The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
89
|
sequence length |
286
|
structure length |
278
|
Chain Sequence |
b'TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTKV'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb |
molecule keywords |
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
|
source organism |
Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
|
molecule tags |
Transferase
|
total genus |
89
|
structure length |
278
|
sequence length |
286
|
ec nomenclature |
ec
2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. |
pdb deposition date | 2015-10-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF14602 | Hexapep_2 | Hexapeptide repeat of succinyl-transferase |
A | PF14789 | THDPS_M | Tetrahydrodipicolinate N-succinyltransferase middle |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | 3 Solenoid | UDP N-Acetylglucosamine Acyltransferase; domain 1 | Hexapeptide repeat proteins | ||
Alpha Beta | 2-Layer Sandwich | Wheat Germ Agglutinin (Isolectin 2); domain 1 | Trimeric LpxA-like enzymes | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |