The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
124
|
sequence length |
429
|
structure length |
388
|
Chain Sequence |
SSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIVEQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATPRVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIDAELIMLTARLWKRMGVDHMVQLELNTLGETDERTEYRNAAPKLHDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQGTVCAGGRYDGLVGQLKGKADQSVPAVGFAMGMERLLLLLEQVEQAEIVRDCEAFLVAEPAYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEAQQLAVKELATAEQSQVALAELVPFLIEKFTK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of a Histidyl-tRNA synthetase from Acinetobacter baumannii with bound L-Histidine and ATP
rcsb |
molecule tags |
Ligase
|
source organism |
Acinetobacter baumannii
|
molecule keywords |
Histidine--tRNA ligase
|
total genus |
124
|
structure length |
388
|
sequence length |
429
|
chains with identical sequence |
B
|
ec nomenclature |
ec
6.1.1.21: Histidine--tRNA ligase. |
pdb deposition date | 2015-10-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03129 | HGTP_anticodon | Anticodon binding domain |
A | PF13393 | tRNA-synt_His | Histidyl-tRNA synthetase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | BirA Bifunctional Protein; domain 2 | Bira Bifunctional Protein; Domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Anticodon-binding domain |