 3AI3A 5JJ5A 3TFQA 5ARDA 1TRHA 1XXHB 3HZHA 3TS1A 5JC1A 5JFTA 4CMKA 4GD3Q 3RKUA 4OJMX 4PAWA 3BZUA 2H17A 1BDBA 3LY9A 3R6GA 2A33A 2XGGA 2ZIWB 4WZAB 2BFWA 3IPRA 3UWMA 2QD5A 4BZZA 4ZYZA 3FBGA 2CNLA 2H16A 3IBYA 1QH1A 3LU1A 3IB6A 3NIBA 3VU9B 2SCUB 4PIVA 3D7NA 1B76A 2I8CA 1LK5A 3GD5A 3LCUA 4OSEA 1W2HA 2Z1NA 4AN0A 4CUJA 5EJ6A 1QPZA 5BSTA 3ESAA 2B6HA 1DHTA 5A71A 2QZ9A 3EQZA 1ZSNA 4XTYA 1YZNA 3IILA 4I4NA 4J0CA 3QBJA 1R64A 9ATCA 1X7DA 1YR9A 4BPRA 1Y63A 2R8EA 4M54A 5FP0A 4Q93A 4X3OA 3L6EA 1VE3A 3I6MA 2JEOA 4NCNA 4U7DA 1X14A 4N6NA 2HA3A 3HJCA 3IP3A 3NGMA 2V3WA 3AESA 4ZGGA 5JYDA 2F8SA 1OV4A 1UT8A 2R7NA 1E1NA 2Q46A 3AYXB 2EZTA 3EOAI 2CKMA 3GP3A 2IIPA 2ZS7A 3KX2A 4UVIA 5FJJA 1JBQA 4DRYA 3AJ8A 4QM6A 2OCAA 2R1ZA 2B0CA 2G83A 1YXMA 2Q0XA 3E81A 1VIYA 3P1JA 4N5DA 2GHRA 1TZJA 2YDXA 4M22A 2JCGA 1IMJA 3AFMA 2DP4E 4HR7A 5KPDA 2Z08A 1W9HA 5LMZA 1HTWA 1U0LA 1KTIA 3TTSA 2JJQA 5ERGB 3PD1A 3L41A 3ONFA 3IMGA 1BE6A 1PWHA 3AFOA 1S8NA 4M9SA 3PG5A 5AJZA 4ZOCA 1DAMA 1ECFA 5KNBA 3B2EA 4JQOA 4LRWA 5CUQA 2K2QB 3TK1A 5B3JC 4PS0A 5HSGA 2OAP1 1IEXA 4Q15A 1F4VA 1PP4A 1SXGA 3MS7A 1U2GA 3GMDA 1IBRA 1A69A 1F2UB 2V74B 2W7TA 1B1CA 3H8VA 4B3TB 4R9UC 1X70A 1OXVA 4CV1A 1BHSA 1ZJZA 1HETA 2ZE7A 5ESXA 2O6HA 5FQOA 3CWCA 1XJ0A 2NSDA 1JIXA 1I36A 1XVTA 1LS1A 1YZVA 3H2IA 5G2OA 5NULA 3DAPA 3CPJB 1M2VA 1PT9A 1IPHA 2FUG6 4LDZA 1AB6A 1VL1A 5IBCA 5MN4A 1Z35A 4H2SA 1OZAA 3PSAA 5L3SB 2AXNA 4CLRA 3QEAZ 5JBIA 1DARA 1CSEE 2X3YA 1Z0KA 3DBIA 3L2OB 3U9SA 4DBLE 1I2ZA 4XU3A 3N58A 5EQFA 2AI3A 3I5XA 3B78A 1Q0HA 1LJUA 1UEIA 4REQB 1N0HA 3LS2A 3OPMA 5DCUA 3OO0A 5KUTA 2V7EA 5AHOA 2BFMA 4RQTA 2YWXA 2CLKB 1UANA 1VJGA 4X91A 3SC3A 3PNBA 5CBKA 2R8BA 3NDIA 1RJWA 1C3OA 1GUZA 3LT2A 3CIOA 4HAIA 2R1TA 2QT9A 1JJAA 1N57A 4N0QA 3K9NA 4WFIA 1DT5A 1HFWA 3ECCA 3EZYA 1CV2A 1VCOA 4W9NA 4WKNA 1ZISA 2M98A 1MC8A 3VUEA 2BFBB 2DCMA 4OEHA 3QF7A 1OA1A 1JLKA 2R96A 4JOCA 3OICA 5K0LA 2OV2A 3WO1A 3IG2A 1RW4A 3HJHA 2C7GA 4GVLA 4QYXA 1K3FA 4DS3A 1TGYA 4LRYA 2RCYA 4N6OA 3DSQA 2ODNA 5A3QA 2EGGA 1ZI9A 1TVMA 1R0SA 3JD0A 3BGSA 2AMCA 2PGNA 1DBQA 4IZ6A 4Q1BA 4S0ZA 3ED5A 4FSXA 4TL8A 3A2KA 4D8XA 4TYWA 5H59A 4UTXA 3GP8A 3OF2A 1E2QA 3IHLA 2FEWB 2WEKA 2FEMA 3MWDB 3O1JC 2PVCA 3VAZA 4BKPA 1OAOA 4KH0A 1C0IA 1N2CA 3OE4A 4E03A 4LNAA 4MS3B 1T0HB 3B48A 4IY1A 2A8EA 4L5AA 3RJTA 2ROQA 3AZQA 2DH5A 1E69A 1ONOA 1TQ6A 4K9RA 5DZSA 5FT9A 1T2EA 1ENZA 2Q29A 3VR6D 3DV0B 4CKWA 1N6NA 5HRUA 3HFJA 1JG1A 3F6SA 1CRLA 1W36C 1XVUA 3L40A 3NAQA 1LDYA 3HXOA 2P6MA 3CX8A 2Y67A 3FOCA 2JARA 3A1TA 5EL0A 1JKMA 4A92A 2QSZA 1L4LA 4ND7A 3HXXA 1TJ4A 3LL4A 1FTNA 1I1NA 4CJXA 2BEUA 3RODA 1AZWA 3C5CA 3HLKA 4DHWA 3U7HB 1HF3A 3B1FA 2VYCA 1YQGA 4B17A 4ROTA 4AZ0A 1MQ9A 1CD5A 2J1LA 3LPDA 3JVIA 4KOAA 2C4KA 4F7WA 5BVGB 5FNZA 5TV2A 4YLYA 2CL7X 1YFRA 1GV1A 1MJHA 1X1RA 2G36A 1D0SA 1NXTA 3E23A 4F3CA 2JGAA 4RIIA 2LCQA 2EOAA 5LKAA 4RLQA 2RDMA 2OY0A 3QNMA 1RS0A 4RZHA 4Z3DA 3DKRA 4HAYA 3NUQA 3TECE 4WADA 3IO5A 5IKMA 3G49A 6CHYA 3NP9A 4UM5A 5GONA 4PPFA 4IS3A 1V16B 1A76A 3IH5A 1HFEL 2RGGA 1BX3A 2AN1A 3GFOA 2JG3A 1AKQA 1C1XA 1G2OA 2P67A 3STHA 1HT3A 1X74A 3W3ZB 1KC1A 2QUBA 3M6VA 3W2TA 1JPJA 2ZUWA 1I6KA 3OCVA 1DAIA 2N42A 3VH4A 4BO5A 4DA0A 1RHMA 3U5ZB 4LDJA 5IJ0A 1GSIA 3P2OA 3A70A 1L7AA 3FN4A 1IC6A 2RSLA 2VT7A 1MO4A 4NENA 3ZY5A 1OLUB 3T7TA 4HDRB 2CJYA 1OWNA 3RYCB 4TLDA 1NF3A 2Z2YA 4RA9B 1KI3A 2ID4A 2WF6A 3QUCA 4GGMX 1DJMA 5UKDA 3C7AA 2YMMA 4N7RA 5EWJB 3MHTA 2CLSA 4B8ZA 3W9SA 1Z4QA 2OZVA 3CUWA 4E6EA 1Y4ZA 3GXBA 2VTEA 5KQLA 4RTPA 2QLLA 4ZK2A 4PBSA 2AC7A 3VR6A 1RPNA 1BS9A 3RRJA 1MX3A 2DLNA 1NF2A 5CDFA 2PGOA 5EQDA 2PS1A 4FQ5A 1E6WA 1X1QA 2AG1A 3BN3A 4ZARA 5CA1F 1VPVA 2IXGA 1R4ZA 3F6RA 4ESOA 1NBIA 3AO0B 3G8CA 2JAPA 1WCWA 2JFXA 3C6ZA 3SGLA 2X58A 3N0TA 3TZ6A 1NW8A 1NVBA 3PVCA 3L77A 2QY6A 3BBLA 2ZR3A 4NMXB 1PIWA 5F7OA 4FDMA 2EG5A 2O2SA 2PYIA 4QYMA 1RJFA 5IHXA 3OU6A 1QRRA 2VXOA 4BEVA 2RD2A 1DOHA 2CN1A 3B1JA 1DMSA 4QJIA 2NU6B 4FI3F 1FUUA 2QP3A 1U3TA 1KJYA 2PTHA 3F6BX 3LC7O 4M9UA 1NVWQ 4ZCMA 2NQ8A 2FPKA 5BQXA 3HU1A 1XCBA 4J7AA 3KUCA 4REOA 4TROA 3WK7A 3EJ6A 3RJ5A 1QJ4A 1P73A 3PQ8A 1O03A 3C3CA 4EA9A 5CR9A 4AMGA 3G1WA 5JZ9A 3KKNA 1V5WA 2O2DA 1RM0A 3LCCA 3R7LA 3JSAA 1GR0A 2IJGX 3OMLA 3A4NA 3A6FA 7GPBA 5JR3A 1V7QA 2IQ5A 1Y6ZA 1Y3CE 4QQ8A 3OBBA 4EW6A 1PTJA 4FQ8A 5HGQA 1H0KA 4PO9A 1PS9A 2XMRA 5SZJA 1I3NA 5PNTA 4HWTA 1IWBB 3B53X 3F46A 2JCSA 3CRW1 3G89A 4DHEA 1WUJS 4RTNA 3UAYA 4D5EA 3B36A 5B1IA 2GBLA 3S2FA 1JG6A 2O5VA 4YJ3B 2O8CA 3S5JA 3ND6A 1ZMBA 4MV8A 5KYTA 4BOYA 1MFZA 4M0KA 1K8QA 3PK0A 4XDYA 1NN3A 3EPRA 1CB0A 3CEAA 4WUTA 1H3FA 1T4CB 3QY0A 4V0ME 4XX0B 4JENA 4LJ6A 3HJAA 4CCWA 2QR2A 2PSEA 3CLTD 1VHJA 1J9GA 5EWLA 3DBRA 3HY4A 3LH5A 2DUMA 1SB9A 3HNPA 1DXQA 3WL5A 3SE7A 4I9NA 1TM5E 3D8BA 1KI2A 2TYSB 1Q1ZA 4ZT6A 2Z5GA 3H5RA 2I91A 1KQFA 1WDMA 4V1CI 3MUEA 2B5WA 3FSEA 3EZ9A 1EVYA 4ZVUA 2VRCD 4ACBA 4MRMA 1Q6ZA 3F97A 2ZS9A 2I8LA 3K9HA 2BFDA 1ZA2A 3FIJA 4DCUA 3VZSA 4PLVA 1MW9X 3AR3A 3LC2O 1OYYA 4M9ZA 4P4GA 2RHGB 1EVZA 1JIIA 4WJKB 5AW5A 4MB0A 3AC0A 3RYIB 4BMNA 1GVHA 4R16A 3ZV3A 3FPGA 3KOOA 1NVGA 3B3AA 3F67A 3IIJA 3PNVA 4RM3A 3GELA 2R8RA 3DNPA 1CDEA 2QSYA 4BKUA 1QX4A 3DDOA 3UO8B 3JZMA 3DPUA 4NJMB 3T1QA 3DEIA 4B7UA 4JI6B 1YWGO 3LG2A 1TZ2A 5JTTA 1JS1X 2ACVA 3IQWA 3FRIA 3EF0A 3VR5D 3BK7A 2XT6A 1SHUX 3HKBA 2Q41A 1Y4DE 2Y1DA 3D5TA 2R5WA 1CLEA 4OV6B 4PGAA 1ZUWA 4UBKA 1BHJA 1B8VA 1S7GA 2DXTA 3H2HA 1QHSA 2FUCA 2GERA 2OD7A 4H2WA 4Y2JA 5ALRA 1GPLA 3ZTWA 1EAYA 5JOQA 3S8EA 4IEEA 4D45A 3ENVA 5C3MA 4OP2A 2JI8A 4NU0A 1JQKA 2VQFB 1H2EA 1I4OA 2H3EA 4JX8A 4Q37A 1XZ8A 4ON9A 4BBJA 4OOEA 1UJMA 3BRCA 1F4LA 2PLAA 3VO8A 1NUUA 4YP9A 1BNCA 4TXMA 4CV3A 1PJBA 1P5HA 1CK4A 1JKFA 4C5CA 4DN6A 3JAKB 1SUPA 3OLXA 1X15A 5EYPB 3A2MA 1QIFA 1DUVG 2NPFA 4ZGWA 1NY6A 3DWEX 4A03A 4AMZA 2YXNA 5FORA 4BBZA 2I9PA 1JALA 5KSYA 2X9NA 1E3WB 1NI4B 1P2TA 1R6XA 4E13A 3LYUA 1TVKA 4OQZA 4PICA 3A4IA 1TKBA 4JLUA 3UQZA 1R6UA 2IZOA 5EUMA 1GDDA 1MH1A 1ZO8A 2Z4RA 2F9LA 2PVSA 1AT1A 2GN6A 4DSAA 2VYND 2HA6A 3CISA 2RAFA 3I6YA 3KU4A 3EUEA 3P9ZA 3TNLA 4P9NA 3HCEA 4Q05A 1XP5A 2QUZA 4DA8A 4E4TA 2GPTA 2MINB 4U2EA 1A8HA 1JHXA 2R8XA 4P74A 2D3TA 3ANYB 3A1EA 3FFWA 1XQ6A 4PCVA 3HCRA 9GPBA 3HBJA 1Z7NA 4PR3A 3HK2A 1AM4D 4MPTA 3JWGA 3TGLA 1Z7BA 3HM9A 1RHUA 4QDUA 2WMYA 1U1IA 1E8NA 1SM4A 3UXYA 4KR3A 4OHPA 2NO7A 4Z5XA 2HRCA 2SBTA 2VHYA 2CLIB 3KXKA 3QFFA 4K1LA 1Z83A 3C6QA 3RJZA 3WLOA 1OTYA 3ZDDA 2CJWB 5CLLA 1EP1B 3O8BA 5ITVA 3Q15C 4JVMA 4E4YA 3WAGA 3PXDA 2CW5A 2XUAA 3UGKA 1TUIA 4IUCS 3NKFA 4QUDA 5K6AC 2DDZA 2Q7EA 3FE2A 3OEHD 5CU7A 1FXUA 4IFTA 3V7YA 2QWXA 4DARA 4H17A 3DZCA 1FB5A 1PZEA 2EATA 2OAEA 2A6PA 2C9CA 1TI7A 2ZBEA 2BI8A 1Q95A 2QTBA 3AIOA 1UXGA 3O03A 4TXHA 2CF6A 3SZ3A 4X7RA 1YA4A 1THMA 1GAJA 2FW8A 3GWZA 4WF2A 5DX8A 3NNNA 2G0NA 4Z86A 3G5MA 3EEQA 1QAMA 4ZZ1A 2E21A 2NNLD 4LQLA 5B3LA 4ZI7B 1TZBA 1YC2A 3MTIA 2XYPA 2Z3WA 3ERRA 2XVXA 4LXQA 4V0RA 4HV4A 2V7WA 3RVDA 2D1SA 1YGPA 1PQUA 3LFHA 4OAOA 3KKZA 1Y81A 3TINA 4F8YA 4X9XA 4UNPA 3W1VA 4F2GA 1A5ZA 3RS2A 3BE4A 4POAA 2VYNA 4XYEA 4DZTA 3SZMA 4C05A 5HIKA 1XD2B 3U2QA 2W9XA 2F1RA 1A71A 3SJZA 1M6WA 1PUIA 4CQMB 3MJHA 5H9WA 4AWBA 2Y27A 4LRTB 3OLZA 3KT0A 1JEYA 1TQHA 5U4XA 2ZZNA 3RWOA 3BMOA 2GJ8A 2HRRA 1EIYA 2UXDB 1R00A 3BWMA 4WY2A 2D59A 2O9JA 3RYFB 