5E3RA

Crystal strcuture of dapd in complex with 2-aminopimelate from corynebacterium glutamicum
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
277
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 86
structure length 277
sequence length 285
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3rA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3rA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3rA01
2WLEA 4N6BA 4IHGA 3OW5A 5F42A 4KPXA 1XATA 3CJ8A 1QRFA 5L6SA 1TDTA 3FWWA 1LXAA 4KPZA 4N6AA 3OUPA 1QRGA 1KRUA 1S80A 2TDTA 3TIOA 1QRLA 3MC4A 5DEPA 3VBPA 2IC7A 3NZ2A 1V3WA 3OTMA 4MZUA 2WLDA 5U2KA 4EA8A 2QIAA 3I3AA 1THJA 3TV0A 4AAWA 4E6UA 3FOQA 1XHDA 3BRKX 1KK6A 2ICYA 3BSWA 5DG3A 3VBIA 2WLCA 4HZDA 5DEMA 2W0VA 4FCEA 1MRLA 3IXCA 3FSBA 3ST8A 4J18A 1MR7A 1Z90A 2OI6A 2VD4A 3R3RA 4J09A 2ICXA 3V4EA 5AFUU 1HM9A 4R36A 2I5KA 4KNXA 4HCQA 5ADXU 4H7OA 4M28A 3GOSA 3TWDA 3EEVA 3D8VA 1YP4A 2AQ9A 2RIJA 4EABA 3IGJA 4G3PA 5AFUV 3Q1XA 4AC3A 2V0HA 3FS8A 3R2WA 1KQAA 3C8VA 5ADXV 2JF3A 4M98A 1SSQA 3R5CA 4M99A 3VBLA 3VBKA 2GGOA 1J2ZA 3BXYA 2V0IA 1HM0A 4EA7A 4M2BA 2VHEA 3R5BA 1KRVA 3VBNA 1G95A 1QQ0A 2P2OA 3OU9A 4HURA 2IU8A 3GVDA 3OTZA 3R8YA 4EAAA 3VBJA 4E6TA 1OCXA 2OEFA 3MQHA 2V0KA 3BFPA 2Q4JA 4KNRA 3SRTA 4EGGA 1KGTA 3FSYA 1QRMA 4G87A 2JF2A 1QREA 2IUAA 3HSQA 3R3IA 3VBMA 5E3QA 2QKXA 1SSMA 2QIVX 3VNPA 4EQYA 4G3SA 4HUSA 1KK4A 1HV9A 3BSSA 4N27A 1HM8A 1KK5A 2IU9A 3P47A 4R7PA 4KQLA 5E3PA 1FWYA 3F1XA 2WLFA 4AA7A 4DCLA 4R37A 3TDTA 3P1BA 3KWDA 1KHRA 3SPTA 4MFGA 3EG4A 3I3XA 4HZCA 3R5AA 2XATA 3R1WA 3EH0A 4ISXA 2OEGA 1SSTA 2V0LA 2WLGA 3D98A 3FSCA 1KGQA 3PMOA 4K6RA 1V67A 5L6VA 3MQGA 3T57A 4G3QA 3JQYA 2OI5A 1MR9A 4IHFA 2W0WA 4E1KA 1KRRA 5E3RA 3ECTA 2V0JA 1YP3A 4E79A 2NPOA 3HJJA 3R5DA 4M2AA 4IHHA 1T3DA 2GGQA 3BSYA 3FSXA 3TISA 3FTTA 4MYOA 3TK8A 3DJ4A 4M9CA 1YP2A 3DK5A 2OI7A 3KWEA 4EA9A 1G97A 4E75A 3GUEA 3KWCA 3R0SA 4N69A 2FKOA 1FXJA 3DHOA
chains in the Genus database with same CATH superfamily
5F3ZA 3AA8A 1PO6A 1CLFA 3PO4A 3PHEA 4F4ZA 2XS5A 1L3VA 4LIWA 3AODA 3IMQJ 4P74A 3BN4A 3I96A 3M8RA 2DO4A 1KQFB 2ZOGA 3BDPA 2LVWA 4EWTA 4AL7A 2VG5A 2X7IA 4FYYB 1UFKA 1YZ7A 2UXDJ 1N4IA 1JMTA 3FGVA 2OPRA 3DLJA 2GVZB 1RT2A 2XLIA 1FERA 4O0NA 1J5OA 2GHPA 2AJQA 5AE3A 4ZN3A 3SRTA 3A8IA 4EEYA 1IKYB 4QZVB 3W8GA 4F25A 1Q95G 3HSQA 3QRPA 3BJIA 1U0HB 1Y5LB 2W0TA 3M9MB 4ZLLA 4C8MA 1QLNA 1KTQA 4MKBA 1N5YB 5GAEI 3G82B 2OI2A 4D3GA 2LA6A 1KLMA 3N28A 3T1AA 4WZQA 3BSAA 3O6QA 1VIXA 3V81B 1MJBA 2IVMA 1WF1A 1YZ6A 3CJ2A 2DVIA 1ZPVA 5ETSA 3T5HA 2C22A 2MB0B 2W7AA 3CGIA 4AXIA 4H4KA 2MQPA 3CWJA 1TOTA 4C8LA 3UCUP 3FUYA 5L6SA 2KT5A 3QIPB 2HBRB 3E2EA 3OFHA 2MKIA 4OZ3A 3EPIA 1MNEA 1RT7B 3V4IA 1EQMA 2IA6A 3MAHA 2HNYB 2LQBA 3J81j 1NSQA 4OJ3A 2DEIA 2YXLA 2CRLA 3TAMB 3DHXA 1N34J 1PJUA 2GC8A 4Y6IA 1HBNA 2V1CC 1HI1A 4Z7YA 3MPWA 4RNMA 4NLGA 2MKJA 5JMNA 2DRDA 1RTZA 1FTCA 3AJ1A 5KFMA 1SSMA 3FC9A 4RW6A 2PMWA 3AAWB 2EPIA 2GFFA 3GZ7A 2OEJA 4NLXA 2OZUA 4OHXA 3TDTA 1JLQB 3RRHA 4ED2A 1YQHA 1R43A 2AU0A 1P9YA 4USVA 2PC6A 1TKXB 4ZP8A 2KH9A 1DURA 3C8YA 3JSRA 1SJ3P 4O4GA 1HMVA 4CH0S 3WHIA 1F3FA 1LQ9A 5GADU 1AYEA 4DMZA 4G1PA 4I7FB 2FD2A 4YOEA 1MROA 2FJVA 1R6VA 2NYIA 1R8PA 4KRWA 2E5JA 4ITSA 2OTLS 2QFIA 3R1LA 4JI6F 2ZKTA 2RQ4A 1YRXA 5DQIA 4XTTA 1OS5A 2RRNA 3D6HB 1REVB 2BR0A 4LUBA 3QMQA 3QAHA 3HHLA 3KDOA 2A18A 3GILA 2V68A 4B17A 3GE9A 1TAQA 3V6DB 1GXLA 3AOCA 1O0PA 2VH7A 4WFBQ 4EO8A 4ANEA 1SBRA 3IAM9 2F3CI 2V0NA 4GVBA 1C4CA 2E5RA 3RRGA 4EZ9A 4HL9A 2LXIA 5K14A 2V8PA 4B3RF 4QYZK 3CTRA 1XMOF 1X74A 3GWCA 3KWMA 3MR7A 5EN1A 3VALA 1M8BA 4MJKA 3N9UC 4J90A 3TZXA 3R6GB 8AT1B 4XIUA 4ZVTB 3C6TB 3ZTSA 1LR9A 2NSBA 4USJC 4O3OA 3RB6A 1VYAA 3M8QA 2EVZA 4E75A 5GADI 3MM8A 1V3ZA 2DGTA 1BWEA 1NH7A 2XS2A 2FZCB 1U09A 1B0TA 2GO8A 1OSDA 4Y28C 5HVFA 3UCZP 5KFNA 2AEJA 3S8SA 2H5EA 3NZ2A 5B08A 1F2GA 2HHUA 3NL0A 2Y3YA 2LQ5A 2O5DA 4F7VA 5DLFA 4CWBA 3ST8A 4C0HA 5DGAA 1T03A 3MM6B 4MH8A 4N8NA 3J7AN 2IAJA 1Q5VA 1ZAVA 4Y2AA 3KLFA 4X4NA 4CO5A 1FDAA 1RT6A 1KRPA 2CJQA 2DB1A 3UD5A 2N7CA 2RS8A 2V0KA 2CQ2A 1FXDA 2GJFA 4QIFA 3HULA 4UOHA 3PFOA 3EZ5A 1EAYC 5LSOA 1NM2A 4RW7B 5CHCB 4KIAA 4E1PA 2YNHB 1QAIA 2YX7A 4ZVUB 3H4DA 1RT3B 2IPOB 1H2UX 2WLGA 5KT5A 3W65A 1T9WA 4JI6J 4U96A 1U7LA 4ZJOA 2SGDI 3QSIA 3QWUA 3QFWA 4JI8J 3GFHA 1HWKA 2FHJA 3SQGB 4EA9A 2Q3PA 2OD4A 4KH1B 3GR1A 3H8YA 4KPCA 4LR7A 3FFIB 2HZCA 4CM2A 3GOXA 3TNVA 1VCTA 2EI5A 1RHUB 2W9BA 5B0CA 1CGJI 3I3AA 5A76A 3SQOP 3PG9A 2G2OA 3KJVA 5LJ5Y 3D4JA 4M94A 4B3RJ 4DX8H 3D7SB 1XMOJ 2YWKA 5ADXV 3R5CA 5BJRA 1D9FA 2E66A 2GA7A 1RTJA 2DIUA 2H4YB 3W5XA 4A8MP 2ADBA 2FJWA 2IU9A 1FKPA 4NA2A 2BJ1A 2PMHA 1VHIA 1WHYA 3GIJA 3BPDA 2FB0A 5AXKA 5B0DA 3CXCR 2W8LA 2XMKA 2J6SA 1JLGA 2I1RA 4ETXA 3NCPA 4I2QB 3MEEB 1JWWA 1IBKJ 4B9MA 2V2KA 1EKSA 1V3RA 2AHOB 2YKPA 4K5RA 3VAFA 3IRXB 2PN6A 3CF5Q 4QR1A 1S6UA 2BJEA 2ZH3A 4MKVA 2M8HA 1LWEA 5J2PA 5KFHA 4LBPA 2IC7A 3TZYA 5J2QA 2DR7A 5DDQC 1OPIA 1EETB 3AXMA 1NPPA 2F4FA 2MEWA 2OPPB 1KONA 2IRXA 4XK8C 1UPPA 3ENAA 1UWAA 1S57A 1SQEA 5B7WA 1TVRB 3PYFA 1KQKA 4C48A 1T9VA 2FHMA 1NDKA 4K7QA 2MDAA 2RUGA 