5E3QA

Crystal strcuture of dapd in complex with succinyl-coa from corynebacterium glutamicum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
278
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
total genus 89
structure length 278
sequence length 286
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3qA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3qA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3qA01
2QIAA 4E79A 4H7OA 2FKOA 3F1XA 4IHHA 4M28A 5DG3A 3TDTA 3VBPA 4M9CA 1FWYA 1G97A 4EQYA 3FTTA 4R37A 1V3WA 3FSBA 1QRFA 3D8VA 3MQGA 4MZUA 3ST8A 3R5AA 1KK6A 4N6AA 4MFGA 3R8YA 3EH0A 1QRGA 2IUAA 4KPXA 1KRRA 3TIOA 2QIVX 2ICYA 3V4EA 4HZDA 2V0HA 3R5CA 1FXJA 3CJ8A 1Z90A 3P47A 3FSCA 3SPTA 3VBKA 2AQ9A 3TK8A 4IHFA 1TDTA 1KRVA 3EG4A 3IGJA 1MR9A 4M2AA 4HZCA 5E3RA 2V0IA 1J2ZA 3R0SA 4EA9A 1MR7A 3MC4A 4KNRA 3VNPA 1SSQA 2JF3A 3TISA 3FS8A 3OU9A 1G95A 2VD4A 2W0WA 1SSTA 3BRKX 1XHDA 2IU8A 3C8VA 1YP4A 3D98A 3KWDA 3VBMA 2RIJA 1QQ0A 5ADXU 4EGGA 4N6BA 1YP2A 5U2KA 4E6TA 1HM0A 1QRMA 2WLEA 4EABA 3FOQA 5DEMA 1KK5A 3IXCA 3R3IA 4G3QA 3T57A 3TV0A 3Q1XA 3FSXA 4N27A 3P1BA 3NZ2A 5DEPA 3VBIA 4FCEA 4N69A 1V67A 4E6UA 2OI5A 3GUEA 3FSYA 3OTMA 3PMOA 3HJJA 2JF2A 3GOSA 4R7PA 3R5DA 3OW5A 2I5KA 3DK5A 2WLFA 4M99A 4HCQA 4AA7A 2OI7A 4J18A 4KPZA 1KQAA 4J09A 4G3SA 1THJA 5E3QA 3TWDA 1XATA 5ADXV 4E75A 2XATA 2GGOA 3R2WA 1SSMA 2OEGA 3OTZA 3VBNA 4AAWA 3BFPA 1T3DA 4MYOA 5E3PA 2WLDA 3BSWA 3VBJA 3R5BA 4K6RA 4AC3A 2ICXA 2WLGA 4G3PA 4DCLA 4KQLA 4HUSA 2VHEA 5L6VA 3DHOA 2V0JA 1HM8A 1YP3A 2V0KA 3JQYA 3VBLA 4E1KA 4R36A 4EAAA 1KRUA 4ISXA 4IHGA 1KGQA 1QREA 3DJ4A 1HM9A 3SRTA 1S80A 2Q4JA 3OUPA 3GVDA 5F42A 5L6SA 3ECTA 1KGTA 4M2BA 1QRLA 2OEFA 3EEVA 3I3AA 1LXAA 3R1WA 1HV9A 2QKXA 2W0VA 4G87A 2IU9A 1KK4A 2P2OA 3I3XA 3MQHA 4HURA 3BSYA 3KWEA 2NPOA 2V0LA 2WLCA 4EA7A 4EA8A 3BSSA 3R3RA 2IC7A 3HSQA 2OI6A 4M98A 3FWWA 3BXYA 3KWCA 1MRLA 1KHRA 4KNXA 2GGQA 1OCXA 5AFUU 5AFUV 2TDTA
chains in the Genus database with same CATH superfamily
3SZ2A 5B7WA 5B0CA 5KG1A 4CLYA 1SJ4P 3MR5A 3M1VB 2CAJA 2XY5A 3LGHA 2ICYA 3VGUA 3PVXA 1KNZA 2DHAA 3KLEA 4YUDA 3UCZP 4JI3F 1TV6B 3DOKB 3MMAA 3KKFA 3R0SA 2KDOA 3KLGB 3G82A 3BBCA 4C48A 2XO6A 1Y8FA 2WRMA 1CJTA 4OZLA 4OI1A 3RYLA 5GADI 2IJRA 1XEZA 2N4CA 1RTHB 2ZNYA 2QIFA 5FIIA 4G3QA 1OS5A 2RAQA 1X7VA 5AE3A 1N5TA 4QJVA 2A0FB 2I9SA 4KBIA 1QDUB 1WC4A 1EARA 1D0EA 3JB9k 1PAEX 2R7VA 3LW5C 1JMTA 3R5JB 3CMAS 3FUYA 3CCZA 4B3OB 3MPDA 2ZJPQ 4O3RA 1L0SA 1N5VA 4DCLA 5F8MA 4NA2A 2J6UA 1DLOA 3OFFA 2X3TA 2A6OA 1LR8A 2IMWP 1Q7YT 3W61A 4OYXA 1VQ9S 1Q1KA 2R9LA 1KK4A 4QCLA 3R7NB 1S7HA 1WDDA 4N47A 2OELA 3HT0A 2M0GB 2MMYA 2DD8S 1Q5VA 4ID5B 3EGVA 3K59A 1Z2LA 2M52A 4ZJQA 2P5VA 2W8KA 3QYYA 3PR5B 2RT3A 2V6AA 3DLJA 4K50A 1U5KA 5LL6d 2KMRA 3FSCA 3QT8A 2K7JA 4Y2CA 3V4MA 2E1AA 4URGA 2LXUA 1Y0HA 3OJSA 2C1EB 2RRBA 4K8RA 5D0GA 3OJUA 2RIJA 1KLNA 3GU0A 4GKJJ 1RHJB 1YRTA 1V3SA 4P2SA 4ED1A 1LV5A 6AT1B 3N4WA 5HJXA 3IM9A 2WCXA 2M4MA 4Q2LA 2CQDA 4Y6IA 2CNLB 1U48A 5E3PA 1WACA 3I56S 2HRTA 1TFWA 2O3DA 4UUXA 4IUFA 4OYWA 2BJ9A 2G1DA 2GVIA 1OQ6A 2YKNB 3M6UA 2G4BA 1T03A 2RDIA 1HNWF 1ZH5A 4NXNF 2DRBA 2HK2A 4JP8A 2KZMA 1U25A 3WBZA 5D0RA 5A6PA 2DHGA 4PABA 3HF5A 5EWGA 2KU7A 3LP2A 1AZSB 4DV5J 2XZWA 2WGCA 3PDNA 3M2RA 1GMVA 5F8GA 2XS2A 4NWBA 1SV5A 2FC8A 1HNXJ 2KRBA 1BQNA 2GHWA 2DXDA 2JC1A 3RB0A 3FCVA 1C1CB 5T41A 8AT1B 1S9EB 2NQPA 2XWYA 5DO2A 3KWDA 1RWOB 2VV5A 1TBNA 2JRSA 3SEKC 9WGAA 4G1QA 4N8OA 2V8VA 1VCTA 3D67A 2DHSA 1TKDA 2MQPA 1KVIA 2LQJA 1LW0A 3U7JA 3AD8C 1PSDA 1AFJA 3HHNB 5BYSA 3ENWA 3Q8UA 2CWKA 5HLFA 2GV1A 3IR5B 3N6MA 1BY9A 2Y1JA 4GO5X 1FJGF 8ATCB 4OX8A 5KT5A 1WUUA 3DOMB 3QIPA 4K4YA 1JLGA 5L1KA 5FDLB 4P10A 3H2LA 2LQBA 4X2BA 1YBAA 4FKXA 4LF4F 5L39A 3N5BA 4QQBA 2R8JA 4DXLA 3R9LA 1KHRA 5E3AA 4I7FB 1WTJA 3TANA 3MM9B 4ZOSA 1F2HA 4ZP8A 2HFZA 2YX1A 4KPXA 1UZHA 1T0TV 1IKXB 2XB2D 5E2QA 3P47A 3G8TA 2WCYA 2DNZA 3VGSA 2YNIA 2C22A 3E2EA 2E5LF 1RT6B 1XR6A 1VBYA 1TP7A 1HWJA 2OKQA 1QRMA 4ANCA 4LF8F 3HVTB 3OHBA 3NCQA 4Z37A 5DLGA 4E6UA 1Z4UA 1F9HA 3OW5A 1PILA 1HARA 2HBQB 3M1VA 1RWMB 3HULA 4IH6A 2XLJA 2HPUA 1LK7A 4EI2A 1TKZB 3E8OA 3VBNA 1TV6A 1VQSA 3DOKA 5I3PA 3KLGA 5IZHA 2R8KA 1BGXT 4LR8A 2R8HA 4RUCA 1HHSA 3PYDA 4RUAA 1RTHA 5A76A 4LMZA 4MH8A 1YZ7A 3VF0B 1K44A 2W4PA 1LOUA 2HQIA 3SYZA 3SI8A 4MKYA 2OPPB 4HURA 2GIFA 4NLDA 3L09A 4CLZA 1FX4A 2MHEA 3P3DA 4U7UK 4NEYA 2SGFI 3T9ZA 4B3OA 1R6YA 1R6VA 3EMTA 2AV5A 2IUAA 2PIIA 2FVRA 5EX3A 5FUYA 4B9MA 1EKSA 1WELA 3TEGA 2JHEA 3DLHA 3CMES 5C2CA 2EFPA 2AYGA 5LSRA 2A2DA 3DDNA 1OPZA 4LF6F 3UPFA 1FE4A 2OD6A 2AP6A 1VBKA 2F1FA 3HD1A 2EXUA 3W63A 3ICLA 3I6PA 4ID5A 1F9EB 4JI3J 5DJBA 2DISA 4EYHB 4RUBA 3QQCD 3GYXB 2IAJB 5SUHA 1SGYI 4DX6A 3FGVA 2J5AA 4NLYA 3ILIA 3R7SB 4OJ3A 2LEBA 2ZDOA 3PHEA 1NKEA 2OPQB 3KHGA 3K57A 2QMWA 5C42B 2F9DA 1XR5A 1GNKA 1NK6A 3L95X 2VC1A 4HHHA 3BSNA 1DHMA 1JLBB 3BKFA 3G6YA 1OY9A 2BQ3A 3DMJB 1VRQC 2DYAA 3CJKB 2WSFC 1VQ5S 2G0CA 2RF2B 4FZVA 4L3KA 4NYZA 3O6QA 2C2OB 2E5HA 2LFVA 1BWVA 1T9TA 3VAGA 3R27A 3ZZUA 5KFNA 3MGJA 3K5MA 3NG8A 2XC9A 1PG5B 1S6PB 4LFCF 2YKNA 5ETSA 1ZETA 1JLFB 