4RMNA 2H92A 4JJZA 3JSXA 2HIGA 1YE5A 1UZUA 2AEMA 3L6CA 1KP9A 1Z8NA 4CF7A 3FWKA 1YBMA 3SVLA 1JFFA 4O4LF 5GGYA 2GCIA 3SJ7A 5EJ9A 4CG2A 1MG5A 1A5TA 3JYQA 3S2SA 3WYEA 3B5EA 3C74A 2XDWA 4POOA 1KI7A 1R5OA 5KCZA 2G9QA 4JJ7A 4FMDB 2KE5A 1SXIA 2ZSFA 4K6CA 5H7XA 5IAAA 5EZYA 1QYIA 3UB3A 4TPKA 2XOEA 3AIKA 4V2UA 1X3SA 3M9XA 3D4PA 3LAWA 2VRNA 3ZBUA 3SX2A 4XPIB 2CLEB 3KXDA 4EA8A 3O8QA 5L51A 1JGTA 4LS3A 2ISCA 1Q0RA 2C3MA 1KVQA 1WB5A 2ZWAA 2PRYA 2P1ZA 1NVVR 3AZOA 4Q24A 3TLEA 4TYYA 2HA4A 3KZVA 4HH0A 1MAUA 3GLVA 5HA5A 4FFBB 4DLNA 4GGPA 4N41A 4KNVA 3ESXA 1AQIA 4X90A 4DC1A 1Y9JA 1EM8A 3PHHA 3H1TA 4PAMA 1B6TA 1LSJA 3CPHA 1YB1A 2WU1A 4JR1A 4YRQA 1ZP6A 2XD9A 1M6EX 1W1WA 4LC0A 3DLAA 2I2XB 4LECA 4V03A 3GZ4A 4R2XA 5FTWA 1SKYE 3WNCA 1D4AA 1GTVA 4BB9A 2V45A 4BUJA 1J7KA 4AUKA 1VRWA 5FNVA 3RBAA 5GV8A 1N5MA 3OHPA 3SYLA 3WJAA 1V8DA 3FPLA 2DMRA 1EA5A 1DT3A 1PDOA 3O38A 2QHSA 5BRJA 2F3QA 4YDRA 2XUIA 2B98A 2E49A 3VVCA 2VK8A 4D9EA 2WJ4A 5JCOA 3GA5A 4W63A 2WA2A 2QRLA 3BFKA 4GE0A 3NDJA 4G41A 4F11A 4IGFA 1HY3A 4PQYA 4ZANA 4BTLA 1XRPA 4CDMA 1MT3A 1CDDA 3EG9A 4YUWA 2SICE 4FS8A 5EMNA 4BJ1A 1SPBS 1UL1X 4ESHA 2FR1A 4PLWA 2GYUA 2MSWA 1NG9A 1UJCA 2C94A 5CM2Z 3H84A 5DXFA 5F5LA 4L08A 2H4HA 4R1UA 4NDAA 2B25A 4RKEA 3T54A 1VBNA 1K7SN 5L6MB 2EJUA 3RS3A 4UM8B 4J7XA 2EHDA 1IN1A 1YDEA 3Q8LA 1N32B 5EJ5A 5J4VA 3GRPA 5I5EA 8MHTA 1R6AA 4IDPA 1LLFA 2O0LA 2IPXA 5D7BA 4G85A 4KQHA 2OFWA 3TIVA 1X54A 2ZZGA 1J24A 3N0WA 1K97A 4DXHA 3K70D 1EZ4A 3WMWA 4OLBA 2IHYA 4RVHA 4MLDA 3NBMA 5D8DA 2OCIA 1BH6A 1RPAA 2XJ4A 4ZHSA 3H2GA 3ADKA 2PGJA 1FEZA 1YASA 4A8TA 3JWIA 4JWKA 5HGJA 3BWVA 1ODFA 3FHOA 2VH1A 3RV3A 3TOZA 3PQ5A 1GKLA 1ZD2P 5A3RA 1JFLA 2G1UA 3USES 4HEA6 1AKTA 1SIOA 3NORA 4HTFB 4M0DA 4C89A 5COQA 1D2EA 5IARA 4ZEVA 3ED1A 4NYJR 4ZOLF 1UDAA 3EBPA 2I1LA 3SEZA 2ZJ0A 4CQLB 2O54A 4YN3A 3MT7A 1TU4A 3TQSA 3FX2A 3GUUA 4G26A 4M87A 4NONA 5TY0A 2H2IA 5I9TA 3ZHOA 4HPWA 3ZZTA 1MBZA 5LBTA 5CJPA 2RGCA 2GVDC 1TM2A 3ASYA 1JU3A 1EQRA 4BVLA 1J5EB 4BATA 1ZSVA 1YV9A 4DW8A 1TT5B 5JSQA 4G4GA 5GZ3A 5EINA 5JZSA 1FZQA 4I1YA 5CFMA 2L18A 3C4JA 4GG1A 5AUOB 5TEWA 1IVSA 2PH5A 4UU8A 3D6MA 1GG2A 1QM5A 4TL9A 3UC9A 5MDHA 1W581 4KQFA 2GFQA 3A1UA 3Q9LA 1KQGA 3HBNA 2AEFA 1XU9A 1GTL1 2UKDA 2XGSA 4ENTA 2AOUB 3BERA 1F7UA 1XJWA 5EI5A 2FDXA 2QPAA 4D9BA 3ADCA 5KYUA 3BGVA 2GCNA 1GZSA 2BFEB 5T41A 4C7VA 2XQIA 1TO6A 3A1SA 5EIBC 2D0OB 1FTWA 1J56A 1X80A 2JZOA 3LCMA 3TMAA 1I3LA 1SZPA 1I4EB 1E6UA 1VCMA 3LRTA 3OH8A 3P2EA 1QHGA 2FPGA 4RKYA 3RTDA 1J8DA 4CM8B 5KQSA 3I6ZA 4OIFA 5FRDA 1N3BA 3A37A 5F2OA 3GP5A 4XDGA 2NUTA 4XJVA 2JLUA 1XDUA 4JLBA 3VKHA 1RQNA 1A9OA 2G09A 3KQOA 4ZVSA 1NQVA 3SE0A 3T1OA 1BYUA 4LXGA 1E9BA 4INPA 5H80A 4IJMA 3SEFA 3QKTA 2HU8A 4WOPA 5LL6P 3T1HB 4W5NA 5LQCA 4C7OB 1RRMA 2KSQA 4RO0A 4RZXA 3OZAA 4MCIA 3WYDA 2BGGA 1PDWA 4FE4A 2B9EA 2RK6A 4YUZA 5ADVA 2RHSB 4JL6A 4I2NA 2YTZA 1ST3A 4ND1A 5LIRA 1JIUA 5KTYA 4HYEA 2ZZFA 1NVEA 5DHQA 5EXXA 1M0EA 1PR6A 4H2XA 2KBFA 1L5FA 1NMZA 2VPTA 1KDPA 4AVYA 4F4CA 2DFNA 2ZW9A 3DGEC 1FNMA 1L7MA 3AHIA 3Q1KA 4GEKA 3KZXA 1LVUA 1EDZA 1MOSA 4B71A 2J3HA 2A58A 3L6RA 2GBFA 1VLMA 1P75A 4RYDA 2VYVD 4OFBA 5ECWA 1IN4A 3K9CA 1VKOA 2AJCA 2VPZA 2IUUA 4IHQA 2AG8A 5HJEA 3L4BC 1PNTA 4RC9A 2VTKA 5ALEA 2VHVA 1T3LA 3L7OA 4I66A 3EX7C 4JUFA 1UINA 4ER0A 4X97A 4MVJG 3JQCA 4I4TF 3ZI7A 5LOVB 5LB2A 1TLLA 4U2DA 1PGOA 2O4UX 4MWSA 3A9SA 4O4JB 5BR4A 5JQGF 1FFWA 1H2RS 4P5DA 3H75A 1SRQA 1EUZA 3BJUA 1EFLA 2FWRA 1OX5A 3GHYA 4Y1RB 1SC3A 2V9CA 4JC8A 4B4DA 3QXSA 3ML1A 1YZUA 3ZKAA 1I2DA 1FJGB 2XOKA 4Y8VA 1W0CA 2ARSA 3HKEB 1LV7A 1E9CA 4TMYA 1XLTA 1ZESA 4BFVA 1QOQB 2XVAA 