5E0OA 2KL8A 3RAXA 3A1YG 2VZ9A 1K9MT 3VF0B 1U2CA 4Y0FA 5HROB 2QL7B 4KC5A 1IKVB 3CCJS 3HHLD 2UXCF 2YNGA 3TUPA 4MYOA 4MKYA 4M5NA 1KBEA 2L9WA 2IM3A 1KRUA 3SDEA 2KDOA 3PO5A 3UVJB 2OU2A 1KLNA 2XM3A 4DU8A 3D00A 1H73A 1Z1ZA 3D0HE 3KLGB 1NDCA 3R7SB 3HD1A 4NYZA 2EK6A 4JI2F 3FRYA 3TUJC 2AW0A 2MZTA 2KRBA 1YI2S 3LWLA 5IT0A 1SGQI 2JF3A 1S9GA 2JW6A 1GK8A 2KHDA 3AFGA 2WHOA 3OUYA 4ZJLA 3R8YA 3OJSA 2B9YA 1WKKA 4A8WA 1ULMA 2O67A 1CC7A 3BGOP 1X4GA 3MCMA 2HURA 2COLA 2AV5A 1CQNA 3IM9A 4P75A 5D4LA 2GVDA 1F0XA 4ID5B 3CIZA 1VQ5S 3BKUA 2VONA 3C16B 2AP6A 3HJVA 2NXEA 4DR4F 1PTRA 5J1NA 1U5KA 2ZZNA 1H2TZ 3NOCA 2VUGA 3FSXA 5KG4A 5D0HA 4PWWA 2BE2B 3V6HA 3PJXA 1SI9A 3H20A 1T7PA 3FDSA 4N6BA 2CJ9A 1TL5A 1DS2I 3PV8A 1RISA 3SCJE 1Y9OA 3CCVS 1CJVA 4PYAA 3DGVA 1DHMA 4GC7A 1KK6A 4ZP6A 1VDHA 1RDRA 2YPZA 3CO9A 4U95A 1Y8FA 1RGVA 2J9RA 4DV2J 4NLWA 2QX0A 2P6TA 3D8VA 3J80Y 1UWBB 3PYEA 3KK1A 2V4QA 3KK2A 5ETOA 2YNIA 1J2ZA 3BH7B 2CKWA 5LMNF 1QJHA 2QZ8A 2FHJD 3SCKE 3G6ES 1JXLA 4L3KA 2K9HA 3KUEA 5IT9Y 2N52A 3U02A 6AT1B 4CP5A 3DOLA 3HX9A 5HMZA 3OD2A 3IBCB 3R27A 1RLCL 1N6QB 3CCWA 1ZTTA 1KSPA 1RAIB 4LF1A 4DV6F 2KJWA 3CMES 3TUIC 3NGDA 4JI2J 3MF5A 3NY0A 5AXNA 3ENWA 1CC8A 3MDFA 3HVTB 1GNKA 4ECZA 8RUCA 2WGCA 2XZWA 1NK7A 3BR9A 2JNJA 1P9ZA 2MQQA 5CYJA 2ZBQA 1D8YA 1HDLA 4MIWA 2GIVA 1MMDA 2GAGC 1UFWA 2L3MA 5EWGA 5KFWA 1UAWA 2JFKA 2DNOA 1NH8A 1ZETA 2YUUA 4WP8A 3QBCA 4DR4J 1H98A 2V8HA 4OJGA 3PEJA 2NUUG 3CT9A 3HKWA 2XMAA 2EC2A 4E6TA 4KSEB 2HFZA 4K4WA 2IBOA 3CC4S 2MGZB 5FDLA 4GRSA 2FLNA 4OYBA 1QREA 3HSDA 4DSEA 5A8RA 5U47A 3QJPA 2Z58B 2VPWB 3ITHB 5BYRA 2PMZD 3TI0A 2C3MA 2VBWA 4F0MA 4B9VA 3D9BA 2VV5A 4EGLA 1H0HB 4FP9A 4ZCMA 1S6PA 3GU0A 1YKWA 5KFPA 3MAAB 1P8GA 4TQRA 1S1WA 3CCQS 3TA0A 4LF4F 4OZ0A 1FEHA 1VQYA 4DZDA 2OSRA 2AEFA 2V63A 4USTA 4ELUA 1W25A 2KVQE 4C11A 3CJ8A 2XGPA 4TQSA 3LPYA 3CDAA 2VB6A 4WFZA 4OZ1A 1VRTA 3PEHA 2HHQA 1VBYA 1H2VZ 4NCGB 2VQEJ 2UV8A 3IGVA 2L08A 7AT1B 3SSSA 2HHPA 2RH3A 2L48A 4DR1F 3FQLA 4DV6J 3HK2A 2DHGA 1JLBA 3DLEB 4R5PA 1UVMA 2IU8A 1B99A 1VRQC 3L7PA 1Y00A 4RWXA 1SGEI 1FXRA 3R9LA 2W9AA 1TK8A 1SC3B 1HQEB 3NOGA 1NK6A 3M8YA 2XBPA 4WP9A 4IH7A 3EGNA 1P1LA 4HVZA 1U24A 3HFVA 4EYIB 3AXKA 5A2QU 5E7OB 1KGQA 4KO0A 2DR6A 2UVOA 2O66A 1RQ0A 1YRTA 1U6ZA 5KAKA 1R7IA 1N32J 2ADCA 3TAQA 1HLWA 2BJ9A 2YKMB 3PW0A 4USMA 2GGPA 2V4JA 1S1TA 6FD1A 3G8TA 2FY1A 1TIHA 4JBCA 4DQIA 2B4VA 1NK0A 2C2EA 4Z7CA 1QD1A 4IFYB 5G4DA 3DI6A 2AGOA 1XWLA 5L1JA 3PX6A 1XA6A 2CWHA 1EP4B 3L9ZA 5KFJA 5JUMA 1C1CA 4B3MJ 1S1VB 3VZIA 4N7TA 3AJDA 3W3SA 4M2BA 1P27B 1ZOTA 4Y00A 3UN2A 4BLGA 1CPZA 4HR2A 3HFKA 3ADAC 4LF4J 3IFEA 5AXMA 4K4VA 3OR2B 4HUSA 2LU1A 4I68A 4P2SA 2G2ZA 4K0KF 3NS5A 3HD2A 3TYTA 2CVIA 3LO3A 4G3QA 1XMQF 4BHQA 2O3DA 3CJKA 2DEJA 2DHAA 4Y2CA 4B9LA 2CPJA 3Q83A 4WZMA 2NLWA 4YY3J 1LW0B 3P6YC 3R0SA 5FUXA 2HQGA 2Q1LA 3GIRA 4ECRA 2DY9A 3TEHB 1M5VC 1D8ZA 4X65F 4V19X 2V9WA 4AQYF 3D3BJ 5T41A 1RTDB 3OUPA 2KM8C 3LOUA 4XAKA 4OI2A 3GV8B 1WI8A 2KFYA 2OKQA 2B6AB 2MSTA 1VBKA 5KT4A 4AD6A 3SMZA 1NHKL 1DQAA 1A9NB 4J5OA 2K7KA 4WPAA 4DQPA 3GQ8A 4WCEQ 2FLOA 3MTJA 4GI3C 2RUSA 1BD6A 3ZZUA 2VBXA 4NXMJ 4DN9A 4M5KA 2KZZA 1WOSA 2B7BB 2VPYB 4LFBJ 1URRA 3SCLE 3H2UB 3PW7A 2V94A 2A6OA 1SIZA 1NK4A 2WOMA 3DYAB 3CDWA 1RWPB 3Q8SB 1TMJA 4G6VB 2ELIA 2V6AA 1TK0A 1WC5A 3LQVA 1CULB 2XZTB 3NEKA 2R8GA 1X9WA 4O3QA 4ZS6A 2R7QA 1FDNA 1RA6A 2WVEA 4BDPA 2PQ8A 1HBMA 1ITPA 1RJJA 2WSEC 3C19A 3P45B 2XC9A 4KGMA 3QT8A 3OT9A 2F3JA 2FKOA 3KNAA 3O44A 4M5DB 2BE7D 1CS4A 1LXAA 4ECYA 3QO9A 2TDTA 1VQPS 5EX3A 3MXHP 3PW2A 3D66A 2FJXA 1HPTA 1N48A 2QO3A 1KMAA 4M63A 4OV1A 5HMWA 1T0TV 3GJTB 2VQFF 1S0MA 4FNIA 3UE2A 4DV0F 2HQDA 4EUVA 5IS2A 2WW8A 1NB2A 4DLGA 4FPRA 4QU6A 1IR2A 1XMQJ 5KFDA 3MEDA 2JH3A 3BBCA 2JHEA 3H5XA 1GMWA 1BXNA 2AJ4A 1CE3A 3MQHA 3BPSP 1S1UB 3M32B 3NBPA 1QE1B 2J9DA 4RNFA 1NSKL 1BUSA 1R8AA 1HQUA 4AQYJ 4G1QA 4TY8B 2IRUA 1HNXF 4NLSA 2VJVA 2OEGA 4DX6A 2ABYA 1UKUA 1HBUB 1GXTA 2QMXA 2D74B 1RFHA 2ZHBA 2B3TB 3SBMA 3OH2A 1N8RT 2DH8A 4QOTA 4DPUA 2B5JB 1ICEB 4CM0A 1KHVA 5CYMB 4ZKAA 1R8CA 5KFXA 1F2HA 4BC9A 1Q4RA 1LFWA 3S7RA 3GIKA 2KG0A 1SH0A 3ELHA 3KUHA 1A7GE 4LBIA 2HHSA 3G6YA 4TU7A 1U0HA 4M5JA 5JHWC 5CD4H 2W25A 2YX1A 2N7YA 3OHBA 1N5YA 1AZSB 3G82A 1HM0A 3KJQB 4LQ3A 3E01B 5AT1B 2FLPA 2VOOA 2E5IA 1B0VA 3AT1B 1R8BA 3TVYA 1IJFB 1QAJA 3V81A 4ECTA 4Z2XA 3BQ1A 2XI2A 4JV1A 2WZ1A 4EFAC 1JNZB 1TFYA 3NWRA 2JFDA 5KFTA 2FZKB 2SGEI 1DTTB 3WIVA 2Y8YA 3QIPA 4DI6A 1TTHB 2HRUA 2ZITA 3M8WA 3NMAA 2VQFJ 2CPIA 1RT7A 3Q24A 4DV0J 4KHPF 3T1HF 4B9SA 2B9WA 3FEZA 1SL2A 1VHFA 2HNYA 3O2IA 1U26A 1IY6A 3QJJA 1WHXA 1T05B 1P6TA 1WDTA 2XSFA 3M30B 4K4TA 1SC4B 3TAMA 2E1RA 1TKZB 4YB6A 3KXDA 2N3OA 1D0EA 5E33A 1IR1A 1ZH5A 1Z90A 3R5JB 1CHOI 2ZUGA 3NNHA 1HNXJ 2Q6CA 3NS6A 2OTJS 4G3PA 2D69A 2UUAF 4F26A 1JLQA 4RBVA 2RILA 1NRKA 1FRLA 4WKYA 1XTZA 2F1FA 3LUYA 2J6UA 2IJRA 3N79A 3OBIA 1TKXA 1NDLA 3QRRA 3LGMA 1PAUB 2V50A 2ARPF 2EFQA 2GHVC 1PTQA 2B4UA 2JZ5A 1KHRA 4I7FA 2X1AA 1Z7KB 4MYTA 3C14B 4K6RA 4O4RA 2KO1A 3QATA 3IP0A 1MLAA 3F56A 2B9EA 4F67A 2DHHA 5DLGA 4L9MA 4OYAA 4P6QA 3H5YA 4CH1A 2DNHA 4CLZA 3MPVA 4WXWA 4RNOA 