5E3RA

Crystal strcuture of dapd in complex with 2-aminopimelate from corynebacterium glutamicum
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
277
Chain Sequence
b'TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 86
structure length 277
sequence length 285
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3rA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3rA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3rA01
1YP2A 3BSSA 4AA7A 3VBLA 5AFUU 4ISXA 2W0WA 2XATA 3GVDA 2WLCA 4N6BA 3VBJA 3VNPA 3D98A 2RIJA 3R5CA 3FWWA 2OI7A 4G3SA 3TISA 2W0VA 1QRGA 1KGQA 2IU8A 4KQLA 3JQYA 3F1XA 3Q1XA 3DHOA 3FSYA 4KPXA 2QIVX 1FXJA 3R2WA 4EA8A 3HJJA 3V4EA 1QRLA 2GGOA 2V0IA 1KQAA 2I5KA 3TWDA 3VBNA 2Q4JA 4IHGA 4G3PA 3FOQA 4HURA 4MFGA 4R7PA 4IHHA 4G87A 1SSTA 4HZCA 3BRKX 2P2OA 3KWDA 1KRUA 3OTMA 4M2BA 3R3IA 4EGGA 2WLDA 4EA7A 1HM9A 3BXYA 4FCEA 4HCQA 4KPZA 4MZUA 1G97A 5E3RA 5DG3A 5L6VA 1V3WA 3OW5A 1MRLA 4E79A 3D8VA 4G3QA 4KNRA 1YP3A 4E6TA 3TV0A 1THJA 2ICYA 3R3RA 1G95A 1KRRA 4AC3A 2JF2A 3BSWA 1Z90A 4DCLA 1MR9A 1J2ZA 2TDTA 3EG4A 3P47A 1QREA 3CJ8A 3EH0A 1KHRA 3R0SA 2WLGA 3VBPA 3R1WA 3R8YA 3TK8A 3FTTA 1XHDA 1LXAA 2OEGA 3I3AA 4R37A 4HUSA 1KK4A 1KGTA 1HM0A 4N6AA 2VD4A 2V0JA 4AAWA 3P1BA 1QRMA 3OUPA 2FKOA 1YP4A 3MQHA 2QIAA 3DK5A 3TDTA 4EA9A 1HM8A 4IHFA 4M99A 4N27A 4HZDA 1QRFA 3FSCA 4M28A 1XATA 3VBIA 3VBKA 3DJ4A 2OI5A 1T3DA 3OU9A 1SSQA 2JF3A 2WLEA 1SSMA 3HSQA 3PMOA 3C8VA 4M98A 1KK5A 3T57A 3FSXA 3FSBA 3GUEA 1OCXA 5AFUV 1V67A 3NZ2A 1S80A 3BFPA 1KK6A 1QQ0A 2V0HA 1FWYA 4R36A 1TDTA 2QKXA 4KNXA 4EABA 4E75A 2OI6A 2NPOA 2IU9A 2V0KA 3MC4A 2VHEA 3OTZA 3BSYA 3ST8A 3R5DA 5L6SA 1HV9A 2IUAA 5DEMA 4M9CA 3IXCA 3VBMA 3SRTA 3ECTA 4E6UA 2GGQA 2IC7A 4E1KA 4J09A 3MQGA 2OEFA 4H7OA 2WLFA 4K6RA 2ICXA 3KWEA 5E3PA 4EQYA 5DEPA 4N69A 5ADXV 3R5AA 5F42A 1MR7A 4EAAA 3KWCA 3SPTA 2V0LA 4J18A 3I3XA 3EEVA 3IGJA 3R5BA 3FS8A 4MYOA 3TIOA 5E3QA 4M2AA 3GOSA 5U2KA 2AQ9A 1KRVA 5ADXU