1EMDA 3HVKA 4XH9B 3K09A 4BTEA 5IFLA 1O5TA 2RGDA 1M6HA 5DYTA 3WQQA 3AY0A 1SVOA 1G4AE 1H1TA 1VL8A 4XJTA 2JIZD 2QPTA 2W98A 4MYHA 4PHCA 4B3GA 3UMVA 1CQIB 3K0FA 5E6SB 3IAM6 4RIHA 2ISSD 1YACA 2AK3A 1WDWB 2Z4SA 4FWIB 4YUVA 4B82A 4JK3A 2EF1A 5A2GA 1I94B 1SK8A 3U26A 1C7IA 1TZCA 2HEIA 4TM8A 2GJ4A 5EP2A 5AUNB 3AI1A 1N1EA 3CGWA 2O1SA 2ZIFA 3O0TA 1ZZGA 1BDJA 1XAIA 2Q5OA 2ZVQX 3I3OA 3ORHA 4G5RA 3C45A 1Q20A 4AKIA 3BD7A 4CM4B 2G6TA 3VSAA 1NVKA 1QSGA 4ZT7A 4WN9A 2D54A 4ZO9A 1F6BA 5G0WA 1QGZA 1Z3IX 3E84A 4QD3A 4UQLA 1WUTA 4AZSA 4PZYA 1J6UA 4ZC1A 1E3MA 3QTCA 1P4JA 1DC4A 1NVAA 1PT6A 1QYRA 3U4MA 4C4PA 2QQFA 2P0EA 4H31A 4FFSA 4L5YA 1PNVA 2JRLA 3ZIAA 4OGWA 3U7QA 1KNQA 4KRXA 4XWTA 4QXMA 1M8GA 4CT5A 2WFAA 3HTXA 2HQBA 1XKTA 3CX3A 2VSQA 2DE0X 3PGXA 5IG2A 4HT4A 3O1LA 1WNFA 4B84A 1H65A 4ILKA 3HDJA 4Z1MA 3MYRA 1Q0TA 2V7BA 3A4YA 4G86A 2AJTA 1W4CA 3I45A 2OV1A 1X8KA 3G7SA 5IRCD 1MMFB 1SBQA 5ILOA 1R4NA 2EW2A 3VPGA 5DHSA 5H3CA 3T9FA 2EJ9A 4HQ6A 1VIMA 4KXUA 2QVLA 2ZANA 3P26A 1FW8A 5F3RA 3OJOA 4E46A 1P0QA 3RHZA 4MQBA 2LIPA 2W2NA 5ICSA 3QV1A 1KH2A 1ZICA 2E85A 2QX7A 2ZJYA 3BGOS 3Q7SA 2XPCA 5AIAA 1ZD5A 3TNFA 4LYJA 1Y8QA 2GJ9A 2JIZA 2V6MA 4P38A 1H5NA 1RBYA 2Y2VA 4ZKEA 2WJZB 1A27A 3SEAA 1YMQA 1GG8A 3D3KA 2Z9DA 3RUHA 4DXAA 1Z4NA 3LUAA 2MOKA 4RETA 3BGWA 4LNUA 5FL3A 3MRSA 4O4HB 4DILA 4WLOA 1W4RA 4LZLA 8AT1A 1PNQA 1WB6A 2DZ9A 1C4OA 4EG1A 2BGTA 1K8ZB 3HTZA 3ECAA 3QQPA 3SXUB 2QHTA 2MYTA 2VUHB 3H13A 3LQYA 3N2GB 4RWEA 5HTOA 1XFAA 3KKLA 1AXRA 3N7AA 3IKLA 4HDSB 4Y2TA 3AF6A 1JA0A 1OH5A 4ZD6A 2C97A 4XB1A 4GEGA 4W8HA 4PO8A 3T5DA 1ZH0A 4LHSA 4GRAA 4PNPA 4PEVA 1B41A 2VF4X 3IUPA 1SUWA 1Y8RB 1VKHA 3NHSA 2JH9A 3DYIA 4EPWA 3BSSA 3OTHA 5L45A 3CCFA 2DERA 2PUJA 5HS6A 3VTFA 2IX3A 1RQ2A 3G8AA 4F1WA 1N36B 5PGMA 1I7LA 3BFXA 1BJTA 2JCVA 2WJVA 4KZKA 2IH5A 1YCDA 1E9AA 1SD5A 2GXSA 1YRYE 3CB4A 1N0IA 4QBTA 2GK4A 3HKDA 1G21E 4OHXA 5BN5B 3MWLA 4DIFA 3O9VA 1HL3A 4HVCA 1VBFA 2Q99A 4LPSA 2E6UX 4XZ3A 4B87A 5CFZA 5JAUA 1U2GC 1ECJA 2O20A 2QN3A 2XCQA 1I3KA 2XAAA 2NO5A 3RFXA 4F1KA 1K06A 1PK8A 3L0OA 3QBDA 12ASA 2J30A 3K2EA 4B45A 4QVIA 2P9HA 3QW2A 3AKEA 1X2HA 2SNIE 3NBUA 3SZOA 2Z5LA 1E9FA 1PFQA 4I6JA 1YVPA 5AJVB 3LY8A 1I32A 4RNCA 4OVKA 1KZ6A 3F74A 1X2GA 2D2FA 3HI6A 1RDFA 3KKEA 4IX9A 4NBTA 4NBRA 4CL8A 4CUZA 4CTMA 3KWFA 3SICE 3DM9B 3EVAA 2QOEA 2CFCA 3QNUA 5EMKA 3HA3A 5FA8A 1DEOA 5P8WA 3VPAA 4D6YA 5JC8A 3TFWA 5J2TA 1DFIA 4X84A 4BMYA 4DM4A 4KYTA 3FKSA 3FTFA 1WD7A 1LVHA 5FULA 1NBEA 2NX2A 2VWPA 3FYCA 2D4HA 1UT6A 3KV1A 2HYDA 4N6GA 4HWRA 3IAS1 3Q2KA 4MVJI 4U6QA 1LBTA 4AKEA 1ASYA 2I9KA 2DU8A 5DLDA 4BU0A 2IDKA 1A2QA 5BNTA 5LDHA 1ZLYA 2WWRA 1SBIA 1A4IA 2VIIA 1QTRA 3CXUA 5JT1A 4RX1A 4LWQA 3HYRA 1LFDB 2CLMB 3LXMA 2C7IA 1GKUB 4KXVA 2WQ6A 1DAOA 1RLOA 1CUUA 2JGLA 5DYIA 4GMXA 3IBFA 2VQ3A 2BVNA 2Y93A 4MQLA 1SHJA 1E6LA 5F77A 3UJ7A 4XVQA 4WZ6A 4QL3A 3HUUA 3SOPA 3A3PA 3VZPA 4BO1A 3ZDZB 4YHBA 2ZVJA 1E5QA 3OZIA 2OV3A 4PN3A 3HA2A 5ENZA 2AW5A 3JWPA 3GLKA 3DBVO 4MVJE 1OAOC 5J40A 1SB8A 1US8B 2J0SA 2CVQA 2XWSA 5HDBB 5DM60 1Z2CA 1FDVA 3R7BA 1ANKA 2B8EA 4DIMA 5A6VA 1P1KA 2WSMA 1MPTA 2G5PA 1QVRA 3CNOA 2Q5QA 4KXLA 1CU1A 1I6LA 4ZVPA 3ONVA 4EGCB 4FDAA 1NR7A 3F96A 2Y1WA 1OXXK 3DHNA 4NFHA 3NHAA 5D6NA 3QOXA 4LAFA 2E7ZA 5ALSA 5T57A 3IESA 3URKA 2I3GA 3NZEA 4IHJA 4HRAA 4DDWA 2VHEA 3LV8A 4WVLA 4NMWA 2AF3C 1S8AA 3HADA 1GUFA 2A92A 3O4IA 2QHXA 4ALNA 5IT4A 2IHNA 1KY4A 4A1FA 2VYQA 4S05A 2ZT7A 2O0MA 3IRVA 3HCPA 3OFSA 3ZDCA 2Z6VA 2C2KA 3PEWA 1Q0UA 2V7VA 3RYTC 4DUYB 2Y92A 4IQ0A 1Z0DA 3V4FA 3ZW8A 2ZUEA 5HZKA 5LP6A 4Y9DA 3T7KA 1KU0A 2D1FA 1TMKA 1F9AA 3WMRA 4A36A 2E4YA 1BA2A 4AJIA 3MVEA 3VR4D 5GM1A 1FSZA 3QEKA 3AM4A 3VOSA 5KX5A 1ZIXA 2C2XA 4MV6A 4DCMA 4FWTA 1P1RA 1THGA 3PF8A 4EFMA 2AOTA 3HBFA 4JVOA 2BJWA 3A7RA 3G85A 1UZLA 3OU2A 4MYUA 3UWPA 4LJ7A 2CVPA 3CKKA 4FLEA 3VQTA 4F60A 1F1JA 1U8TA 3GUYA 5AP9A 1Z68A 4QA9A 3LK6A 2FH5B 2XH8A 1N25A 1XN1A 1FDSA 1S2IA 2JVKA 3D6HA 3PC3A 2WAMA 3QE2A 2PUGA 3KB1A 3H1BA 5DHUA 1HE1C 9LDBA 2KI5A 1QH8A 4JROA 3CWZA 4DMGA 1YDGA 4NATA 2YBDA 1XRRA 1HYGA 1W96A 2OCBA 2ZIXA 2QL9A 3M5WA 4KGDA 5D84A 3OPYA 2KQUA 4RLHA 2WSIA 5AOBA 5K3FA 1TM3E 4B7AA 1IL2A 3L8EA 2DGDA 2I33A 4AMYA 2QTMA 1ZPDA 1UXIA 2HK8A 2HNBA 3B7GA 3KVNA 3SNHA 3WWPA 5BY2A 1KVSA 1R9JA 3IYLW 4YMLA 2TS1A 3A7DA 3WLAA 3KETA 2Y1GA 5CTAA 4L85A 1KEUA 1EB8A 4U39A 1W6UA 2VPYA 1KBOA 4F7DA 1BWPA 4DV7B 1G4UR 3EBLA 4QUKA 3LT5A 2B1GA 3OX4A 3I4CA 2FN7A 5F76A 3TB4A 3QLEA 3EQ7A 5TC4A 4QO7A 2O1XA 5EXTA 2DTIA 3X3HA 5LYJF 4QPCA 4L9AA 2VDWA 3NTVA 3ZWDA 1BKYA 3LXUX 3P27A 1JR2A 4TT3D 2I6FA 3IB3A 4XRRA 5CM9C 5AK6A 1XMPA 3L7CA 2FPOA 4B0OA 3MUNA 4GYWA 3BICA 5DASA 2XB9A 5GJVC 2C1ZA 2WUDA 2GJKA 4Y0NA 4FGKA 4DTCA 2NV0A 4H3VA 3OMWA 4K9NA 1V1RB 4AZWA 3VR4A 3I83A 4FYMA 1IN6A 1X8JA 4A4DA 4CEIA 2WVHA 1Y1KE 2HW8A 1FNSA 4BJ3A 4DIEA 2M6SA 3I72A 3HQ4O 1SXQA 2HLDD 5DXAA 1KFJB 1NF8A 1Z56C 3HS3A 3TCKA 4MUAA 2JCXA 1PTJC 1J2UA 4ZV7A 3QFRA 3PXGA 2XQKA 2FI1A 1UDRA 4ITVA 5NLLA 4CMEA 3C6MA 5KJEA 5DNDA 5KZMB 1U0RA 2AHRA 3OE5A 1PGPA 3GZNB 4Y6RA 3K9FC 4JUIA 2OENG 4HJRA 4YDQA 4W8GA 5TT1A 4IV0A 1H1DA 3FOZA 2G77B 4EEKA 3GT0A 2X13A 4EK9A 3ER9A 3ZWPA 4QU9A 3QX9A 3PA8A 5EJ2A 1NW4A 5CCEA 4YJ3F 2R4UA 4LCBA 4ZQEA 2ARTA 5JRZA 1BIAA 2FUEA 3OPXA 3DVLA 4L5CA 1N3IA 3H97A 3FHCB 3MWKA 5HP4A 4MDHA 1CJTC 2IXBA 4UHEA 4DCJA 4CEHB 4JB8A 4MYTA 2A1TS 3OWXA 4RS3A 3MRTA 4M55A 4O59O 1EGAA 4WXRA 3ZQJA 3AI7A 1EBFA 4UATA 1IJFA 3H9EO 5I4BA 2HJSA 1CEEA 1TEVA 1ZIOA 3BIWA 4NBSA 5K2MA 3RS9A 1PL0A 4EVSA 3DV9A 4F9GA 3HV2A 4RVFA 4Q3DA 3DF7A 4E11A 5JVDA 1ZFNA 4LSWA 4V38A 3AP1A 4JBHA 4ZEWA 4BMPB 5JD5A 4ENPA 3BTVA 1HYQA 2WICA 2MSDB 1HQYE 3O1IC 5KVCA 4YR9A 2CJPA 5LPNA 4I9GA 4Z2AA 1JU9A 5AVZA 3FOFC 4GHWA 4DDVA 2X8LA 3EEFA 2D3WA 4QUEA 2OB1A 4CNBA 5KCMA 4EHIA 1NZDA 1T9AA 3RC9A 4HADA 1JQLB 5HUJA 4IIYA 3L06A 1PFUA 3Q10A 5EOVA 2V55B 5AH0A 3UMGA 4ER7A 1FFGA 4MARA 2HCRA 2TMDA 4MGYR 5D5PA 4GU5A 1NR5A 1U7ZA 2ORWA 4X1OA 4PM4A 3GLHB 3E61A 3BHIA 3HY3A 4L95C 1VKZA 2Z9CA 5HFNA 4MS1A 2GBPA 2COKA 5CEFA 4CMAA 5LMUB 4ARSA 4W5OA 4MR9A 2CJBA 1RCTE 4XQGA 4IHAA 3VMFA 3HB0A 3ZDQA 3KQKA 4KK3A 1V95A 2YVKA 3QU9A 5IFKA 3I42A 3AFIA 5AVJA 3A74A 5C8YA 2DQ0A 4XIJA 2WHXA 1M2WA 1HM5A 2X77A 1WY5A 4HNTA 1U5CA 1AGXA 3EWIA 4DDMA 5EJEA 5M34A 4KRFA 3OO1A 1CR1A 1ODIA 1Q2UA 2QL7A 2B69A 2RKOA 3ZZ1A 4FB5A 5GM2A 2ZIGA 4DQUA 5GWXA 2JAHA 2I55A 3WWOA 3CLTC 3M89A 1L4NA 4C6SA 2HO4A 3S2GA 3NPMA 4Y6SA 1KFEB 2VA9A 4LMRA 1GRQA 5CB6A 3KQNA 3SIWA 1CT9A 2NU8A 4F4DA 1JLLB 3N76A 2X2FA 3OCJA 5CH3A 4DLYA 3SR3A 4YY3B 2HWWA 3KEGA 1S8OA 1AA9A 4ILEA 3T7EA 5LXTF 3O4GA 1IXYA 2IIVA 5HIMA 3GBPA 4LCEA 4QNRA 2KPOA 1A9XB 3FHTA 1SVLA 2RHDA 1JEEA 3CINA 1RE1A 2FB9A 2Q5FA 1M1YE 1TCBA 2P1DA 2V7PA 3GQBA 1SY7A 2Y9MB 3PDWA 1XDGA 1RQPA 1PSDA 3D1VA 1GQOA 4LXIA 5C34B 3IHKA 3FTDA 2Q7GA 1T3ZA 1VE1A 2WU8A 3K1ZA 4OGFA 3RNOA 5JH7F 3ZD8A 3AUKA 2VO1A 4B85A 4R71A 4MJXA 2JW5A 5CLQA 2NG1A 5DGXA 5AM1A 5EE5B 2JD1A 1DEHA 4BLQA 5EIEA 5JZOA 2W2PA 2D8MA 5CVEA 3CNBA 4FFPA 3JZDA 1KAOA 2ECFA 2LWIA 1P5ZB 2OBMA 3IVMA 4KBYA 5AW9A 1WV0A 4J7UA 3S28A 4PNZA 1K98A 1KDYA 5E9AA 4EPRA 3WMEA 4CMIB 1DRJA 1GKIA 2GT1A 3IC5A 2NTJA 5CG1A 2B0JA 4KLZA 4ID3A 1Q15A 1KJIA 1DSSG 1ZGCA 4EJ2A 2RCNA 1PJQA 2DWOA 1YTLA 1JX6A 2VUIB 3GJ3A 4DT1A 4J15A 2V3VA 