5E3QA

Crystal strcuture of dapd in complex with succinyl-coa from corynebacterium glutamicum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
278
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
total genus 89
structure length 278
sequence length 286
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3qA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3qA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3qA01
4EGGA 3BSWA 3DJ4A 4FCEA 4N6AA 2VHEA 3DK5A 3I3AA 3FTTA 4EAAA 2IU9A 4N69A 1HV9A 4HUSA 1MRLA 3OUPA 3DHOA 2VD4A 3CJ8A 3MQHA 5AFUV 2ICYA 2OI6A 3D98A 4J09A 1T3DA 5AFUU 1OCXA 4M98A 1YP3A 1S80A 3SRTA 3D8VA 3C8VA 4E79A 4E6TA 2V0IA 3F1XA 3FSBA 2WLDA 3EH0A 5E3RA 1QRMA 3ST8A 2GGQA 3T57A 1QRFA 3BFPA 5DG3A 2FKOA 4M99A 3FS8A 1HM0A 3HSQA 3I3XA 3P1BA 2QIVX 4G3PA 2GGOA 4K6RA 3P47A 1G95A 3TWDA 3GVDA 3FSCA 2OEGA 4KNXA 1QRGA 3Q1XA 2P2OA 5F42A 4E75A 5U2KA 3ECTA 1V3WA 2QKXA 2W0WA 4R36A 4MFGA 2IUAA 5DEPA 2RIJA 3EEVA 1KK6A 1KGTA 3R2WA 2WLFA 4ISXA 3R5BA 4EA7A 2OEFA 3BRKX 3KWDA 1XATA 3OU9A 1J2ZA 3JQYA 3IXCA 1LXAA 2IC7A 1KRUA 2WLGA 1KK5A 2AQ9A 3GOSA 1KGQA 3IGJA 3BXYA 1KRVA 1TDTA 4KPZA 5E3PA 1YP2A 2V0LA 3OW5A 2OI7A 4MYOA 3VNPA 4EA9A 5ADXU 3BSSA 2V0KA 3TDTA 1FXJA 3TIOA 3MC4A 3OTZA 1KK4A 3R0SA 1QREA 3BSYA 4IHFA 3VBLA 5L6VA 4KNRA 3VBIA 2QIAA 3HJJA 1G97A 1FWYA 1KHRA 1XHDA 4N27A 3KWEA 1HM9A 4HCQA 4DCLA 4EABA 4HZDA 4IHGA 3GUEA 4KPXA 1KQAA 3R5CA 4G3SA 3FSYA 2XATA 4H7OA 4J18A 3R3IA 1V67A 4KQLA 2JF3A 3MQGA 3VBPA 1SSTA 2OI5A 4AA7A 1SSMA 1MR7A 3V4EA 2NPOA 2Q4JA 1Z90A 2V0JA 4M9CA 4N6BA 5E3QA 3EG4A 5L6SA 3R3RA 3R8YA 1THJA 3PMOA 3SPTA 4HZCA 4IHHA 3TK8A 2ICXA 1SSQA 4E1KA 3FSXA 1HM8A 3OTMA 4AC3A 1QQ0A 2I5KA 3NZ2A 2IU8A 2TDTA 4G3QA 4M28A 4M2BA 2JF2A 4E6UA 2WLEA 1KRRA 3TISA 1YP4A 4M2AA 3R1WA 5ADXV 2WLCA 3VBJA 4EA8A 4R37A 4R7PA 3KWCA 1MR9A 3VBKA 4EQYA 4G87A 1QRLA 4MZUA 4AAWA 4HURA 3TV0A 5DEMA 3VBNA 3VBMA 3FOQA 3FWWA 2W0VA 2V0HA 3R5DA 3R5AA
chains in the Genus database with same CATH superfamily
1FFSB 4OZ0A 4WP4A 4GVBB 2EFVA 2QA4G 3Q2SC 2LUYA 5F3ZA 3CCSS 2UVWA 4J9VA 2A2CA 5A8WB 2ZFHA 1P6TA 1HV9A 1R31A 1VRUA 1Y1CA 3BKFA 4DR5F 1F3FA 3HFVA 5CZVA 2FLNA 4PCQA 1N0UA 3V6JA 1Q4RA 1ZOTA 4A24A 2AEJA 1MNEA 4E2FB 4ZVQB 3DLEA 4IDKA 3D98A 1RWKB 4PPZA 4F04B 2GIRA 2V4QA 4DQIA 1NDKA 4WZQA 3WQPA 1TKZA 1WI8A 4CZCA 1U09A 4ZJOA 4B3SF 5DQGA 5DM6Q 1Y0HA 1FI4A 2RSQA 3LF0A 1HI8A 5KFQA 2MHEA 1SH0A 1VQ5S 5G0RA 5GMDA 2PA8D 5E0OA 2FVPA 4RU2A 2MQ8A 3P49B 1BLUA 1SJ4P 1RZMA 3HMJG 1N54B 2B7BB 5HVFA 4DPWA 2XMTA 1MJBA 3WIVA 1SJ3P 3Q8QB 1CHOI 1OQ6A 3A3NB 2AP6A 2ZH5A 1I5OB 2JEGA 1NSKL 1LKZA 3RB4A 3OH2A 1BGXT 4MFGA 2LB7A 1RJJA 3OTDA 1RA7A 2JNJA 4OYXA 3OL6A 3CCMS 1WHYA 5D0HA 3U7JA 4YUDA 5L9NA 1XIQA 4O4RA 3M8QB 3M6XA 2RDJA 1CJTB 1IKXA 4UUWA 1TKTB 2DKVA 1TTHB 3MR3A 1N4LA 2QQCA 4CYUB 4ZPCA 2AQ9A 4XIUA 2C42A 4LF5F 2P9EA 4X4PA 1YIJS 2IY5B 4OV6A 4RX6A 2XY6A 4KFBA 3FVYA 4USJC 2QN6B 1NK6A 1YP2A 5F41A 4YN3B 1K0TA 2OI7A 1NXUA 3CC7S 3R6LB 1FRHA 1X5SA 3FZ2A 2U2FA 4G65A 4MH8A 3M8SA 3DOKB 4FF1A 3DXSX 2C2DA 5T41A 2HFVA 2MDAA 1C1BA 2XS7A 2EKNA 4B9UA 4NXMJ 2CWFA 3GG0A 2OFHX 3LGNA 2AJ4A 3CXCR 2OLWA 2NUUG 2Z58B 4I4BA 1KHRA 4JI8F 4XO0A 1HNWF 2BANA 1LK7A 2HGNA 1BXNA 1QAYA 1W25A 3KJQB 1REGX 2PMWA 2ZNYA 3EGVA 4NL5A 2UV8A 4V1Ak 3RAQA 4FNHA 1H2UX 3N5FA 2XATA 2NSCA 3CJ5A 2YKMB 3RR8A 4DHVA 4LQ9A 1LW2B 2HNZA 3GILA 1SSTA 1RWOB 3WBZA 2IVYA 1S48A 2RUSA 4FNIA 5KT7A 1C4CA 1V5IB 3FRYA 3WX8A 3QSYB 1YI2S 2MMYA 4JV1A 4ECVA 4KH0B 7FDRA 2I5JA 1I3OB 2NPFA 2Z0GA 3ICLA 2RQCA 4H4KA 4KE5A 3ZZRA 4N76A 2VC1A 1Q7YT 1N48A 1Z90A 5DZ6A 1VK8A 3CT9A 2ADBA 4U7UD 3O1LA 3CCRS 2UVVA 1BUXA 2OSQA 4FZVA 4DQSA 2PQ8A 3PHEA 2YWHA 2VPWB 5K8MA 3QT6A 3QZ7A 4A8FA 1SSQA 1TK0A 2DNZA 1FD8A 4BC7A 3A4TA 2R7RA 3QAHA 1IY6A 1S6QB 2ZHOA 3M2UA 1FJEB 2MZTA 5HL7Q 2K7JA 2MPUA 4B3RJ 3OTOF 5IV4A 4TY9A 4F0MA 2QSWA 1VLYA 2ACYA 3Q83A 5DQIA 4P6QA 4DV7J 1N34F 5IXUA 3C2PA 2QQEA 3NAHA 1OVOA 1JLFA 4UXJA 2NU0I 1RTZA 2E1PA 2DR6A 2MJUA 2HVDA 4UT4A 1T9UA 3SSSA 3H0PA 4EYHB 3Q8RB 1WKJA 3VBKA 2MZSA 4C8NA 3BBCA 4DBQA 3T1AA 4WFBQ 4MZUA 4AAWA 3M30A 3VF0B 4AXIA 5EWFA 3T5KA 2R2SA 1NBEB 1T11A 3T9NA 3TRGA 3KJVA 3MAHA 1S99A 1TL1B 2V0HA 1WC0A 1T03A 2CQHA 4OX9F 2CWKA 2ZH4A 4DV3F 2W4DA 1HQUA 5CYJA 2EPIA 1S12A 4LFAJ 2HMIB 1RT5A 4M5JA 3I0RB 1LR8A 2GKVA 4FYYB 5BR8F 1MRLA 3KG4A 2DPJA 1M1HA 4J9MA 1V5VA 2E5LJ 3MQHA 2DTJA 3UDVA 4DPOA 1VRTA 4J09A 1X4AA 2IRXA 3C6TB 3TP2A 3TVZA 1JLEB 3G2XA 4WWSA 3RR7A 2VOPA 1LWFA 5L46A 1N33J 1R6VA 3WX4A 3TZXA 3K5LA 4R5PA 3SUCA 1NU4A 1NHUA 5J2MA 1Y3JA 3QLHB 1IN0A 3BPSP 1PGZA 1NK0A 1UPPA 4LF6F 1FCAA 4K2XA 3UQSA 2X1FA 2BOAA 4ZDNA 3M2VB 4O0IA 1W7WA 2RF2B 2ASJA 1NK4A 2CWXA 1Y5LB 4QPTA 1Q1KA 1H98A 2GGOA 1R0RI 2NXEA 4IH5A 4NZ0A 4UUXA 4ZCLA 5KG1A 1G95A 4CLYA 3J7ZT 4F4XA 2GJ2A 2ZOFA 2OEGA 4FBTA 2GX8A 2J9CA 2XHWA 3BBBA 1WNEA 1A9NB 4KGKA 4FP9A 5HLFA 1HR0J 1V3WA 1NZ8A 2WSEC 2YH0A 4KSEB 1Q78A 2RS8A 3W9JA 2F4VF 4JOUA 5F3TA 1HHSA 2K3IA 4Q2LA 2Y8YA 4ZVSB 3DLEB 4EA7A 2WK4A 2SGPI 5ETMA 3T6JA 4URGA 5J1EA 5A0YB 2WVCA 2YNIB 3DKDA 5CD4A 1FO1A 4O0NA 4N41A 5IT0A 4DF4A 2V50A 4RWXA 