1KOHA 1NSPA 3RR8A 4DPOA 2QA4S 3QLHB 3MFIA 2PI5A 1LR7A 3V6DA 2DNKA 5ITHA 1ROFA 2VG6A 2F8MA 5IV3A 4RW8B 1T9TA 2ATLA 4LMZA 3W9JA 1MRLA 4ECWA 4OYIA 1TU0B 5HJYA 4H7OA 1SUQB 3NGRA 2XMJA 3H5UA 3PKMA 1X60A 3VBKA 4OX6A 2VIHA 3JXOA 3I4HX 3B6BA 5BYQA 1PJ6A 3R7BB 2R7TA 4MIAA 3ILIA 1IKWA 3I32A 4OZJA 1LNQA 4FKDA 1YRUA 4IOCQ 4DV4F 4RW4A 2GKTI 4DG1A 3T1HJ 3C6TA 4KHPJ 2HIQA 4B9NA 3IR5B 4I64A 2VFSA 2VL1A 3FBCA 4QQBA 3CCSS 5M2PA 2QYGA 1X0PA 3N6LA 1ZS6A 4ICLA 3SPTA 2V53A 1UEUA 2JWNA 2ILYA 3PKYA 2GMJA 4ILLA 4KT0C 1UETA 3GV7B 1Y0HA 5EWEA 4DUYF 4AT1B 1G1XA 5ETNA 4AYBD 3HT3A 3BO3A 3G6XA 5GMDA 2X1BA 2UUAJ 3W2WB 4ECVA 3VQTA 2U2FA 4X66F 2DR9A 1GMWD 2XMVA 5H9EJ 3MM6A 4PXDA 3I5AA 3CCES 1F6TA 4RW9B 2Y9HA 3ZZTA 1SQFA 1FRKA 2BVZA 2CQDA 4FF4A 2DKOB 5IT4A 2HMIB 4DX7A 4HI1A 4GO5X 5HQ8A 1XK8A 4J9OA 2FC9A 4RW7A 2YNHA 1RT3A 2YPYA 4MTPA 4ANCA 1N56A 4CLKA 4PG5A 1PYOB 2UV8G 2VPZB 3KG0A 2D3OR 3B54A 2WSFC 3GSIA 2QKXA 2QSFA 4ELVA 1N13A 1OY8A 2KVIA 3ENQA 3SQGA 3K17A 4AL5A 2BRKA 4O0IA 4RBTA 4WYLA 4NLPA 1S6QB 3BF4A 3G96A 3FFIA 2XO6A 2CJYB 4K4YA 1HHQA 2KN4A 1TL7B 5BXIA 1PKUA 4KHRA 4JI1F 3UGDA 1T3DA 5D15A 1ZA1B 1BHNA 3OLBA 2KKHA 3US5A 3TO6A 3NGUA 3T5KA 1JJCB 1YJ9S 1R3NA 5F8HA 1TKTB 1S4EA 3LF0A 3D1HA 1IWGA 1R0CB 2FHKA 3IC1A 4URSA 2UUBJ 3G87A 4XPCA 2KYXA 3QT7A 1EARA 2HS3A 2A10A 3R2DJ 4CI0B 1X8DA 1X4BA 2XI3A 2W2NP 1BWVA 4DOZA 2MZRA 2KMPA 2ZH9A 2G9OA 4P7TA 1LR8A 3W9IA 4ZPTR 2UP1A 1CGII 2CQPA 4C8ZA 1TQLA 2ENZA 2F9DA 4I2QA 2HZAA 3C66A 5C42B 2R2TA 2DH9A 1CJUB 1LEOA 4X66J 3T9NA 1Q8IA 3UD3P 3K8WA 2GAHC 3J81Y 3QYYA 3E59A 1MN9A 3MUTP 3KJFB 2HNDB 1S10A 1T9YA 5KOXA 2ZM6F 4DSJA 1CSJA 2DHSA 1SJQA 4TY9A 4YDXA 4QPXA 4ZIWA 2Y1IA 1EETA 1LWCB 4QW8A 5IQQA 3IS9B 4M5IA 2BACA 2OPPA 3PDNA 4LFAF 2RU9A 2HWTA 5GMKa 5T7LB 3J7Z5 3RAQA 3TIOA 3MEKA 3CD0A 1N36J 2QIFA 3E3XA 5B0BA 5KT7A 4E6UA 5GAGU 1TVRA 1UEKA 2HVEA 3M2VB 2OAUA 4E1RA 3BGFA 4CQ1A 3OSPA 5J2MB 1MR7A 3IR7B 2BDPA 4DV7J 2APOA 3MD1A 2BOAA 5HMXA 2RIJA 4DFKA 3LANA 3BREA 1WSVA 1FTRA 4H4KC 1RAGB 4MFBB 1PGZA 5HROA 4JI1J 2QSWA 2V69A 3LW5C 2JSXA 3CJQA 4QIWD 1IKVA 3VQSA 2XQCA 3NNCA 2CQ0A 4USKA 2W2MP 3H42A 4EGGA 1HHSA 4WP4A 3Q0AA 5A8KB 4LRCA 2FLLA 4EQYA 1B0PA 1RWOB 5HANA 1PBUA 2RNEA 2IHR1 1I94F 4FS2A 3AOBA 1IJEB 3UVJA 3JYTB 3WDOA 2NS1B 1YJ7A 4CYUB 4RU2A 2CG8A 3I0RB 4P73A 4C97A 4UY8T 1G6BA 3IG1A 4CLTA 3KLGA 3K57A 3DKDA 3LALA 1HNIB 4L74A 1L5UA 1Q9BA 1U1QA 2P9EA 2KHCA 4IO9Q 5HK4A 2SGQI 2R2UA 1S76D 5GAGI 2E5HA 4J9NA 3GTYX 3GG0A 4ETZA 2YBVA 2QIAA 1IBLF 4AAWA 1LWFB 2FJBB 5DEMA 3OW2R 2F65A 4U8YA 1EX8A 2UVWA 2HS0A 4TLQA 1J2VA 3NS7B 3C8VA 4ID5A 3AD9C 4TLRA 1E6VB 3PVXA 2N4CA 3C16A 2EEYA 5HMYA 2ZM6J 3LAKA 1OYEA 5CYQB 1JX4A 2YKOA 1RHKB 4L73A 3RG6A 2GKRI 2XWYA 1RCXB 1ZM9A 1WG5A 2BE2A 1UZHA 4LFAJ 2VG7B 1SKUB 2QJ3A 3HHLC 3KLEB 3CCMS 2CJBA 5I42B 1FNXH 2FVSA 3RBZA 4TXSA 1HL6A 3EVMA 4R25A 3BKFA 2RDIA 2VASA 2IM1A 2E9ZA 1WTJA 2CWFA 3VAHA 4D3HA 3BBBA 1FVQA 2LUYA 2UVRA 1CSOI 2XY6A 4ZOSA 4KGVB 1XC9A 1UWBA 3DU5A 2KMOA 1VQLS 3OVAA 3A8EA 2DNRA 1QVFR 2KU7A 5LSLA 2WONB 2YKQA 2IC3B 2R8JA 1B70B 4IG3B 1YTYA 4YN3B 2FHOB 2KXNB 1VGYA 1P1TA 3MI7X 1RBLA 4B6DA 1YDLA 4ZLPA 1UJ5A 1Q81T 3TUZC 2RKIB 3EWGA 1BGXT 3H2VE 4KGKA 4EI2A 1N6QA 1HIYA 1FEEA 5DM7Q 2JL9A 4RO0A 3VWSA 3VBMA 3HCXA 4UT4A 2L7XA 3EUNA 2VOPA 1BQMA 1TL1A 2Z4PA 3HVTA 3P1BA 4RBUA 2BJDA 2A6MA 3Q86A 3EXCX 1IBLJ 4FBUA 2ZWPA 4NA1A 4KKOB 1XNRF 1F1BB 2AYBA 4NZ0A 4ZPCA 1YWXA 3KHRA 3RW7A 2CADA 4JYAF 1NXIA 3OVOA 5IZHA 5F42A 3T3FA 3OR1B 1HNWF 1MJAA 4NX9A 2XTJP 1SXLA 3KHHA 4G3IA 3T6JA 4DCPB 3KG1A 2FY8A 1AUSL 3QTLD 3I9V9 2MGZA 1YVFA 1HWIA 1FY7A 2OMLA 1AA1B 4GO7X 5F8GA 3ZZZA 2YVSA 1QAXA 2R7XA 4F4XA 4NRUA 3ITHA 4OI4A 3RBEA 2KT3A 1S6OA 3MFHA 3R6LB 2KTQA 1LK5A 4DCJB 4NLOA 4P2FA 1S0OA 3GPAA 2W2OP 1U49A 3KHLA 1MN7A 1QSLA 3FCHA 3MAAA 2K3IA 2B43A 5T14A 3X3UA 1H72C 4ZLNA 4HTJA 2P2CB 2W9CB 2OD1A 2RE1A 5F9NA 4P10A 1UVJA 3KOAA 1SCJB 1XQIA 1RA7A 3EH0A 1KC8T 2CWXA 1HD1A 2E7VA 4B3OB 1XR6A 5G0RB 4B08A 4CTAA 3K5LA 2W01A 2WVJA 3PYDA 3IRWP 2R7SA 4NCGA 3OTCA 2FZGB 1M5HA 2RC4A 2MKCA 5HJXA 3CULA 1F5CA 1BUXA 4J9MA 4O3SA 2CJSC 5KFAA 1UVIA 3UPFA 3BB5A 3CW2C 4IQXA 2OVOA 4F8RA 4PG8A 3UDLA 1NLKL 2HK2A 3DLEA 2HSEB 3IWLA 5ETTA 2RAQA 2IA0A 3F41A 4IFVA 4R8UB 1SJRA 1W7WA 2J5AA 3A4TA 2BQ3A 1JKHB 5AE2A 1S0VA 4PR6A 2OO4A 4NLYA 5KFIA 2FTRA 2G0JA 2JJ4D 1D3WA 4UOCA 4DBQA 1RWMB 1WDDA 4ZPAA 3HM9A 1XNRJ 4X4TA 4LR8A 3MCSA 4JYAJ 3KLIB 1U1RA 3M2UB 2ZDOA 1VBXA 2BM0A 2DGWA 3P47A 4I2PB 3TANA 3I0SB 1HNWJ 2MZJA 2YKMA 1GTEA 2IJFA 2QLJB 2DGQA 2W2QP 4ED0A 5KFCA 1UTAA 1Z2ZA 1S99A 3HVAA 2FVQA 1SGRI 4LSLB 4IFYA 3DLGA 3I55S 4RZRA 3CVKA 4TU8A 2LEAA 2L9NA 1IQZA 1NB7A 2IJNA 4KHMA 1EP4A 2WTFA 2JLEA 1RAOA 4C98A 1D09B 4N6AA 1S1VA 2QT7A 4OV6A 4Y65A 1GMVA 4YB7A 2HKEA 1C4AA 3IBFB 3K0JA 2M3DA 3JQMA 1N5QA 2CQHA 1F3VA 4UXIA 1AFJA 3JSMA 2JOQA 4M28A 4XO0A 3OR2A 3W2VA 2R8IA 1KBRA 1K8AT 2ZUAA 2HLTA 2NU0I 4HEA9 3HT0A 1I5OB 4EA7A 2GHWA 2VBYA 2XG8A 3P5TL 1R0AB 4JV2A 2JEGA 3UGLA 1Q78A 4HYKA 3M6UA 4N77A 3UGIA 2AIRB 3EPGA 4F50A 5M2UA 2EFOA 5HLFB 1LW0A 3HXMA 2KXHA 1S9EB 4AA7A 2BABA 3Q23A 4ZVSB 1CJTA 2XRCA 5K5MA 4OFZA 2PEHA 3PMOA 1ZM3A 1RTDA 2ROWA 2W0WA 3NGSA 1HWJA 4K2XA 4YFUA 2B6AA 3FTTA 5KFUA 3HJFA 1WF0A 3QT6A 4U8VA 1KVIA 1HKAA 2EXUA 3A8KA 2HQIA 2MQOA 3KFWX 1RI7A 3N5BA 2GVIA 2VKZG 1F9FA 4UQTA 3QPIA 3RZAA 5HQMA 4IH6A 1N52B 3DYAA 2HQFA 4NLTA 4OQJA 2W8KA 3LH2S 4LF2A 4ED3A 2P9CA 1CULA 4C8KA 2JLGA 1S7HA 4HI2A 3OL9A 2JZMA 1NAQA 1H0ZA 4IH5A 3ZXWA 3TO9A 2MQMA 2IYIA 1S59A 2B0GA 1BMQB 1HNZF 1KQSR 3VAIA 1FWLA 3T5JA 1DRZA 1RCOB 4M5DA 3AJ2A 4P2XA 3MHYA 3N6NA 3POTB 2LU2A 4X64F 2LA4A 4TYBA 4M2AA 1GT8A 2DNMA 2DCUB 2JC0A 3GR0A 4X4SA 3EGZA 3NG8A 1T3NA 4C3KA 1VDDA 2WVBA 2AZ1A 1Z2LA 3CDEA 4USUA 3D68A 2WLDA 2J7KA 3BRKX 4ZMMA 1SH2A 4QIGA 2OFGX 3DRSB 5DO2A 4BWMA 3GQ9A 1S7IA 3M32A 2KFNA 2BE9B 4NCBA 4PG4A 4WK1A 5GAHU 1WGTA 1QE1A 4JP8A 6FDRA 1NK9A 4A8QA 2C3OA 2DIPA 2K1RB 3PRVA 1VLYA 4N8OA 4TY8A 4DPXA 3CD6S 2DNQA 2H4WB 3K5PA 3I6PA 1PIEA 1WHWA 1HW8A 4FYVB 1HBUA 5J8FA 3D6TB 4ZCLA 4X62J 3MUMP 5B0EA 4PUOB 4Q8EA 1LFPA 2UU9J 3C6UA 3N4WA 2M5XA 2ODDA 2NZCA 5ADZA 2B5JA 2M70A 1GAOA 3AD7C 3SV4A 5CYMA 3NRBA 1JXEA 2CFXA 3J7ZT 3OXGA 5CA5A 3SSQA 3CJ0A 2ZJPQ 2NU2I 2I2YA 1FFWB 3VAKA 1ZAWA 3M8SA 2C3UA 4PQUB 4J91A 4U7UD 3DN9A 1AZSA 3EE3A 4X84A 3E01A 3EXYA 1OSCA 4MIBA 2AX1A 3DM2B 5DG3A 2CWKA 1NNDA 4NLQA 4LF7F 9WGAA 2E1CA 2EFPA 2CPZA 5GAHI 2ZBIA 3BQ0A 5LMUF 2I5KA 5KOWA 2HWHA 2IVYA 3DCAA 1TBOA 2H54B 3VV2B 3TZWA 5LT5A 5IWAF 4X64J 1FA0A 2V34A 4MK9A 1MG7A 2ZOMA 5ETQA 1RU1A 1DTTA 1WJ9A 4J37A 2L8EA 4IOBA 1M5KC 2BYCA 4LJMA 1OVOA 4ZLJA 5HATA 5KTQA 2V67A 4TVAB 1HHTP 3BSNA 3UWTA 4OL8A 2IDEA 1D9AA 1T05A 3UFCX 3MQGA 3R97A 4PPDA 4KYZA 3M30A 4QPTA 1QY7A 4OZLA 2RQKA 2H48B 2FVCA 2MLYA 3GG1A 1TKZA 2DD8S 5A8WB 1Q8BA 4X4OA 3D1QA 1YU6C 2ZVSA 3TOAA 2NUHA 1Q86T 1Y11A 4CIOA 2E44A 1FXJA 4NI2A 5KG3A 2QV6A 3D0GE 4DV5J 4GVBB 2AJ2A 4O44B 4A8SA 1OMTA 1W2BR 5DEPA 5RUBA 2J87A 4QR0A 1OMSA 1YJUA 2BV3A 5IOLA 3V6KA 2BW7A 4J18A 4DV1F 2RU3A 2E7XA 2CQIA 2RF2B 2ZH4A 3G86A 3LWMA 1PPFI 3W61A 5EDWA 3BXYA 1ZBTA 4SGBI 3VBNA 3H59A 5HVHA 1X4AA 4YEAA 4WTOB 3C14A 2R7VA 3QSYB 1JIHA 2ASLA 1KP6A 4FZVA 4F02A 1DQ8A 3BQ2A 3KTQA 4CDIA 2Y0BB 3U1MA 4JI5F 4F4KA 4N27A 2HVHA 1PSDA 3JAMU 4LIRA 4DCLA 4YR0A 4DR3J 2XULA 3HHKA 3W9HA 3QLHA 3O3LA 5L1KA 1N5SA 3T57A 3L3CA 4DL4A 4UZBA 4LF7J 1FJGF 4OHYA 4LRAA 4OLPA 4RW8A 3K5OA 3TARA 4ER8A 2JA1A 2YKNB 3UDCA 2FPHX 4AXJA 1YJRA 3PM9A 1SUQA 4ZCIA 4JCVE 2Q43A 1RT1A 2C28A 1VRUB 2ALYB 2DNYA 3IAS9 1V3WA 3ILOA 4ALZA 2HHVA 1B7YB 4DPWA 5E41A 3TWZA 5F9LA 4M8LA 3CEDA 3TO7A 3OFFA 1RWWB 1P9QC 3AHPA 1XBTA 4YHHF 4KE5A 1U8SA 3R2WA 2MY8A 4PABA 4FS1A 2EFNA 4RKUC 3F73A 1WUUA 3N5FA 3PHTA 1RHQB 3OGZA 2B7CB 1IKXB 1O51A 2WVCA 4ZIVA 3NXZA 5C5JA 7FDRA 2W9BB 3W2WA 1WC0A 3SEOA 1KN6A 4WFNQ 2HHWA 4RW9A 2E29A 4DV1J 2MKSA 1IY5A 2KFZA 5AE1A 2HMIA 3ZZRA 2QTWA 5EWFA 2YKAA 4BC7A 3V4MA 3OH0A 2ZC3A 1RTJB 1RZMA 4HT5A 3UCGA 5HP1B 4JI5J 1S49A 1WEYA 2YNFB 3ENVA 4DUTA 3T5LA 3OTBA 4NYOA 1YX2A 4MMOA 3B82A 1K73T 4DL2A 2JVOA 1S6QA 1FJGJ 4EBEA 1Y3KA 2ZE2B 5DM6Q 4EAAA 1TL7A 3L7UA 1S77D 1ULRA 3R7NB 3ZZPA 2H1YA 1XEZA 3U1LA 2V8GA 3ILJA 4CLPA 2ZNYA 2DYAA 3SFGA 1NJWA 2MKHA 1VFJA 4OZNA 5A2QY 2CUYA 2F4VF 5J2PB 3TX0A 5J1EB 2XNRA 4NZ6A 4MFGA 4Q43A 2XNQA 3R1WA 1BQXA 1PG5B 3ZTQA 1TKTA 3GYGA 2I8EA 1FO1A 4M5MA 1M1GA 2VC1A 2IIHA 3SIPB 2DR8A 3KK3B 4NA3A 4K2JA 5BYSA 5KFBA 2YH1A 2YQ3A 3MCNA 2ZNZA 2QQEA 2LMIA 1ZA2B 2AX0A 2HFOA 3C2PA 4HDHA 3DLLQ 3T9ZA 3TA1A 2CQGA 3L95X 2I9SA 2FJDB 3RJMB 2DRAA 5IC6B 5K20B 5A6PA 1XJWB 3BSCA 2HIYA 1NKBA 5IV4A 3BKTA 4J9KA 3AQPA 5C42A 3BO2A 1FVSA 1CJUA 3LAMA 3EEVA 2FYXA 3NMRA 4H4OB 4RWWA 3VGTA 1HD0A 1PYSB 3GB0A 3TA2A 1AN1I 2IVFB 1DTQB 2WB4A 1MWYA 4WK3A 2N4DA 4NMXA 1NJIT 3ZFVA 5H9EK 2HNDA 4NXNF 3DLKA 4R7PA 3M6VA 2DH7A 1LWCA 1EIYB 1FI4A 3OH1A 1K7UA 4ZPBA 1FDBA 1I6JA 2D3ZA 2LCWA 5KFYA 3WQPA 3TX8A 4E79A 4KAIA 4K59A 2VA3A 3PR4A 3M2VA 2GS8A 2RRAA 1UJ6A 5L39A 5KT3A 1S9GB 5J2MA 4HHHA 1VLOA 2POKA 4FNHA 1OQ3A 4IHGA 1T02A 2JXDA 4KPXA 4DXLA 3IR6B 4XDCA 1ULKA 1FFGB 2HFUA 3LA0A 3TP2A 1K47A 4MFBA 3U1NA 4Q2LA 2CJAA 3ZTRA 2WLCA 1HJAI 1WC6A 2X51A 2DR5A 2F4VJ 2F63A 1RAFB 3HLUA 4PQAA 4KNXA 1WHVA 4Q0BB 2AD9A 1Q8LA 3IWXA 3GCWP 3MEGB 4RNHA 4AUKA 4I0WA 3QFHA 4IRKA 2FUG9 3CCZA 2DNLA 3JYTA 3AQOA 2Z2ZA 1V1HA 2W4DA 4KFBB 4CYUA 3BFPA 2YWGA 3I0RA 1Q79A 4NLDA 4URGA 2C2RA 2B8TA 2A2DA 3HMJG 1HNIA 1Q16B 3FZ2A 1FARA 4S0MA 4CLWA 4NWBA 1FAQA 3MAQA 3B78A 1DY3A 4V1Ak 1LK7A 5DG7A 1LWFA 2OPQB 2Z56B 1BY9A 1W26A 3DRYA 1FXLA 3M1VB 2WLEA 2KJVA 4CZCA 4Q7AA 2KG1A 4HACB 3SUCA 1B64A 2M7SA 1E6VA 1FWKA 3RU0A 3DOLB 3H2LA 2MXYA 2LLZA 4LFCF 5CYQA 1Q1KA 5MLCV 4OHZA 4A46A 5B09A 2XY7A 4K4XA 2ZKUA 1K0VA 4JOUA 2VG7A 3DRXA 5DG9A 4JI3F 3BGLA 2KB2A 3KLEA 1U25A 3A12A 1WD6A 3GONA 2MTLA 3FQKA 2F40A 2NXJA 2E9TA 4GKKF 4M5LA 4FYXB 4CO3A 2CQ3A 2NCKL 1IQTA 3BSOA 1J27A 1D9DA 2M88A 5IC4B 4CT8A 2DGUA 3MCOA 4RX6A 2YQPA 1HBOB 2NREA 2V0JA 3RGIA 4LF9F 1O8BA 1SGYI 1RK8A 2WONA 3O8WA 3I87A 3HSZA 2MQLA 3I82A 3FEXB 4J9VA 1XN9A 4ATNA 2A3JA 1VC0A 1GX6A 1SL0A 2D3O1 1TBQR 5EX0A 3PJ9A 3H0PA 2RKIA 2NU4I 4WF9Q 3BSWA 3KDNA 3M8ZA 4J09A 3W60A 1KEKA 2HVDA 2HHHF 2K8GA 2DGOA 3IM8A 4NMLA 3DOMB 3DDIA 1FE4A 4JI7F 1X4SA 1RADB 