chains in the Genus database with same CATH superfamily
4DQIA 4P73A 4RW9B 2IA6A 5AFUU 2KXHA 1QE1A 1CS4B 2GJFA 4DNCA 2F8EX 3D4JA 3BM7A 3CC4S 4RUBA 3QO9A 1VOMA 3GV5B 4NLVA 1RT2A 2WSFC 3BGLA 4WFAQ 1J5OB 2BUNA 2ZBRA 1N36F 1GMVA 5HROB 4M2BA 4LBPA 2GW8A 2B4PA 3HFVA 1SC4B 3CIMA 4ZVOB 3OJSA 2C3UA 3D0HE 1TL3A 2W01A 2CQIA 1HWIA 3G96A 3W5YA 2RDDA 1J2ZA 2YNIA 1N48A 3CJ3A 4KV8B 2HQDA 1VMBA 1TTHB 4RW4B 2H5JB 4N47A 1JLGA 2QQDA 4F50A 2NU3I 1SGRI 5I3UB 3CGIA 4DV0J 1CVJA 3FRYA 2H5IB 5HJYA 3VR1A 1SGQI 2DR8A 3TQEA 2Q66A 1TBQR 1ZM2A 4OYOA 1HFEL 3PHEA 1G3OA 3WX8A 1IJEB 1TMMA 1DARA 3OL7A 3HZGA 2UU9F 1KRVA 1YP2A 2J8SA 1N36J 3UWTA 4WXOA 4ED8A 1VGYA 1VBZA 3GU0A 4YS2A 2OU2A 4K4ZA 4J9UE 1VIXA 2IIHA 1HR0F 1FDAA 1R8HA 2XGQA 2ZHAA 2K8GA 4I56A 3Q86A 5KFDA 2DVIA 2YVSA 1HNVB 2DEJA 3PW0A 3JQMA 3UW1A 2HWTA 1UUCA 3I82A 1RHUB 2GO8A 4DV2J 3J7YU 2VA2A 4RNHA 4DN0A 4BC9A 1JLQA 4A8OA 1N88A 3K5PA 1X4CA 1YSJA 2XWYA 4HTJA 3IO1A 4G3IA 1HPZA 2V69A 4NLXA 2E7VA 1P1LA 3MMJA 3LF0A 4LSLA 3SQGA 4IQXA 4K4XA 3C6TB 3KLGA 4U8VA 2XLIA 2QO3A 2XMTA 4DZ6A 5CCLA 2R7WA 2VFRA 3QFHA 2D3O1 2DGXA 1NH7A 1CEZA 5F42A 5KFPA 1IM6A 2ALZA 1F2GA 2NLWA 2ZH2A 2V4JA 1TKTB 1Z2FA 2FGCA 2LUYA 1IKXA 1B64A 1ZYQA 2XM3A 4ZPWR 2MHEA 4ANEA 4UQGA 4NYOA 1YRUA 1F5AA 1ZAVA 3MUMP 2ZH3A 4XDDA 2GJIA 4JI2F 3SIPB 4LBHA 1OSDA 2MKIA 2HWHA 3DFEA 5DO2A 1KTQA 3BSNA 1MJAA 2XZWA 1RABB 3H4DA 1AXQA 3N28A 3I3AA 1TAQA 4O0NA 2MKSA 2C42A 2ZH8A 5DS7A 2C2OB 2HGMA 1N54B 3WDOA 2MEWA 2ZH6A 3S7RA 1DQAA 3PDNA 5DG7A 2KYZA 3BB5A 1Q7LB 4PQAA 4CZCA 3QGGA 3ECTA 5ETSA 4O44A 3TR5A 1A9NB 5U47A 1CT0I 4NLOA 1S4EA 5KFRA 2W9BB 1BQXA 3NKYA 4LR9A 1PAUB 1PBAA 3BGRB 1R0AB 3Q8QB 1T9TA 2B4UA 1PJ7A 2EC0A 3CCJS 2FLLA 4JI2J 4DFMA 1R8BA 2C28A 5HK4A 5KT3A 2MQLA 2W2MP 1IW4A 1HDLA 3HH2C 3M6XA 1VQNS 1SH3A 2DNKA 3TEGA 4PWUA 2G13A 3IR6B 1SJ4P 3V4EA 2X7IA 3RR7A 5J2PA 3QIDA 5KT6A 2AF6A 3PEJA 4I68A 2VQFF 2FVPA 1FRHA 3GQAA 1N5TA 1SGYI 4WP4A 3CD7A 3UE2A 2Z56B 3TO8A 1HARA 