1LWFB 4G1IA 2K9HA 3ZNJ1 4LBPA 2LQ8A 4LVNP 1WDTA 3MI7X 4IFVA 3LP0A 2KT5A 3CIMA 5HP1A 2V94A 3OBIA 3LQVA 5J2PB 4Q0BB 3SEOA 3TIOA 5KFAA 3NNHA 2R7XA 2MKYA 3PX4A 3N6MA 2BUSA 4NZ7A 2HZVA 4KV8B 1RHJB 4ZPAA 2C2NA 5E3CA 1QAJA 4MKAA 1RTHA 2DNYA 3G82B 3MFIA 1S77D 4DG1B 4MIAA 2P5VA 1Q16B 2Z56B 1VC0A 2IDEA 1HYSA 2OPRB 5LSRA 2KXNB 4ED8A 1HMVA 1U49A 4Y2MA 1SGDI 5ETKA 1T03B 2QT7A 1CGII 4EABA 2AX0A 4A4JA 3I0SA 3M30B 3N01A 1DARA 3QGPA 4W90B 1NEEA 2D3UA 1YSJA 2MQMA 4O3OA 2MQQA 2YPYA 1PAUB 1YK9A 3CO9A 2VBZA 4OL8A 3AXMA 2V4JB 3X1LB 4R8UA 4X64F 1OYDA 1R0BG 2GVZB 3UVJB 4CO3A 5J2QA 4DFMA 4ILLA 5F8LA 3J7YI 3LANA 3ZNUA 3VGUA 3HO1A 4EFAC 3TEHB 1XMBA 4IUFA 1GX6A 1M5HA 2OPQA 4M9CA 1YVFA 2SGEI 3BS9A 3LP2B 4HLBA 2ZH7A 3MM5A 3CPWR 1BWVA 3T1HF 2HNYA 2OPPB 2IJNA 3IFEA 2QLBB 3OSNA 2YY3A 3HHLD 3M6WA 1S57A 2AJ1A 2BX6A 4RW8B 3E01B 1WORA 4OI1A 2DNLA 4DR3J 4FYWB 1UL3A 4EUVA 3OVSA 1ZPVA 4CLZA 4DLEA 2DHXA 4I6WA 3OH1A 2IU8A 2V5HG 4N8OA 1AT1B 2GMJA 4ZPDA 1S6UA 3HHLA 4ELVA 2WW8A 2VPZB 1WC6A 2QO3A 5BXIA 4B3RF 4K5RA 4PXBA 1AFIA 4F0HA 3HLUA 2XI3A 2YUUA 2Z8QA 5KG6A 1H6KX 3OXGA 4I6YA 3A8JA 3KWCA 1YQHA 3QGIA 3BJIA 4USUA 1HBUB 3M9NB 3EPGA 1W26A 3V6HA 2CXEA 5A0YA 5LMUJ 3ENWA 3DRRB 3WC0A 2H4WB 1NUEA 2XYGB 2U1AA 1HHTP 3FMBA 1OPZA 3OTZA 4NCGB 1KFSA 1OY9A 1SJQA 2NU3I 2L48A 3FGVA 4J9KA 2GIVA 1EJ7L 2AD9A 4C7QA 2SGQI 2ZDPA 3DCAA 3TYTA 5GAGI 3OVAA 4AUKA 5JXSA 2CZ4A 3VGTA 3D4JA 4X64J 1KQSR 3C66A 1V3RA 5AT1B 4EAAA 2YXLA 1B0VA 1WEXA 5H9EK 1S1WA 1G3OA 1VS3A 3TUPA 1A0OB 4P2SA 3FEZA 1FRJA 2FTRA 3G82A 3WIUA 2CQCA 3EDRB 4DSEA 3JTOA 4OHXA 2MGZA 5FLXU 1APSA 3S6EA 3TEGA 1AXQA 2CQGA 4X66J 2HK3A 3K5PA 5H1SV 4WCEQ 1KFDA 1S1UB 3OPKA 3LWMA 4EBDA 1WG1A 3ISND 3HHNB 2IC3A 3M8YA 3NG8A 3SSQA 1CJUB 2BABA 2FPHX 3THPA 5DG3A 2CWGA 2VV5A 4F3OA 5BYRA 4M99A 1PAEX 4ILRA 1HW9A 2KB2A 3DDNA 2CJ9A 2BZ2A 5GAEU 4DV4J 1YJNS 1U47A 4DSJA 4ED3A 1G4CA 5C25B 3GQCA 3MMBA 4E1RA 1PC5A 3NRBA 1RU1A 1SPBP 3I0RA 4Z2XA 5RUBA 3HT3A 4E75A 2DNKA 2V6AA 2WSFC 3ECTA 5HMXA 3ETOA 5FUWA 5ETNA 2HGMA 3IO1A 5HATA 4V19J 2CIMA 1Y8FA 3IR5B 4Z37A 4F0KA 4USWA 1KBEA 4BWMA 3CVKA 1HWUA 2I38A 2M7SA 1S0NA 2HHVA 3PJXA 4XTTA 2NZCA 3OXLA 4WXOA 2IM0A 3OTBA 2ZZMA 1KK5A 2EFGA 2HNYB 4MKBA 1VDHA 3QBCA 3SDEB 2CPDA 1AUDA 1K8AT 1JLFB 3IG1A 2G13A 1SXLA 1QJHA 2EEYA 3DOMA 4KHPJ 2EFNA 1EQ0A 4DPTA 5KG5A 2HRYA 2A20A 1DRZA 2VIHA 2ZJQQ 4ELUA 2L9NA 3DLLQ 5A8WA 3BGUA 4IHFA 3VBLA 3MMAA 2WVDA 2IJFA 4ETZA 4Q5VA 4KNRA 3QGGA 3V4IB 4FYXB 1TKXB 1HNZF 1U6BA 4RJVA 1D8YA 1M1GA 1GXUA 4J9NA 2LECA 5FLXY 1J2VA 4EMDA 2PIIA 4H7OA 1FT8A 1YJVA 1VIXA 3D6MB 3R3IA 4ID5B 1SL2A 2KFNA 3QJJA 1M8BA 1X74A 1R8CA 3HSJA 1IKWA 5LJ3Y 2AF6A 4ES2A 3MD3A 3NGDA 1NK8A 2F8EX 1K73T 4LFAF 3JQKA 2ZZTA 2NXJA 2F8HA 1D1UA 4Q0BA 2YKMA 1EETB 4TU8A 3MM5B 2V9WA 1F5CA 4MIBA 1TL3A 5HBMA 4DR7F 2CNLB 1QUVA 2P8IA 1SGPI 4UXIA 2A18A 5GVQA 3RBZA 3VALA 1N56A 3H90A 4X4VA 4GVBA 5IT9U 4HZCA 2VH7A 3C8YA 3CTRA 3IP0A 4E1KA 2I2YA 4DJBA 4NXNF 1HM8A 2NXNA 2IC3B 4EWTA 1NSPA 2V8DA 4UZCA 1O51A 4DN0A 2UVUA 2O67A 1N5TA 4JV5F 4DSLA 1FHTA 1YP4A 2C2OB 2EG1A 4G1QB 4KFBB 1WF0A 5LXYA 1O0PA 5ITHA 3KUEA 1YTPA 4WK1A 1Z4UA 4EA8A 4FDFA 5L38A 2NXCA 4UY85 1VHFA 1FFWB 4A47A 2HG4A 1TBQR 2K3KA 2QYGA 2GAGC 4QIEA 2QYCA 3RYLA 3VBNA 5D15A 4F4YA 3RB0A 1JLBB 1HBOA 3JSRA 2DCLA 2ZH9A 1YTYA 1ZAVA 3FBBA 3K8VA 4C98A 1SL1A 2MZRA 3SIPB 5HP1B 2QL9B 4LT6A 2GMHA 1FDNA 3DDKA 4I2QB 3DC2A 4FVMA 4ICLB 4HEA9 2JZMA 1P9YA 4Q7AA 2VJVA 3HFZB 1I94J 3KK3B 3MMCB 2B0UC 2FZKB 1SQFA 4P2XA 4X4QA 3DFEA 2QQ0A 2M70A 4PWWA 1LR9A 3ETMA 1KR4A 3CDUA 3D28A 1RT5B 2XMMA 1DHMA 1MW7A 2LYVA 4YP3A 1CLFA 3SCKE 2DGSA 2H54B 2MKSA 5KFTA 1MWYA 5KFCA 4DFPA 4OZJA 3QT8A 1NJYA 4K0KF 2GNKA 2W2NP 3AD9C 2Y1IA 3S8SA 4O3SA 4JI8J 1RBAA 1TBOA 3LALA 1Y1BA 3PACA 1H0ZA 1N6QA 2DVIA 2IBKA 4KPYA 2VONA 4NYOA 5KG7A 1NK7A 2VG5B 2BQUA 2XCPA 4UOHA 2QLFB 4QCLA 3KLGB 3OR1A 4HGUA 1FE4A 4LUBA 4OYMA 2M88A 4DL2A 5GAGU 1RACB 3CW2C 3W3SA 2NU1I 2V63A 3U1LA 3CD7A 3Q8YA 3ISNC 3ZTPA 2EFQA 1JLQA 2ZH1A 4DSKA 3K5OA 3IBWA 2Y0MA 2E7WA 5B0GA 4NEZA 3FKBA 4DU7A 1RYRA 2UXBF 2ZKTA 2NU2I 1VQ7S 3V6KA 3G9CA 5DRKA 5IQ6A 1FRMA 3TARA 1S4EA 2Y3YA 2N1AB 3GYGA 3PEJA 4KT0C 2N82B 4DV0F 2HAFA 5GAHU 5BYSA 1HNWJ 2V0LA 1XMQJ 3DLHA 5B0BA 1DS3I 2ROGA 2VFVA 4DG1A 3MPWA 2FLLA 1HYSB 2J0SD 1S6PB 2CZVC 4ETXA 2CPIA 3GFZA 2B5JA 3I9ZA 4I64A 1P9GA 4QWAA 1TFWA 2ORVA 1VBXA 3OW2R 4TY8B 2YNGA 3PO4A 1FEEA 4KH1B 2XEXA 1PIEA 4RR5A 1FWYA 1T94A 1NUBA 1YJWS 4ANDA 1BQNB 4KHRA 4N27A 1Z2LA 2D7SA 2B9WA 1T9TA 1N5QA 5DLFA 1F3VA 1HM9A 1JKHA 2IVFB 4U95A 4HZDA 4RNNA 4J9QA 4A8OA 1R6YA 2APOA 2D3O1 2XY7A 1SKRA 1FX4A 4J18A 2PI4A 2GVDA 3KG0A 4DSFA 2ZZNA 2EKYA 2KJVA 4KGVB 4NLRA 1KMAA 4BHQA 1S9EA 2CVEA 2XNRA 4X4SA 2V8HA 1C1BB 3GFHA 1HNIB 2MY7A 2IA0A 3JQJA 1IBMJ 4LFBF 5KG3A 5HK4A 4AT1B 1TVRA 1LFPA 5KFXA 1RFHA 2XLIA 3LO3A 2ALZA 4DMZA 3HPOA 4F4KA 2JVOA 5K20B 1IM6A 3NCQA 4DR1J 2CQPA 4N6BA 3Q2TC 3E3XA 4TLQA 4NCBA 2ZVSA 1HL6A 1SQEA 2OMOA 1KEKA 1THJA 2XLJA 3FQLA 4FS1A 1QVGR 1VGYA 3OQ2A 2ICXA 1IKXB 5A8RB 2YBVA 5F0UA 5CAAA 1VQOS 5JHWC 2ORWA 2X52A 1S4FA 2JFKA 3C16B 2OPQB 1HQEA 2ZVIA 4AC3A 4K59A 2FY8A 