4LY3A 4M6WA 1F51E 2LP4Y 5DDIP 5ILQA 3CZCA 3N3AC 1ENYA 3W79A 2AFHA 1GCGA 1VSQA 4BXOB 4U1RA 1ECLA 1VC2A 3BDAA 3RSLA 4BGDA 1UR5A 3FUVA 3QU7A 4H3KB 3M4YA 4QG3A 4OA5A 2B82A 3AEUA 1PWXA 1X9IA 1NBMD 4LGYA 1GL9B 2PANA 1XZIA 3WLSA 4ZYLA 1NW3A 1U65A 4GVPA 2B2XA 1DQYA 2DBZA 2OEPA 2QTGA 2VSOA 5CM8B 3T06B 3AEZA 1DKMA 5AVWA 3L4KA 3FTQA 4EJMA 2GSWA 5F4BA 1MXHA 5J4LA 1HE8B 3L9XA 3R9KA 1JIQA 2BM8A 2FPUA 2I22A 2IC5A 3EA4A 4LOHA 1QH1B 5DH9A 2CXPA 4BBAA 3F8WA 4ZVMA 5AFSA 2HT1A 1CR0A 4PCAA 4Q9KA 2OUIA 4CIVA 3K0CA 5EHXA 3VNRA 2X15A 3TXAA 2QT1A 1XXHE 1SRYA 5FL7D 2XMZA 3GV0A 3BE5A 1UAGA 4PBRA 1YBHA 3LSYA 5BV0A 3QEBZ 1ZWLA 1FPQA 3Q7QA 4INAA 1PEKE 1EDDA 2WUWE 1JHVA 2PZAA 3PYXA 5D1NA 3EBOA 1DJLA 1TVEA 3FNRA 3PWSA 3JPWA 2FPWA 4RW0A 1TT7A 2AMLA 3KYDA 4CNQA 3WLNA 1OMOA 3AGPA 3TAUA 2UYOA 1NT4A 3AESB 3R0QA 3PC8A 4LHVA 1YDWA 4O0MA 1RZVA 2ZSEA 3TSOA 4AUNA 3MPOA 5F3DA 3CTMA 2V8OA 3GFTA 4L22A 1NY5A 3H16A 5FPHA 3ZJ4A 1E20A 4B81A 4P71C 4DEYA 3A3YA 3DW1X 3MRXA 1AGRA 3AHFA 1VKJA 3PCXA 4UZFA 3VJMA 3I4LA 3NATA 1TTTA 4CKEA 2YZGA 2EW1A 3EEBA 4QYTA 4ISCA 4LDRA 4PG8A 1U63A 5P21A 4YAJA 3PUJA 4X20A 1XCPA 5FWXB 3M34A 5A5FA 2XI4A 4OBEA 4HF7A 2X5OA 2EQBA 3R3YA 1ZUIA 5I7FA 2DTOA 1UP7A 4LI3X 3TVDA 4FMDF 4PYJA 4EM6A 2WYWA 1U31A 3GGJA 3IP8A 3KNZA 1BX0A 3EQ9A 2WYHA 3EHDA 3Q40A 4RZQA 2LCIA 5LUBA 3OQ6A 1IBLB 1RYEA 4ZJPA 5BNIA 3NT2A 4QLOA 5F5XA 2WQ7A 4WJZA 2XW6A 1NBMA 3R09A 3JRNA 4R0VA 5A5VA 1ULBA 11ASA 5DHFA 3ZDFA 2TMKA 2C7QA 4DQ2A 5DK6A 1M2VB 2P3OA 4XASA 3CR7A 1XTJA 2Q4DA 2JFUA 3MBKA 3QVKA 4ZI2A 3R5FA 5K0TA 3N2NA 4KAJA 2NS6A 5ALMA 3DOHA 4CLRB 2OLJA 3WJ2A 4KPGA 1TU3A 2B94A 2ZKLA 3OHMA 4IX1A 2PJRA 4QO8A 1JVNA 2GN0A 1E9DA 1Q50A 2HPZA 2HM7A 2YXLA 1WLSA 1MN6A 3F5MA 5FL7A 3TVTA 1XN4A 4L9SA 5BQ3A 1GPNA 2FEOA 3L0ZA 1VOTA 2N3ZA 5K8LA 1WO8A 1UWLA 8LDHA 3I61A 4EG3A 1QZTA 2LIVA 1J4AA 1C3OB 2IXAA 3RUDA 4F3TA 2GRUA 1XTQA 4YRKA 4WKOA 5FPSA 4DM3A 1K27A 3HXZA 2IHJA 4GUDA 4BIIA 4EY7A 5JXGA 4WNAA 2QR5A 2AN4A 1ST2A 2I4LA 3F1LA 2IGBA 1H4QA 2A9PA 4HRXA 3R0XA 4W99A 4ZAYA 4QM7A 1QF6A 2EX0A 2VOEA 3EVNA 2OBXA 2A7XA 3WKEA 1JYSA 4Q02A 5JAZA 5LWHA 4G0NA 2IZ7A 1RHQA 2WTEA 1UBSB 1NP3A 1CF2O 4NCJA 1IUNA 3ZCXA 4CM7A 2AMCB 2OXIA 2MT9A 2CNWD 2IL1A 3C7KA 4NBKA 4ZCLA 4QIHA 4F9FA 2PUEA 4UVEA 2XZPA 1MVLA 1E7WA 4GH5A 1V9SA 4XCVA 2CUKA 2UVQA 2W2MA 2BR5A 1SUSA 3O92A 1N2CB 2J4FA 3PZBA 1G20A 2EFCB 2B4AA 4X3PA 3F4LA 4J76A 5T8KA 1YS7A 4YCSA 2IP4A 2P77A 3VR0A 4MI1A 1H05A 5E6RA 4GDMA 5IT0A 2YMPA 3DOOA 1PD1A 1QANA 2XQJA 4RCVA 1YKFA 1JVBA 1JLRA 1QIIA 1FP6A 4HFMA 5KNDD 3SQXA 4CKWB 2ZB7A 3HKCA 1TQ2A 4ATNA 4IDGA 2QVYX 1IQPA 1Q11A 3FZQA 4JLAA 5D85A 5EFOA 4R8KA 3WGZA 3ZGYA 3P9PA 2Q62A 4GOJA 4WGFA 3LDGA 3T3HA 1TEXA 4HYQA 5DNUA 4UPVA 1EXVA 1H2WA 3BCUA 3PR2B 4QDTA 4ZDKA 3TLKA 2BEUB 1NC3A 4S3MA 4ZQGA 1TW2A 3DZGA 1AMUA 4ZP1A 1NF9A 1L7XA 2Y1FA 3FVQA 4KIUA 1OJLA 3LPNA 3OCYA 2RJNA 3P2JA 4AZ0B 4C78A 4WOKA 2OHOA 4P4UA 4X93A 2FZVA 4PY2A 1QFSA 4BRSA 2M1XA 1MW8X 1K6MA 3A6ZA 1AOXA 4KQ6A 1KH3A 3K53A 3E0XA 5IUJC 1B3RA 4PANA 4W5TA 2HA0A 3GRCA 4GBJA 4RIEA 2NIPA 1IZZA 1LRJA 3U39A 4KIFA 3R74A 4OX9Y 3VSDA 1ZNWA 2RH4A 5EHQA 4YXFA 1PG0A 2H1RA 1MVOA 5DMXA 2UAGA 5GONB 3U0VA 3RQIA 1FX0A 3CJQA 3VHRA 1YQQA 2XTNA 4M0UA 4DLRA 4IEIA 3GNQA 1C1XB 4JGIA 1L1FA 1R10A 3GT7A 4OM7A 5C1PA 1SURA 2HT6A 4RDCA 1EINA 1WQ4A 3B6IA 4N01A 1C9NA 1JA9A 1W5BA 2CEAA 2CNWA 2MMCA 5DX1A 3TG2A 5FBRB 5AUPB 5IJ0B 1PEDA 2VG8A 4RK4A 4DMKA 2PX0A 4DREA 1XQYA 5M29A 2R8PA 3D81A 2LGJA 3L8CA 4LF6B 4D8VA 2VDPB 4R01A 4UU1A 2WD7A 4P72A 4C30A 3K70C 4Z4GA 3RAJA 2HCJB 3C8ZA 4BE9A 4JL8A 4BGVA 5CFRA 2F1IA 2EBWA 4B83A 2PT7A 