3A13A 1WNEA 3AFGA 1HNZF 4ECZA 4H4KA 4WXWA 3RBDA 5EWEA 5G0RB 2V2QA 1AZSA 4I1TA 2VB6A 3FRYA 4CNYA 2FLPA 3O44A 1RCXB 2G1HA 3WQPA 2VZ9A 3OTDA 1RACB 4ZJOA 3ZC4A 1C1CA 2GJFA 1W2BR 4M5HA 1L3TA 2W2NP 1S9EA 4DV0F 4NLTA 2JL9A 2PN6A 2C2EA 4UXJA 4DPYA 4EBDA 3CJTA 3T1AA 2Q6BA 5T14A 1KMAA 1IWGA 3MMBB 1WEYA 4DR1F 2YQ0A 2WVBA 4CLLA 4Z7CA 1X4FA 3CDBA 2Z8QA 4P75A 2EFQA 1MMNA 1YHQS 2HS3A 3DXBA 3IMQJ 5IWAJ 2BZ2A 4DPXA 3VQTA 2FJDB 3DOMA 2CPEA 4MMOA 5FDLA 3MCMA 1PJ7A 4EO6A 2B4PA 3Q23A 3D98A 2CNNB 4N6BA 4FXWA 3UDEA 1UCNA 1JX4A 1XNQJ 4ZVUB 4I7FA 1KHWA 2XTJP 4XIUA 4KAIA 1VC6A 3MM9A 1NZAA 1P9GA 1FWPA 3J7A1 2FHMA 3LAKA 1IKXA 1HHTP 2QX0A 4CO3A 4EWTA 3LPEA 5D6GA 3EX7B 1T3DA 3GSIA 3MFIA 4NRTA 5KFHA 5AT1B 2DGVA 5CZXA 1RT6A 3MHYA 2H51B 5FUXA 4FPIA 3CCQS 2RQMA 3ZZPA 2J76E 3HVTA 3K8WA 3M9OB 3UO0A 2BX6A 2V0LA 4NA1A 1S99A 2JLFA 4KNXA 1Z90A 1YJ9S 1TKZA 1RT4A 3N6NA 4ZVTB 2HFSA 1OMTA 1FNMA 4UOFA 4A46A 3MCSA 3A3PB 2MKKA 2ZITA 2J9DA 2JF3A 3TJAA 3C8YA 2F5GA 2HLTA 4F2SA 1YVFA 4IYQA 4WXOA 2JC0A 2KM8C 4UZBA 2XS5A 2MXYA 2JXDA 4HYKA 3T1YF 2HGLA 2OIHA 1AUSL 4ED8A 1RTJB 1VJWA 1DRZA 1TL3B 1SQGA 4B9VA 3A12A 3A3OB 1YJ7A 2HQGA 3BZQA 4DUZJ 3CJ0A 4DPWA 5AE2A 2B43A 3D4JA 4DG1B 3KHHA 4E8UA 4JV5J 5J2QB 1FK9B 3OUPA 5L6SA 1VI7A 3CJQA 2DGSA 3VWSA 3W3SA 1XN9A 1VFJA 2IAJA 3HKZD 3AOCA 4XPEA 2XGPA 4F0KA 3TDTA 4P7TA 4ZHRB 1N34F 2I0XA 3D8VA 2DH9A 2X3DA 2AEJA 3K2YA 2OPQA 4LREA 2FB0A 1RK8A 5C42A 1XMQJ 2DR8A 1F3FA 5C25B 3UDVA 1JLBA 4UOGA 3HHLC 3HXMA 1WSVA 2V8PA 1YGYA 1NXUA 2F3CI 1R0AB 1YP2A 3CJKA 3GCWP 2YXLA 3JXOA 2RF2A 5L8RC 5KFDA 1JNRB 2MKIA 3BYRA 1B0TA 1K47A 1NJZA 3JS9A 3W9HA 5D8HB 1U45A 3SFUA 3GJTB 4KGXB 1TVRB 3GMGA 1S6PA 4ID8A 2NPFA 1JLFA 2MQNA 4O3QA 5HJYA 3FKBA 2P6AC 1R8AA 2IM1A 4YS2A 5G0RA 2GKRI 2CYYA 3NBPB 1ZTWA 1IBKF 3IM8A 2B0GA 4LSZB 3BSSA 1KVKA 2CVEA 1CQNA 1VIXA 3UN5A 1WG1A 1VQYA 2DIPA 3B6BA 4ECSA 1FWYA 1FWLA 2SXLA 2J0XA 1CJUB 2V2VA 3CCMS 3MM5B 3M2VB 1RHMB 3G96A 3BR8A 2AQ9A 3M32B 2DNYA 2ZNZA 4K4UA 1H3DA 4E1PA 1UVMA 3AAWB 2J0QD 1P9YA 4S0MA 3MMBA 2M7SA 5JMNA 3OFGA 2N4DA 1V5VA 1X9MA 4OX7A 2OHDA 1TTHB 4DV1F 3SSRA 2BDPA 2OI5A 2AJ2A 1RAOA 2W9CB 1P9QC 3UGDA 1MLAA 3ZTPA 3AHPA 3I9V9 3BR9A 3DRPB 1HNZJ 4TY8B 1YI2S 2IM2A 3J81Y 1KOOA 4MK7A 1EHWA 1UA0A 4GC6A 4FYVB 1FDNA 1RAGB 3I3XA 2DIVA 3ETOA 3M8YA 3TUZC 2ASJA 4IRKA 1FNXH 3EDRB 4EA9A 2WB1D 3RBXA 1VBXA 4U95A 2G2OA 2XMVA 3EZUA 4IFVB 3MOZA 1UEVA 1V3RA 2AJ1A 2DNOA 4ICLB 1H74A 1H98A 2WONB 4YQWA 4FYYB 4LRAA 2J9DE 3GR0A 3R6GB 3H59A 2J9CA 1DAXA 4YMEA 1SJFA 4IQXA 1CVJA 3O8WA 4ECXA 2MY8A 1FRLA 1F5CA 2I38A 1KTVA 2Z0GA 4W98A 4O4GB 4DQQA 2VOOA 4MT1A 1AB8A 4DF8A 3LQVA 3EZOA 4NLXA 1RWNB 1Q0NA 1UFWA 1W25A 5GAEU 1HM9A 2AW0A 1XMOF 4DV7F 5H9EJ 2WW8A 4ZKAA 3ZNJ1 1RTJA 1RTZA 3GFXA 1IM6A 4K4VA 2OI6A 4CZCA 1XR7A 2YQ1A 1O8BA 1TL3A 4ZPAA 4FPRA 2EC2A 3H25A 1Y3JA 3ZZTA 1W3SA 2Y0SD 4DG1A 2GQCA 4NASA 2A20A 5J2QA 1FK9A 4B3TF 4DR3F 4WU3A 3IWXA 4MK8A 1I94J 5HROB 1L3VA 2OO4A 3BPSP 5KFUA 3UFFA 2AZ1A 4C0HA 2LP4A 2UVRA 4ZHRA 1RHRB 5D0HA 3QRQA 4DX7A 1TU0B 4ZPDA 2R2SA 3BJYA 4A8FA 2BKPA 3KDOA 5KT2A 5C25A 1ZTTA 2HG4A 3HSJA 4DMZA 1TZ0A 4WF9Q 4OI0A 2HHWA 2V9KA 1GX6A 4O4RA 3T1YJ 4DR6J 2VUGA 5IV3A 4O3PA 2BW2A 5CHCB 1TL7A 1TUWA 1O0PA 3GIJA 1LXAA 1T05B 1WEZA 3L4BC 3OTOF 1YRXA 2RU9A 4P52A 3ETMA 3VE5A 4J91A 2ZH7A 3NS6A 4K5RA 2FLNA 1TVRA 4UOHA 3LF0A 3OLAA 4QIVA 3VAHA 1OSDA 3HP6A 2BANB 3BO4A 1LR7A 4RBUA 1CC8A 2AMCB 4NLQA 3CD0A 3V4EA 3DXSX 1NH8A 3TO7A 4JI5F 1KBEA 4DZ6A 3H4BA 3S01A 1N34J 1GH8A 1RAHB 2BJ7A 4F0MA 1VHIA 1REVB 3C15B 5DS7A 4Y0FA 4CM2A 4P2FA 3FSXA 3KJNB 2X3GA 3D00A 3R7BB 3G6XA 1WDTA 1CJUA 3M2VA 3JAMU 4G3SA 3CD7A 2VFUA 5F8HA 2R2RA 3M32A 4FVCA 1NK7A 3LGMA 1WGCA 3QT5A 2NYHA 2UVOA 4TNOA 3I31A 4C8LA 3AOBA 2ZUAA 4CO1A 2YNGB 1LEOA 1P6TA 3EVWA 5DDPC 3JQYA 2R4FA 1NHUA 2KL8A 3TUJC 2LKZA 1VQ6S 5CH7B 1Y9OA 4MAKA 1R31A 2GX8A 1SJ3P 4X4VA 2L08A 2F40A 1ZA1B 2DNRA 3D0GE 3CXCR 2W9CA 1PTQA 4EA7A 3Q83A 2BRKA 4NLUA 2GGQA 3BS9A 3DRPA 1KC8T 3WZ0A 4P2MA 3BGOP 1FO1A 3OBIA 1IBKJ 4HLBA 4DV6F 3VGTA 2JOQA 1G6BA 1S1WA 3TK8A 4ED5A 1MR9A 2OD4A 1A9NB 2OMLA 3L7UA 4Q2MA 4CCHA 3J7ZT 4LSLB 5BJRA 2C2KB 3OXFA 3NZ2A 1NB7A 1XQIA 3VBIA 1N6QB 2OD1A 2WLFA 4IFVA 2QQ0A 2HGMA 1UJ4A 4ICLA 4RNMA 4BBYA 1FVQA 3A8EA 3VZIA 2U2FA 4EGLA 2WONA 1JLEB 5F3TA 1LWFB 4I56A 2VDHA 3W8PA 1FEHA 2PEHA 1JJCB 3PV8A 3M8QB 3IR6B 1R0BG 2BKOA 4FF2A 3TA1A 4X4OA 2P2OA 4OI3A 3ONQA 2NCKL 3MQHA 4UXIA 4O4GA 4B3RF 1TBRR 5AFUV 4IO1A 5D0EA 2J9RA 2NSBA 4U7CA 1GXLA 1J5EJ 2YQ3A 1MJBA 3OFHA 3H20A 4IRCA 2UP1A 3CD5A 4ER8A 3T5KA 4EEYA 2AEMA 1ZPWX 1UKUA 4FYXB 4E6TA 4CIOA 3QT6A 4QIFA 4FXDA 2XMWA 2LXFA 3GUEA 5T7LB 5ADZA 2VA2A 3GOSA 2ERWA 1WSRA 3VCDA 4RBVA 1SH3A 4J18A 5J8CA 4X62F 5HATA 1FRMA 2JDJA 2AU0A 2D7SA 2JEJA 5LMUF 4LBHA 2RRNA 2MQOA 4ZPBA 1V5IB 5HROA 3TVYA 1VISA 2F4FA 2MZTA 2H4YB 1KVJA 1W4RA 2UUTA 3GFHA 5GMDA 2ZUGA 4NLGA 1IQTA 4OX9F 3LWLA 4CQ1A 5KG6A 1HFEL 2BQRA 3NY0A 2VFVA 1UVLA 4NLOA 2D3ZA 2ENZA 2HFNA 1EWWA 1BXNA 2WZ1A 5CYJA 4ILLA 4AD6A 4X64F 3PACA 2ZOMA 4FNIA 1K7UA 2M2BA 2AYBA 3I82A 3NGSA 1VOMA 4BC9A 2LDYA 1T05A 1RLDA 4HKQA 4NPOA 3B82A 5KFMA 3TA0A 1U1QA 4WK1A 3W5XA 4WPAA 3HHDA 2K06A 1SJ1A 4OJ1A 2BANA 2B6AB 4B3TJ 3QBCA 2DIUA 4DUYJ 5DG8A 1HBOB 1M5VC 1WF0A 2Y1RI 4O0IA 3NMRA 4F4KA 2KFNA 2UUAJ 3UD4P 5J1EB 2MJUA 4LFAJ 2DTJA 1W2IA 4UF4A 3SV3A 2IDEA 3RRGA 2V0JA 2BJ3A 1RADB 1REVA 1YK9A 2AX0A 3C15A 1HPZB 5IM0A 5DLFA 4ECUA 3LP0B 4CRJA 1JNZB 2HVHA 5EHHA 4OIXA 1WG5A 2D74B 4I69A 5K20B 3T5HA 3CGIA 4NMLA 2TDTA 4YN3B 1FA0A 4X4SA 4OYAA 4N8NA 1TQLA 4PKDB 2YNGA 3Q24A 3BF4A 2OTLS 2N71A 4ED6A 3MM8B 4DPOA 3VALA 4G6VB 2HAIA 3MC4A 1O5JA 4Q5VA 5ETQA 4QWBA 1IWAA 3WIVA 5M2RA 2HHQA 2NZ4A 5A0YB 1BC6A 2ZVSA 4OHWA 2DXFA 3CMQA 2GVDB 2OU2A 5KFTA 2UVUA 4V1Ak 2ZD1B 3TZXA 2YWHA 2DNKA 3CVKA 3GV8B 3HVWA 2VODA 2AKWB 2XMUA 5HMZA 3OHAA 5KFXA 2DY9A 1HD1A 1PC4A 2V9WA 1MWYA 4OJGA 2PMHA 4K6RA 1NEEA 2W2PP 2FDNA 1ELOA 3GJSB 4HDGA 2XSJB 3W9IA 4R36A 4LSLA 3H8YA 2AGQA 5B0AA 4Q7AA 2KYXA 4WBFA 4ZLPA 2V1CA 1OVOA 3RB4A 5DAEA 2BE2B 1FARA 1M1GA 1DQAA 3HMJG 4Y2KA 3B4MA 3MDFA 2IBKA 4EQYA 1D8YA 3JTOA 1IVZA 3JQJA 3I96A 1LWFA 1T3NA 1V1IA 4ZN1A 3EUNA 3PHTA 1KHVA 4R25A 2J0WA 1RZMA 1CC7A 3M8QA 1CSJA 5IXUA 2P2CB 3HVAA 1RT1B 1KN6A 2V0IA 2E7WA 2PC6A 4DWIA 1RKIA 3SCKE 5FLXY 3VNPA 3TISA 2VD4A 2Z57B 4X66F 2C2DA 3TOBA 1EP4B 2Z4PA 5A2QU 4UUWA 4NI2B 4QZVB 3HVRA 4N69A 2VBYA 4KC5A 3T6BA 5BXIA 2O66A 3X3UA 1UETA 3TOAA 1VS3A 2HQ3A 1MWQA 1F9FA 4ANEA 3SMZA 1YITS 3Q8QB 2ZH2A 1F60B 4KH0B 3TQEA 2XMKA 1FI4A 1N36F 1YP3A 3KHLA 2ZH9A 3N79A 1N88A 3SSQA 4DN9A 3IXQA 3MPYA 4EK2A 5T7LA 2EFVA 3ILJA 4AFFA 4DSKA 4HT5A 2FHKA 1EQMA 2IC7A 2A6MA 3DLKB 1SKSA 2DJWA 3UDLA 4HI1A 1S4EA 5KFPA 1U0HB 1V3WA 2V2ZA 2PEBA 3MPVA 3AQOA 2X52A 2WK4A 3FEYB 4K4ZA 3QAUA 3D0HE 5HVGA 2CWHA 4B3RJ 3JTNA 5E3RA 4DF4A 1HQ2A 2ZWPA 1H7WA 1IM4A 2KFYA 2BBEA 5ADXU 4YFUA 1UPMB 5F8NA 4KGVB 1HBNB 2EI5A 5DZ6A 2RH3A 2JA1A 3VVTA 5K5MA 4ZCMA 3SBMA 2UUWA 2ERRA 1SGQI 4WTOB 1CT0I 5B0EA 2QL5B 4DR7F 3QFHA 3TJ8A 5EDWA 2QZ8A 5B09A 5M2PA 1NK9A 1TAUA 2R7OA 4ZS6A 4JI1J 3DI6B 5HL7Q 3NOCA 3UOEA 5LMUJ 5EWFA 4QIGA 3ZTSA 1U1KA 3FNNA 2IA6A 2HZAA 3PYGA 1O51A 1WF2A 5J1EA 1KTQA 4KV8B 4MZUA 5KFZA 2CPXA 1XIQA 1P27B 3KYLA 2NU0I 1UHAA 4TLQA 2GA7A 3LP0A 4B9SA 2HGNA 4TU7A 4F7VA 1K7VA 1T9VA 1UWBA 4KGZB 4X64J 4USKA 1UVGA 3DN9A 1V6HA 3T57A 3IP0A 3G6VA 2YNHB 1HMVB 3FEXB 4I67A 5HP1B 4UY85 2AJ4A 5B0BA 4UZCA 3IC1A 4M63A 3MM8A 3BSCA 3PFEA 1MROB 2KB2A 1YBTA 3UI3A 3GCXP 3VAJA 4ES3A 1IR2A 5A0YA 4KTQA 2GMJA 2CQ0A 1QUVA 2GVDA 3OVAA 2JYYA 5E5NA 2ZD1A 4P7VA 1HI8A 1VK3A 1SH2A 4EA8A 4F26A 2OPRB 4QW9A 5LMNF 4WFBQ 3NWRA 1HQEB 5DDOC 3MEKA 4UOCA 2ZH1A 4BWJA 4JCVE 2KMPA 1MSWD 3EH0A 2YNFB 1NSPA 1VMBA 3CCUS 5IT4A 1X4CA 4DNCA 1NJYA 1U2RA 4K4TA 4ELUA 3ENAA 3JQKA 4I6AA 1WC6A 2IFXA 5K8NA 2XMTA 2GCFA 3HD2A 2YWWA 3T1HF 4Q0BA 4NX9A 4O3SA 3W9JA 2DCLA 2B51A 4FCEA 1M5HA 2ACYA 3HJJA 4DSEA 3T9NA 1RBLA 2HS4A 2E7XA 2PO4A 2BJEA 1VBZA 3H90A 1NDLA 2X1GA 2ZEJA 1QM9A 1RT1A 4DV4F 1LQ9A 2R7RA 1VIOA 1Q4RA 2C3UA 2VHEA 4J9NA 2C2MB 1NSAA 1HM8A 4M5KA 1KRPA 1EP4A 2VFTA 2M88A 2HVDA 2KVQE 4NI2A 3RAXA 2AT1B 1QRLA 3R1WA 2RU3A 1X8DA 3CD6S 2D3UA 1BUSA 1PCAA 4M98A 4MIBA 3FMWA 2ZE2B 4IHHA 1PKUA 2F3JA 5AJ3J 3KHRA 3Q0AA 2JVOA 2UUBJ 4TQSA 2V0HA 3CC2S 1LXNA 3SV4A 2W0TA 1HI1A 3MAQA 4PXBA 2MZJA 4IKAA 2KG0A 3KXDA 1DTTB 1Y1BA 2H5JB 1FTRA 3TJQA 3ZTQA 3DLKA 3HHLD 1T3OA 2BM1A 2Y1IA 4HI2A 4RNNA 1U0HA 3RZAA 3CCLS 5J1PA 2QE5A 5A8WB 3FJ2A 4X66J 4XDDA 4J09A 3F56A 2GO8A 5C24B 2AYMA 2AJFE 2XMJA 5L9NA 4DSFA 3TWDA 2AEFA 2NXCA 3MEEB 2Z2LA 3H5XA 3K5NA 2POKA 4XTTA 2VQFF 5KFYA 3TO6A 2OEKA 3CCSS 1FY7A 1OY6A 1WEXA 1RWUA 3GPAA 4XK8C 4SGBI 5DG7A 1HBNA 3EVMA 2OAUA 1GK8A 2MQMA 3TI0A 3NCRA 3S6EA 1N36J 1U4BA 1K0VA 2UXBJ 4M28A 2BE9B 2F8HA 3P6YC 1VQ8S 4F4WA 3OH4A 1K73T 3OH2A 4OZ2A 3RU0A 2DNHA 1BMQB 4J9MA 4JYAJ 3OSNA 2E5IA 3VAKA 3JSMB 2MSTA 2MZSA 1DS2I 1T9WA 3GR1A 1MR7A 2EC0A 1FVSA 3DI6A 1SSTA 1RQ0A 2J0SD 5LM7E 1SL0A 3IBCB 4F4AA 3TYTA 1Y4ZB 2AGOA 2D69A 4CO5A 5KFIA 1S12A 3HH2C 2IBOA 4KV8A 1OIAA 2J8SA 4CLFA 3HJFA 1CLFA 2LA6A 4OLOA 2XLKA 1PTRA 4C0OC 3LP1B 2HRYA 3QAHA 2DRDA 4PZVA 3RTVA 3DDIA 4I6WA 1BMOA 3HI9A 2KM8B 1HBUB 1U1NA 1Q8LA 4TYBA 3MMCB 1NH7A 1TBQR 1LWXA 4G65A 2ZH5A 4DLGA 3CULA 2YNHA 1SB6A 3L9ZA 2PGCA 1HMVA 3CJSA 4DR7J 5HP1A 2YKAA 3PX6A 1OO0B 4MFBB 2PMWA 5KFLA 4ETXA 3CW2C 3L7OA 2MKSA 3J7YU 1MROA 1RABB 3QWUA 2V4QA 2F7VA 2EWHA 2V8HA 5KFOA 5L46A 5KG0A 3C46A 3T41A 3D6HB 1IUJA 1KRVA 2X7IA 1RSCA 3WX8A 4FKYA 3PNIA 3QJPA 2FVPA 3DRRB 1DJ0A 2ZWOA 2WBMA 4EMDA 1Z1ZA 1RA7A 2OPRA 2YQPA 1MT1A 1ROFA 1HQEA 1N0UA 3PYFA 4FNHA 5C2GA 2QC3A 3JQMA 2YNFA 3HHLB 1JWWA 2MZQA 4C2MA 1N56A 3EPIA 3BFPA 4CLWA 4OQJA 1YJTA 2E1PA 2V8DA 4ZVEA 1U6BA 2W4DA 4YB1P 2N82B 2Q3PA 3BJIA 3P8BB 4USUA 2HHXA 4FBUA 2SGPI 2H9ZA 1U7LA 2FTRA 4GKJF 1QVGR 3MMJA 2DKVA 3CJ5A 4H4KC 2C3OA 2V34A 3MAHA 2VG6B 1N52B 2QMUB 4DR4F 4ZITA 4Y65A 3RG6A 3W2VA 1SL2A 4Y28C 2AQ4A 3I5BA 3EGZA 4ZVGA 4N41A 1GQEA 3OW2R 3AA9A 5LMNJ 2G0IA 2OMOA 1XHDA 2W9BB 4LQ3A 5KFCA 5EX0A 2IIHA 1RU1A 2HWTA 5DEMA 1TELA 3H42A 4HL9A 2ZE2A 2ZOGA 2HQCA 1S57A 2P8IA 3KJVB 3FQLA 3M9NB 1HBMB 4CWBA 3BN4A 2CRLA 2CJQA 2CADA 4DV5F 1BQXA 1SSMA 1Y11A 3DLGB 3I5AA 1DTTA 3EGNA 4JBCA 2CG8A 4DV2F 3AOAA 5HAOA 3MECB 3C19A 2NU3I 