1QQ0A 2XSJA 4ED5A 4HKQA 4PRFA 3GIMA 3NLCA 1N36F 5IT9Y 2J0WA 4X4TA 2V2ZA 3BB5A 3CJ3A 4Y2CA 2HBZB 1D9DA 3W2WB 2PT0A 4D3GA 4LF8F 4UQTA 2WBMA 1VRTB 1NK9A 3VBJA 3G4SS 3EGWB 3PJWA 3I96A 3KWMA 3U02A 3D00A 1P9QC 1TQLA 4LRCA 5HI7A 4ZN1A 2ZH3A 4QIWD 2B9EA 2G0IA 3EUNA 1IBLF 1HBNB 3L9ZA 4IH6A 2G1HA 2JL9A 1WC1A 4EZ9A 1IKVB 3CJSA 5AJ3F 2NQPA 4OJ3A 1X8DA 4P72A 1H0HB 3DRSB 4CO2A 1WTFA 4XDDA 3BZQA 1UWAA 4FXWA 4OI4A 3MUVP 3I82A 4USHA 1TUGB 5IFMA 5K8OA 5I42A 1TL1A 4NX9A 3P6YC 5IOLA 2COLA 2GFFA 3D67A 2RMLA 1UJ4A 3KJNB 2XRCA 4P9SA 5BJRA 4QWEA 1JWWA 3QWUA 4DU8A 4OYIA 1SUQA 2QIFA 1LK5A 3IAS9 4EBCA 2KFZA 2RRBA 3OUPA 1RT7B 3MM8A 2ZWOA 2LCWA 4J5OA 1ROFA 2EI5A 4F8RA 2HYIB 4PQUB 1MN9A 2V4JA 3IRXB 4DR2F 1NDLA 1T3DA 3M8WA 4HH0A 1OCXA 3D68A 1UETA 2BVZA 3SRTA 5D0EA 3PYDA 3ZZOA 4CO0A 1RT4B 3TW0A 5KOWA 5KFBA 1D9FA 2UVOA 3QQCD 2HHXA 3HDSA 4LF4J 3Q86A 3N6NA 4ZVGA 3OL9A 1NXIA 2OZUA 2K06A 3HP6A 2DISA 3WDOA 1Y00A 1TBRR 2DGOA 3QMQA 3Q8PB 3UCUP 3J7AN 3ULHA 2KHDA 2UXDF 1REVB 2NYHA 2LMIA 4OV1A 4NLSA 4DQRA 5LJ5Y 2OD4A 3GIKA 4KNXA 4KV8A 3HT0A 1WOPA 1JLAB 1U1MA 3M9OB 3KK1B 5U2KA 4ES1A 1FRKA 5IT4A 4I7FB 3AQOA 2B56A 1MT1A 3HH2C 2DT9A 2MZQA 4IQMA 5AXKA 4N47A 3TZYA 4F2SA 3MM9B 3QATA 1KGTA 9WGAA 2BKNA 2LQJA 4QYZK 1KQGB 3K5MA 1R27B 3W65A 1XATA 3HM9A 1FNOA 1T02A 4USTA 4MK7A 1YBAA 3PX6A 3AXKA 1O5JA 2WW4A 3UE2A 1ZH5A 3ILIA 5A76A 1ZBTA 2DNNA 4LRDA 5KFHA 1EWWA 3WHIA 2YH1A 1KRVA 4QIFA 2CNNB 3NBPA 3RUBL 4DZDA 2OO4A 3BGRA 2M8HA 4DR3F 3VDUA 4DL4A 1UVJA 5KG4A 3OW5A 2FD2A 2XZDB 4QIVA 5C2CA 4ED2A 1UJ5A 2X1GA 3ZZZA 4PUOB 2JXDA 1FXJA 4M5MA 2PEHA 2YNGB 1JJ2R 4B9MA 4X62J 2BKOA 2E1AA 3FSIA 4N7TA 3OH4A 1K47A 3BSYA 2VPYB 1UEKA 2OTJS 3JAMU 3HJFA 1TL7B 1TV6B 4C8ZA 2QIAA 4URQU 3I87A 2VB6A 1WKKA 3GJQB 3EWGA 1VBYA 1XHDA 5AE1A 4RNOA 4N56A 2M9KA 3AODA 2WZ1A 1UVMA 1HWLA 5AE2A 1J5OA 3QLHA 3GUEA 1YWXA 2DD8S 4O3QA 4X62F 2AZ3A 5J2PA 4ZVUB 5KFKA 4DR7J 1VOMA 1V67A 2DH8A 3NMAA 4LSLB 2W9CA 4FF4A 3NP5A 3U27A 3OTEA 3EXYA 1M8NA 3BREA 1PSDA 2CQ4A 4ZJLA 5C2GA 1LR7A 3M8PB 4K4UA 1D9AA 1DURA 2IM2A 3GQAA 2PI5A 2F63A 3H2LA 3T9ZA 4RBVA 1NSAA 3TO8A 4DS5A 2NPOA 2Q4JA 2H1YA 5EX3A 2D3OR 4QR0A 1ZETA 3R8YA 3T5LA 1N36J 1SQGA 3R27A 3JYTB 5ETSA 4L74A 4GC6A 3HD1A 2OU2A 2JZ5A 2YNFA 3AOBA 1YGYA 2ZWPA 2DNQA 3ENVA 2V2VA 4IYQA 4RUHA 2F4FA 3MR2A 5LSLA 3R2DJ 4ZCKA 3JTPA 2P6SA 5HMYA 5CYQB 3LW5C 1WG5A 1YJRA 2VKZG 3SEKC 4GRSA 3UCGA 5G4DA 4LQ3A 1BQMB 4U7CA 1RGVA 2CNKB 2XMUA 2MKCA 4JI3F 2HBRB 2N71A 2KT2A 3H59A 2G9OA 4EBEA 1S9GB 4D3HA 2CDQA 2HHPA 1W4RA 2F4VJ 2RH3A 2DEJA 2HPUA 2OFGX 2G2ZA 2PA3A 3QO9A 1K0VA 1XEZA 3VV2B 2ZD1B 2JJ4D 3VQSA 1L3SA 3FWWA 2ZOMA 1NPRA 3KKFA 4PQUA 3R5DA 3W60A 3CDEA 1GK8A 4CTAA 1TMJA 5KG2A 2HS4A 1KVKA 2ERRA 3CJ4A 1IW4A 1OY8A 2H5EA 2B5JB 3UFFA 1GMWA 1AB8A 2QA1A 1S9FA 1YHQS 3FTTA 5D3GA 2XC9A 2WGCA 2NCKL 2KZMA 1Y3KA 3PYGA 2PFFB 2DGQA 3IS9A 4IO1A 5KG0A 1RUSA 4UOGA 5KTQA 2FVSA 1RWUA 1U0SA 1RT4A 2K1RB 2NSBA 1X5TA 2CRLA 4RO0A 1PKUA 1TBNA 4WU2A 4QW8A 3KLFA 4QU6A 1HEVA 1S80A 2B9XA 3C8VA 2YWWA 2GVDB 2P6TA 3TA2A 1XNRF 1N6QB 5BR8J 3CSKA 3LP0B 1GTHA 1U1LA 2NREA 4OYPA 1I1GA 2AHOB 1TOTA 4B9SA 2KHCA 2QRRA 3AAWB 2BANB 4DZ6A 2BJ9A 2Z2MA 3DNCA 3KLGA 1JLGA 4A8WA 4ED7A 3P1BA 2HQ3A 4URSA 3Q8SB 3KY9A 2MSSA 4YHHF 2FJWA 2Z57B 2C2RA 2RD5C 1VFJA 1VQ9S 1SC6A 4LSLA 2CJKA 1SJRA 2KYXA 3AA9A 3AOAA 3IXQA 1JB0C 5HQMA 2KXHA 2WVJA 4Y0FA 1KBRA 2B7CB 3ZTQA 2FHJA 4CH1A 1ZA1B 4TNOA 4U7UK 2AMCB 1G6BA 3DLKA 4ZCMA 5CA5A 3GQ8A 1RXOB 3ZC4A 3R2WA 1KHWA 1D8ZA 4AL7A 4Z7CA 4PWDA 3KWDA 4DN9A 4YY3F 3BQ0A 4ERDA 2ZC3A 2J6UA 3JQYA 3EJMA 3IXCA 1ELOA 1KP6A 1LW0A 1RT3A 2CQBA 1TL7A 1TV6A 2NS1B 3TOAA 2PEBA 3NEKA 3NWRA 4MFBB 1WOSA 4QQBA 2DNHA 1WUUA 5E5NA 4P7TA 3BXYA 3Q8UA 3U1NA 3W7BA 4DV4F 4DR4J 4NLDA 4ZOSA 2ENZA 1C4AA 2CQ2A 2DIPA 4KYZA 5M2RA 3BO4A 3J80U 1DY3A 2QJ3A 4JI2F 2E73A 1KLNA 3R7NB 4MYOA 2FNFX 1X9MA 3EM1A 5ADXU 3KNGA 2ERWA 2V0NA 1ITPA 4O4GA 4NLPA 1FJGF 4ZVPB 1KBFA 1LWEB 2Z2ZA 5L6VA 3HHEA 4WFXA 3VQTA 2YWGA 3ONQA 1UCNA 3DI6B 2HHHF 1S1TA 1N8RT 2O66A 3Q89A 2C3YA 3CMQA 1Q8LA 4UXHA 2KRBA 1V9OA 4J91A 4HTJA 3VAJA 2V8VA 3T1HJ 1OMUA 1VIOA 1WTJA 4GI3C 1HNIA 3MFHA 2KMPA 2UVRA 1HQUB 4IRKA 4WYWA 2VD3A 3CCZA 1MROB 1Q8KA 1QTMA 3BDEA 3J81j 1F9HA 4TXSA 1S0MA 1ZM3A 3VZHA 1M5VC 4I6AA 4IDKB 1TK5A 3TJ9A 4OLOA 1JKHB 2LQBA 3FMWA 3KLEB 3MAAA 1SBRA 1L5UA 3V4EA 2NYIA 3SFGA 1EIYB 3B4MA 4U8VA 2DRBA 3HZGA 1G7CB 3QWPA 2AU0A 4QYZJ 2V0JA 3M4XA 1W2IA 2E7VA 3EG4A 4R5PB 1QLNA 4NPOA 3QIPA 3OR1B 4LF1A 2HQCA 1FVSA 1OMSA 5L1LA 4FF3A 3BF4A 2B4OA 5F8GA 2EWHA 1XR7A 4FPRA 1ZS6A 1FESA 2MKJA 2ZM6F 1U8SA 4DLGA 3UNGC 5MLCV 3UD3P 1RTDA 4DNCA 3KJVB 2I5KA 1RT6A 1S97A 3NZ2A 3QSIA 4B02A 4DV2F 4UW2A 5GMKa 2ZE2B 3UDEA 2DHGA 1IQZA 2KI2A 4EYIB 4ED6A 2E1CA 3TANA 1ZA2B 1RADB 1Z2FA 4JI0F 2A3JA 7AT1B 1UZDA 2BJ3A 4LR7A 1EX8A 2QEXS 3R5JB 4YDDB 1OWXA 3TV0A 2V1CA 3MCMA 2R7OA 6AT1B 4N5SA 3NNAA 2CADA 3L7UA 2PDAA 2XYHB 5B0CA 5M2PA 3FCHA 4YB6A 4FCEA 1FK9B 1GMWD 2BM0A 2HBYB 2VFRA 1N4IA 3QFHA 5AXMA 4AFFA 3TO9A 1YBUA 4PPDA 4I2QA 1P1LA 3I4HX 4DOZA 3BYPA 1WC3A 4WFYA 5CHCB 4DPUA 1FWPA 2B4PA 2JOQA 3ILJA 3UOEA 4LF5J 3PW5A 2DR7A 2JC0A 2L9DA 