1YTPA 4O23A 3QGGA 3SFUA 2MZQA 3MMCB 2JF2A 3V2UC 2GMHA 5JVGQ 3R3IA 4C11B 1URNA 4KKOA 4MKAA 9RUBA 1U02A 3KLHB 4I1TA 5BR8F 2GJ2A 5FUWA 1AROP 4DR6F 1U1LA 3THVA 1TL3A 5E2QA 4QJVA 3OR1A 2VDHA 1S20A 4F04B 4LFCJ 3ECTA 2MKKA 1X5OA 3KG4A 3DJ4A 3VAGA 5F41A 2RQMA 2V8DA 3MM5B 2NU1I 3S01A 4CLLA 3CE8A 1G97A 1HYSB 2QQDA 2WBRA 4JI3J 4V19J 3T41A 1V5VA 4PG6A 1JLBB 5EGYA 1FK9B 2OH2A 3KKFA 1CT0I 4KB7A 1CT2I 3NGKA 3CIMA 1VJWA 4C0BA 2ZZMA 1S12A 2UXCJ 3R1HA 1RWVB 4GKKJ 5HVGA 2R8KA 3GOSA 2I6WA 2AKWB 2W9CA 2H51B 1SVDA 4USHA 4A4JA 1L3UA 2ORVA 4LF9J 7WGAA 3CC7S 4B3OA 5G0RA 2PA3A 2YQ0A 2NYHA 3TEGA 2J0QD 2GGPB 4WU3A 2P5VA 4Q2MA 1HV9A 3FMBA 3EJMA 4FYWB 2I5JB 4DQSA 2ZZTA 5KG1A 4ZVQB 2O01C 3DLBA 1UJ4A 2V0LA 2C3PA 1FRMA 1SB6A 5DQGA 1HARA 5D0GA 1JXVA 9ATCB 1PJ7A 3BGUA 1RAJA 4DF8A 3PX4A 4ILMA 2IRYA 4A8XA 1X4FA 4KH0B 4MAKA 3R3TA 1R0RI 4Q8FA 4JI7J 1F60B 5H1SV 2D3UA 4R8UA 2ROPA 5AJ3F 1JKHA 4W98A 4KPZA 3AB2B 2HNZB 4C7QA 4DJBA 3CJ3A 2BXJA 4ED8A 5LJ3Y 5KFSA 3D0IE 1YBUA 2AT1B 1R31A 4MT1A 1V1IA 4UXHA 1KHWA 2YWWA 5BR8J 2ICXA 2FIUA 4K50A 4DR6J 2GJIA 1R27B 3KLIA 3M2UA 4WBFA 3SV3A 4I2PA 3DRRB 4M98A 2G1DA 1TFWA 3EVWA 2HZVA 1MU2B 4NYPA 1TBRR 2FGOA 2E73A 5KFZA 4LSNB 2GQCA 1YHQS 2XMWA 2NZ4A 1X7VA 3CDUA 5C24B 2E5LF 3MPUB 4KQLA 2C42A 1YG0A 1RUSA 1RWKB 2AMCB 1TURA 3ISND 1XX6A 4DLEA 5LMNJ 1RT5A 2CJXB 1WI6A 2OJ3A 4QWCA 4IHFA 1SKWA 3GQAA 2OEMA 3LP1B 3WZ0A 2DNNA 1VJQA 3PYGA 2G1HA 2Z2MA 1VQ9S 2UXDF 5ETKA 2HHTA 3GJSB 2WOMB 2AWZA 1ZTWA 4I4BA 2KRRA 4OZ2A 1N5VA 3SEKC 1R0AA 3TVKA 1HW9A 2DRBA 1CEZA 2EG2A 1W3SA 3NAHA 1TAUA 4DUZF 1T3OA 3UI3A 1KR4A 1S9EA 2KXFA 1K1SA 3OTEA 4DSIA 1UA1A 2ZD1B 5KFOA 4E98A 3GVDA 1FESA 2EFVA 2JYYA 1J5EF 4JI4F 1VQ7S 4IG0B 5AJ3J 4URQU 2C2ZB 2J9DE 5C25B 4PZVA 2GCFA 4ID8A 2B9XA 1D1UA 4PWUA 2H9ZA 2KZMA 1UW9A 3PW4A 1PAEX 1X4CA 1Q0NA 2DGXA 2EG1A 4YS2A 1ULNA 5L9XA 2BKOA 1H6KX 4ZHRB 3LP2B 1OO0B 3AY0A 1SV5B 1IM6A 2BJ8A 5B0FA 3SSRA 2E1MC 1N34F 2ZH2A 2QMUB 3HPOA 2IFXA 4ZPWR 4A24A 1UUCA 2FVRA 3BN7A 2E5LJ 4RJVA 1U47A 2V8VA 3OXLA 4R0JA 4CCHA 2EWHA 4DSFA 4DCOB 4DV3F 4IR9A 1WEZA 1MMLA 3ZTOA 2V0IA 2X1GA 2G0CA 1YK9A 5I3UB 3ETMA 3POTA 4TU9A 2RB7A 2AQ4A 1U0SA 2XB2D 3D67A 2CNNB 2ZHOA 1RBOB 1RXOB 4M1KA 4DR1J 1MJ9A 3H5SA 1KKHA 1A6LA 3WX4A 1DLOB 2N1AB 2EW9A 3NNAA 1NJXA 1YP3A 3PNIA 1IW4A 3BSYA 4HTIA 2DISA 4ZVGA 4DUZJ 3E51A 5HO4A 1SKRA 1RT4A 4RU9A 2Y1RI 2OIHA 2WBMA 3DRSA 3LPEA 4PEOA 5KFFA 1KNZA 3DHOA 3OL7A 3D54A 1HEVA 4YB1P 1HNVB 2MSSA 1VC5A 2GIRA 2K1RA 3DRPB 4J9QA 3D6FB 2J8AA 2HW3A 1J5EJ 4JI4J 3G8QA 5F0UA 1FHTA 2C2MB 4U7UK 4F2RA 1U2FA 1WSRA 4PUOA 2VRWB 3RUBL 2YX4A 3IGJA 3Q1XA 1R79A 4TNOA 1KFSA 4UUWA 1Q8KA 2HFNA 2XCAA 4AFFA 3HVRA 3TQ1A 2N82B 2Z30B 3G71S 4UQGA 3NCRA 5F8MA 3HHEA 2BANB 1VQ4S 1OJ4A 4UF4A 3RAMA 5L9NA 1CBKA 1SIWB 2AGPA 5KG2A 1WELA 1DQ9A 3DU6A 2M52A 4PQUA 2IDLA 3M8PB 1EZZB 1FF2A 3M05A 5DGBA 2PO4A 3VAMA 4OHWA 3VR1A 3DM2A 1SJ1A 1YBTA 2CQ4A 2UUWA 4DV3J 3UFFA 4NEYA 3PACA 3MMAA 2WSCC 3QAEA 4K0KJ 3JS9A 1UCNA 1L3TA 3AD8C 3VBPA 3BGRA 5KFLA 1MSWD 2PEBA 2CPEA 1JLFB 4RNNA 1GMUA 3N6MA 4FDFA 3TJ8A 1C0TB 1NMEB 4P9SA 2NU3I 2AZ3A 5H9FJ 2UXBF 2RHQB 1JLEB 1OY6A 1YP4A 4FKXA 2MZ1A 1Y1BA 2EKNA 1Q7LB 4X65J 4L72B 1KRVA 3UDVA 3KNGA 5K9FA 4XDDA 1BLUA 4KNRA 1IBMF 4JI8F 4ES2A 1FDDA 4DDFA 5A8WA 2MPUA 1KK5A 4IQMA 2N3LA 2VG6B 4ZCKA 1ZZNA 4LRDA 1N0VC 2R7RA 1M5OC 3MMJA 4Y2IA 2QA2A 2RDDA 2V2ZA 1TUWA 4O44A 3WC2A 5FJ4A 5C2CA 3JQYA 1RABB 3G4SS 2VFTA 3UOEA 4I56A 2GVZA 1FX2A 4EU0A 4WJBA 1EQ0A 3HZEA 1IKYA 3CB4A 2RF2A 4OI1A 1IKWB 3JTNA 4F3QA 1U1OA 2PA8D 4WTYA 1WGCA 4HHJA 4OHVA 2HWIA 4RW4B 4DG1B 4U6PA 2Z2LA 2H5IB 1VMBA 1YJNS 3TJQA 2DNZA 4UZCA 3K58A 4WE1B 4BBYA 5AFUU 4ICLB 3DMJB 4ES3A 3HH2C 2VDIA 4JV5F 4A8YA 1G3OA 4E2FB 3FSIA 4M95A 4B9TA 2KT2A 1IBKF 2RHSB 2OGUA 2E1PA 1WOPA 2X1FA 2HGMA 3JTOA 1BQNB 4ZDNA 2YKNA 1OWXA 4HH0A 1Y3JA 1FRJA 4ED4A 2A1BA 3I3XA 3OVBA 1H3DA 1VRUA 1R6YA 1GEHA 2HBQB 2R4FA 2I38A 2R7UA 5E3RA 3H98A 3TJAA 2VODA 2UXBJ 3CCTA 5JJBA 3ZC4A 1U1KA 1PCEA 3FKBA 3IN5A 2NPFA 2HRYA 1RB0A 3OHAA 3DFEA 2VFVA 4OIXA 1VI7A 1AW0A 4OJ1A 1QRFA 4TYAA 5DETA 3S6EA 1XIQA 4BWJA 5KT2A 1IBMJ 5KFVA 5KG0A 1WTFA 4EA8A 3TW0A 2IMWP 1NUEA 3IGNA 4HZDA 2QFJA 3GLJA 3GIIA 4KY3A 3MMBB 3IXCA 4ED1A 2VD4A 2O1PA 4U9RA 1TR0A 4ZJQA 1IKXA 1R89A 4EZ6A 2GZOA 3G2XA 4QWDA 4X2BA 3UN5A 1FJEB 1FKAF 2DB6A 1G95A 2OPSB 4KQZA 1MWQA 3QGHA 1IBCB 2JDJA 1PBAA 1RTHB 1M1KT 2QLFB 4G3SA 1UP1A 2F5GA 4EBDA 1S4FA 4IDKB 5DZ7A 1REVA 1SGDI 1G2EA 1JLCB 1KTVA 2JRSA 4X4RA 3KY9A 3FVYA 3TAPA 2PFFB 5DG8A 4IUFA 4DL5A 2W4PA 1DS3I 5A0YB 1S97A 1RP5A 4JV5J 4KBIA 5HP1A 3KMQA 3UNGC 3EGWB 2QPOA 1TUVA 2YNFA 3JSYA 3RR7A 2Q66A 3OSNA 3EYZA 3ZZYA 4QWAA 3CMAS 3SCIE 3UQSA 1ZZFA 2ASJA 2ZE2A 4PAAA 1H38A 2PI4A 3BDEA 3TQEA 5HQLA 3V4EA 3QJLA 2OELA 4B9UA 1U6BA 2C2OB 2HPUA 1DZ5A 3FJ2A 3M4XA 3FCVA 2GQ2A 4ZVPB 1KQAA 1K7VA 5J1EA 4PG7A 2NXUA 1YSJA 4ZVOB 3GJQB 2UUCF 2IMOA 2QLXA 1FNMA 1N54B 4DFPA 1VS3A 2JVRA 1QRMA 3KK3A 1WTBA 4O3NA 3OFGA 5FLXU 4QCLA 3BSSA 1QDUB 1NCLA 4ZN1A 1JNRB 3F1XA 3MD3A 1L3KA 2F8HA 2BBEA 1VC6A 2V9KA 3DGPB 4PWDB 3D5MA 4W92B 1YGYA 3MM9B 3OVSA 2MLXA 1Q82T 2MYFA 4CO1A 2VFUA 4WFXA 