1RJJA 4L9MA 2DGXA 3QNWB 2HEKA 4L73A 1T02A 5CYQB 4LQ9A 1PPFI 2W7PA 2VJVA 3EDQB 5KG2A 5KT4A 5A8WA 1G3OA 2FJWA 2BMBA 4F2RA 3PRDA 5HVHA 2VL1A 5C24A 1P9ZA 4IQMA 1S97A 3Q86A 4M9CA 3FTTA 1GXUA 3Q8SB 2BUNA 2ATLA 1NHVA 1CGII 4ECQA 5KOXA 3IGNA 4GKKF 3E59A 3V6DA 1IW4A 4WWSA 3UW1A 3KJQB 2M70A 3IO1A 2VJUA 3P5BP 4NA3A 1YG0A 3H0PA 3R2CJ 3MXHP 4WP8A 2YY3A 1YTPA 4IOAQ 4O44B 2CQIA 1MJ9A 4TQRA 1C2PA 2ZH3A 3O5TB 3VGVA 5H9EK 5H9FJ 3PFOA 1FNOA 4ZPWR 1B3TA 3SXLA 3JSMA 2MY7A 3TVKA 3GG1A 1MWZA 2FZKB 3C16B 2F4VF 2WVEA 4FVMA 1M8BA 2FY8A 1EJ7L 2LA4A 2QQDA 1HEVA 3QJJA 4LRFA 3SQOP 1UTAA 2GFFA 1OMSA 1WOOA 1EIYB 3V6KA 1AT1B 1H72C 5A6WA 2VQFJ 1XWLA 3HSQA 1SJQA 4OJHA 5KFKA 4B9NA 3LP1A 1WC0A 2XMAA 3F1XA 3VBPA 2A18A 3MFHA 5IT9U 1X5TA 1HBUA 2G2ZA 4G1IA 2OSRA 4B9TA 3MMCA 1KSPA 1FT8A 3Q22A 4L76A 5LT5A 4Z2XA 1J5OA 2MQ8A 3K89A 3HSDA 2W0WA 3J7YI 3ZZYA 4MFBA 1J2VA 2FGOA 3U1LA 4EO8A 2C2RA 2CPHA 1FKAF 2CPFA 2WVJA 2ZKTA 4YHHJ 1RBOB 3NS5A 4H54A 4AA7A 2FJAB 1FAQA 1X5SA 3R1HA 1S59A 5BR8J 2GGOA 2DR6A 4B02A 2QLFB 2H5IB 4RW7B 3CF5Q 1RT3B 4JI2J 1RB0A 1ZM9A 2DO4A 1UZDA 1WOPA 2GMHA 2RILA 5LSLA 5B08A 2HHSA 1U1RA 4OL8A 4YB6A 2D1CA 2AX1A 5KT7A 5F42A 3ISND 3EEVA 4DX8H 5L1IA 4MK9A 2K3KA 2RJZA 2HHTA 4C8MA 7AT1B 3D28A 2KI2A 5HQ8A 4AQYF 2YH1A 3GQ8A 3R5AA 3Q8VA 2CDRB 4DSIA 4J9UE 4CLUA 4K2JA 1A6LA 1S1UB 4I2PB 3MPUB 5J2MA 3BV8A 1KLMB 3VBMA 4E98A 2VG6A 4U67Q 3L7PA 3GQAA 1SQFA 5A8RB 2N7CA 1XX6A 2W1BA 3LTOA 1ZBTA 4H4MB 3ZXWA 1SGPI 3I0SB 1SL1A 2LMIA 1YSJA 1UWAA 1PGZA 5D4LA 3JYTB 1UAWA 3CO9A 2W9BA 4J90A 2B7BB 4YY3J 3QWPA 2A1BA 1KRUA 1XTZA 1U0SA 4LJMA 3KJVA 4OZ5A 3M30B 1SKRA 2AJQA 3SDEB 2GJIA 3HSGA 1HBMA 4X4RA 2UU9J 4ZVFA 2HNYB 4QWDA 2CPJA 2P9EA 4U7UD 5DQGA 1OCXA 2QIAA 4I68A 3P4UB 3DLGA 1QUPA 4AE5A 3P96A 3MECA 4PQUA 4JV2A 1M0SA 5DDRC 3OR1B 3KK3B 3RAQA 3HK2A 2XMMA 2XQCA 5CYQA 4DR4J 3S7RA 2UVVA 3QZ7A 2VQEJ 5CCLA 1S0MA 4QOTA 4F25A 2KT2A 4UY8T 3D3BJ 1KK5A 1SCJB 2FHOB 4LVNP 3BO3A 2GIQA 4MYUA 2C3YA 5KFBA 3B4VC 1SC1B 4Z7YA 3NKYA 2QA4G 3T6JA 3UNGC 5IWAF 3B4DA 1HWLA 1C0TB 1RHUB 2W4CA 1RT7B 4DL4A 3B54A 3HZEA 2Q6CA 1ULNA 1KONA 5HVFA 1Q8KA 3TW0A 1YLXA 3G87A 3DJ4A 4LRBA 4O44A 2YPYA 3FRZA 1XNQF 1Q9BA 2WW4A 1U6FA 5JXSA 4DV2J 3C6UB 3ECTA 2HBRB 4DFKA 5CYMB 2DB6A 2MQLA 2Y0MA 1QRFA 1Q78A 4RLEA 3OUYB 1S20A 3C16A 1HWUA 5KFGA 3KG1A 1TBOA 2QIVX 3KG4A 4BS2A 4J9LA 1JLCB 4HZCA 5F8JA 4BLGA 4C98A 2VKZG 3P45B 2VFSA 4WCEQ 3CE8A 4JOUA 5I4MA 4YR3A 3F73A 2QL7B 2XLIA 2X51A 4DQPA 3D9BA 1ULMA 4GKKJ 2XZDB 4WFXA 5I3UB 3GFZA 2J7UA 3M6VA 3NGDA 1R89A 2KN4A 3NGTA 1SBRA 3MM6B 4CTAB 1WKXA 1NMEB 1X0PA 1IY5A 2ADCA 4AL5A 2NXEA 3OH3A 3CDAA 2CFXA 1KD1T 1EB0A 1S1XB 2YX4A 1RTDB 2OVOA 2NU4I 2V0KA 4Q8FA 4NOHA 3PEHA 1QSSA 2ROGA 1NSKL 4X4QA 2ZM6J 2RE1A 2YKMB 4C97A 1QAXA 1IBMJ 4LF9F 5HQMA 1H73A 3KUEA 1NM2A 1PYTA 3SQGB 2F4VJ 2OJ3A 2HFVA 1R8BA 4K0KJ 2MKCA 4EZ6A 2SGEI 4RW7A 4HDHA 3EYZA 2YH0A 2RQ4A 3ITHB 3V4IB 1CG2A 1BD6A 5D77A 3CJ8A 4F36A 3QGGA 4DUZF 5E7OB 1FXLA 2VBZA 3ULHA 3D54A 3PKMA 4W92B 3DU6A 3NNHA 2FLOA 4ECYA 4ZIWA 4JV5F 3BO2A 3QSIA 2VF3A 3PW2A 1TKTB 2XBPA 2HIQA 1HM0A 1I51B 1QSYA 4A8XA 4Q44A 1QAIA 3FQKA 2XCPA 2QEXS 2AF6A 2B5JB 5ADXV 2DITA 1S1UA 4I2PA 3AB2B 3NLCA 1YJNS 1XMQF 3O1LA 3MCNA 1GAOA 4F3MA 2MKJA 3SCLE 2B3TB 2MLXA 2EK1A 4ZP9A 4ISXA 2CJKA 3KWMA 3BBBA 4OMFG 4M95A 3QGIA 5A8RA 1YJRA 4P71A 2JJ4D 3IRWP 2VICA 4CP5A 2ZJRQ 2KCXA 1PBAA 4H4MA 1IKWB 3AJ1A 4CH7A 5KG4A 2FD2A 3I0SA 7FD1A 3UVJB 3JYTA 2O1PA 5D4NA 3AD7C 3M05A 2PT0A 2YWKA 1I3OB 1Y00A 1DZ5A 3SUCA 3EM1A 1SSQA 4WIQA 1WI6A 5FUWA 2Y3YA 3M30A 4AQYJ 2QT7A 4USWA 4A24A 2LECA 2HNYA 3NAHA 2C2NA 2VOPA 1XA6A 3F0NA 4KGMA 5K8PA 1ACMB 4LSNB 5CQGA 5G4DA 4DFPA 1NU4A 2NR0A 2DXEA 1N33J 3GIRA 2Z2ZA 1PBUA 2CNOB 3OR1A 1UEKA 3KK3A 3P5TL 2QFIA 4N77A 2CJYB 2W7AA 3OR2B 3UN3A 3NRBA 3FK4A 3RJMB 5DRKA 4DI6A 5GAHU 3TRGA 1WKJA 3BSOA 3T5LA 1RU2A 1SQEA 2BEFA 3AXKA 4FXVA 3DLLQ 3TJ9A 4FYWB 2R8IA 5CABA 4X65J 5D78A 4I64A 1OWXA 4AMLA 1C0TA 2BJDA 2VPXB 1N4IA 1RT7A 3GFYA 3K58A 1SVDA 5CCMA 1S49A 1FXJA 1WF1A 4RW6B 1Q7LB 4M2AA 2DR9A 3KY9A 2MKYA 4CT8A 3ADAC 3UGIA 2HVZA 4QWAA 4TU8A 3C6UA 3AJDA 5CYMA 2L48A 1HW9A 5HANA 3OUYA 4B3SJ 1IJEB 4PCQA 3OLBA 1VQMS 3BGUA 2NPIA 2DCUB 3IG1B 3X1LB 3MURP 4LF5J 1JLCA 2CQHA 4ZP6A 2OLWA 3OL6A 3W62A 3FZBA 2I1RA 3IBWA 4KQLA 3EZ5A 3MR7A 3PCOB 4IG3B 4H4OB 2Z30B 1RYRA 2IRYA 4NLPA 1F1BB 5I3UA 5IC4B 1MN7A 3KMSA 4IFYB 1HPTA 3MM6A 2HHHJ 4CTAA 2IY5B 2B7CB 2DPJA 1ZAWA 4DQIA 4PPDA 1NSQA 3BDPA 1U49A 4DCPB 4ZLJA 1FYBA 3NP5A 1E6VB 1S1XA 4URSA 4X4NA 1RTDA 4DN0A 4ES1A 1TMMA 2AD9A 1MNEA 4YB5A 2DGTA 4Y2MA 5BYRA 1P1TA 2YKMA 2QSFA 2DEJA 2WVFA 1B7FA 4BHQA 3QT7A 3UD5A 3LUYA 4PYDA 3SQGA 1HHQA 1R27B 4C8KA 3KUHA 3MI7X 2BOPA 3J80U 1S6UA 2I8EA 5GVQA 3G8SA 4ED7A 4R7PA 1BLUA 5F8LA 4URQU 3ITHA 4F4YA 3A4TA 3V4IA 2CJXB 4LF1A 3WIUA 4WU2A 2HAFA 5IV4A 3M8WA 1S1TB 3KK1B 2KXFA 1IKYB 1UL3A 3G8QA 4PUOB 2JH3A 2BOAA 1YIJS 1LW2B 5AXLA 4R0EA 3FBFA 3M4XA 4AT1B 4KB7A 1I94F 3D1HA 1FTCA 5F3ZA 2DT9A 4XPCA 3CO0P 3MEDB 5HBMB 5FJ4A 1X4HA 4LFBF 4RZRA 2FVQA 1N5QA 2X1FA 1M5OC 4UQTA 1SUQB 2IM3A 2B5JA 4AUKA 2IDLA 3FDSA 1BE4A 4CNZA 7FDRA 4E2FB 1H6KX 