2RKIA 3GFYA 3DU6A 3W63A 2WVBA 1GFWB 4MTPA 1FWLA 4OX7A 4B17A 3QZ8A 1UVFA 2AJ0A 3FSBA 3AD7C 5DDRC 1NB2A 2NLWA 4O44B 3RZAA 2Q3PA 2OPSB 4RW4B 3OLBA 1YU6C 2RS2A 2ZD1A 4WFZA 3H98A 3KK3A 1UVIA 1CSOI 1FXRA 5HVHA 4I2PA 2E5LF 2I5JB 3QJPA 4WF9Q 3C14A 4C97A 2KDOA 2MEWA 4CRJA 4ECSA 1AZSB 4ANEA 4WP8A 3M6VA 4JI1J 1FTRA 2QMXA 2G4BA 3EGNA 1SKSA 1JK9B 1K9MT 2J6SA 1F1BB 2XO6A 1XQIA 4PQAA 3QT5A 4OHYA 4J37A 4PABA 2IUAA 1QUPA 2FY1A 3BGOP 2GW8A 3TJ8A 3BSOA 1RT3B 4OX9J 3HKZD 2WB4A 5ETVA 2Q79A 4LRFA 1H38A 2AEMA 2OEFA 3BRKX 2VA2A 4B9VA 5ETOA 1NKEA 4NRUA 1K7TA 1HNVA 3LGMA 4I1TA 1LXAA 4WKRA 1SIWB 1UVGA 2VU5A 1KRUA 3M1VA 5FIIA 1RT2A 4FPIA 3M8RA 3GOSA 3RTVA 1F5AA 3VHQA 1W3SA 2FVCA 2W2OP 1WDDA 3P8BB 2CQIA 1P9ZA 2HGLA 4OX8A 4OI2A 4O44A 3T3FA 2QQDA 1RTIB 3GQ9A 2YKNA 2W2MP 4DV7F 3GR1A 1UPMB 3ZZ0A 4X66F 3AY0A 1JIHA 3UD5A 4OHZA 3OTOJ 3GV7B 4ED1A 3FBFA 3NGTA 4RW9A 2P9GA 5GAEI 1U2RA 5C25A 1UW9A 5KOXA 2DBBA 3KDNA 5EWGA 1ULNA 3QPIA 3DN9A 4FYVB 4WTOB 4JYAJ 3UN5A 3OJUA 4LJMA 1U02A 2GVIA 2F3JA 4CM2A 1SH3A 2RHSB 2V34A 4FKXA 1RHQB 1P27B 4WP3A 2H5JB 4IHGA 3FDSA 3MHYA 1KQAA 1BQNA 1FRXA 2ACMA 2AYGA 3J7YU 2HQDA 3IS9B 3VE5A 4QYRA 4QR2A 1U1QA 2HZAA 4RUBA 3PR4A 2FHMA 2YTCA 2W8LA 3PVXA 4NA1A 3BQ1A 4ECTA 2CPXA 3D1HA 5EGYA 3NGSA 3VZIA 1ULKA 1H73A 4OFZA 2RQ4A 4NLYA 1Y5IB 3EXCX 2VJUA 5L1IA 1U45A 1RWVB 2X51A 1ULRA 2ASYA 5T7LB 2F5GA 4DL5A 4TQRA 2R7SA 3FNNA 1N34J 1DQAA 3FRZA 4YB1P 2DNGA 1MMDA 5KFYA 2Q1LA 1MU2A 5U47A 3IGNA 4A8YA 1U1OA 3TK8A 1RT6B 1BHNA 2DJWA 3MCOA 1K7VA 4C3LA 1XX6A 1N32J 1Q79A 2H9ZA 3DMJB 2JEIA 1K7UA 1U2CA 1R8HA 3MCSA 1AFJA 4LSZB 1ULMA 5KFIA 2JW6A 3M6UA 3R9LA 4EZ6A 3R1WA 5THWA 3NOCA 1LWCA 2JDJA 3BGLA 1PC4A 2CQDA 4U9RA 4HI1A 5K8PA 1EHWA 3ZZUA 1SH2A 4EK2A 3DM2B 4F4WA 2PO4A 3PRBA 4EQYA 4TY8A 4QWBA 4DX7A 1A6LA 5D8HB 5ADZA 1UVKA 2MQLA 1P1TA 4H4KC 3VBMA 4ER8A 3FOQA 2MLZA 5FUVA 1KD1T 2CQ0A 5C42B 1ZM4A 3UNYA 3O5TB 1FKPA 2DIUA 3M32B 1N52B 3BGFA 3SCLE 3NGKA 2L7XA 1MWQA 2VHEA 2G0CA 5LT5A 1J27A 6FDRA 3UR3C 1M90T 3ITHB 4HUSA 1JXVA 2UUWA 2LEOA 3CD5A 1FX2A 2FIUA 1S1TB 1DQ9A 3ADAC 2RC4A 3C14B 3DLGA 2LA4A 4KHMA 1DTTB 4LF9F 3QJLA 4FVCA 2E9ZA 4EU0A 2XQCA 1IVZA 3F41A 3G86A 1B70B 4A48A 5K14A 1YP3A 4RW4A 1F6TA 5ETRA 2DO4A 2ZBQA 2I0XA 4B3TJ 1TAUA 3PYFA 1KC8T 1RK8A 2K8GA 3TWZA 1S1VB 1XR5A 3JSMB 2N4DA 4M5DB 3SQGB 3MM7B 5HMZA 1IJEB 1H74A 4C8MA 4CH7A 4ZP6A 4ENOA 1UZHA 2HK2A 3A13A 5B08A 1CT4I 2ATLA 3PDNA 3D3BJ 5AXNA 3FK4A 4LR8A 3PV8A 3FSCA 5CCMA 4ZLPA 3TQ1A 4M8LA 5B09A 5KT6A 2BXJA 1KTVA 3PYEA 4U96A 4J7CA 2HQFA 2LXIA 3PCOB 3W2WA 1SIZA 2HFZA 3ZFVA 2C28A 2XB2D 2W0WA 2OPPA 3GV8B 3EZOA 4JB8B 2KM8B 2HWIA 2OI2A 1KK6A 5EDWA 2BMBA 4JI3J 3IM8A 1X4HA 2ABYA 4QU7A 4BS2A 3IN5A 2DPIA 2YWKA 2XS2A 4PR6A 4WZMA 2FDNA 3NY0A 2PN6A 2PSZA 1H3DA 1VI7A 1K1QA 3D5MA 2UZ3A 1HHQA 2YNHA 5C24B 4M95A 4DUYF 1JLAA 1QTNB 2CPHA 3I5BA 1SC3B 3OFGA 3RW7A 5KFPA 3CC2S 4DV5J 1ZZNA 4JYAF 5EHHA 2J9EA 1TIHA 1RAJA 4H4OA 4F67A 3RBEA 4UTGA 1FYBA 1WI6A 5GMEA 1OSCA 2CG4A 2DR8A 4UY8T 2MQPA 1QREA 3DGVA 1YJ7A 3MURP 3EGZA 2DB6A 2EC0A 2R7QA 1MMLA 4DF8A 1EKRA 2IAJB 4M5GA 4EO6A 3MTJA 1XNRJ 4DI6A 1RLCL 2R3VA 3C6TA 4ZP8A 3UVJA 2YQPA 1S6QA 3SCJE 4KPXA 4DCOB 3VAKA 1LFWA 5MAOA 3FSYA 5KAKA 1DZ5A 1JJHA 5HROB 1LOUA 5F8NA 5J2NA 2FJBB 5AXLA 4IG3B 3MQGA 1LXNA 1DS2I 4R0EA 1NKBA 4AA7A 2SGDI 1PCEA 3CCQS 2DIVA 1IR1A 3IMQJ 4NASA 4FKDA 2QTWA 1CULA 1U6FA 1JLGB 2FHJD 2F9DA 3W1YC 3KHGA 2R7WA 1KWMA 3PTWA 1MMNA 2DRAA 3I55S 3DRSA 5B0FA 1PG5B 5E33A 3PM9A 1UWBA 5E3QA 2UUTA 1RE1B 3R97A 4K4XA 5L6SA 1Q8IA 2IMWP 3M2RB 1TFYA 1LQ9A 3U1MA 2XSFA 1LW2A 2HNZB 4L76A 4USKA 4ZIWA 3MM7A 3MGJA 4OJ1A 2AEFA 4NLOA 4FF2A 1C0TA 3JS9A 2RU9A 3MWBA 3VVTA 1U0HB 1VYAA 1YJ9S 1FD2A 1PTQA 2JF2A 3TAQA 3CJRA 2KG1A 1DTQA 4M2AA 3GLJA 4MYTA 3KYLA 1T7PA 1TELA 2AT1B 3TO7A 2FHOB 3CJ2A 4JI7J 1KLMB 4NLVA 5AE3A 2FLPA 2AJQA 2D74B 1UA1A 1OIAA 1BQMA 2XTJP 9RUBA 3G6XA 2J9DE 3GWCA 3CCJS 4GKJJ 1UJ6A 4Y34A 2M5YA 2J0QD 2R9LA 1FERA 3RGIA 1R0CB 2VICA 1T9WA 3BR9A 4FYDA 4YFUA 5EUHA 1FDBA 1ZM9A 3JXOA 4BC9A 3KK2A 5LMNF 1X9SA 1UVLA 2IDLA 2MJNA 2VQFJ 4A8QA 3QYYA 3R6GB 3J81Y 2WAQD 3S01A 4XPEA 3VWSA 2MGZB 3RB3A 1VC5A 3GOXA 2UV8G 2IU9A 4Y2KA 3Q23A 1Y4ZB 1RWNB 3KUGA 4KTQA 3IM9A 4RNMA 4DV3J 3PY8A 3C46A 4K50A 3O3LA 2VD4A 1L0SA 1JNZB 3HHDA 4P2MA 1YKWA 4LRBA 1O6XA 3TVKA 1FXLA 5DLGA 2GVZA 4M98A 2HWTA 1FY7A 3MMJA 1U2FA 2CYYA 4E6TA 1EARA 1SKUB 2VFUA 2YWFA 2G2OA 3GCWP 3H8YA 2KMRA 1AZSA 1JLCA 3OL8A 4OZ2A 2AKWB 3CF5Q 3BFPA 1HARA 3MEGB 2D1CA 4PYAA 3CD6S 4CO5A 5DZ7A 4U6PA 3C15A 4DUTA 2XM3A 3RB6A 2VG5A 3B6BA 3LUYA 2BQ3A 1SGYI 3QRRA 1OYEA 3B78A 4JI5F 3POTA 1NCLA 3GYXB 1JNRB 5T14A 4CLFA 1QRGA 2DHHA 4YR0A 2N52A 3OTCA 2XO7A 1RTHB 1WEZA 1IKYB 4KC5A 4PXCA 1IM4A 5H9FK 1RAOA 1KVJA 2C3UA 5C5JA 4TKTA 2ZE2A 3M1VB 1CE3A 3L7OA 3MECB 5A8KB 3W9IA 4ILMA 2DXFA 1HMVB 2A1BA 4ISXA 1RTJA 1SV5B 2EK6A 3MM6A 3PEHA 4K4TA 3UEYA 1WD6A 3K17A 5C24A 2KL8A 3OFFA 2Q66A 3VDPA 1CJVA 2HQIA 2BE9B 3I5AA 4K4YA 2L9WA 3FEXB 1X5OA 2O3DA 4PXEA 4QOTA 1FARA 1RHRB 1RA6A 3CCTA 1M1KT 4DPXA 1D0EA 5E3PA 1YJUA 3MEDB 2E66A 1BE4A 2DR5A 3C16A 1DTQB 2JLFA 2GIQA 4NRTA 3VNPA 1XJWB 3N6LA 