3PCOB 2FGCA 2HGLA 2XY5A 4DQQA 4DV2F 5LXRA 2CZ9A 4J9LA 2QYCA 1FE0A 4OYXA 1RE1B 4DQRA 1X31C 5D3GB 4H4OA 2HVZA 1NBEB 1U48A 3GYXB 2QEXS 3RTVA 2LQ9A 3OTDA 3TO8A 2LXFA 2NPIA 3VBIA 3F44A 4USWA 1DTQA 2RJZA 2HG4A 1VOMA 2QLWA 4LF6F 1K1QA 1TMMA 4DEZA 2BM1A 1YJTA 4Y3CA 3IG1B 2CPHA 4JUZA 4HURA 4BS2A 2ERWA 2XYGB 3FSYA 3MOJB 3W5YA 4I6YA 2Y0SD 2VF3A 5IFMA 2ZBRA 3VZHA 2ZH8A 4YQWA 3D6MB 1DBDA 1HM8A 2YWEA 2OHDA 3KLVA 4ERDA 4DS4A 1KBFA 1JQGA 1NPKA 4OI0A 4FYDA 2OI5A 1SQGA 2M4MA 3K2YA 1Y5NB 4UXJA 2R2SA 4DV4J 2XSJB 4N5SA 3U7JA 2L41A 2R3VA 4CNZA 3MM7B 2OEKA 4Q0BA 2UUCJ 3EGVA 3Q22A 3MEGA 4X4UA 1VK3A 2ZHAA 5F3TA 3GJRB 1XHDA 4DUYJ 4OX7A 3PR5B 1JLAB 2YWHA 4KFBA 4C8YA 4ZPDA 2LDIA 3IA0A 2Q79A 1A0OB 3MEEA 3RB3A 2BEFA 2PFDA 3W63A 3BR8A 2YH0A 2R9LA 3UO0A 1W2IA 3PIOQ 1RYSA 5B0GA 4GKJF 4RL1A 3IRXA 2W4CA 5ETMA 2NXNA 2I0XA 4I6AA 1WEXA 2JX2A 1RWUA 2HFSA 3QT5A 1FT8A 3OH4A 2XYHB 1O5JA 2NR0A 2ZOFA 3UEJA 3H4BA 2OPQA 4EK2A 4ZP7A 3DNCA 3CMQA 1FWYA 3HP6A 1XERA 3M1VA 2W2PP 2HFVA 4HACA 5F8NA 2GO9A 4C2MA 2GMLA 4Q45A 4E1KA 4CH7A 2GGQA 3K5NA 2VQEF 3PW5A 1VISA 2XHCA 3KWEA 4LF6J 4IR1A 3GUEA 1CJKB 1Q53A 1NO8A 1IUJA 2IYGA 1YJVA 2KM8B 4I6WA 4DN0A 1L3SA 3N01A 4DPYA 3OW5A 1TELA 1EHWA 1KWMA 2Z8QA 1KOOA 3BV8A 3FWWA 3H90A 1LV5A 1AT1B 2MJNA 1BE4A 3B4MA 2GKVA 4OLOA 1BQMB 3MR2A 1TL1B 3L4BC 4LQ9A 5KG5A 4A8FA 4UOFA 1NXUA 4CO4A 3W8PA 1U4BA 1E6YB 2QA1A 2BJ7A 1IR0A 2QN6B 3MR3A 1ACMB 2G4BA 2XS7A 2HK3A 3QWPA 3DHWC 1OYVI 2FNFX 5J8CA 2ASYA 5HBMB 4EBCA 3EM1A 3CJ5A 4BCAA 4WIQA 5IM0B 1HBOA 5AXLA 2CDQA 5KFKA 2AGQA 1N32F 1JB0C 5K8OA 3EVOA 2XLJA 4L6V3 4DZ6A 3K8VA 3GQCA 2LP4A 2J0XA 2WVDA 3DOKB 4C8OA 3D98A 2ILZA 3VVUA 5B0AA 1RHMB 4ES1A 1VIOA 2BJ3A 4F3MA 4KPYA 2BQUA 1HPZB 2CVEA 4YP3A 1X4HA 3W1YC 3FRZA 4GKJJ 5D4NA 3DOMA 4B3MF 1MW7A 4NLUA 1U1NA 3BEGB 2PT0A 3RYLA 1QRLA 4E8UA 4F0HA 1KVKA 2UVUA 2NSCA 1KDNA 1S48A 1VQKS 2DTJA 3MMCA 4M5GA 2UVVA 2LFVA 4HCQA 3WIUA 2LECA 1OIAA 1RAAB 4CTAB 5DDOC 3KLHA 1LW2B 3P3DA 3A3PB 4OX9F 4WFYA 1R8HA 4WXOA 1N5TA 1ZPWX 2NQPA 1TKDA 1QSYA 1SKSA 1KGTA 5CZVA 4QWEA 5ETPA 3IWNC 1HWLA 4YY3F 4F3OA 1KFDA 1U2RA 3MM5A 2VJUA 1HYSA 4ZVEA 1FRHA 3RW6A 2AEMA 3EG4A 4CLUA 2WCXA 1FK9A 1RTIB 5K8MA 1FKOB 5J2NB 1LWXA 4IFVB 1S1XB 3THTA 4TKTA 3HJJA 1V5IB 5KT6A 3DK5A 3JSBA 1T94A 2Z57B 1F5AA 3MECB 5FUYA 1I94J 2Y1LB 1RHRB 3EDQB 3LP0B 3I9ZA 4H4MB 3M9OB 2M5YA 4NXMF 2CQBA 3CJ4A 3Q89A 4LFBF 3FOQA 1JJ4A 3UEYA 1BC6A 2Q6BA 4LSZB 3QZ8A 3QGPA 2OSQA 2I5JA 2OFHX 4DR5F 4Q44A 2MZSA 4HLBA 1QTMA 3DLGB 3A3OB 5LXYA 3G6VA 3ET6B 1ZYQA 2Q4JA 3D28A 3DC2A 1WKJA 4KV8B 5CQGA 3JAMY 2PIIA 3UW1A 2D7SA 1RAHB 2HYIB 1KK4A 4F4WA 1XR5A 1UZDA 4OYWA 2C1EB 4ED6A 5CABA 3TOQA 3DDKA 3GYNA 3Q2TC 4J9RA 1IXKA 4CT9A 1VQ6S 2XMTA 4HZCA 4G1IA 1UL3A 2MMYA 3N0VA 1VQNS 2RVJA 2Z0GA 3JSMB 2VPXB 2HNZA 3FC3A 2NPOA 1IWAA 4RUHA 3W2VB 2ZWOA 3Q2SC 4WFAQ 1HR0F 4OX9J 1RAEB 3DXBA 2J8SA 5CZXA 2ENNA 5F8IA 2ATCB 1TBNA 2V1CA 3DRRA 2CPFA 2WW4A 3JQJA 5SZTA 1MU2A 1QUPA 4OI3A 3WC0A 2P6AC 1CJTB 1ZM4A 4LSNA 5L8RC 1N33F 4P52A 2RD5C 2DXEA 5C24A 1IN0A 3AH6A 3FBBA 4AC3A 5MAOA 3MUVP 2SGPI 2KCXA 1QTNB 4UY85 4C9DA 2CZVC 4UOGA 1WG4A 2LDYA 2BKPA 4PXEA 2XMUA 3VAJA 1SGNI 5ETRA 4QU7A 1HFEL 1HI0P 3LP1A 1UVFA 5CCMA 3EMTA 2QGFB 1M90T 1FJ7A 4ED7A 2E9RX 3KWDA 1QVGR 2KMQA 2YWFA 2JC1A 5D78A 3GV5B 5D0EA 5J1PA 2VFRA 5F8LA 1PC4A 2K3KA 1M8NA 1UFLA 4NLRA 1KRRA 4ELTA 1K44A 1TV6B 2CZ4A 1APSA 4MPIA 1GFWB 4GMKA 4DR5J 2J7WA 4LT6A 2HQ3A 1H74A 1SPBP 1CG2A 4A8OA 4K8RA 2E5GA 1HQEA 3MC4A 1QSSA 2X3DA 2HQCA 2ZD1A 2YTCA 3OLAA 1UHAA 1QUVA 4QYRA 3TVZA 2XWXA 4H54A 5ADXU 2XCPA 5LM7E 3GQ7A 4IG0A 1AUDA 2ORWA 1RACB 3BS9A 4ZA1A 5I3QA 4RUCA 1GXUA 5C25A 4M99A 4FF2A 3HFZB 1SJ4P 1OQ6A 3SYZA 2WCYA 3OTOF 1WC1A 1HR0J 2RDJA 3VDPA 1YLXA 3ISNC 3OL0A 1UW4A 4ZHRA 3LP2A 2UUTA 3LGNA 1SV5A 2CNOB 3HKZD 4CO0A 2DITA 2LKZA 1SSTA 1G4CA 3HVWA 5EHHA 2AYEA 4ZK7M 1OPZA 1N33J 4G65A 1VQ8S 1NKEA 3Q8UA 4I67A 5DRKA 1NK8A 3RRKA 1GX5A 4USIA 2K2PA 4NPOA 2W24A 2QL5B 3C6UB 4X4PA 1NZ8A 3NGTA 3BYPA 5I3UA 3I31A 1U8WA 2OI6A 3SGBI 3C15B 2DXDA 2J9EA 1S79A 1S9FA 4K4SA 4DL6A 3GSDA 4GVLA 3FNNA 1NK5A 3BH6B 1M1HA 2M8DB 1WOOA 2IY5B 3ZNJ1 1OCXA 1DLOA 2OEFA 2RRBA 4C6AA 1Q5YA 2JEFA 4ECQA 2XO7A 4IRCA 2WLFA 2ERRA 3GMGA 3M2RB 4CLFA 4ZPVR 1VQSA 3CCUS 4YMEA 1HNVA 4LRFA 2QG9B 5THWA 3THPA 4M5HA 1F9EB 2ZFHA 3DRPA 4EO6A 1NHUA 2EFGA 4OX8A 3TISA 3CDBA 2CPXA 2J7UA 2DPIA 2HBYB 2MKYA 1C1BB 3NLCA 3PRDA 3PFEA 4QIVA 1KQGB 2C2DA 4A8KA 2OUGA 5CCLA 3CNQP 1U45A 1UEVA 2EKYA 2XMMA 4N56A 3E2IA 3OTOJ 4QBUA 3M9NB 1C0UB 3W64A 4KTQA 1RBAA 1UVGA 2VC0A 5GVQA 2ZBPA 4PPZA 3GIMA 8ATCB 3Q8VA 4X4VA 1U6FA 1SC6A 1NU4A 1Z4UA 2BANA 3CPWR 2WRMA 3Q8YA 3QGIA 3K7RA 2QQ0A 2K06A 3JB9k 3J80U 1TUSA 3CXLA 4LF8F 4J9UE 3OU9A 3OXFA 2EK1A 2H5JB 5D4OA 3M8PA 4CRJA 4NI2B 1X5TA 3ETOA 3VNPA 1HI8A 5E3QA 2UZAA 4C4WA 3CUNA 2DK2A 2VG5B 2N71A 3H25A 3T6BA 4B3TF 5E3PA 3A3NB 2B0UC 5F8JA 3J7A1 4NLVA 2ZBCA 2DGVA 2OPRB 5IT9U 1RT2B 1S5ZA 4P71A 3M6XA 4N41A 3VGSA 2W7OA 3U27A 1J5OB 4O3RA 3ULHA 3W66A 1EB0A 3VHQA 1N0UA 2F7VA 2P6SA 3W62A 1JLFA 3TK8A 3JTPA 4M9CA 3K89A 4F2SA 1NJYA 5DAEA 1C0TA 1V6HA 2SGFI 1S1UA 1JLEA 1U1MA 1KLMB 