2RGEA 1EFRD 1JH9A 4P0PB 3COYA 1MOPA 1CZNA 1XAHA 3CVJA 2RH9B 4D6XA 4N3BA 3WL3A 5KNDA 1GA6A 1AKMA 1RM4A 4HGRA 4C7JA 3K9QO 1JE1A 1K7FB 1WKVA 2OWDA 4N0MA 2ZBPA 3JQ6A 2A5GA 3NEJA 1KOGA 2XCUA 4GZ5A 2GCOA 5ECYA 3GLFE 3A06A 5CTJA 3I8XA 5BV1A 3MWGA 2NUPA 3IBCA 2JGJA 2VQ6A 5DGIA 2HF9A 3HYCA 3JQRA 1VCHA 3MMZA 3DE2X 4KRYA 4XD7A 3ZXSA 3NHUA 3PFWO 1ISHA 2HDNB 4RMFA 3KWLA 5GVRA 1BAPA 2H9AA 2PX4A 2WJWA 4IJVA 1ODSA 4KXNA 2ZM6B 3IAEA 2JJMA 3V9PA 5F2EA 2O8BA 4QLAA 5KYGA 2I54A 2FWNA 1SCJA 3GUZA 2OGTA 1GT6A 4H4CA 4M0LA 2R44A 5AHXA 4E14A 1L5HA 3LA8A 4K05A 2ST1A 4BX8A 1TAGA 5BUSA 3KUXA 4UM9D 5IDXA 3AW9A 1P2SA 2K7FA 1FOEB 4QXAA 1F2VA 2ZRHA 3VAYA 2ZCJA 2YV5A 5FTJA 3T7SA 1MEEA 4AC9A 3KP1A 5AW3A 1TC2A 4NQRA 5J1TB 2UYGA 4CIXA 2X23A 3SWWA 4JAVC 1WXFA 3UH0A 1VHTA 2NT4A 3AB8A 5DWQA 1NYLA 2QVGA 4O4JF 4YQEA 1XLTC 1GPYA 3DAFA 2AR7A 2BMAA 2PSHA 4XR4A 1Z6XA 2V6JA 3K09C 3M1LA 4DUZB 3RADC 3C7TA 3M8KA 2DU7A 1OKKA 4W1PA 4URVR 3HNRA 3TW8A 1RQRA 4DMMA 3DMFA 2Q1XA 5EIWA 4MKIA 2GF0A 4UU0A 3SMVA 4D56A 3QE3A 2H7XA 3PFHA 1NNHA 4I5DA 4K2AA 4MEAA 1JAZA 3WL7A 5HJ7A 3IURA 4RDHA 4QUGA 4AZ3A 1IQ0A 2O8CB 5U9CA 2ODPA 1QH0A 2O2EA 3HSKA 4H2UA 3G7UA 4DVJA 5HF8A 3MCUA 3OMXA 4XU1A 3GVCA 5JY6A 4NZ9A 1ADBA 3I6IA 4DAOA 2H4FA 2XBLA 1MC1A 1F38A 1WHTA 4QASA 3LBIA 4TZTA 1RFLA 1F8YA 4DV4B 4ZDWA 3A9UA 1FK8A 2JI6A 1LBHA 3OJ0A 4BDTA 4CLDA 5MF6A 1P4AA 5D3ZA 1EBUA 2BGLA 1GZ4A 5EWLB 4D9FA 3DBRB 4FYJA 1JYFA 1ZGHA 2O2YA 1Y37A 2V7UA 4JNCA 3LWNA 4W7HA 3RHFA 1KSGA 5DTJA 3SFVA 3L1IA 3SHOA 1OYWA 3GVXA 1DB3A 3AFHA 3L7KA 2AHOA 4H02A 1ZGZA 2GDZA 3CH4B 3NIFB 3VKVA 3W6UA 2OOKA 1AKEA 1YQ9A 4NLLA 1D5WA 2QU7A 2QG9A 4OJTA 2M6LA 4AKHA 1IN5A 1L4HA 3REUA 1OROA 1FRVA 2O2XA 3KOZA 4FVTA 2RHJA 4Q6BA 4MW5A 4KPUA 4CR6A 5C8ZA 3WGOA 4MRMB 4B6JA 2AZMA 3ADPA 3PYMA 2IOQA 2BJHA 5TARA 3M2TA 4NS1A 2BFDB 1XZLA 4CMHA 1NRJB 2O7VA 4R83A 5TSDA 1MU0A 1QK4A 2Z09A 3NEYA 2I3BA 2POQX 4F3NA 1YNOA 2X0EA 4DC0A 2XE7A 3DT9A 1V9CA 4F4IA 1DUIA 1RE0A 5DFAA 2HN9A 2GD6A 1E2FA 4C0BA 3WICA 4FBGA 1ZX1A 4M60A 5DTQA 3SLKA 2Y0PA 1V5FA 5ELNA 4BMCA 4BS9A 4CG0A 1GOTA 2VYFA 5F52A 1G7TA 2CC2A 2BIFA 3VU8A 1A1SA 2JBWA 3BZBA 4JWTA 1O4VA 4JR0A 4K7JA 4XWGA 2JC3A 5KHAA 5HWSA 3HJBA 2P2DA 4RPHA 3E9YA 2JJ8A 4NFLA 1JN0A 2AXQA 1WD5A 4L4YA 3GB9A 1SWVA 2W2QA 3PQDA 5HEKA 5EVCA 2FWPA 3U3JA 1BFUA 4FSDA 4IDOA 3WLQA 1RADA 4ZVOA 2WHQA 3FYUC 2WWHA 1E1TA 4GOLD 5C1BA 5SYMA 3L4GA 2QNIA 5JJLA 3D2LA 3QO8A 5LQKA 1YJXA 1GUAA 4CR8A 1XDWA 3EMKA 3V8EA 4WLEA 1SOAA 2V4MA 3MT8A 4O4HF 2IITA 3WDKA 4CBVA 1ATIA 3W3SA 1NQWA 4DJJA 1K92A 2IYUA 3OZSA 2AFIA 3MMPA 1K66A 4O6VA 4CF4A 3EGIA 1RXVA 1PJ2A 2NV6A 1JBEA 4GICA 1FVXA 2FQXA 3IDSA 1X7XA 4OKSA 4TV9F 5LDGA 1A7AA 4Q4CA 5C80A 5LD2B 1NN1A 2WMNB 3N2KA 4KFTA 2JANA 5BYAA 4KAXA 5DE3A 5CNJA 1TVKB 4EUNA 1C4KA 2A67A 3BJIC 2FR0A 1E2UA 4MKHA 3DOIA 3TOVA 3UUGA 4YRIA 1Y1SA 4CN8A 5CA1A 1UWCA 1KC3A 3RUCA 2VDMB 4YMUA 3A9TA 3WBKA 4TTVA 1N92A 2IYLD 4G9EA 2JAQA 3VC2A 1P0PA 3CG0A 2WV7A 1C81A 2X4LA 5EHGA 4ZN6A 1B43A 3NYWA 3DMHA 4JUCA 4M98A 1H6AA 3C3DA 4MV5A 3R9IA 1J00A 3EF3A 3SXPA 3T99A 3TBKA 3UB4A 3VTKA 3JQEA 1EGQA 2ZXUA 4DSZA 2PUCA 4FDUA 4KYUA 3TLYA 2HXYA 3BIFA 4P92A 5GINE 4AUEA 4Q21A 3WNDA 4J43A 1VKNA 5EN4A 3W5JA 3PFFA 3ZE6A 4WASA 3ONEA 4UARA 3KSAC 1HG1A 3PUHA 3ORSA 3UG7A 4Z4QA 2I2DA 4YUYA 1D1PA 4YIKA 3KVYA 3K9BA 3UXEA 3FNIA 1XALA 2HSWA 2HWXA 4KNYA 2GRJA 1I7PA 3IT3A 5C2JB 2P6RA 1CCWA 1RWKA 421PA 1NRXA 4O63O 4EKDA 3K2QA 4G4IA 3VYTB 4YT5A 3R4VA 2H1HA 2K4MA 3ST7A 3B6MA 2QTTA 5AKYA 3L8DA 4Y0VA 1YF3A 2R7MA 1DFHA 3A3NA 4HH1A 1A9ZA 1WMSA 3RRYA 1O94D 1NYTA 3KQMA 5ESDA 5IAJA 4CM1A 1KO8A 1QOPB 