2VA3A 5CCLA 3BSSA 3EZ5A 2BR0A 2CDRB 3R1HA 1JLEA 4MPIA 1NLKL 2JVRA 2DNRA 2YQ3A 3T5JA 4ZVOB 3KOAA 4NOHA 4CLLA 3CJ0A 4IG0B 4ID5A 3CJTA 1VK3A 1IY5A 1F9EB 4PKDB 4LF4F 8AT1B 3UGLA 3GSDA 4C11B 4NXMF 1UAWA 3J81U 1RISA 4LVOP 4Y65A 2AYEA 4ED4A 4C8OA 3R5CA 4CCHA 2VDIA 1FJ7A 3D54A 1S7HA 3VVUA 5M2UA 3W2VB 3NNCA 1C0UA 1CVJA 1PJUA 1EB0A 1VRUB 2Z2YB 1WC4A 4WKYA 2IA6A 4MKYA 1VQPS 4RL1A 3T1YJ 1TU0B 1WTBA 4R0JA 5E41A 1J5EF 2GO8A 1OS5A 4WTYA 4MAKA 2XNQA 3G96A 3HJVA 2UUCF 5DO2A 2KTQA 1TAQA 3M9MB 1E6VA 1XNQF 2XZTB 1LWXA 4RWWA 5KT3A 3K8WA 1FVQA 2YKPA 5KFRA 5A6WA 3HHKA 4CLWA 3OVBA 1F0XA 2ARPF 1H72C 4QIGA 2W9BA 2RHQB 2EXUA 1F2HA 3OXFA 2VDHA 3EDQB 3MPVA 1LW0B 2YNIA 3G6VA 1ICEB 5HBMB 3QRPA 1RQ0A 4ZN3A 3LOUA 2A2DA 4IR1A 5DJBA 1IBCB 4EO8A 2HWHA 4C11A 4B6DA 1YRXA 1X4SA 4DCPB 1RT2B 2WLEA 1IJFB 2RB7A 1IKYA 3D2WA 2D9PA 1XMOF 4E0DA 2ILZA 5IV3A 1XWLA 3DI6A 4DL3A 4PUOA 3ISZA 2ZEJA 1C0UB 4M1KA 2XY5A 1QSSA 3POTB 4CLTA 1CEZA 2D69A 4HDHA 2LDYA 1AN1I 2YX1A 4O4GB 2C3PA 4ZVHA 2WTFA 3HX9A 1IR0A 1TUWA 4AQYJ 3G8QA 2KMQA 3GR0A 4HURA 4UOFA 2DNOA 1CJUA 2E1MC 2LEBA 4JUZA 2W0VA 2DGXA 2E5GA 3EMTA 4FKYA 4ZIVA 2AGPA 5A2QY 4P75A 3HHLB 1T95A 2MQOA 1CQMA 2OMLA 3DJ4A 2AV5A 2H48B 3KG1A 4PG5A 4DL7A 1WWHA 3KLIA 1YG0A 4C8KA 4YOEA 4LFBJ 3GMGA 1SJ1A 1FRIA 1LEOA 1Y9OA 2YX7A 1RT1B 2BEFA 4WBFA 1S79A 2LP4A 1BMOA 4MK8A 1REVA 3CMES 5J1EB 2UUAJ 4HT5A 1TZ0A 2YKQA 1NAQA 4BWJA 1HLWA 1RKJA 2HIQA 2IMOA 1X4BA 3BPDA 2GMLA 4MFBA 2GAHC 4ALZA 4ZHRB 4USMA 3GV5B 3NAIA 2WLDA 3P45B 5CYMA 4A8XA 4IG0A 1QRMA 2MZ1A 3MOJB 1LNQA 2OD6A 2FGCA 2ZDOA 3C15B 3DU5A 2KO1A 3P5TL 2HAIA 4ZCIA 3W64A 1GEHA 3VAFA 5FD1A 4JI0J 2FKOA 1RWWB 1F5BA 3HCXA 3IAM9 3QO9B 4J9RA 5H9EJ 2E5IA 1Q8BA 5DETA 1Q7LB 1HNXJ 3P47A 4ES3A 3BKTA 1KRPA 4DX8H 3E2EA 4K4ZA 3GVDA 2CVIA 1RWMB 2W24A 3BO2A 1L3VA 2VG6A 1R79A 4H54A 4L73A 3VAMA 2IBOA 4DV0J 3CGIA 5DGAA 1S76D 1TR0A 4J9SA 2IRUA 2QLWA 2LKZA 4CLKA 1H2TZ 2LU1A 2OUGA 3BSCA 1VHIA 3D1OA 2KM8C 4ECWA 4ANCA 5I4MA 1BQXA 4OHVA 5GADU 1VMBA 3EICA 1Z1ZA 1X4CA 3SGBI 1RABB 7FD1A 2BRLA 3KLFB 1M5PC 3OR2A 3PFEA 2DNPA 5DS7A 4EGLA 4ZITA 4K4WA 4F36A 2CQ3A 1UA0A 2LEPA 3D1QA 1SGEI 4DV1J 2E7XA 4NXNJ 1UP1A 4MK9A 2GA7A 3AJDA 2DCUB 2CNOB 3H5UA 3PRVA 4NZ6A 3D0HE 2I6WA 5DGBA 3E8OA 3LP1A 4OQJA 3ILOA 4LSNB 5DDPC 2ELIA 4ECYA 1FJGJ 4V19X 1EP4A 4CI0B 1S9GA 3F73A 1VQYA 1S6OA 2HFSA 2JC1A 3UDCA 2Q6BA 1B7FA 3RRHA 3EVMA 1F60B 2FGOA 1MU2B 1RHMB 4L75A 3IRWP 4B9NA 3TOBA 2Z2LA 3DRYA 5HANA 5SUHA 2AZ1A 4BLGA 1RBLA 1Q81T 1KSPA 4HCQA 3CXLA 2VBWA 3A3PB 3NXZA 2YQ0A 2IRYA 5D0GA 3DYAA 4TYAA 5HO4A 3VAHA 4LRAA 1HWIA 4WJBA 5LMNJ 2IAJA 7WGAA 4MJKA 2XMVA 3CD0A 2EBGA 4UF4A 4CWBA 2R8GA 3DLJA 4QPXA 2R7TA 1SSMA 2ZH6A 3SQGA 4KO0A 4P2FA 4BBYA 3J7Z5 5HQ8A 1X4DA 2ZUAA 1NNDA 1FA0A 1WELA 3BH6B 1VBZA 1T9YA 3IBCB 1NB7A 1RT1A 3NS6A 2MY8A 1NHKL 2BKPA 3AB4B 4P10A 2BJDA 5JVHQ 3SV4A 3UCZP 4F3MA 3BH7B 1Y7PA 4LBHA 1FK9A 2LA6A 3D6HB 4IRDA 5H9FJ 1H7XA 4X4RA 3UW1A 2M3DA 4OI6A 2W9AA 4C8LA 4ITSA 4ICLA 4ZPBA 3ZTOA 4MT1A 2UZAA 1K1SA 4OZ1A 3N28A 3WC2A 4OVOA 3DOMB 1O8BA 3RG6A 2GCFA 4EI2A 2E1RA 3QAEA 1UMJA 3W5YA 3UGIA 4RU9A 1EETA 1QAXA 2FJDB 1Y11A 3HVTB 2OD1A 1WHWA 1RTIA 1UEVA 3ENAA 4OYWA 3BQ2A 3JB9k 3EYZA 1VQNS 2VKRA 2WB1D 4QBUA 4YMEA 2WONB 2B8TA 4WU3A 2O1PA 5I3QA 1SC4B 4OZ5A 2F7VA 4F26A 3I32A 4RUAA 3OUYA 2M8DB 2JEFA 2K1RA 3O6QA 2ODDA 3VAIA 1B3TA 4B3MJ 1WACA 5F8JA 4ZVTB 2W7OA 4JI6J 1FDAA 2ZH8A 1T0TV 1HBMB 1GXTA 5D3GB 1IWAA 4F2RA 4LFCJ 5J1NA 2X1BA 1KQKA 2DY9A 2JH3A 4K2JA 3US5A 2BUNA 3UN3A 2R8KA 1WEYA 4DV6J 3QNWB 1GX5A 1NHVA 2H4YB 3AB2B 4L3NA 2B6AB 1TL3B 3V81A 5J2NB 4CDIA 1AUSL 4QZVB 2D9OA 5CD4H 4GKKJ 4DS4A 3ITHA 3CJ8A 1CS4A 2JWNA 1B99A 3R5GA 3BYRA 4I0WA 4YR2A 1M5SA 2OPRA 4E79A 1E6YA 3M32A 2V0IA 4NE9C 2ZUGA 1HQ2A 4OYBA 3TA1A 3UO0A 4F3QA 4DPYA 3OFEA 4ZK7M 4LF2A 1T05B 5ETPA 1V1IA 4AD6A 1B0PA 1EZZB 1X4EA 3OUYB 2AX1A 1MJAA 2ZBCA 3CE8A 5D4LA 4ZMMA 3FEYB 3CDBA 3H2VE 1FRLA 4KO0B 4X4UA 2HFUA 3GIRA 4LF7F 4FXDA 1BMQB 1TKXA 3BEGB 5LSOA 2L41A 4USVA 3NWGA 4YEAA 5K14B 1B64A 1WKLA 4OIXA 4PWUA 4L9MA 2GKTI 2GQCA 4CM0A 2QKXA 4L72B 1GNKA 4GC7A 2RIJA 2E5JA 4LIWA 3EEVA 4KGXB 4LSNA 5F9LA 3OL7A 2HVIA 1YBTA 2IJRA 2JEJA 2JLEA 4I56A 3D0IE 4YQWA 3CEDA 4W98A 2FC9A 1HPTA 1SGRI 1CC7A 1SCJB 2RAQA 2MLXA 2W1BA 2WRMA 2WLGA 2YKOA 5FDLA 2LFVA 5KFZA 1VJQA 4PZVA 3IGJA 1FKPB 1RDRA 2HRTA 2FLOA 5CABA 2W7PA 1TDTA 1SV5A 2AWZA 4NYPA 1C2PA 2VQEF 1A7GE 3PFOA 1M5KC 4CYUA 5B7WA 2CPFA 2MSTA 1TP7A 2SXLA 1OYVI 2D41A 1Z2IA 2BRKA 2GHPA 3M7VA 4C0BA 4X4NA 2GC8A 2LEAA 1XMQF 4AL5A 3DYAB 4O23A 1SB6A 2YWEA 2CJBA 4NCGA 2L8EA 1NPPA 4HTIA 4OYAA 3S1TA 3KLIB 4O3RA 1S0VA 4DCLA 1PILA 4DDFA 2OIHA 2GS8A 1YRUA 1T9VA 4G3SA 1CT0I 4WYLA 2HLTA 2P2CB 1WJ9A 2JF3A 1NDPA 2JX2A 4RW7A 1YITS 4OJGA 3RW6A 3B82A 3L09A 5KFVA 5KT2A 2CPEA 2HHTA 1MSWD 3NCPA 1HD0A 1N5YB 1VDDA 2HNDA 2O01C 3E2IA 1ZTTA 1X31C 2CFXA 2HEKA 3LP1B 3KTQA 3UEJA 2V1CC 1TVRB 4TU7A 1PO6A 4B3OA 5LMUF 2VUGA 3PMOA 2QMUB 3G8TA 1NK5A 1S9EB 2I9SA 2QLJB 2VFSA 3L7PA 1RKIA 2V2KA 4AL6A 4B3TF 4LBIA 5FUYA 3OV7A 3ELHA 4F4AA 3EVOA 4UQGA 4JI4J 3KHHA 4JI7F 2R7VA 4M2BA 2W9BB 2CAJA 3LAKA 1OJ4A 5ADXV 3CO0P 1Y5NB 2A6OA 1L3TA 1FJCA 3N5BA 3B4VC 3JQMA 1Q95G 3IRXA 4M5LA 2YQ1A 4X65F 4UZBA 1ZTWA 1CJKA 4Y2IA 3UR0A 1VC6A 4DQPA 2E5RA 1ACMB 3P96A 5EX0A 3LTOA 1S7IA 4OYZA 2YVSA 4CT9A 3F44A 2V8GA 3NGUA 4HHHA 4TN2A 4JV2A 1VQ4S 4NI2B 1UFWA 1ZM2A 2B43A 3C6UA 4U67Q 3DGPB 2BJ8A 4K8RA 5IZHA 3TO6A 5IM0A 1I94F 3HK2A 1Q0NA 3BN4A 2AYMA 1V1HA 1EKSA 3P5BP 3UN2A 1QM9A 1RAEB 2IHR1 3MEEA 4F7VA 5HVGA 4DL6A 4I68A 2KH9A 2F3CI 4P7VA 1FAQA 1CG2A 5LL6d 2CPJA 2KG0A 5DG7A 5D4PA 1HDLA 2UU9F 4I69A 2GV1A 2MQNA 1CULB 2AJFE 4NYZA 3T41A 1PCAA 3TJQA 2NXUA 5AJ3J 1R8AA 4KGMA 5HSPA 2BACA 1S1XA 3CJQA 1ZYQA 2YNHB 3PIOQ 1UFKA 1TKTA 1VR6A 1X0PA 2RRNA 4KPCA 2BJEA 4Y3CA 1U1NA 2V8PA 3B54A 1T9XA 2QC3A 3EH0A 1CJKB 3HSGA 4L6V3 5KFFA 1HNZJ 3CCES 1E6VB 3OD2A 1PYTA 2LQ9A 3HSZA 1Q53A 5D4OA 3TAMB 3O44A 2NR0A 2HVHA 1U25A 5A8RA 3LGHA 2Y1RI 2KZZA 4AYBD 4JBCA 4DX5A 3TUZC 4LF8J 3GTYX 1HI1A 1L3KA 4QW9A 2QIVX 3CNQP 2DHAA 2XSJB 2V4RA 3H4DA 3NMRA 3SMZA 2YX4A 4OX6A 3TWDA 3K5NA 5F42A 4DV5F 5L1JA 1Z2ZA 2UP1A 5I3UA 3CC4S 1HBNA 4Y2AA 5KFJA 1R0AA 1J5EJ 5DEPA 1BUSA 4ZVEA 3SGQI 5F8IA 3N9UC 4ZVFA 3GP9A 2B51A 1WG4A 5G0RB 3T1YF 3RJMB 2QFJA 2MHNA 1RCOB 3MMAB 4IFVB 3OJSA 2W8KA 5L1KA 4DR1F 1U1RA 2J87A 1C1CA 1IXKA 5F8HA 3Q22A 1IQTA 2RQMA 3DDIA 2BA9A 2RRAA 3R1LA 1UFLA 2J7KA 1CJVB 2R2RA 3MR5A 1URRA 5CZXA 2MKHA 2L3MA 4NLTA 1WOOA 4ZVRB 1VBKA 3RBXA 5KFSA 3KHLA 4PG7A 5E7OB 4EA9A 2ZJPQ 2VFTA 4JI5J 3KDOA 1R0AB 2HHHJ 1N88A 2Y1LB 4F4ZA 4DV2J 2J5AA 2QL7B 2RDIA 2ROEA 2IFXA 3KNAA 3R0SA 1T3NA 4RKUC 3RRKA 4LF9J 1GXLA 4G1QA 2IIHA 4E1PA 2ILYA 1KVIA 4WFAQ 3HSDA 1JLBA 1HBOB 3UPFA 3PKMA 5F0WA 4FXVA 1S10A 1OQ3A 1DBDA 3V5RA 3KMSA 3PW7A 3TI0A 1CQNA 3MUMP 5J2MB 2DR9A 1RWPB 4RBUA 5HJXA 3PKYA 2OI5A 2QPOA 1UKUA 2A6MA 2DY1A 2R4FA 4NLXA 4PG6A 1JMTA 3FJ2A 4CLPA 4DL0C 5HJYA 3HFKA 4K7QA 3H5YA 4Q44A 1DTTA 2W9CB 2GHVC 1FDDA 1I6JA 1HIYA 1B7YB 1NH7A 2V68A 1S1UA 3CUNA 1HJAI 1RAAB 3M8QA 4C9DA 1X0FA 2BE7D 1SGQI 4ECUA 2VG6B 1R89A 2XGQA 2CPZA 4G6VB 1MJ9A 4KIAA 3R3RA 2A10A 5I42B 4E8UA 3MAQA 2KT3A 3MAAB 1V3ZA 1S1XB 2B8QA 4HACB 5ETLA 5B0EA 2SGFI 5E2QA 3TX8A 3PR5B 2C3MA 5J8CA 2QZ8A 1ZPWX 2VQEJ 2F40A 4GVLA 4MYUA 2WBRA 4CNYA 3JSBA 5GADI 3DLBA 4GO7X 4G3QA 1X60A 1U48A 4WE1B 1U7LA 3K89A 1PBAA 3FFIA 3NKYA 1NRKA 2MTLA 3GYNA 4K5SA 4XK8C 3VGVA 3PW2A 4JI2J 1PYSB 1FKOB 3GFXA 5ETQA 2FVQA 4R37A 1N32F 1VQ6S 1MR9A 4A46A 1YZ7A 4C3KA 3CB4A 2DRDA 3SXLA 3GJRB 2E9RX 3Q24A 3H4BA 2KVQE 3CDAA 3M2UB 3ZTSA 4YY3J 2KXFA 3R5AA 2B6AA 4WIIA 5D77A 1QE1A 1U6ZA 4EGGA 2J7WA 3A3OB 2VBYA 3D6FB 3BSWA 2E44A 3BSNA 2C22A 3DHXA 2AIRB 1FWKA 1RB0A 1Q82T 1OSDA 4RW9B 5JJBA 3G8SA 1GMVA 3K58A 2PC6A 3H25A 1WGCA 2G1DA 2OELA 3TUJC 1PJ5A 5J1PA 3EPIA 1MLAA 1VCTA 2OHDA 1Q5YA 2NUHA 2XMJA 3FBEA 4QJVA 2Y9HA 2LDIA 2ICYA 2OI6A 1H2VZ 3J7A1 4PWDB 2BJ1A 3OVOA 1AROP 4YDXA 3D8VA 4KY3A 2DGVA 2XWYA 3O2IA 1NZAA 3GJSB 3QTLD 3IR7B 1ZAWA 4JV0A 4CNZA 2ROWA 3AT1B 4Q43A 4DV6F 3ST8A 4KGZB 3PZPA 1U5KA 2ZKUA 3T57A 3GQ7A 3DGPA 1XC9A 3L4BC 3G71S 4BCAA 1TGSI 5IC6B 3HSQA 1QSYA 4MMOA 1RSCA 4G3PA 4K6RA 5CQGA 4N8NA 2HHWA 2E5HA 4Y6IA 2KU7A 2GGPA 4YB5A 2P2OA 4IG3A 6FD1A 1ZZFA 3PRDA 4OI3A 4LMZA 1ZAXA 1NJZA 1GMUA 1N0VC 1WC5A 2W4CA 1VLOA 5D6GA 2VOOA 1NPKA 2ZBRA 4CLSA 1T8EA 2B8PA 3T19A 2WONA 5K8NA 5DG8A 3A8KA 3HI9A 2KJWA 3ZO7A 5KFLA 2EW9A 3M2RA 1FNMA 2HQGA 1TKZB 2J8SA 4DFKA 4CTAB 3AHPA 1JXLA 4J9UE 3BDPA 1HWKA 2HVZA 1LWCB 2QMWA 3AH6A 2FZCB 3HVAA 3MR6A 2VRWB 2AJ2A 3NCRA 2R7UA 1HPZB 1OY6A 1NO8A 2BE2B 2EG2A 3GONA 4KKOA 1SC1B 4Z7YA 4GMKA 3W8GA 8RUCA 3KJFB 5FUXA 4J9PA 4IQXA 3C6UB 3QIDA 3OHAA 4B08A 1XN9A 2XBPA 2EFOA 2QV6A 3GSIA 5IQQA 3CWJA 2CJXB 3TQEA 2XWXA 4P52A 4LIRA 1OPIA 1R8PA 2W4PA 2C3OA 3GB0A 1VJWA 3K7RA 3KWEA 2CJQA 3IGVA 1Q9BA 5CYQA 3BO3A 5DM7Q 4GO5X 4IKAA 3DHWC 1B0TA 3EE3A 4NMXA 2NPIA 1JJ4A 2W0TA 4OYOA 3RBDA 4KQLA 1F9FA 1FXDA 3SV3A 1NJXA 2I8EA 1R43A 4KHPF 2RF2A 4B9TA 3RAXA 2MLYA 5ETTA 4F50A 1IWGA 4YR3A 1NM2A 3DLKB 3VGSA 1FE0A 1R7IA 2QLXA 1DJ0A 2KRRA 2EC2A 2C2ZB 1GQEA 2M52A 4H4OB 4RPFA 2ZHBA 1S72S 2VODA 2HHSA 4RW6B 4NEYA 3PNIA 5HN0A 2HKEA 4X65J 4HACA 1FF2A 1RAIB 3IBFB 5DQHA 3A8IA 3BR8A 3O8WA 3PG9A 3QAUA 5D78A 2RNEA 4AE5A 3CULA 1KONA 2V9KA 2XYPB 1HBMA 3LP2A 5E3AA 2JYYA 1BY9A 3IC1A 5KFNA 3KMQA 3FCVA 4RNFA 1RP5A 4DV1F 4LF6J 2MZJA 3TX0A 2RU3A 2J0XA 3ILLA 3BBFA 2CA9A 3FFIB 3OSPA 3DRXA 4ED0A 5CXTA 4M28A 3TNVA 2P6AC 3PW4A 2JSXA 1J5OB 3OH0A 2HFOA 3H7HB 4NWBA 3W5XA 4PG8A 1RCXB 1VQMS 1YZ6A 2DGUA 1NKCA 3BJYA 3NOGA 4HHJA 2CZ9A 1OMTA 2LLZA 4RW8A 2WHOA 3AJ2A 3D9BA 3OR2B 4ZPTR 2XMAA 4ZLLA 3M2VA 4K4VA 1CJTA 1FFGB 3C19A 1SVDA 3HZEA 3SCIE 2R2TA 2F1FA 2XMWA 1PTRA 4ECRA 2NZ4A 2V69A 3E59A 3AFGA 3D7SB 2MYFA 5LM7E 1YRTA 2IPOB 3OHBA 4M5NA 4WK3A 4A8KA 2VASA 2ZOGA 3MF5A 5J2QB 2F8MA 3ZXWA 3I3AA 1HQEB 4PXDA 4YB7A 2BQRA 1SJFA 3NS7B 3W61A 2HS3A 4NMLA 3GU0A 1SGNI 1HBUA 3OL0A 1QD1A 4Y28C 4HVZA 2GJFA 3B8HA 3H2UB 5K9FA 4QWDA 1MG7A 2DH9A 3NS5A 5KFDA 2AGOA 1JX4A 2XLKA 4IOAQ 5KFEA 2AYBA 2C2EA 1Q5VA 2OSRA 4CQ1A 2IVMA 1TKDA 3MPYA 5AFUU 1Y10A 2PFDA 4HI2A 1WF2A 2DKOB 2N7CA 4I7FA 4IOBA 1TUVA 4CP5A 3VTIA 2Y1JA 2CQ1A 1SI9A 2PMZD 2GIFA 4QWCA 1QRFA 1IKVA 4J90A 4OZNA 1RTJB 3MM6B 