2G13A 1EWWA 3RBXA 3AOAA 2G2YA 4LREA 4QYZJ 1T11A 2EBEA 1GQEA 5M2RA 3BJYA 2AJ1A 2X3TA 3CSKA 4EMDA 2OP5A 3Q8RB 4OVOA 3KUGA 4OMFG 1T8EA 1WKLA 2HGNA 2BW2A 2GW8A 2PDAA 3GFYA 1Y5IB 3V4IB 2WVFA 2D9PA 3ILLA 3UDEA 1WORA 2V2VA 5L1IA 2YQ1A 2QIVX 2KMRA 2CNLB 3NWGA 4DSKA 1XMBA 1RT1B 5A6WA 2HEKA 3BBFA 4K4ZA 3VDUA 1HBNB 2CPDA 4K4UA 2CQ1A 2MY7A 5DDPC 2CXEA 1XR7A 4DU7A 2UUBF 2B8PA 4IO1A 4RW6B 4WE1A 3CJRA 4DL0C 4P7VA 1HNZJ 3DMJA 1NHVA 4WIIA 5E3AA 4KGZB 5D0RA 4GC6A 2AYMA 4LF8J 4ED5A 4PXCA 1VK8A 2XEXA 2LB7A 1TZ0A 3HI9A 4ZVHA 3UN3A 4O4GB 2ICYA 1HMVB 4NZ7A 1KS2A 4FCEA 2B51A 4B3TJ 1EKRA 3FMWA 4CNYA 1BQNA 5KFQA 2OD6A 2D9OA 1MROB 3CCRS 5HI7A 2U1AA 3EZOA 1UPMB 3GFXA 2BKNA 3PX0A 4DHVA 5LL6d 5E3CA 3ZZ0A 3NP5A 2LQJA 4AE5A 3OJUA 5GMEA 1CQMA 1RU2A 5ETLA 2W1BA 2CWGA 3HHLB 2JEIA 4AMLA 3MR5A 4Y2MA 4F4AA 3CO0P 1L0SA 4ISXA 4MK8A 5H9FK 1N36F 2UZ3A 3TRGA 1NEEA 2E1AA 3AB4B 3ZTPA 3MMBA 4FVCA 4DV7F 4B02A 5K14B 3D2WA 3QNWB 4CO2A 3CD5A 4PYDA 3TZZA 4FN5A 5KG6A 4HDGA 5LSRA 1I3OB 2FDNA 3RB0A 3UR0A 2ASDA 3I5BA 2BOPA 2ZJRQ 2OPSA 3P49B 3M8QB 3CC2S 4FF3A 2R7OA 3MM8B 4ZVFA 3E8OA 3K5MA 4IOAQ 1RTHA 3NAIA 1Z2FA 2PSZA 1PCAA 4YB5A 5JVHQ 1SGPI 4IDKA 3MPYA 1KVJA 2X52A 1JLCA 1PILA 4JI0F 4PKDB 3K59A 1ELOA 3Q8QB 3SI8A 1SC1B 4G87A 1T03B 3IO1A 4IYQA 4ECSA 1Y4ZB 5A0YA 3TR5A 5LMUJ 3PZPA 4F0KA 5L38A 1UA0A 4WWSA 2IAJB 1TK5A 1UVLA 2HBZB 3AA9A 5C7PA 3KLFB 2GQQA 5IWAJ 4OYPA 5DZ6A 1F9HA 1RT6B 4OYMA 1V67A 3DDNA 1SH3A 2CG4A 2WAQD 1T9XA 1Y1CA 4YR2A 3W7BA 4ENOA 2FVPA 4FF1A 1AB8A 2V4RA 2MHNA 2XGQA 2HS4A 2QC3A 3HHNB 5DDRC 2N17A 3DLKB 5DJBA 4Z37A 2XHWA 4JV0A 4Q5VA 5CAAA 1X9SA 1VQMS 1NKCA 3GFZA 2AQ9A 4EABA 2IM0A 1OMUA 3D1OA 1SSQA 1FD2A 2D41A 3VTIA 3QAUA 2NXCA 3DGPA 3VGVA 4PWDA 4KGXB 3KJVB 4W4MA 3MM9A 2HVIA 3UR3C 2XYPB 2GX8A 2G0IA 1FD8A 2DY1A 4CLSA 2X3GA 4JB8B 4FXVA 3WX8A 5L1LA 3ONQA 4Y34A 1JJ2R 3VVTA 1TUGB 3QZ7A 1GTHA 2RMLA 2R8HA 5EUHA 2AJFE 5D3GA 2DNPA 2GV1A 2LXUA 2Y0MA 1PJ5A 2VKRA 4DR7F 2R7WA 1FKPB 2KI2A 3S1TA 3KWCA 5KG7A 3MZIA 3W5ZA 2RSQA 1JLGB 1WACA 2WB1D 2VD3A 2JEJA 3V6JA 4JI0J 1DARA 2BX6A 3BO4A 2DHXA 4DF4A 2ZH6A 3PIPQ 1X5PA 2ROEA 3I5CA 3RB4A 4XPEA 3O1LA 1DJ0A 3SGQI 2C2NA 2B56A 2FJAB 4J9SA 2V0HA 2B4OA 1LWEB 1WF2A 4ECXA 5J2QB 2J9CA 3TOBA 5I3PA 2BRLA 2QL9B 1RWNB 3VBJA 2CA9A 2DNGA 1CT4I 1FNOA 2XSJA 4U67Q 2MJUA 2QQCA 3NKYA 4FXWA 4W90B 2VHGA 2R42A 4L76A 2C3YA 4YHHJ 1NDPA 4ZP9A 3MM7A 1HA1A 3LTOA 5DS7A 3R5AA 5I4MA 4N47A 4C3LA 4UTGA 4DFJA 2MQNA 1LXNA 2CJKA 2OLWA 4RR5A 3P4UB 1JLAA 2DKVA 2LYVA 3MWBA 3DXSX 2ZH1A 4C3MA 3NCQA 1XATA 1SL1A 1Q7YT 5LOQA 2GIFA 1Z2IA 5K8PA 2CIMA 2YNGB 4FPIA 3Q8PB 2DCLA 4KR0B 3ZZOA 2E7WA 2VA2A 2A0FB 2D1CA 1X4EA 2H65B 3ZO7A 3SDEB 5HL7Q 2BA9A 1MMNA 4PRFA 2F8EX 3VBLA 7FD1A 1ZM2A 4OYZA 3IS9A 2HHXA 4DR7J 5T7LA 5KFEA 2J6TA 3C3LA 3I4PA 4LF5F 2Y8WA 1REGX 1B7FA 5SUHA 2CQCA 1CJKA 4R37A 3L09A 5F0WA 1CVJA 4RLEA 3OUYB 4L3NA 2DGSA 1R0BG 4MK7A 1M0SA 5K8NA 4IHHA 2J0SD 1YP2A 4OJHA 3FEYB 2GNKA 2GVDB 4NL5A 4NCAA 1E6YA 2FC8A 5ETVA 5A8KA 2B4PA 1T9UA 1X0FA 1S72S 2CDRB 3FZBA 3BM7A 1QRGA 1S80A 1Y7PA 2B8QA 2LEOA 5HBMA 3MGJA 4ANDA 1H7XA 4C8NA 3KJNB 3PJWA 1I1GA 5IM0A 1AFIA 2DXFA 3PXGa 2P9GA 3A13A 1TL3B 3OPKA 4YUDA 4I69A 3RBDA 1SJFA 4DL3A 1S0NA 1CJVB 3QQCD 3UNYA 3KHGA 3DOKA 1QQ0A 2LQ8A 4X4QA 2C2KB 1FFSB 2ZH5A 3T1YF 1PC5A 2CNKB 4HGUA 4P2MA 2M2BA 3H7HB 1U1PA 2HLUA 1NUBA 4ZVRB 2A20A 2J0WA 3KK1B 1HPZA 3KK2B 1WC4A 3PY8A 2YNIB 1O6XA 4HHUA 4FVMA 4TN2A 1IM4A 3MOZA 1EJ7L 1UVKA 2ROGA 2ZDPA 5KFGA 2CAJA 3B4DA 2DO0A 4NXNJ 1TP7A 3TJ9A 1FJCA 2HAFA 1YITS 2AYGA 3A8JA 4F36A 1LW2A 4NEZA 4MYUA 4OI6A 3G8SA 2ZC4A 3T19A 2FJEB 4LF5J 3R2CJ 3H40A 2W0VA 3EX7B 5I42A 4DS5A 5CD4A 4CLYA 2M0GB 4P72A 3PRBA 5AFUV 1XNQF 4ILRA 1PYTA 4YDDB 1P9GA 1XBWA 3R5BA 3R5GA 2DBBA 1RTIA 2LEPA 3GCXP 4OYOA 1FKOA 2HAIA 5J2NA 1S1XA 4YR3A 1FWPA 2IC3A 4HT7A 2XLKA 4IG3A 2R2RA 4FBTA 4K5SA 3IXQA 3MECA 2HRTA 1WG1A 1LKZA 3LP0A 4H4MA 2A2CA 1LOUA 2ZEJA 2FQQB 3CJSA 3HF5A 3I56S 5FDLB 2Y1JA 5A8RB 1JK9B 3SXLA 3IBWA 3OV7A 3C46A 2RS2A 3GP9A 1TDTA 1OYDA 4LVOP 2DJWA 3JQKA 3T1YJ 1S6PB 4A48A 2F9JA 4MZUA 1S1WB 3ET6A 2K7JA 4C0OC 2V5HG 4KV8A 2BQRA 3HSGA 1IVZA 1FX4A 1RT5B 1VR6A 4QWBA 4ZITA 3CD7A 2VHEA 5FUVA 3OFEA 4F4YA 5DQHA 1VRTB 3CCLS 4LVNP 1V9OA 1H7WA 2P8IA 4QR2A 4ECUA 2DPJA 1GH8A 3MPDA 2ACMA 1NJZA 1C2PA 1DAXA 4IKAA 4DFMA 2PE8A 5D4PA 4QIEA 2AF6A 4R5PB 5L6VA 4DR2F 2WK4A 5C2GA 2ZH7A 1RKJA 3B8HA 2M9KA 4B3SF 4J9PA 1K0TA 4EYHB 1XNQJ 5IXUA 1YJWS 2OMOA 5D77A 4N69A 3KYLA 1F5BA 1MT1A 1N88A 4AL6A 4KO0B 4WKRA 4NRTA 2ALZA 1VBZA 5U2KA 4A47A 1VQOS 1X9MA 1THJA 2DIVA 3PTWA 4X62F 4RUAA 3OL8A 4LBHA 2UU9F 4UW2A 3B4VC 1HM9A 4R36A 3M6WA 1QAYA 2V4JB 1OY9A 1S1TB 1YIJS 3FBFA 2CPYA 2GGOA 3ICLA 2MHEA 2BUNA 4DNCA 2P2OA 1N4LA 3DI6B 3DLHA 4HKQA 2SXLA 4U7CA 4R0EA 1TV6A 2HHHJ 2PGCA 3SZ2A 3ZNUA 1C1CB 3L7OA 3EZUA 5HSPA 4OZ5A 2YY3A 2XATA 5E5NA 4KJIA 5JXSA 3FSCA 1FYBA 1MWZA 4Y2KA 1NPRA 4NE9C 4RUBA 3OL6A 4WYWA 1FCAA 3R5DA 3J81U 5D8HB 4L75A 2Z2YB 2OI7A 2H3EB 4HH1A 3MR6A 3WBZA 4WP3A 2ZJQQ 5CXTA 1M8CA 4E0DA 3CJKB 3I0SA 1HWUA 3OTMA 5HAOA 4DSLA 3TV0A 4FXDA 4DWIA 2DT9A 3HZGA 4RPFA 4QW9A 5IQ6A 3R3RA 1AXQA 3CJTA 3D3CJ 