3UH1A 4ZYUA 5CYGA 1UPTA 2WQZA 2EP7A 3LC1O 3QHQA 1RQLA 2JFFA 1Q1GA 3QOWA 1ZMTA 4RK1A 3UA4A 3ZX5A 4AJPA 2CXOA 3W5CA 1PR3A 1PEAA 2B6NA 3SC6A 1L8OA 3O2SB 4NE2A 3F7MA 3RF1A 1DOZA 3FSRA 1RRPA 3N87A 4Y7DA 3WTBA 4RM2A 2C4MA 2JVIA 4ZVTA 3UMBA 1A8SA 2ATVA 3UANA 1B7YA 2C9ZA 4WKBA 1GFWA 3CSSA 4RPLA 1D4ZA 4IQ4A 2W0SA 3RUEA 4CCSA 1GGHA 4MUYA 1EI9A 2WRZA 2YN0A 4OMUA 5H16A 4BLRA 5KQRA 2UUAB 2VP9A 3II6X 4N4AA 3UXHA 2FCAA 1LZKA 1Y1QA 4L4ZA 4QGFA 1WW8A 3H2YA 3OPVA 1JEYB 4EL0A 2IELA 1CY0A 3BMOB 3RI3A 3LQQA 1EIYB 5HZGA 1XZNA 1N75A 1T6BY 3A0RB 4HGYA 1F3LA 3E9CA 4PYQA 5FOTA 3KD2A 1QNLA 3TQIA 1IZYA 5EJ8A 4LRXA 1CE8A 1TADA 2I03A 4S2EA 1VIAA 5L9AA 4RKWA 5HIJA 3VHXA 2L82A 3B1ZA 4IIBA 4DCSA 1QQ6A 1PJ3A 2BFOA 3BGDA 4PNHA 3NHPA 2GCEA 3IT2A 4EPYA 3BXEA 4NCKA 2QMOA 5F51A 3KXPA 2BELA 1ESDA 5EZYB 3G23A 1U8ZA 2ZJ1A 3LY7A 3EXG2 4G25A 1Q0ZA 1N4AA 4A2CA 3G0DA 4U0KA 4E0BA 5JAOA 3B13B 3QGMA 3PXXA 4AJ9A 3ZJTA 2GZ1A 3AT1A 2WKWA 2HJRA 2CNOA 4LV8B 2FMKA 4YJKA 1KDZA 5HZHA 3O8QB 5A0TA 3Q8XB 2BKAA 2XMDA 3T95A 1GQRA 1XO1A 3D5EA 3QPBA 1U8AA 1CNFA 1DVRA 1K5HA 1J06A 4JJ4A 4GBGA 2VQSA 1E3TA 2EGUA 3C6BA 1EM8B 4RE5A 3PHCA 4KSCA 1ULZA 1PLJA 3FJYA 4HRYA 4KQ1A 4RD6A 1PSWA 3CGGA 3CVUA 1MOQA 2IYVA 2GN9A 1C8VB 2BJVA 2IHVA 1LQ2A 2AK2A 4DJEC 5HRAA 3OJWA 3TTXA 4EQ6A 1DDIA 2QMZA 2I2AA 1BA3A 4NK4A 5FPTA 2A5JA 2QLTA 5KTMA 1N7JA 3AFGA 5AO9A 5FNVB 1S8FA 2OCDA 4HGPA 3WWZA 4AICA 4EG6A 4WLUA 1SIUA 3OZFA 1QQTA 1U1GA 1ETHA 3TZQA 1ITZA 2J0EA 4B3IA 3DO5A 4G1VA 4I1OA 5F78A 4UUBA 3TLBA 2DZDA 4TS1A 4IPTA 2DPLA 3Q72A 1TEZA 1QIKA 3HR4A 2IV7A 3H3JA 2V5VA 3FOAA 1ORTA 2VJNA 2CDCA 3EAQA 2YWDA 5A0FA 2MCFA 1AH2A 1CRQA 2CLLB 1BD4A 4J2OA 3CMQA 2PZMA 2ZWPA 3H83A 5ICCA 3WL4A 2B20A 2PD4A 4DLWA 3EG9B 3MGKA 1MX9A 1ZOPA 4HNGA 3ZPXA 4IS2A 1GKKA 5TS3A 1Z39A 1EHYA 4MVJF 2C4WA 3LO5A 4XD2A 1H2XA 4YDSA 2DPHA 5DLPA 5FBKA 5ICMA 3BUSA 4R69A 4EW2A 1OGJA 2BR4A 3VDQA 3WGLA 5CX1A 5KU1A 2VHWA 1L4FA 1QG4A 4AJNA 1HNNA 4EGSA 1W6RA 2JHCA 1I9CA 4JHLA 2JDID 1PS8A 4OAPA 3AV3A 3K0SA 3RABA 4EFKA 2ZTUA 1HMYA 1QLWA 1U7DA 4L0CA 4KYVA 3WNBA 5E4FA 1N6HA 4GBMA 2YCLA 1O58A 4HQOA 2WE8A 1PJRA 1M2NA 4L4UA 3PVZA 1SC4A 2JIDA 3IA2A 1H66A 1SCIA 4R2MA 1ZCFA 1KZHA 1NTRA 2J4CA 3UV3A 3VKWA 1KYZA 2RG7A 1YS4A 4EYGA 4JN6B 1H2ZA 1TDJA 1TAUA 1TJPB 5E3JA 3OTGA 4FNOA 4MW6A 1QZXA 3P0HA 3UUFA 5KYYA 2I1VB 1YT5A 2JKVA 2X0NA 3A3OA 4ZODA 1RBQA 4LX8A 1E1QA 3GJ6A 4CMEC 3GPDG 2CVOA 1JJVA 3JR7A 3LZ6A 3FHLA 4E4RA 5KYNA 4MUXA 4ZOBA 3FMIA 4EATA 1LLUA 2CUNA 2ZREA 4TYNA 1D6NA 4G1FA 4MPJA 1BWSA 2PKYX 4X63A 3RV4A 3JWJA 1BIBA 1N8NA 2F59A 2FN8A 4G0XA 4L6AA 5D5HA 1KVUA 1NQUA 1GAEO 3R7AA 1J0BA 2RFLA 5CEJA 4WEOA 3L0IB 5IM4F 2OLKA 4EHHA 5ENVA 4YMGA 1NA5A 1HQDA 3A2NA 3H4IA 4N82A 3N59A 2E55A 3M7IA 1YZHA 5JE8A 3I9KA 4MULA 1FP2A 4LHYA 1V7PC 3KDSE 4KN5A 1GO2A 5DO9A 2UXBB 4U4AA 2G4CA 1YB7A 1P0MA 2Q6OA 3I6BA 3F8TA 3EF1A 4MHSA 3FBTA 4J0JA 4LX0A 3QKRA 2EL7A 4XIYA 3UT5B 1EQUA 1R18A 4FOTA 3RVRA 3X1DA 5KYUB 2XUPA 1NZJA 3HB5X 4Y6LA 3VPSA 4IWNA 3KZ1E 1XTSA 4KVZA 5ICEA 4EDFA 1LLDA 3SX4A 1X80B 3R3ZA 3VI3B 1WW2A 3M4PA 4UXJA 4C6RA 2FPGB 3LCVB 1U94A 2PMBA 4O4LA 1Y8AA 4HB2A 3TEHA 4QE3A 3L18A 4WZZA 2NUTB 3G9ZA 4B33A 3PD0A 5BV7A 1V3VA 2JDIA 4Y6PA 1B8PA 2HGZA 3GH1A 5EY5B 1AO3A 4IF6A 2IPNA 1E60A 3CKLA 4JELA 1R3DA 3P2IA 5C8XA 2G4VA 2YWFA 3K70B 4BNFA 1R5JA 1KK3A 1CUWA 1GQYA 1LK0A 2FR8A 3KT6A 2PX5A 4QTUB 3IL2A 5CVJA 2WIDA 4M7OA 1VLVA 1BX1A 3QLUA 1KZ7B 2PWYA 4P53A 1QQAA 1E3SA 1DC3A 1X1CA 4A5SA 7YASA 1KYXA 3WGUA 1EVIA 1L0WA 1W2WB 4ENWA 5KJCA 1GPJA 1QGAA 3Q7TA 1U4NA 4H2XB 3Q3IA 3VH3A 1C3JA 3VVMA 1YVEI 4JXKA 3KT3A 5HBRA 4D7AA 2GEVA 2O7SA