4WIQA 5DG9A 3E01A 3CCLS 1AW0A 1N5SA 3N79A 1HM0A 4NLQA 2BJ7A 3I3XA 5KFOA 4M5IA 1NJWA 5LOQA 3FCWA 1JXEA 2WOMA 3SSRA 3Q1XA 5F8MA 5IC4B 1KOHA 1P8GA 3OT9A 4C48A 2X1AA 1HW8A 3N0VA 4XDCA 3W62A 5IWAF 2N4CA 4DR4F 2QL5B 4ZP7A 4ZS6A 2JHEA 3I6PA 3AOCA 2VC0A 1UTAA 2FJEB 2MKIA 4I67A 2WLFA 3T6BA 3PIPQ 3BN7A 1CGJI 3TAMA 2Z30B 3Q8VA 3EVWA 1J2ZA 2BW2A 1NJIT 3MUTP 1IR2A 1IBLJ 2M2BA 4P74A 4CT8A 1S6PA 1YJTA 3OLAA 2IYGA 1NH8A 1S49A 1KGQA 2ALYB 4W92B 1FEHA 3CJKA 3DXBA 4KPZA 1GT8A 4P71A 2RILA 5KFUA 2HHQA 4JI1F 1WHXA 2E9TA 2P9CA 4Q2MA 3I31A 1S1WB 3BV8A 3IA0A 3FC3A 1BD6A 5JVGQ 1XK8A 3UDLA 1XERA 2DGWA 2X7IA 3QFWA 4HHUA 4C0HA 1X5PA 1PJ6A 3VBIA 4OHWA 2UU9J 4HT7A 1G97A 3MR7A 4RNHA 3TJAA 3KK2B 2G2YA 1HR0F 4B3SJ 2H3EB 3VAGA 2CWHA 3BKUA 4O3NA 4CO1A 4U8YA 4X4OA 4I2PB 2XMKA 3G87A 1UEUA 3D66A 2N3LA 4XAKA 3HVTA 3H20A 2CJSC 2H5IB 4LFCF 3B4DA 5KFMA 3LAMA 1LXJA 3V4MA 2ENNA 2ZJRQ 3CIZA 4N77A 4JI6F 4ECQA 4DR5J 4DQQA 1S20A 3VBPA 4RBTA 3W5ZA 1U1PA 1KNZA 3AA8A 2UXCJ 1S0OA 4DFJA 1XTZA 2DB1A 4QR1A 3CCWA 3MZIA 3GZ7A 2HMIA 3H5XA 2HURA 2BOPA 2BE2A 3OFHA 4KKOB 1VQKS 4KRWA 2XULA 2HBQB 1XA6A 3MPUB 1C0TB 2CJAA 3EZUA 2AW0A 2IYIA 3LH2S 5IM0B 2ZBPA 2KFYA 2YNFB 1U8WA 3JTNA 2QFIA 3MEEB 3FQKA 2FYXA 4IHHA 4M63A 4RW7B 3K59A 4JI4F 4B3OB 1HNVB 1BC6A 2W25A 1MWZA 1RLDA 3W9HA 1UW4A 2AQ4A 1JLQB 2ZBIA 2HW3A 3OTMA 1RAGB 3GPAA 2QA4S 1X4FA 1EAYC 1GTEA 2RQKA 2DHSA 2WCXA 1YLXA 4E6UA 3D0GE 5D4NA 4E98A 2HZCA 4F25A 2R8JA 4OZ3A 2CJYB 1TUSA 2OGUA 2B3TB 4USIA 2V2QA 3HKWA 2WLCA 1KOOA 1M8CA 2ZM6J 1KHVA 5IS2A 1SL0A 4R7PA 4AMLA 3TVYA 2YPZA 3OGZA 3RU0A 3ZTRA 2OH2A 1PYOB 4WE1A 3KLEA 2DH7A 3HULA 5JMNA 4RZRA 1N33F 2RT3A 3V6DA 1QY7A 2OKQA 3ET6A 2LVWA 2ZC4A 3AQPA 2M0GB 4OZLA 4WPAA 2C2MB 4WXWA 4ZP9A 5EWEA 2ASLA 4ZHRA 4TU9A 1HI0P 2X3GA 4CIOA 2DGTA 1F2GA 5F9NA 2HNDB 4W4MA 2CUYA 5K5MA 4N69A 2DITA 2LQ5A 2B4VA 4M5KA 4IRCA 3C3LA 2PD1A 2PE8A 3KXDA 3MDFA 1JLCB 3DHOA 1XBTA 1RTDB 2NU4I 2RVJA 3MMCA 2JFDA 3DRPA 2J7UA 4Q8FA 3K0JA 3MEGA 5FDLB 3F0NA 3R7BB 4ZPVR 2QE5A 2POKA 2XHCA 3MOZA 2JRSA 3I5CA 3MCNA 3ZZTA 3MEKA 3HVRA 1KKHA 4BDPA 2VG7B 4K4SA 2FVRA 4DR6J 3I0SB 2QA2A 2GGQA 1D09B 4P73A 2GGPB 1RWXB 5L39A 2LU2A 3D3CJ 5B0AA 4DWIA 3IWNC 2GHWA 5A2QU 2VHGA 2ADCA 2L08A 4Q8EA 2RDDA 2PGCA 2UUAF 5DDQC 3UD4P 2WSCC 3R7SB 1FNXH 2UXBJ 2Q6CA 5HLFB 1MROA 1QVFR 4C0OC 2ZH2A 2FJXA 4LR9A 4S0MA 1UHAA 3LA0A 3TR5A 1I51B 1HD1A 4NLUA 2J9RA 4OMFG 1G2EA 2VL1A 1RU2A 4HDGA 2OJ3A 4JCVE 3HF5A 4GKJF 1CBKA 1JJCB 2VBXA 2XI2A 2GO9A 2CPYA 3V81B 3R5BA 2M5XA 2GQQA 2R42A 1KLMA 1HWJA 3MEDA 1LWEA 3OU9A 4M5DA 4ZLJA 4OLPA 5GAHI 2DXEA 3GG1A 4AQYF 2IC7A 2DYAA 4TYBA 4ECXA 1N5YA 2V53A 2G0JA 3QIPB 5J8FA 4ATNA 5B0DA 8ATCB 2AGQA 4K0KJ 1C1CB 1H7WA 1RAHB 3VR1A 2R8HA 3PO5A 2EFPA 2WVEA 2X3TA 4RLEA 3MPDA 4NCAA 3FZBA 1QE1B 2XZWA 1FTCA 3KLVA 3P3DA 4ZPWR 4TQSA 2V0KA 1FKAF 3CDWA 2VF3A 2FHKA 3M8ZA 5D0RA 4JV5J 3GJTB 1QSLA 4KAIA 1KDNA 3RRGA 1RBOB 4GKKF 1TL5A 4A8SA 2VPXB 1RHUB 2D3ZA 1RI7A 3R3TA 5HAOA 2H65B 1DAXA 3HJJA 3SBMA 3W2VA 1XBWA 4WP9A 3HVWA 3P4UB 4ID8A 2OEJA 1RAFB 2UXCF 5L9XA 3FC9A 3JSMA 4FS2A 3PX0A 1RYSA 1XNQJ 1R8BA 3HHLC 5KT4A 2ZITA 2UUCJ 4B3MF 2HHUA 3ET6B 2I1RA 1NDCA 2XGPA 3CJKB 1PBUA 4X84A 4X2BA 2UUBJ 1UVNA 4PAAA 3UWTA 3A12A 1V3SA 2KMOA 3JSYA 3DRPB 3OH3A 1PJ7A 3TAPA 4NLGA 1IUJA 1GAOA 1DQ8A 2W2QP 1K44A 4G1PA 4YHHJ 3GIJA 1HFEL 3G6ES 3K57A 1S5ZA 3IWLA 4DSIA 2J8AA 4HR2A 2Y0BB 1TURA 2OVOA 2VZ9A 4PEOA 4ZKAA 1AYEA 3FUYA 4HH1A 3TUIC 1DLOB 4LREA 3BM7A 4O3PA 4KR0B 1NMEB 2WCYA 4IFYB 4PYDA 4RW6A 4J9LA 2WOMB 1KS2A 2N7YA 4DUYJ 1URNA 1TK8A 2OPSA 3V6DB 4NLWA 1UUCA 4LF7J 4R25A 4TVAB 1DFDA 2TDTA 3LPEA 2DK2A 1NSQA 3JYTA 3H40A 3TISA 1WSVA 4HL9A 4C8YA 2K7KA 2O5DA 3LWLA 1UWBB 2E29A 4YS2A 2WVFA 4WFNQ 4G3IA 2ROPA 2UXDJ 1WKXA 4ZA1A 3MMBB 2QX0A 3KLHA 1CC8A 2RJZA 2ZNZA 4NA2A 2FZGB 5IWAJ 2J6TA 4KJIA 4G87A 4XPCA 2HSEB 3VCDA 1VRQC 1T3OA 3HD2A 1CS4B 4SGBI 1WSRA 2OP5A 1U0HA 3R2CJ 4NA3A 3ENQA 3SDEA 3EX7B 2DNMA 5DDOC 4Q45A 1VQLS 3N4WA 4DX6A 5LXRA 3RAMA 1VQSA 4N6AA 4H4MB 2UUBF 1IBMF 3DK5A 3TA0A 1Z7KB 2W7AA 3T5HA 2IM3A 4IFYA 3UI3A 2W2PP 2QGFB 3IWXA 3X3UA 4DXLA 3IG1B 4DCJB 2HIYA 2YKNB 4ECZA 1E6YB 2DXDA 5L8RC 5AFUV 2B0GA 1X7VA 4IO9Q 3ZZPA 3M8PA 2HS0A 2B9YA 5KT5A 1S59A 3WZ0A 4C6AA 3THVA 3F1XA 2H51B 3MTKA 4IH7A 4IOCQ 1YX2A 3KHRA 1HA1A 1MN7A 5E3RA 5HMWA 2IM1A 3GIIA 3CCUS 3V4IA 3L95X 2RE1A 5A6PA 3ZZYA 2LXUA 2BBEA 3DRRA 3NBPB 1XR6A 4M5HA 4R8UB 1CSJA 3IR6B 3FS8A 3K2YA 2JLGA 2N3OA 3Q0AA 4DUZJ 1RT7A 1U26A 2Z4PA 2PMHA 3THTA 2HRUA 5CYMB 3I56S 1FKOA 1GH8A 2GJIA 5HQLA 5KFGA 3J80Y 4JP8A 2BM1A 5EN1A 4DEZA 4C3MA 2ZHAA 2C2KB 2K2PA 4ZLNA 4R36A 2Q43A 4L3KA 1W2BR 2BDPA 3KK1A 2QSFA 4A8MP 3DOLA 4C2MA 1Q86T 2A0FB 2FUG9 2MKKA 3MD1A 1HNXF 1LV5A 3F56A 1IBKJ 4FBUA 3QGHA 3KFWX 1U4BA 2KVIA 1L3UA 2FC8A 4IR9A 4F02A 4CH0S 4HYKA 4AXJA 1T05A 3I9V9 5CH7B 3A1YG 3SQOP 4J9OA 2N17A 1S1VA 3SZ2A 2F9JA 3DMJA 3PHTA 3A8EA 3S7RA 1WHVA 3D6TB 3TDTA 9ATCB 3MM9A 1CPZA 3BGRB 3MC4A 2KCXA 3AJ1A 1QAIA 3MXHP 4MIWA 3LPYA 3KLHB 1VQ8S 1KK4A 1CT2I 1VISA 2DEIA 2OTLS 1YDLA 1M0SA 2RUGA 3BSAA 1KQFB 3UGDA 1X4GA 5DAEA 2X3DA 3M05A 1KTQA 4CLUA 2Y0SD 1R3NA 2F65A 2M4MA 