3KK2A 3M1VB 3IG1A 2D9PA 3WQPA 1PIEA 2HQIA 5J1PA 2LEOA 3T1HF 5KFJA 5J1NA 2AYMA 4M98A 2YNHA 1RT4B 2NU1I 1YHQS 4QIFA 1OJ4A 2HFOA 3MEEB 5EX0A 5L6SA 2HMIA 3CO9A 2IJRA 3R97A 4WFNQ 1VQ4S 4CI0B 4SGBI 3QAEA 4J09A 4DF8A 1SUQA 1NNDA 3CE8A 5RUBA 4L76A 4YHHJ 3GOSA 3VVUA 4EZ6A 1VBKA 4JI8J 3GIJA 5B0CA 1WC1A 1NDKA 4DPYA 3UGLA 2YH1A 1M5KC 2OEMA 2B0UC 2JW6A 1DTQA 3D9BA 1CC8A 1U49A 2J9CA 2B0GA 2WAQD 1UTAA 3RGIA 1EQMA 3C16A 4FXVA 2YNFB 1RWVB 3MF5A 3BKTA 4RW6B 1VCTA 3BJYA 1GEHA 4ZPDA 3T1HJ 1WTFA 3GWCA 3HSDA 4DV4F 1NPRA 3RAQA 2UVWA 3KJQB 2IJNA 2IVMA 5KFUA 3N9UC 1ZZFA 2KZZA 2R7TA 5K14B 3EM1A 4GO5X 1S7HA 4M99A 3PIPQ 2XYPB 4Q8FA 4ZLLA 2K7JA 1NK7A 3RJMB 4ANDA 1Q1KA 2F40A 4KRWA 4PQUB 4EO6A 3TUPA 3E2IA 2JL9A 3OW2R 5EN1A 5ETQA 2WLFA 1CQMA 1RLDA 2D74B 3C14A 4V19J 3TVKA 2JDJA 4EBCA 4CLKA 4TKTA 3M8QA 2O66A 1SH0A 2HURA 1RAEB 2XNQA 1UPMB 4O3NA 3FQKA 1Y1BA 4FF4A 3HJJA 2ASYA 5KOXA 3I9V9 3KG1A 4URGA 3E01B 4B3RF 5J2NA 4ID8A 4USKA 2Z8QA 2F63A 2NXCA 2DO0A 4HCQA 1H72C 1TK0A 5IZHA 3NMAA 2J7KA 5ETNA 4C48A 2FLNA 4AC3A 2ZBCA 2RU3A 3S01A 3N79A 2EFVA 1IR1A 2IVFB 1JLBB 5E7OB 2AGOA 3O6QA 4TY9A 4NMLA 4ZPTR 2V94A 5B0DA 2WLEA 1QE1B 1OPZA 4V19X 1F2HA 2CQ0A 4X4OA 4OLOA 4DV5F 1S97A 4F02A 3QO9B 3DOKA 2K7KA 4H4MA 1KFSA 1IWAA 4FVCA 2LKZA 4DR6F 1LWEB 1AT1B 2H65B 3IWNC 4MIWA 4NWBA 1JLFA 3IS9A 4JV1A 3JSRA 4ZP6A 1PO6A 3ZZYA 2KMQA 1RT3A 2FQQB 4YR3A 5D4PA 4WU2A 1UZDA 2YNIB 4ED0A 4B3RJ 2PN6A 4F3OA 1S1XA 4DR5F 1JLGB 4CWBA 1KKHA 4QW8A 3JS9A 2Z2MA 2RH3A 2BE7D 3KG4A 2CKWA 3SCJE 4EBEA 5A6PA 5DDOC 2LQJA 2VA3A 1M8CA 4U7UK 3L95X 4OYXA 4O3RA 2ASLA 1UMJA 4OYAA 3OVSA 2ZH4A 4TLQA 2V8VA 2WW4A 2DNGA 4P10A 1TUWA 3MPUB 3HD1A 1KVKA 4UTGA 3BN7A 4N6AA 4DV5J 4CLWA 4JI6F 2XLKA 3I4HX 4X4VA 1ZTTA 1WDTA 4DX8H 5KFKA 2XTJP 1MWYA 4DR6J 3OLAA 2JF3A 1GFWB 2QFIA 2QA2A 1IBLF 4IR9A 1FWYA 1RTJB 2ZNZA 2EKYA 1MU2A 5HP1A 1AYEA 5D0GA 3VAMA 1NKCA 4Q5VA 1NLKL 3QYYA 4WP3A 3SRTA 1RT1A 1MMLA 4R0JA 4DR5J 4K4VA 3QT5A 1SCJB 2VPXB 