3J7YU 2ZVIA 3FK4A 1FRXA 3KMSA 2IBKA 2QA4G 4LSLA 3FS8A 1NSAA 4DR2J 2BUSA 1WC3A 2QE5A 1T95A 3FCWA 4FKYA 1UVNA 1RT4B 5FLXY 1YBAA 4B3SJ 5L46A 5D6GA 4DL7A 4NASA 2RQCA 3O5TB 4PXBA 2RT3A 3VGUA 3MURP 1B4SA 3ISZA 2MLZA 4DV5F 3X1LB 1B3TA 3HDSA 2KYZA 4LRBA 1X5SA 2EBGA 4DPTA 3G9CA 3UD4P 1Y10A 2J76E 5HN0A 3M7VA 3HO1A 1TL4A 2QMWA 1FRIA 2JLFA 1NZAA 4N76A 4DX5A 5CH7B 3V5RA 3BZQA 5FIIA 1ZAXA 5KFRA 5HLFA 3C15A 3OQ2A 1RWXB 1HBMB 3HHDA 4WU2A 2W7PA 1DFDA 4PCQA 3P8BB 3P96A 1RSCA 4IRDA 4LR9A 2VICA 3HSJA 4O3PA 1UMJA 1W4RA 2IM2A 3J7YI 3FSBA 1M5PC 3TWDA 1RHJB 3QIDA 2EC0A 1TGSI 3F0NA 2VBZA 1CS4B 2XZDB 3MTKA 4DR3F 1X4DA 3QO9B 2VU5A 5FD1A 1LXJA 1M5SA 3QRQA 1V3SA 3M2RA 1WNEA 1QM9A 2L9DA 3VE5A 3VCDA 1I51B 3OTZA 3EICA 1BMOA 3P5BP 1K7TA 1KD1T 3LGHA 3MMAB 2AJ0A 4J7CA 2IUAA 1JJHA 2CYYA 1RKIA 1C1BA 1G7CB 2GIQA 3BGRB 3OH3A 2QRRA 3MEDB 3FBEA 2MQ8A 1RYRA 4UUXA 2BZ2A 3BYRA 5GAEU 2PD1A 2BMBA 1MR9A 1RLDA 2QLBB 3NBPB 2V2QA 1C0UA 2LEBA 2ACYA 1HQ2A 3EDRB 1WWHA 1HQUB 4G1QB 1WKXA 4NOHA
chains in the Genus database with same CATH topology
2DR9A 2WLEA 3DXBA 2KJVA 2XMVA 4CZCA 5F3ZA 5CZXA 3AA8A 1PO6A 5H9EJ 4Q7AA 3MM6A 4PXDA 5F8IA 3PO4A 1CLFA 3PHEA 2KG1A 3DRRA 3I5AA 3CCES 1B64A 4F4ZA 2XS5A 4RW9B 2CPFA 2M7SA 3ZZTA 1E6VA 1L3VA 1FRKA 2BVZA 2CQDA 3RU0A 3DOLB 3H2LA 4LIWA 2MXYA 5SZTA 1MU2A 2LLZA 1QUPA 4OI3A 4LFCF 4FF4A 3WC0A 5CYQA 3BN4A 3I96A 1Q1KA 5MLCV 3M8RA 4OHZA 1ZM4A 2DO4A 4LSNA 5L8RC 2ZOGA 1KQFB 4A46A 5B09A 5IT4A 2HMIB 2XY7A 4HI1A 3BDPA 1N33F 2LVWA 2RD5C 4K4XA 4EWTA 4AL7A 2VG5A 5C24A 1IN0A 4GO5X 2ZKUA 3AH6A 5HQ8A 1K0VA 1XK8A 4JOUA 5MAOA 4AC3A 2VG7A 3MUVP 3DRXA 4J9OA 5DG9A 2FC9A 4RW7A 4JI3F 4UY85 1JMTA 3BGLA 3FGVA 2YNHA 2KB2A 2OPRA 3DLJA 1RT3A 4C9DA 1RT2A 3KLEA 1U25A 2XLIA 4MTPA 1FERA 1WD6A 2CZVC 1N56A 1WG4A 1J5OA 2GHPA 2LDYA 4PXEA 2XMUA 2AJQA 4PG5A 3VAJA 2UV8G 5AE3A 3SRTA 2VPZB 3FQKA 3KG0A 4EEYA 2D3OR 1IKYB 4QZVB 4F25A 4QU7A 1HFEL 2WSFC 1HI0P 3HSQA 2F40A 3LP1A 2QKXA 1Y5LB 2QSFA 4ELVA 5CCMA 2KVIA 3ENQA 3M9MB 1M90T 3SQGA 2E9TA 1FJ7A 4C8MA 1QLNA 1KTQA 4GKKF 4AL5A 2BRKA 4O0IA 4ED7A 4RBTA 4WYLA 3KWDA 2CQ3A 4NLPA 4MKBA 4CO3A 1S6QB 1QVGR 3BF4A 5GAEI 1N5YB 1IQTA 2YWFA 4D3GA 3G96A 2JC1A 3BSOA 3FFIA 5D78A 3GV5B 5J1PA 1D9DA 2LA6A 2M88A 4K4YA 2VFRA 5F8LA 2KN4A 4CT8A 1PC4A 2DGUA 2K3KA 1KLMA 3N28A 3T1AA 4WZQA 3BSAA 4KHRA 1UFLA 3O6QA 4NLRA 1VIXA 4RX6A 1KRRA 1HBOB 2NREA 3V81B 4JI1F 2V0JA 4ELTA 4LF9F 1O8BA 1RK8A 1T3DA 2WONA 2IVMA 1TV6B 2CZ4A 3O8WA 3OLBA 1WF1A 3I87A 1APSA 2KKHA 3CJ2A 3US5A 1ZPVA 2DVIA 4GMKA 3T5HA 2MQLA 2C22A 2MB0B 2W7AA 3T5KA 3CGIA 4AXIA 1YJ9S 3I82A 3FEXB 2J7WA 4H4KA 4LT6A 2HQ3A 1R3NA 1XN9A 4ATNA 2MQPA 3CWJA 2A3JA 5F8HA 1VC0A 4C8LA 1GX6A 3UCUP 1SL0A 1CG2A 4A8OA 5L6SA 1TKTB 2E5GA 2KT5A 5EX0A 3LF0A 3QIPB 1HQEA 3D1HA 3MC4A 1QSSA 3E2EA 2RKIA 3OFHA 2MKIA 2FHKA 4WF9Q 3IC1A 4URSA 3EPIA 1MNEA 1RT7B 2ZD1A 2YTCA 3V4IA 3BSWA 4XPCA 3OLAA 2KYXA 1QUVA 2IA6A 4QYRA 4J09A 3TVZA 2HS3A 3MAHA 2A10A 2XWXA 2HNYB 2LQBA 4CI0B 4H54A 1KEKA 5ADXU 2HHHF 1X8DA 1X4BA 2K8GA 2DGOA 2XCPA 2XI3A 4NMLA 4IG0A 1AUDA 4OJ3A 3BS9A 4ZA1A 1FE4A 5I3QA 4RUCA 1GXUA 4DOZA 2MZRA 4JI7F 2ZH9A 5C25A 2G9OA 4M99A 4FF2A 2CRLA 4P7TA 3TAMB 3DHXA 1SJ4P 4O23A 1OQ6A 3QGGA 4ZPTR 2GC8A 3SFUA 2UP1A 4Y6IA 1HBNA 2CQPA 1HI1A 4C8ZA 3SYZA 1TQLA 3MPWA 4RNMA 2F9DA 4NLGA 2MZQA 4I2QA 3C66A 3OTOF 2MKJA 3MMCB 5C42B 2JF2A 3V2UC 2GMHA 2R2TA 1FTCA 2RDJA 5JVGQ 2DH9A 3R3IA 3AJ1A 4C11B 5KFMA 1SSMA 1URNA 4KKOA 4MKAA 3ISNC 3T9NA 4RW6A 3AAWB 2EPIA 1Q8IA 2GFFA 3KLHB 3GZ7A 1UW4A 4NLXA 4I1TA 4ZHRA 5BR8F 3LP2A 2UUTA 3LGNA 4OHXA 3TDTA 1AROP 2GJ2A 1SV5A 4DR6F 3HKZD 1JLQB 3RRHA 3UD3P 3K8WA 4ED2A 4CO0A 1YQHA 1U1LA 3J81Y 2DITA 2LKZA 1R43A 3THVA 1SSTA 1TL3A 5E2QA 2AU0A 4QJVA 3OR1A 3QYYA 2PC6A 1TKXB 4ZP8A 3HVWA 3ECTA 2KH9A 1DURA 2MKKA 1X5OA 5EHHA 3MUTP 2AYEA 4ZK7M 1OPZA 2HNDB 1S10A 3C8YA 3JSRA 1SJ3P 4O4GA 3KG4A 3DJ4A 5KOXA 5F41A 2RQMA 2V8DA 2ZM6F 3VAGA 3MM5B 1CSJA 1VQ8S 4DSJA 2DHSA 1SJQA 3S01A 3CE8A 1G97A 4TY9A 1HMVA 4YDXA 4CH0S 1HYSB 1NKEA 4QPXA 2Y1IA 4I67A 1EETA 1LWCB 2WBRA 1LQ9A 5DRKA 4QW8A 5IQQA 1NK8A 5GADU 4V19J 4DMZA 3IS9B 4G1PA 4PG6A 1JLBB 4I7FB 2BACA 2FD2A 2OPPA 3RRKA 3PDNA 4LFAF 5EGYA 1FK9B 1GX5A 2OH2A 2RU9A 3KKFA 4YOEA 2HWTA 4KB7A 4USIA 5GMKa 1MROA 5T7LB 2K2PA 2FJVA 3J7Z5 3RAQA 3NGKA 3TIOA 3MEKA 4NPOA 3CIMA 2W24A 1VJWA 2NYIA 1R8PA 3CD0A 4KRWA 4C0BA 2E5JA 2QIFA 3E3XA 3C6UB 5B0BA 4X4PA 4ITSA 5KT7A 2OTLS 2ZZMA 4E6UA 5GAGU 1TVRA 3R1LA 4JI6F 2ZKTA 3R1HA 2RQ4A 1YRXA 3M2VB 2OAUA 5I3UA 3I31A 3BGFA 4CQ1A 3OSPA 5DQIA 5J2MB 1MR7A 2OI6A 1OS5A 3IR7B 2RRNA 2BDPA 1REVB 2BR0A 4LUBA 3QMQA 2R8KA 3HHLA 2APOA 3MD1A 2A18A 3GOSA 5HMXA 3GILA 2RIJA 4B17A 4DFKA 3LANA 2W9CA 3GE9A 2J9EA 3BREA 1S79A 1TAQA 3V6DB 1S9FA 1FTRA 1GXLA 4USHA 1O0PA 4A4JA 2VH7A 4H4KC 4WFBQ 3GSDA 4MFBB 4DL6A 4EO8A 5HROA 1PGZA 1L3UA 3FNNA 1NK5A 2QSWA 3LW5C 1SBRA 3IAM9 2M8DB 2JSXA 2V0NA 4QIWD 1IKVA 3VQSA 5G0RA 3CC7S 4B3OA 3NNCA 2PA3A 1DLOA 1OCXA 2OEFA 2CQ0A 2RRBA 4EGGA 1HHSA 1C4CA 3RRGA 3Q0AA 4EZ9A 5A8KB 2FLLA 2J0QD 2GGPB 2JEFA 4WU3A 2P5VA 4EQYA 4Q2MA 1B0PA 4ECQA 1HV9A 3FMBA 2XO7A 4HL9A 4IRCA 2RNEA <