4PG4A 4RUCA 5I3UB 1V6HA 4UOCA 1N13A 1EP4B 2CKWA 2FJAB 4KBIA 3SFUA 2XG8A 2FQQB 5T7LA 3TZWA 1SKWA 2LXFA 3E51A 5I3PA 3JAMY 1HPZA 1OO0B 2XCAA 2EK1A 2VQFF 2BW7A 4ELTA 3TZZA 5FJ4A 2MB0B 2FB0A 5C42A 1DLOA 4B9LA 2C1EB 3HXMA 4C4WA 3H5SA 2XS5A 2ASDA 2RKIB 2KKHA 3I4PA 3L3CA 1MR7A 1N5VA 3PXGa 4H4MA 2OAUA 3MECA 5A8KA 2MXYA 1U1KA 4TLRA 5BYQA 2V67A 2VG7A 4OI0A 1IBKF 4DR2J 2EVZA 3DLGB 2EBEA 2KN4A 2HLUA 4CO4A 1G1XA 1XMOJ 2QG9B 1RHKB 2OEMA 3G6YA 1M5OC 2J76E 3SPTA 2HVEA 3V2UC 3CMAS 1B4SA 1WGTA 3H42A 4KQZA 5HROA 1JQGA 1TMMA 1U24A 2DO0A 3KUHA 3W8PA 1SUQB 4M94A 1BWEA 3SYZA 3FSXA 1QDUB 3FBCA 2R8IA 3MM8B 4DR6F 2HFNA 1PPFI 3DOKA 2BV3A 3QRQA 1X9WA 1KRRA 4DUZF 3GCXP 2J9DA 1WF1A 4EEYA 3SI8A 2JA1A 3DM2A 2OEKA 2YKAA 3NGRA 1IKWB 1KN6A 5JUMA 2ATCB 2CG8A 2GZOA 3GE9A 3UFCX 3AD8C 4NI2A 4MKVA 3DOLB 2GKRI 2W01A 4FN5A 1TL4A 4ZJQA 5C7PA 2Y8WA 3PJ9A 1D3WA 2BYCA 2KYZA 2B4UA 2GQ2A 1QRLA 4KB7A 3CCVS 3QT7A 4Y00A 5DEMA 5SZTA 3NL0A 1EQMA 3TOQA 2R2UA 1HKAA 5KFWA 2FJVA 4OJHA 1AA1B 3PW0A 3W66A
chains in the Genus database with same CATH topology
4OZ0A 2EFVA 2QA4G 3Q2SC 5F3ZA 3CCSS 2UVWA 2A2CA 5A8WB 2ZFHA 1P6TA 1HV9A 1R31A 1VRUA 4DR5F 5CZVA 2FLNA 4PCQA 1N0UA 3V6JA 1Q4RA 1ZOTA 2ASLA 1MNEA 3DLEA 4IDKA 3D98A 4PPZA 2V4QA 4DQIA 2GIRA 4WZQA 1TKZA 1WI8A 4CZCA 1U09A 4B3SF 5DQGA 5DM6Q 1Y0HA 2RSQA 3LF0A 1HI8A 5KFQA 2MHEA 1SH0A 1VQ5S 5G0RA 2PA8D 5E0OA 2FVPA 4RU2A 3P49B 1BLUA 1SJ4P 3HMJG 1N54B 2B7BB 2XMTA 1SJ3P 3Q8QB 1OQ6A 2AP6A 2ZH5A 2JEGA 1LKZA 3RB4A 1RJJA 1BGXT 4MFGA 3OL6A 3CCMS 3OTDA 1RA7A 1WHYA 4YUDA 3U7JA 5L9NA 4O4RA 3M8QB 3M6XA 2RDJA 1IKXA 4UUWA 1TKTB 3MR3A 1N4LA 4ZPCA 2AQ9A 4XIUA 2C42A 4LF5F 2P9EA 4X4PA 1YIJS 4RX6A 2XY6A 4KFBA 3FVYA 4USJC 1NK6A 1YP2A 5F41A 1K0TA 2OI7A 3CC7S 1FRHA 1X5SA 3FZ2A 2U2FA 4MH8A 3M8SA 3DOKB 4FF1A 3DXSX 2C2DA 5T41A 2MDAA 1C1BA 2XS7A 4B9UA 3GG0A 2OFHX 3LGNA 2AJ4A 3CXCR 2OLWA 2NUUG 4JI8F 4I4BA 1KHRA 4XO0A 1HNWF 2BANA 1LK7A 2HGNA 1QAYA 1W25A 4EYHB 4NL5A 4FBTA 2ZNYA 3RAQA 2UV8A 4FNHA 1H2UX 3N5FA 2XATA 2NSCA 3CJ5A 2YKMB 3RR8A 4DHVA 4LQ9A 1LW2B 2HNZA 3GILA 1SSTA 3WBZA 2IVYA 1S48A 4FNIA 5KT7A 1C4CA 3FRYA 1YI2S 2MMYA 4JV1A 4ECVA 7FDRA 2I5JA 2NPFA 2Z0GA 3ICLA 2RQCA 4H4KA 4KE5A 3ZZRA 4N76A 2VC1A 1Q7YT 1N48A 1Z90A 1VK8A 3CT9A 2ADBA 3O1LA 3CCRS 2UVVA 2OSQA 4FZVA 4DQSA 3PHEA 2YWHA 2VPWB 5K8MA 3QZ7A 4A8FA 1SSQA 1TK0A 2DNZA 1FD8A 4BC7A 2R7RA 1S6QB 2ZHOA 3M2UA 1FJEB 2MZTA 5HL7Q 2K7JA 2MPUA 3OTOF 4TY9A 5DQIA 2QSWA 1VLYA 2ACYA 4P6QA 1N34F 5IXUA 3C2PA 3NAHA 1JLFA 2MJUA 3SSSA 3VBKA 2MZSA 4C8NA 4DBQA 4WFBQ 3T1AA 4MZUA 4AAWA 3M30A 3VF0B 4AXIA 5EWFA 3T5KA 2R2SA 2HW3A 3T9NA 3TRGA 3KJVA 3MAHA 1S99A 1TL1B 2V0HA 1T03A 2CQHA 4OX9F 2ZH4A 4DV3F 2W4DA 1HQUA 5CYJA 2EPIA 2HMIB 1RT5A 3I0RB 5BR8F 1MRLA 3KG4A 2DPJA 4J9MA 3MQHA 2DTJA 4DPOA 1VRTA 2IRXA 4J09A 1X4AA 3C6TB 3TP2A 3TVZA 1JLEB 3RR7A 2VOPA 1LWFA 3WX4A 3K5LA 4R5PA 1NU4A 1NHUA 5J2MA 1Y3JA 3QLHB 1IN0A 1NK0A 4LF6F 1FCAA 4K2XA 3UQSA 2X1FA 4ZDNA 3M2VB 4O0IA 2RF2B 2ASJA 1NK4A 4QPTA 1Y5LB 1Q1KA 1H98A 2GGOA 4IH5A 4NZ0A 4UUXA 4ZCLA 5KG1A 3J7ZT 3GQCA 1G95A 4F4XA 2GJ2A 2ZOFA 2OEGA 2GX8A 2J9CA 2XHWA 1WNEA 1A9NB 4KGKA 4FP9A 5HLFA 1V3WA 2WSEC 2YH0A 2F4VF 4KSEB 1Q78A 2RS8A 4JOUA 5F3TA 1HHSA 2K3IA 4Q2LA 3DLEB 4EA7A 2WK4A 3T6JA 4URGA 5J1EA 5A0YB 2YNIB 1FO1A 4N41A 5IT0A 4DF4A 4RWXA 1LWFB 4G1IA 4LVNP 3MI7X 4IFVA 3LP0A 2KT5A 3CIMA 5HP1A 2V94A 3OBIA 3LQVA 5J2PB 4Q0BB 3SEOA 3TIOA 5KFAA 3NNHA 2R7XA 3PX4A 3N6MA 4NZ7A 4KV8B 4ZPAA 5E3CA 1QAJA 3CMES 4MKAA 1RTHA 2DNYA 3MFIA 1S77D 4DG1B 4MIAA 2P5VA 1Q16B 1VC0A 1HYSA 2OPRB 5LSRA 2KXNB 4ED8A 1HMVA 1U49A 4Y2MA 1T03B 2QT7A 4A4JA 4EABA 2AX0A 3I0SA 3M30B 3N01A 1DARA 3QGPA 4W90B 1NEEA 2D3UA 1YSJA 2MQMA 4O3OA 2MQQA 3CO9A 2VBZA 4OL8A 2V4JB 3X1LB 4R8UA 4X64F 4CO3A 5J2QA 4ILLA 4DFMA 5F8LA 3J7YI 3LANA 3HO1A 4EFAC 1XMBA 4IUFA 1GX6A 1M5HA 2OPQA 4M9CA 1YVFA 3BS9A 3LP2B 4HLBA 2ZH7A 3T1HF 3MM5A 3CPWR 2HNYA 2OPPB 2IJNA 3IFEA 3OSNA 2YY3A 3HHLD 3M6WA 4RW8B 2AJ1A 4OI1A 3E01B 2DNLA 1UL3A 4EUVA 3OVSA 1ZPVA 4DLEA 2DHXA 4I6WA 2IU8A 2V5HG 4N8OA 4ZPDA 2GMJA 1S6UA 3HHLA 4ELVA 2WW8A 2VPZB 2QO3A 4B3RF 4K5RA 4PXBA 1AFIA 3HLUA 2XI3A 2Z8QA 4DR2F 5KG6A 1H6KX 3OXGA 4I6YA 2XNRA 3KWCA 1YQHA 3QGIA 3EPGA 3M9NB 1HBUB 3V6HA 5A0YA 3ENWA 3DRRB 3WC0A 1HHTP 1KFSA 2U1AA 3FMBA 1OPZA 3OTZA 4NCGB 1SJQA 2L48A 3FGVA 4J9KA 2AD9A 4C7QA 2ZDPA 3DCAA 5GAGI 3TYTA 3OVAA 4AUKA 5JXSA 2CZ4A 1KQSR 3C66A 1V3RA 4EAAA 1B0VA 1WEXA 1S1WA 1G3OA 1VS3A 4P2SA 3FEZA 1FRJA 2FTRA 4DSEA 2CQCA 3JTOA 4OHXA 2MGZA 1APSA 3S6EA 1AXQA 2CQGA 3K5PA 5H1SV 4WCEQ 1KFDA 1S1UB 3OPKA 3LWMA 4EBDA 1WG1A 3ISND 3HHNB 2IC3A 3NG8A 3SSQA 2BABA 2FPHX 3THPA 5DG3A 2VV5A 4F3OA 5BYRA 4M99A 4ILRA 5GAEU 1HW9A 2KB2A 3DDNA 2CJ9A 2BZ2A 1U47A 1YJNS 4DSJA 4ED3A 5C25B 3MMBA 1PC5A 3NRBA 4Z2XA 3I0RA 3HT3A 4E75A 2DNKA 2WSFC 3ECTA 5HMXA 3ETOA 2HGMA 3IO1A 4V19J 2CIMA 3IR5B 4Z37A 4BWMA 3CVKA 1HWUA 2I38A 2M7SA 1S0NA 2HHVA 3PJXA 3OXLA 4WXOA 2IM0A 3OTBA 2ZZMA 1KK5A 2EFGA 2HNYB 4MKBA 3SDEB 2CPDA 1AUDA 1K8AT 1JLFB 3IG1A 2G13A 1SXLA 1QJHA 3DOMA 2EFNA 5KG5A 2HRYA 1DRZA 2ZJQQ 4ELUA 2L9NA 3DLLQ 5A8WA 3BGUA 4IHFA 3VBLA 3MMAA