2WOMB 4A8FA 2RS8A 4OYWA 3K0JA 2OFHX 2V2ZA 3D98A 2NREA 3BO4A 2WW8A 3MMBA 1DZ5A 2NSBA 2B8QA 1FNMA 4IRDA 4OYMA 2IMOA 4JI6J 2KL8A 4LSLB 2PC6A 1NXIA 2AX0A 2FNFX 4FN5A 3HVAA 3KLGB 2FC9A 3ICLA 2BW2A 3FC9A 2ZHOA 1S6UA 1PILA 2E44A 2RMLA 4AXJA 1VQKS 4AAWA 1UVNA 4NA1A 2Y3YA 1X5SA 1FEHA 2KTQA 2P9GA 3G6ES 2V4JB 3GTYX 4C8KA 2GCFA 2XB2D 1IKXB 4USMA 5GAEU 2L9NA 3UGDA 3L7OA 1V3RA 2ZWPA 4HHHA 4IYQA 3R5DA 2APOA 5KFLA 2GA7A 5HBMB 2RQMA 2J6UA 1UAWA 3M2UA 4RBUA 2ZDOA 3L7UA 3ZZTA 4IFYA 2X3TA 2CWKA 3NCPA 3V6HA 2HFZA 1EHWA 2VL1A 4Y3CA 1LXNA 2AQ9A 5KFXA 3K59A 3RRHA 1C4AA 4NCBA 2QL5B 4P75A 1Y8FA 4CT9A 2PI5A 2O01C 2KT2A 2IYGA 5C25A 1RFHA 1KD1T 4UT4A 4DL6A 3ET6A 2N3OA 4NOHA 5B08A 4D3GA 1ZA2B 3SI8A 4EO8A 2V1CA 4E79A 2Y9HA 2JC1A 1Z2LA 2VC1A 3M05A 3IXQA 4O44B 2WGCA 2DGQA 3NAHA 4UXJA 1LXAA 1QSLA 1SKWA 4NX9A 4A47A 1S9EA 2R8IA 3TAPA 1JQGA 4PXBA 7AT1B 4OX9F 3DRXA 2WZ1A 3LO3A 2CJ9A 3LAKA 3D2WA 1PKUA 2DTJA 4RZRA 2V0HA 4MFBA 2B56A 3DGVA 3CW2C 2YUUA 3ST8A 4E1RA 4IG3A 3QZ8A 2DR9A 1KBEA 3I31A 1V5VA 4JCVE 1WORA 4LUBA 3VAIA 3Q8VA 2W24A 5B0EA 1UCNA 3PTWA 5DG8A 1CGJI 2FZKB 3VTIA 2IDEA 1IY6A 2B7BB 4M5NA 2IAJA 4M5DB 1GT8A 1VQ8S 1U6ZA 2XSJA 2LDIA 3IG1B 1QAIA 5KFOA 4J9RA 4UXIA 1UW9A 4YFUA 2NZCA 1IKYA 2YNHB 3GSIA 4CH7A 2QYCA 3R7NB 1RWMB 2QFJA 1RT5B 2W4CA 4LF9F 4UOHA 1SH2A 1RTIA 2HMIB 4OX9J 4NLPA 1HHTP 1XJWB 3MPWA 2CQGA 2ZH5A 3CJ8A 5CD4A 1SL2A 4XPEA 4R8UA 2DH8A 1S20A 3I55S 4LR8A 5L9NA 1NCLA 3AJ1A 4USJC 4FP9A 2VJUA 1EIYB 3B4VC 4FZVA 2XC9A 2ENZA 2NPIA 3A8KA 3I87A 4ZN3A 3C16B 2VG6B 1SIZA 1VQ9S 2XBPA 4YMEA 5HVGA 5L1LA 2KXFA 3ZTQA 1P9ZA 3MEGB 3K8VA 4I1TA 1X9WA 3DOMA 2YX1A 4J18A 3FRZA 2D3OR 3A13A 3W60A 2BKNA 3G4SS 2CZ4A 1RACB 3PXGa 1XK8A 1IKWB 1Q9BA 1LWCA 3AA9A 1N5YB 4HDHA 1WKKA 2DKOB 2MQNA 3CCTA 3CPWR 4DFPA 3VBNA 4IHGA 4MTPA 4P2XA 2BJ9A 4IOAQ 1RQ0A 1TKXA 1HM9A 4ECXA 4MZUA 2U2FA 4FYWB 1GK8A 1JB0C 4CYUA 4CH0S 1FDNA 2RRAA 2C2EA 4C8ZA 2CJXB 4I6WA 3C14B 2DB6A 4JI3J 4YY3J 4DSEA 3M8QB 1Z2ZA 