1NK0A 2OPPA 4DX5A 1R79A 3V2UC 2JW6A 5KFRA 4RPFA 4ZLNA 4EZ9A 2VIHA 4LF9J 2GKTI 2E9TA 3FCWA 1S76D 1JLQB 1RLCL 3VAMA 4DR6F 4I2QB 1RXOB 2HHUA 4K4XA 1WHVA 3AD9C 1IKVB 1IKWA 4DPTA 4HR2A 2E9RX 2B9WA 3GTYX 1FFSB 2DO0A 5M2UA 1L3UA 1YKWA 3GJQB 3MCOA 3VDPA 2IRXA 1X4EA 3TUPA 2B9YA 4ZVSB 1XNRF 5GMKa 3HHKA 3RR7A 3Q8PB 3SIPB 3PEJA 5EN1A 1D3WA 1LKZA 2MGZB 6FD1A 1F6TA 1X9SA 1GMUA 2KT5A 4M5DB 2XY7A 4LSNA 4RNOA 2VG5B 5KFWA 1RTIB 1U8SA 2CXEA 4TLRA 3M6XA 5GAHI 5K9FA 3DMJA 1N32F 2R2TA 3OR2A 3UWTA 2E73A 3VHQA 1RWXB 2M5YA 1OYVI 3MUMP 3K8VA 3G6ES 2VBWA 2YWGA 2ZC3A 4MYTA 3W5ZA 1Z7KB 1KQKA 3RUBL 2E1RA 2VG7B 4NLRA 2GAGC 3ZZZA 3D0IE 3KOAA 1PYOB 5U2KA 1RISA 1CJKB 4RX6A 2V1CC 3I4PA 2XHWA 5F0UA 4O23A 1YU6C 2JF2A 2UXCJ 1F5BA 1RWPB 5BYQA 3W5YA 2H1YA 4RW6A 2FY1A 1PYSB 2A2CA 3OTZA 4PYAA 4RNFA 5I42B 2RHSB 2VPZB 1KEKA 3VBJA 3KK2B 1URRA 3PG9A 3G9CA 1TUVA 2CNKB 4ZCLA 2CJBA 3QMQA 4CM0A 2CZ9A 2MLYA 1HWKA 3DFEA 4E0DA 3HPOA 2GIRA 4ZJLA 2F8EX 4JUZA 4DPUA 5LXRA 3CTRA 2ASYA 3EPGA 4E79A 5IQQA 4I6YA 2M8DB 2W25A 4JI7F 4JI0J 3TIOA 1W7WA 5KFAA 4YEAA 4IG3A 3R1LA 1YDLA 2ZHAA 3GIMA 2AIRB 4JI4F 3FVYA 1WTFA 2XG8A 2DNMA 4FF4A 1FWKA 4MIAA 3R97A 4AL6A 1SPBP 3L3CA 1RHQB 4HACB 1GFWB 5KFSA 1E6VA 2CG4A 2V63A 1BWEA 3MR3A 4KPZA 2MPUA 3MZIA 1CGJI 1J5EF 4M5JA 5ETLA 4DQRA 1CBKA 1Y5IB 3EVOA 3K5LA 3AT1B 4KFBB 3UEYA 3M6WA 3WC0A 3SRTA 3GV5B 1RCOB 4P6QA 2IRUA 3HX9A 2KTQA 1KBRA 1OSCA 1T9XA 2IU9A 2Q43A 3GLJA 4BWMA 2W7OA 1SGDI 3KK1A 1T11A 1UJ5A 4HTJA 4IOBA 1IKYA 4DZDA 3JAMY 3CCES 4C3LA 3D6MB 1WC1A 4PUOA 2HWIA 2BV3A 2L9DA 1LW2A 1MU2B 2DKOB 3QLHB 1RWWB 4ZPCA 3IGJA 2PA3A 4C8ZA 3QSYB 3UR3C 3DYAB 2HSEB 3QAEA 2ASLA 3MEDA 5HBMA 1FD2A 4HT7A 1JJ2R 2DR5A 5AXMA 4WFAQ 3TV0A 1SUQA 2MSSA 4F02A 2KVIA 3PMOA 3H2UB 2PSZA 3R5DA 1F0XA 3HCXA 3RB3A 1FRIA 2XY6A 1U09A 3N6LA 3U27A 4ECTA 1JLQA 4AAWA 4I2QA 1VYAA 3AJ2A 1OJ4A 4U8YA 1TOTA 1QAYA 1FJ7A 1R8CA 1IKVA 4JV1A 4L3NA 1YTYA 2H65B 3NOGA 2LUYA 1OYDA 2BJ8A 1ZM2A 2V4RA 4CYUB 5JVHQ 4OI4A 3LPYA 3OV7A 3WDOA 2GC8A 3H4DA 5A8KB 3I5CA 3Q89A 4DUYF 1N5SA 5DG3A 2Z56B 2CJAA 3M2UB 3VAFA 1ZZFA 1DS3I 4NCAA 2UUAF 2FQQB 2MJNA 2MGZA 2KT3A 4LFAF 3HFVA 4OHYA 4LFBJ 2DH7A 3E01B 4DQSA 5HI7A 2E44A 1IN0A 4OZ1A 4LF7J 4M5DA 2VDIA 1JXVA 2VG5A 2K3IA 2NREA 1RTIA 1NKBA 2ENNA 3V5RA 3OL8A 5C7PA 2O67A 3TZYA 4FS1A 5DEPA 2DNQA 3WX4A 1TMJA 1R0AA 2PFDA 1S6QB 2N3OA 2DVIA 5H1SV 2CQ3A 1FHTA 2OEGA 4P72A 2VG7A 3CXLA 4ECRA 1LXJA 1S0VA 3HFZB 2DNGA 5MLCV 4DR2J 4PWUA 1U24A 1XNRJ 1CJKA 4NLWA 4R0JA 4KHMA 2VONA 2ZVIA 2MEWA 3BSYA 1Z2IA 5AFUU 5E33A 1MN9A 3NBPA 3KMQA 1U6ZA 4RL1A 4PRFA 3MQGA 5I42A 3KK2A 4PG8A 3D66A 1FDDA 2NS1B 4PXDA 2SGDI 2E1CA 4UW2A 3MM5A 5MAOA 1N32J 3CC4S 1VJQA 1RA6A 4ECVA 1AW0A 4LUBA 1SGNI 1A7GE 4K4WA 7WGAA 4N27A 3P1BA 1NPRA 2GHVC 4J37A 1T95A 4EYIB 1X4AA 1D09B 4OHZA 3IAS9 2DBBA 2BXJA 4M5GA 1FJEB 2RUGA 1WOSA 1K1SA 1WD6A 1JJHA 4TY9A 4ED4A 5CXTA 4J7CA 3K17A 4MIWA 3MUVP 1XBTA 4C8YA 1S77D 2UUCJ 1C0UB 2ILZA 4TY8A 5CD4A 1RAJA 3D5MA 4LR7A 3CWJA 4DS4A 2NYIA 2IVYA 4HACA 3HFKA 1I5OB 1S72S 4LRCA 2BQUA 4IRDA 1SIZA 5J2PB 4B08A 1MRLA 2DK2A 1FRXA 4R37A 2M3DA 4DEZA 2V4JB 4XAKA 2WVDA 2OEMA 4KFBA 1HW8A 2F9JA 5F9NA 3SPTA 1R7IA 3EG4A 5H9FK 4DBQA 2J7WA 2QLJB 2H4WB 1XJWB 4JI7J 2DY1A 1NRKA 2DNLA 2V67A 2YUUA 1S0OA 3AODA 2F8MA 2HW3A 5D4OA 1X5PA 4JI4J 2VH7A 1FRJA 1MU2A 2FJEB 3QLHA 2EPIA 4DCOB 2MZ1A 1R43A 5EGYA 4OYZA 1TUGB 3DYAA 3FBCA 2HK3A 3OH0A 2CWGA 2LXIA 3D1QA 4F0HA 4CDIA 2FZGB 4PEOA 5I3QA 1Q79A 3V6HA 5GAEI 1FEEA 2BACA 1IR0A 4WKRA 2CKWA 4UXHA 1RT4B 1KQSR 1UFKA 2AJ0A 2DHHA 1WC3A 1ICEB 3EJMA 3BKTA 1ZA2B 3GIIA 2HZVA 4ZA1A 3AA8A 3I32A 2EG1A 1QD1A 1WI8A 3R8YA 4EU0A 1FFGB 4HZDA 4JI6J 2Z2MA 3NMAA 3TR5A 4DCJB 2PD1A 2VU5A 4IO9Q 5DQHA 3GIKA 1LK5A 4J5OA 4JI1F 4CYUA 1HD0A 4A48A 1T94A 5A8KA 2LU2A 1UUCA 1ZOTA 2RC4A 3A8KA 1F2GA 1IBLF 3FSYA 2D3O1 4P9SA 3M2UA 4GMKA 2I5KA 2Z2YB 3DRSB 3UN2A 1HI0P 3PW5A 2APOA 2XATA 4WZMA 3E01A 2GO9A 1CT4I 4M8LA 2GQQA 2EFOA 1FJCA 2NZCA 2CPYA 4C9DA 2IYGA 4ELTA 4DDFA 3HT3A 4E1KA 2WTFA 1S7IA 3TO9A 3J7Z5 3N5FA 4MKBA 1HNIB 1U1OA 4IR1A 1DTQB 3PO4A 5A2QY 2GVZB 4HTIA 2PQ8A 1S6QA 2B56A 2XULA 3KWEA 1SGEI 2ZBPA 2HIYA 4F3OA 1SC6A 3F44A 1JKHB 2ZFHA 5DGAA 2XO7A 2W24A 4IOCQ 3BQ1A 3QZ8A 1HKAA 3DKDA 2QA2A 4FYDA 4ED2A 4NLVA 2B9EA 1S5ZA 2GAHC 2OI2A 2ZZMA 1P8GA 1VQ4S 3OGZA 3FMBA 1NUEA 1H2UX 2G0JA 2LCWA 3F41A 4C7QA 4ERDA 4RR5A 1TFYA 3NGKA 3D2WA 1N0VC 5DDQC 1Y10A 1EAYC 1G1XA 1ZAVA 2P9CA 1H7XA 3RRHA 2CQCA 2X1AA 1NDCA 2CQBA 3ZZRA 3FEZA 3EE3A 4J9SA 2C28A 3PKYA 3GZ7A 2V0NA 2CQGA 4F3QA 2BE7D 4KYZA 2ZH4A 2VA3A 2FYXA 2NUHA 4LIWA 1EX8A 4AYBD 5B0DA 3HM9A 1F3VA 2NSCA 4B9UA 2ADBA 1BQMB 5ETVA 4R8UB 1RT5B 3PJ9A 1QRGA 4U6PA 1AUDA 1S79A 1C0UA 3MF5A 3LH2S 5ETMA 1QAJA 2XGQA 3GQCA 4DL5A 3KLVA 5J2PA 3D1OA 1L5UA 1HNWJ 4NXNJ 4GI3C 1N5YB 2G13A 4NL5A 4ZCIA 2R42A 2BA9A 2V4JA 5AJ3F 4UT4A 2XI3A 2UUBF 4E75A 3R2WA 1GMWD 2FVSA 1Q8BA 4IH7A 1N6QA 1ULRA 2QTWA 2OEJA 2HHVA 1RAFB 2W9AA 1IR1A 1B7YB 2HLUA 4IHGA 3CEDA 2EKYA 2N52A 1JLEA 3N28A 2OPSB 3UGLA 2OEFA 1PC5A 3FCHA 1Q95G 1H38A 4FN5A 4YR2A 1RBAA 5IFMA 3V81B 2R8GA 1DQ8A 3MTJA 1V9OA 4X4UA 2COLA 3AH6A 1UJ6A 5DM7Q 4ZVQB 2J6TA 3CT9A 2KZZA 2JZMA 4Y00A 5DGBA 3DLBA 4F50A 3BQ0A 2BRLA 2B9XA 3SFGA 5CA5A 2KH9A 3CCRS 2NU1I 2JEGA 1FJGJ 2ORVA 2K2PA 2JVRA 1RAAB 3Q2SC 2ALYB 2R7XA 3IRXB 3CIZA 2WAQD 2QQCA 2H48B 3NS7B 1E6YB 2W01A 4LF4J 1T8EA 4W4MA 1R0CB 1VRUB 3OXGA 1RP5A 2UXBF 1NK8A 4ZCKA 4M99A 1Q16B 2OH2A 2OI7A 2YKOA 2RRAA 4USTA 5E3QA 1GT8A 4DJBA 1HL6A 4JYAF 2CWFA 2E5JA 1OPIA 2W8LA 2QQEA 3PY8A 3R5BA 4ES2A 3NNAA 3GB0A 3QJLA 1UVFA 3UE2A 1XBWA 1Y7PA 2IJNA 3DU5A 4OYMA 1X4DA 2RHQB 2E5LJ 1QREA 2L8EA 1SIWB 4MKVA 2F65A 3A8JA 1U02A 3OVBA 4A8SA 4ZDNA 4LF8J 2QV6A 4M5LA 1T7PA 3DRSA 2XRCA 4LIRA 1UEUA 2QA1A 2B4UA 2GZOA 2IPOB 4ILMA 4WP9A 4WE1B 3NXZA 2OTJS 2KRRA 1DFDA 2VHGA 4HHJA 4O3OA 1T9UA 1S9GB 1RUSA 4ED3A 4M5NA 3VBKA 1FRKA 2I2YA 3RBZA 2HMIB 5K8MA 1HNIA 4U8VA 3W7BA 1Z2ZA 2H5EA 3QRPA 1DTQA 4YB7A 1Z2FA 2GVZA 1CHOI 1K8AT 3IS9B 1YJUA 1JKHA 2C42A 2B4VA 2EFGA 2RB7A 3GSDA 4CO0A 1B64A 2J6SA 2VPWB 2IM0A 2B6AA 1TL7B 1TL4A 2YBVA 1S48A 1D9AA 4DSLA 1HBOA 5KFVA 1I6JA 4HUSA 1IBLJ 4TYAA 2IVFB 2RQCA 1RWVB 1OMUA 4WP3A 3MUTP 4A8QA 4LF6J 1F5AA 1HPZA 1SI9A 4ZK7M 3P49B 4OHXA 1CE3A 3KLHB 2ZH6A 2MLZA 5AXKA 4GC7A 2HVEA 4NZ6A 4NZ7A 1VR6A 3TX8A 1RT2B 3MOJB 4O3NA 2P6SA 4F8RA 4JB8B 5LXYA 4LVOP 1UVIA 1FERA 3R2DJ 3MR2A 4K59A 2XYHB 2KHCA 3SCJE 3KLFB 4ELVA 3I0RB 1QQ0A 1YQHA 2FHJD 3K5PA 2Q66A 4A8WA 2VPYB 1CJVB 2KJWA 1BQMA 2XWXA 1S6OA 4KY3A 4R8UA 1RT5A 4FP9A 1TURA 3VR1A 4OYIA 3C3LA 3OSPA 4L6V3 4ZVOB 5J1NA 5IOLA 4CT9A 2JEFA 1M5PC 1NK4A 2W2OP 5HSPA 4LFCJ 2KYZA 1KBFA 4C6AA 2ZC4A 5KT3A 4KT0C 2ABYA 3CIMA 5SZTA 3Q2TC 2FPHX 2OSQA 4O0NA 3CC7S 1AN1I 2NXJA 1N5YA 3I3AA 2CJ9A 1TIHA 1HQUB 4D3GA 4WJBA 2XSJA 1WHXA 4JI8F 2KKHA 1KR4A 3W2WB 2PI5A 3BH6B 2AYEA 4DL3A 5D3GB 1MW7A 3MPWA 1S1WB 5JUMA 1CS4B 3K7RA 4QR1A 1PAUB 2BE2A 3UQSA 2OUGA 3C14B 3LOUA 5LOQA 4DV0J 2OPSA 4Q45A 2IJFA 4NCGB 2R7TA 3NCPA 4RW9B 3NGUA 1APSA 1TL1B 3V81A 3FOQA 1Y3KA 2HRUA 4KIAA 2QMXA 2BVZA 4DR1J 3D6TB 4J9KA 1DARA 5HMXA 5KTQA 1VHFA 5HQLA 2R7UA 2FJVA 1LR9A 1B70B 3KNAA 1RHKB 1B0VA 2JNJA 4FBTA 4WFZA 1LWEB 2ICXA 5RUBA 3IRXA 4GVBB 4CO2A 4GVLA 1ZYQA 1E6YA 4QPXA 4L72B 3V6JA 3PJWA 1PJUA 4GO7X 3D6FB 5DZ7A 4WK3A 1VRUA 4D3HA 1IY6A 3GWCA 1HJAI 2LEOA 3BDEA 1D9DA 3D3CJ 4WYLA 4N7TA 5KFJA 4DV3F 1KDNA 4ZLLA 4B17A 3C2PA 1U2CA 2HYIB 1BUXA 1NHKL 3CJ2A 4PXCA 4V19X 3BYPA 4PG4A 2QG9B 3QGPA 1PJ6A 1G95A 5L9XA 3C8VA 1NCLA 2ZOFA 3OD2A 4AXIA 1WKKA 1SC4B 1B0PA 4C3MA 4WE1A 3GJRB 3OTMA 5DM6Q 2K7KA 3LWMA 2G2YA 3DK5A 2IHR1 2ROWA 4TXSA 1S9GA 4FF1A 2HFOA 2U1AA 2HMIA 3N0VA 3CJ4A 2FUG9 3IS9A 2CJSC 4QYZJ 3DOLB 1QLNA 3LANA 1KGQA 4Y3CA 1FD8A 2B4OA 4RW4B 2RS8A 4CO4A 3TAMB 4QPTA 1TK5A 1RYSA 2Y1LB 3UDCA 4RW8B 1G2EA 2GIVA 2AWZA 2I6WA 4DFMA 4I0WA 2JEIA 2NPOA 3VVUA 2RKIB 1UMJA 4YHHF 2M8HA 1G97A 1Q8IA 3KDNA 2XCAA 1TGSI 3Q8RB 5BR8F 3CUNA 4JI2F 5J8FA 2YTCA 5FD1A 1XC9A 1GTHA 3AY0A 3J81U 4J9OA 1XMBA 1GMWA 4XO0A 2L7XA 1FDBA 1IQZA 5L38A 4QU7A 2ZJQQ 1PCEA 5LJ5Y 2KMQA 2ZH8A 3KLIB 3LA0A 1P1LA 1UPPA 2MYFA 3CDUA 4FS2A 3HLUA 1Y5NB 2UZ3A 3KLHA 1U8WA 4OFZA 5IT0A 3POTB 2KJVA 2GS8A 4OZ3A 4HGUA 1TKXB 4OZJA 1RT2A 1BHNA 2E7VA 5IM0B 3NNCA 4HH0A 2B8PA 3BSWA 2C3PA 2K8GA 4DL6A 1Q82T 3EGWB 2XHCA 2ZZTA 1HA1A 3KLFA 3I0RA 4PG5A 3UCUP 1CJVA 1VDHA 1AXQA 3GVDA 3OL9A 2YWFA 5KG5A 2Q1LA 4CLTA 1LWCB 2J9EA 3OVSA 3SCIE 1SKUB 2VBXA 2EG2A 4N5SA 3S1TA 1X9WA 5F9LA 3W64A 3GE9A 1JIHA 3ZO7A 3RR8A 3S8SA 4UQGA 5D4PA 2MHNA 4ZMMA 1NDKA 2VD3A 5LSOA 4LT6A 4FF3A 3LO3A 1R0RI 4YY3F 1C4AA 1TAQA 2CVIA 2ZZNA 1HQUA 3HO1A 4ZPVR 1QSLA 1RAEB 4LR9A 1N13A 8RUCA 4PQAA 5HMYA 3W2WA 3HHEA 2XS7A 2KHDA 1AYEA 2WSCC 2MKHA 5D3GA 2UU9F 2PI4A 4ZP7A 4RJVA 1V67A 2KG1A 1WTBA 1CS4A 4RKUC 3C66A 2K1RB 4TVAB 3C14A 3BPDA 2BKNA 9RUBA 4NRUA 5IT9Y 1JK9B 3PO5A 4OZNA 1X4BA 1DY3A 2CA9A 2GQ2A 1X4GA 4TU9A 3OH1A 4K7QA 4AC3A 3OXLA 2W2MP 4NCGA 1M1HA 2WOMB 3Q8YA 4RW9A 1TL1A 2VQEF 2PE8A 1S80A 2CPDA 1FX2A 1WG4A 1FF2A 1G7CB 2LB7A 1U26A 2P6TA 4DV1J 3ISNC 4KKOB 1TK8A 5ETPA 2LLZA 2QN6B 1LWEA 3W8GA 2HFUA 3VDUA 4GVBA 3RBEA 2A10A 3CNQP 3JSYA 4JI8J 1TDTA 5ITHA 3DHWC 2ZBCA 3W1YC 1R8PA 4ATNA 5U47A 1K0TA 3GYNA 4IH5A 1Q53A 3IR7B 2LQ5A 3DGPB 3QO9B 1D8ZA 1ZAXA 3IN5A 2GMLA 1RI7A 2IYIA 5AXNA 4NYOA 2EK6A 3CJ3A 2D9PA 2I5JB 3ELHA 3LGNA 2XYGB 2ZBRA 3GYGA 2HNZB 1UW4A 2QYCA 2ZBIA 4XDCA 1SH0A 3J7AN 1ZZNA 2LVWA 1IJFB 2FZCB 1OYEA 4G3IA 2BABA 3T5JA 2CPZA 2JWNA 1VDDA 1RGVA 1LNQA 3SGBI 3HSZA 3ZZ0A 1HYSB 3MEEA 1C1BB 1FKOB 4IG0B 2RUSA 3ZZOA 2EW9A 2MDAA 5B0GA 2WHOA 1N8RT 2QKXA 3E2IA 3RAMA 4LRDA 3BB5A 2WLCA 2FHJA 1NJIT 2UV8G 4H7OA 3IAM9 2GHPA 2ZDPA 4LBIA 3WHIA 1G4CA 3M8PB 4PWWA 2ORWA 1EETB 1TL5A 3IGVA 3DOLA 3R3TA 1U1MA 2EKNA 2YX7A 2E5RA 2OFHX 3TZWA 1XK8A 4DV3J 4RW4A 3ISZA 2NUUG 4PR6A 3TAMA 1CT2I 4RW8A 1ULKA 2ZM6F 1XMOJ 3OVOA 2CQ1A 1M8CA 2RKIA 2KMOA 4DV7J 1IBMF 3TARA 3G86A 1R3NA 4OLPA 2HQDA 2WBRA 5KT6A 2NLWA 1HR0F 4K0KF 4EUVA 2DGOA 4OV1A 2DGQA 2MQQA 4PAAA 1NAQA 2JLGA 2DR7A 3PM9A 1VQKS 2KO1A 1U1PA 3UEJA 1QJHA 2J8AA 3KLIA 3TO8A 2E66A 2L3MA 4DR3J 1R8HA 4ALZA 4EAAA 3TZZA 4KPYA 1FCAA 1C4CA 1WJ9A 4AXJA 4WZQA 5THWA 3PX0A 3POTA 4QIWD 3ZTRA 4WKYA 3ZNUA 2IA0A 1TKXA 3R3RA 3DLEB 3K0JA 4DSJA 4RWWA 2LQ8A 3QFWA 3RRKA 1N48A 1KWMA 1UWBB 4PG7A 3MTKA 1X5OA 2HBZB 4NEZA 3OU9A 1LWCA 3H2VE 3TAPA 2J87A 2FGCA 2VRWB 4EABA 3OTOJ 1B4SA 4A8KA 3DRRA 3GOXA 4TKTA 4IR9A 2ZKUA 1JLAB 3OT9A 2JLEA 2BUSA 4KHPF 1H0HB 2JZ5A 4U96A 4WFNQ 1QE1B 2D3OR 3PIOQ 1YX2A 1VQPS 1ZM4A 4ENOA 2DPIA 1IXKA 4RU9A 3HHLA 3VTIA 3H5SA 4JI5J 3GG0A 4ZVRB 2Q79A 2OZUA 4ETZA 1Q5YA 1NPPA 1UW9A 1KQFB 1KFDA 1KGTA 1RWKB 1M5KC 3UNYA 1CEZA 2K1RA 3OL0A 2GJ2A 2JX2A 3GP9A 4IDKB 1N33F 3CB4A 2VFRA 4WTYA 3FFIB 5L1JA 2QYGA 4C0BA 1WC5A 3ST8A 3VQSA 1RFHA 2JFKA 5F0WA 3IA0A 2WOMA 2HKEA 3BGRB 4IHFA 4Q0BB 1J2ZA 4KGKA 1GEHA 1UVNA 1DQ9A 2RD5C 3J81j 2IU8A 3BM7A 1NBEB 3CCWA 5DQIA 4WIIA 5CD4H 1M5SA 3FBBA 3THVA 4KKOA 3R3IA 4OVOA 3OQ2A 2ZHOA 2NU2I 4EFAC 4HHUA 2UXDF 4P73A 3C6TB 4X65F 3DRYA 4DFJA 4RWXA 4NCBA 4QYRA 1SXLA 4ITSA 4YDDB 3M7VA 1KFSA 2HQFA 1JB0C 2Y0BB 1MMDA 3IBFB 3D68A 4J9QA 2YPZA 2Y9HA 3R5GA 4DV6J 1YWXA 4F04B 2B8QA 3W60A 4NXMF 1L3SA 2XSFA 3DGPA 3QO9A 1WGTA 3ET6B 3PYEA 2QGFB 1YRUA 1T9YA 2I5JA 1FFWB 2FJXA 2UV8A 2QLBB 4MJKA 2HNZA 3G71S 4ECWA 3TAQA 1VGYA 1A0OB 4MPIA 4Q43A 2MZRA 3MR6A 3THTA 2RDDA 3PIPQ 3SSSA 3FSIA 4B3SF 2OP5A 3GQ9A 1D9FA 4LF5F 3QGHA 1O6XA 1NB2A 3WC2A 1HYSA 1C1BA 4C3KA 1FKOA 4IG0A 4OHVA 4N76A 3DRXA 4KNRA 2HHPA 3D7SB 4PPZA 4X84A 1ZPVA 4NZ0A 3A8IA 2DB1A 3Q1XA 3DHXA 2V69A 2HHHF 2HVIA 5DG9A 4ZVHA 3M8PA 2BJ1A 2CQPA 1EETA 2ODDA 2QLWA 1K7TA 2OGUA 4USVA 1KQAA 3DNCA 5HO4A 1IBCB 4EBEA 3JSBA 5F8IA 3MEGB 3TEHB 4DLEA 4QIEA 3DDKA 3TOQA 4NYPA 3OL7A 3N01A 1WWHA 3NGRA 4BCAA 2ALZA 2KXNB 2UZAA 2HNDB 2Q4JA 3LAMA 3CCJS 3E3XA 4PWDB 2DNNA 2FVCA 4BC7A 2RQKA 3KWCA 3KFWX 4RNHA 3QIDA 3UCGA 3CDWA 2LEPA 3GONA 1Y1CA 1I1GA 2DRAA 4K2XA 1S9FA 2CZ4A 2XYPB 4X62J 4J9PA 2ZBQA 2HWHA 4WFYA 3BKUA 2QSWA 1VQ7S 3TP2A 4OZ0A 4USHA 2YVSA 1VK8A 1YJVA 2WSEC 2B8TA 2PFFB 3AXMA 5HN0A 4Y34A 2V68A 3PJXA 5CAAA 3K5OA 1VLYA 4OX9J 3PW0A 2ARPF 3DLEA 5F41A 1JXEA 4QWCA 2V94A 1FESA 2RS2A 3KUGA 1ITPA 1NUBA 2N1AB 4KH1B 3QTLD 4CLKA 1DURA 3ILOA 3KNGA 4W90B 1GTEA 2NXUA 1QTNB 2H3EB 4DU7A 3KG0A 3RW7A 5KFQA 1RDRA 2M5XA 4NMXA 3B8HA 1HR0J 5FLXU 1HNVB 2K9HA 2XNQA 4TN2A 1U1LA 1RT3A 4QW8A 3IWLA 2E5GA 4DL7A 3MD3A 2W0VA 1QVFR 2R7QA 3DGVA 1V3ZA 1M90T 1WHWA 1JLAA 3PTWA 3MD1A 3CCVS 4E1RA 2KXHA 4QU6A 2EFNA 3FC3A 1QE1A 1RKJA 3DM2B 2QA4S 5GAGU 3W66A 3O2IA 2WB4A 4AL7A 1NKCA 4U9RA 5ETRA 3PZPA 1UVKA 1CQMA 1CULB 1J27A 4MTPA 1Y5LB 4QBUA 2XI2A 5E3CA 4RU2A 4OI6A 2V2KA 2H54B 2X1BA 2RVJA 2DH8A 1S1VB 1RAIB 4A47A 4QR0A 4BDPA 2A3JA 3ENQA 4IDKA 1SJRA 3OFEA 1Q86T 3QRRA 2CQ4A 2P9GA 3FFIA 4Y2IA 1KLMA 2JFDA 1X0FA 3H7HB 3MM7B 5J2NB 2N7YA 3LALA 2KFZA 3M8RA 2YKQA 2SGQI 5KFEA 3BGRA 1EKRA 4DR5F 4DHVA 2IC3B 3OPKA 4X4TA 2ACMA 1KQGB 1JJ4A 3BEGB 1JQGA 3PXGa 1KS2A 3TX0A 2O01C 4KHPJ 3PW4A 2FNFX 2BM0A 3M8ZA 2ILYA 2XNRA 1SKWA 4JV0A 4G87A 3C6TA 3QPIA 3W2VB 5LJ3Y 3BQ2A 3J80Y 2QFJA 3MAAB 3VZHA 2ATCB 2UXCF 4P74A 2FC9A 1W26A 3SDEA 4NE9C 1ZM3A 2GW8A 4V19J 4G1PA 1K9MT 3ET6A 1N4LA 3FBEA 1H2TZ 1X31C 4GRSA 2PA8D 3H5YA 2LEAA 2GGPB 5JJBA 2FIUA 3EXYA 3FC9A 4C4WA 2M9KA 1NO8A 2J7KA 2PMZD 5K14B 2UVWA 4FDFA 1NPKA 4KO0B 5JHWC 4OYOA 1X4SA 3SGQI 1XATA 4JI0F 4L74A 2LU1A 5KAKA 3TUIC 1AROP 4L75A 4G3PA 1FE0A 2UXDJ 4KE5A 3I87A 4F4XA 1PJ5A 4MKAA 4KSEB 1WHYA 3ENVA 3VV2B 1VQLS 1OY8A 2EBEA 1RE1B 3R6LB 5K8OA 1LFWA 2RDJA 4KRWA 2DHXA 3RB6A 3B78A 3EWGA 2JSXA 5IQ6A 4NXMJ 3NEKA 2L41A 1NK5A 2V53A 1Q81T 1KOHA 4B3MF 2VASA 3V6DB 3MEGA 2R2UA 1UP1A 3G2XA 4ILRA 3VAIA 2HS0A 4N6AA 4KPCA 3M9MB 1U47A 4YDXA 3PW7A 3PX4A 4K5SA 4M5MA 4J9RA 4J9VA 3ILLA 1EZZB 4OYBA 1OQ3A 3FZ2A 1VQNS 4OX6A 2HNDA 2PDAA 4C11B 1AA1B 2DGWA 2AGPA 2CWXA 1YP4A 4PWDA 1FKPB 4EGGA 4WYWA 3O3LA 2HBYB 2L9NA 1LFPA 1HLWA 6FDRA 2FLLA 2QJ3A 3OTEA 1WORA 3KTQA 2QPOA 4KJIA 1V1HA 2V50A 1SGRI 4PG6A 4R5PB 4A8YA 3TQ1A 2CPIA 5GMEA 1N54B 2QO3A 4QWEA 3GILA 2C2ZB 3RGIA 4DOZA 1NXIA 3EXCX 4M2BA 5KFFA 3JSRA 2VKRA 3EICA 3PRVA 1VRTB 1QTMA 1MMLA 2BYCA 4ZPTR 2DEIA 2NXNA 5ETNA 1J5OB 5B0FA 5IS2A 2XZTB 3CJRA 3R5CA 4QR2A 1HNVA 1M8NA 2F63A 2W2QP 2MB0B 4OYPA 3A3NB 2ROPA 4KQZA 2R3VA 3BRKX 2V8GA 3G4SS 2WVCA 3TA2A 2O5DA 2N17A 1S0NA 4F67A 4B9LA 5GAGI 3I9ZA 1MJAA 1NNDA 5AE1A 2WLEA 2R7WA 3E51A 1MG7A 5L1LA 3PRBA 1UA1A 2IVMA 4B6DA 3DM2A 3DC2A 1FXRA 1TKTA 1UFLA 4HCQA 4HH1A 4M5IA 1S10A 2RNEA 2AZ3A 1CULA 2VC0A 4DUTA 4USJC 1TUSA 4DL2A 5D15A 3CSKA 4FKDA 2IMOA 3CDEA 4LF7F 3KLEB 4F4ZA 2XM3A 1S1VA 4A8MP 1H2VZ 3MMAB 1VC5A 3G82B 2HURA 1HV9A 4Y2AA 3I55S 1QY7A 4I4BA 1CJTB 2YWEA 3MM7A 5J2NA 3A1YG 3JTPA 5JVGQ 2LQ9A 5CZVA 2RSQA 2AHOB 2DGUA 5C5JA 2QRRA 3UD3P 4USIA 2BR0A 3BN7A 4USMA 5GADU 2IC3A 2Y8WA 4YR0A 3PR4A 5J2MB 1KK6A 4MFGA 1VQOS 2E29A 3UVJA 5IC6B 5KOWA 3KJFB 5ETTA 2Y8YA 1B99A 4UTGA 4DR2F 3GQ7A 3M8SA 4OV6A 1FRHA 4CH0S 3THPA 2ASDA 2HZCA 2DNPA 1DLOB 2C3MA 3MAAA 3IXCA 2G9OA 1NZ8A 1FXDA 3H5UA 3HZGA 3CPWR 2CUYA 1U2FA 1VC0A 1VLOA 3H40A 1EQ0A 2GNKA 1HIYA 4YOEA 3DCAA 4Q8EA 1M1KT 4DU8A 1L3KA 5ETOA 3BBFA 2WLGA 4ZN3A 2GGPA 3DHOA 5KG3A 3HDSA 3CCTA 3I4HX 3BGFA 3VBLA 3IFEA 2MTLA 3BSAA 1AFIA 3N9UC 3HJVA 3ZFVA 1YZ6A 5K14A 1NJWA 1ZS6A 5EUHA 3T1HJ 5KG7A 4CH1A 4DR5J 3HKWA 4HVZA 9ATCB 4KO0A 2LYVA 3NL0A 1HNXF 4RBTA 3SEOA 4PQUB 2FKOA 4A4JA 1CSOI 4N56A 3T3FA 1K1QA 2EBGA 1WKLA 3BH7B 1KRRA 2LDIA 3W65A 4DV4J 1DBDA 5HMWA 4HEA9 2UUCF 3IWNC 1SC3B 1YBUA 3AQPA 1KP6A 1TR0A 3FS8A 1HWIA 4M94A 4LF2A 4NLSA 2V5HG 5E0OA 2EEYA 2BW7A 3OTBA 2D41A 3US5A 5FUVA 4A8OA 5HK4A 1FDAA 3GV7B 2QL9B 2E9ZA 4KR0B 1T03B 3ZTOA 4OI2A 2D9OA 4DL0C 1GXTA 4DS5A 4ZIVA 4ANDA 1THJA 2EVZA 2ZHBA 3OTCA 2CZVC 1KKHA 3QATA 1S4FA 2YKPA 3LP2B 4C8NA 4C11A 2FJBB 3M2RB 2R7SA 1HDLA 1FKPA 1PIEA 3IG1A 1SV5B 1NLKL 3NWGA 3NAIA 3U02A 1BQNB 4RO0A 3TNVA 3UR0A 3U1MA 5DETA 4M1KA 4H4OA 4ZVPB 5E41A 2RMLA 2ROEA 2XEXA 4G1QB 3H98A 4C8OA 4CLSA 2GKVA 1REGX 4IFYA 3TWZA 4R5PA 3FSBA 4WP4A 2L9WA 3U1NA 1X74A 1LW0B 4RUHA 2E1MC 2CQ2A 4YP3A 5HLFB 2OFGX 1URNA 1NJXA 4B3MJ 4KHRA 2CDQA 1YJWS 3UFCX 3QIPB 3T19A 1JLGB 1X60A 1VRTA 4EBCA 4QYZK 3MWBA 1JXLA 4PXEA 1D1UA 3RW6A 2Z58B 3AB4B 3BGLA 2ELIA 3BREA 4K4SA 4P2XA 2CIMA 2N3LA 4MYOA 5ETKA 4JI6F 2WLDA 1TK0A 5L6VA 1PO6A 4LBPA 1S1TA 1UVJA 3TVZA 1XERA 1CPZA 1H0ZA 4CLPA 2QLXA 4X4PA 2B0UC 2YNIB 4ED0A 1GX5A 1NDPA 4CI0B 3FWWA 3BXYA
chains in the Genus database with same CATH topology
5D78A 4I64A 1OWXA 3SZ2A 1FA0A 4B17A 5B7WA 1C0TA 3C2PA 5B0CA 2BJDA 4X4SA 2VPXB 5KG1A 2HYIB 1SJ4P 1FXLA 3MR5A 1RT7A 3GFYA 4N8NA 1TQLA 3M1VB 4PKDB 3CJ2A 2XY5A 2YNGA 3K58A 3Q24A 2ICYA 3PVXA 1KNZA 3BF4A 1S49A 2DHAA 5CCMA 2OTLS 3KLEA 4ED6A 4YUDA 1FXJA 4PXCA 1WF1A 3MM8B 4RW6B 3UCZP 1Q7LB 4DPOA 3VALA 4V19X 4G6VB 2HAIA 4M2AA 4JI3F 1TV6B 3DOKB 3MMAA 3KKFA 3R0SA 2KDOA 4PG4A 3KLGB 3MC4A 3QGPA 2DR9A 1O5JA 4Q5VA 1G95A 2WRMA 5L9XA 3C8VA 4CT8A 4OZLA 4OI1A 3RYLA 5GADI 2HVZA 4QWBA 2ZOFA 1XEZA 2N4CA 4QWAA 4TU8A 5M2RA 1RTHB 2HHQA 2ZNYA 4AXIA 2NZ4A 5A0YB 2QIFA 5FIIA 1BC6A 3C6UA 4G3QA 1OS5A 2ZVSA 1X7VA 4OHWA 5CYMA 5AE3A 2L48A 1HW9A 1N5TA 4QJVA 2I9SA 1B0PA 4C3MA 4KBIA 4WE1A 3OTMA 3OUYA 5KFTA 5DM6Q 1D0EA 2K7KA 2UVUA 1IJEB 2ZD1B 3JB9k 3LWMA 2R7VA 3DK5A 2IHR1 2DNKA 2YWHA 3CVKA 3GV8B 3HVWA 4TXSA 4PCQA 3LW5C 2VODA 2XMUA 3OLBA 5HMZA 1S9GA 1VQMS 4FF1A 1JMTA 3BGUA 2NPIA 2DCUB 2HFOA 3IG1B 3X1LB 2U1AA 3MURP 3OHAA 3CMAS 2HMIA 5KFXA 3N0VA 1JLCA 2CQHA 3CCZA 1HD1A 4ZP6A 1PC4A 2OLWA 2V9WA 1MWYA 4OJGA 4B3OB 2PMHA 4K6RA 2ZJPQ 3CJ4A 3OL6A 4O3RA 3FZBA 2I1RA 1N5VA 3IBWA 4DCLA 2FUG9 4KQLA 1NEEA 2FDNA 3IS9A 3EZ5A 5F8MA 1ELOA 4HDGA 4NA2A 4QYZJ 2XSJB 3DOLB 2J6UA 1DLOA 3OFFA 4IG3B 1QLNA 4R36A 3LANA 4H4OB 4LSLA 3H8YA 2IMWP 1KGQA 4Y3CA 2AGQA 1Q7YT 1FD8A 2B4OA 1RYRA 4RW4B 2IRYA 2RS8A 1VQ9S 4NLPA 5B0AA 4Q7AA 3TAMB 4CO4A 4QPTA 1Q1KA 5I3UA 2KYXA 1TK5A 4ZLPA 1RYSA 3UDCA 3RB4A 4RW8B 3KMSA 2R9LA 1KK4A 1G2EA 4IFYB 4QCLA 2AWZA 4DFMA 4I0WA 2JEIA 1S7HA 2NPOA 2BE2B 2RKIB 3MM6A 4N47A 4CTAA 1UMJA 1DQAA 4YHHF 2M0GB 2B7CB 2MMYA 2DD8S 4ID5B 3HMJG 4Y2KA 2DPJA 1ZAWA 3B4MA 3MDFA 3K59A 1Z2LA 2M52A 4DQIA 2M8HA 2IBKA 1G97A 1Q8IA 4EQYA 4PPDA 2XCAA 1D8YA 3BDPA 3JTOA 2P5VA 2W8KA 1U49A 3QYYA 3NP5A 3Q8RB 3I96A 1E6VB 1S1XA 4URSA 5BR8F 2RT3A 3PR5B 1LWFA 4X4NA 3DLJA 3CUNA 1RTDA 4K50A 4DN0A 1T3NA 5LL6d 4ES1A 4JI2F 3EUNA 2AD9A 1KHVA 2YTCA 4R25A 3FSCA 1MNEA 1CC7A 2J0WA 5FD1A 1GTHA 1CSJA 3M8QA 4YB5A 5IXUA 1XC9A 3AY0A 4J9OA 1XMBA 2K7JA 4Y2CA 3V4MA 2DGTA 2E1AA 3HVAA 4Y2MA 4URGA 4XO0A 1RT1B 1KN6A 2V0IA 2LXUA 2E7WA 2PC6A 1FDBA 5BYRA 4DWIA 1RKIA 3SCKE 1P1TA 1Y0HA 3VNPA 1IQZA 5FLXY 2YKMA 5L38A 3TISA 3OJSA 4QU7A 2ZJQQ 2QSFA 2RRBA 2VD4A 4X66F 1B7FA 5LJ5Y 2ZH8A 2C2DA 3OJUA 3KLIB 4BHQA 1EP4B 2RIJA 1P1LA 1KLNA 3LUYA 2MYFA 3SQGA 2Z4PA 4UUWA 3CDUA 4QZVB 4FS2A 3HLUA 1R27B 4C8KA 1YRTA 1V3SA 3MI7X 2BOPA 3HVRA 1Y5NB 3KLHA 4OFZA 1S6UA 4N69A 2I8EA 2VBYA 3POTB 5GVQA 5IT0A 3G8SA 4ED7A 2KJVA 4P2SA 4R7PA 1BLUA 4ED1A 4KC5A 1LV5A 3T6BA 3N4WA 5F8LA 1TKXB 4URQU 3ITHA 4F4YA 2O66A 3V4IA 3X3UA 1UETA 4OZJA 1VS3A 4WU2A 2HQ3A 2WCXA 1F9FA 3SMZA 1RT2A 2M4MA 2CQDA 4Q2LA 1YITS 4Y6IA 3Q8QB 1S1TB 3KK1B 2KXFA 2ZH2A 5IM0B 3NNCA 1IKYB 4HH0A 1F60B 1U48A 5E3PA 1WACA 1UL3A 3BSWA 2C3PA 2K8GA 2XMKA 3G8QA 4DL6A 4PUOB 1Q82T 3EGWB 3I56S 2JH3A 1TFWA 1HA1A 2O3DA 4UUXA 3KLFA 1YIJS 1LW2B 4IUFA 1N36F 1YP3A 3I0RA 5AXLA 4R0EA 2G1DA 3M4XA 4KB7A 3KHLA 2ZH9A 1I94F 3D1HA 1OQ6A 1N88A 3N79A 4PG5A 3UCUP 1FTCA 3SSQA 2YKNB 1AXQA 5F3ZA 3GVDA 2DT9A 4DN9A 3OL9A 3M6UA 2YWFA 3IXQA 1T03A 2G4BA 4XPCA 3MPYA 5KG5A 2Q1LA 5T7LA 2EFVA 2RDIA 1LWCB 3MEDB 4AFFA 5HBMB 1HNWF 1ZH5A 4NXNF 5FJ4A 2DRBA 4DSKA 2J9EA 4HT5A 1X4HA 3OVSA 2KZMA 1U25A 2FHKA 3SCIE 2VBXA 2EG2A 3WBZA 3S1TA 4RZRA 2IC7A 4N5SA 4LFBF 2FVQA 1N5QA 3DLKB 2DJWA 1X9WA 1SKSA 1M5OC 5F9LA 5A6PA 2X1FA 4UQTA 3UDLA 1SUQB 2IM3A 3GE9A 2DHGA 4HI1A 1JIHA 2B5JA 4AUKA 3FDSA 5KFPA 4CNZA 7FDRA 1H6KX 3HF5A 1NK0A 5EWGA 3RR8A 1V3WA 2KU7A 2OPPA 3S8SA 4UQGA 3V2UC 5D4PA 5KFRA 3LP2A 2XZWA 3MPVA 2MHNA 3AQOA 3PDNA 4EZ9A 4ZMMA 3M2RA 5F8GA 2WK4A 3FEYB 2VD3A 2XS2A 4NWBA 2E9TA 4K4ZA 5LSOA 3QAUA 1SV5A 3D0HE 2FC8A 4LT6A 1S76D 1JLQB 3VAMA 4FF3A 2KRBA 3JTNA 4DR6F 3LO3A 5E3RA 4I2QB 4DF4A 1BQNA 2GHWA 4YY3F 1C4AA 1TAQA 2JC1A 2CVIA 2ZZNA 3RB0A 1HQUA 1C1CB 3HO1A 5T41A 1H7WA 1IM4A 2HHUA 4K4XA 4ZPVR 1S9EB 2BBEA 2KFYA 1WHVA 2XWYA 5DO2A 1QSLA 3KWDA 2NQPA 5ADXU 4YFUA 1IKVB 1IKWA 5F8NA 4PQAA 2VV5A 5HMYA 3W2WA 2B9WA 3HHEA 2E9RX 2XS7A 2JRSA 2KHDA 4G1QA 2WSCC 4N8OA 2DO0