1N5VA 3D6MB 5FUVA 4WFXA 1L3KA 3E3XA 2M52A 3AD7C 4RJVA 1KONA 3T1AA 4MMOA 2VBXA 4K4SA 1WHXA 4G1IA 2R7RA 2WSEC 5F8JA 2OAUA 5HQMA 3ETOA 4RUAA 3Q8UA 2ZJQQ 2UUAJ 3WZ0A 4FVMA 4FNHA 4HH0A 5L46A 3PV8A 1CQNA 3D7SB 2IM2A 2OZUA 4A8QA 4FKYA 4ZKAA 2YBVA 4DU7A 1Y5NB 5E3QA 3TA2A 5E2QA 2OPRB 2WLCA 4C3LA 2VFSA 3QTLD 4DX7A 1D1UA 2LU1A 5GMEA 3NP5A 1L3UA 5CCMA 1FRMA 5G4DA 2KVIA 3CJTA 3F41A 3LP1A 1N34F 3KLHA 5L39A 1VQOS 4KFBB 2HBZB 1T05A 5KG1A 3GIRA 2HG4A 2CA9A 3JYTB 1CPZA 2PGCA 3PNIA 3GYXB 1WJ9A 3KJVA 4ED4A 2BOAA 2J9EA 1QREA 1B7FA 2R4FA 4DF4A 4F4WA 1M5PC 5HVHA 4RLEA 4OFZA 4Q43A 4OHYA 3C15B 2POKA 2HHHF 2FJBB 4LRBA 1RA7A 1P1TA 1SV5B 2A6OA 2MKYA 3N01A 2CJAA 2W2QP 3H4BA 1S1XB 2HHQA 1R79A 2PO4A 3BFPA 3CMQA 1FT8A 2BDPA 3MAHA 5HJXA 1V5IB 1M1GA 2J6SA 2GIFA 4JP8A 1ZM3A 4F4ZA 1EKSA 4ZITA 2ZOMA 3JQKA 1R8CA 2BE9B 1XC9A 3MHYA 4EAAA 1JX4A 1U25A 1Y00A 1B70B 3MURP 3GVDA 4DSIA 1FJEB 3GFYA 4X4RA 4NXMF 1X4EA 5MLCV 1SGEI 2YKNA 4DBQA 2CPDA 3ENAA 1UVKA 1TUGB 3T6BA 1U02A 2X1AA 3FNNA 2CDRB 4F25A 4TYAA 2AJQA 3VZIA 4QWEA 3AD8C 2BR0A 4ZVTB 3TJAA 1E6YA 2HHHJ 5HP1B 1HW8A 3GP9A 2A10A 2JF2A 5IQ6A 4J9OA 3CJSA 1KHRA 3R0SA 4DU8A 2FLOA 5L1JA 4X4PA 3BSOA 4ZOSA 2YNGB 2DH7A 1TL1A 2XGPA 3ZNUA 1HD0A 1FAQA 1BGXT 3DJ4A 4F04B 4P6QA 4CLSA 1SKRA 1SSMA 2VKZG 2X51A 4NLGA 1S80A 2BQRA 2LEBA 4E75A 4Q2LA 5HVFA 2DNNA 3PRDA 4OZLA 1RWXB 4OYZA 3JXOA 1S1VA 1Q81T 4IUFA 4NXMJ 4DXLA 2R7SA 4H54A 3H7HB 1TUVA 2CYYA 1HL6A 2FJEB 3RBDA 3Q8YA 2QMUB 1QTNB 1HW9A 1S59A 4B3MF 3FSYA 2C3YA 1IKVB 4ZJOA 4ZLNA 4N41A 3NXZA 3TOAA 1H7XA 1UETA 3O44A 3SFUA 3VDPA 3AOCA 1O8BA 1W7WA 2P5VA 5LMUJ 2YWWA 1LR9A 2M8DB 3I56S 5KAKA 4HDGA 3M2UB 1F6TA 4O4RA 1U2RA 2E9ZA 1XHDA 3RB3A 1Y9OA 2GIRA 2BANA 4KPYA 2R8JA 3UGIA 1ULNA 5CH7B 2CJYB 2HVDA 4O4GA 3I5CA 4WE1B 1T3DA 3HSQA 2UVOA 3SZ2A 3AHPA 1HI1A 3MC4A 4M5IA 3OTZA 1S57A 2HNYB 1S4FA 4EBDA 2ROWA 3QBCA 4PYDA 4CDIA 2ADCA 3HFKA 1M5OC 2NU0I 2EK6A 4B3MJ 4PR6A 4B9UA 1G4CA 4EYIB 1KLMA 4LF5F 2XWXA 3T9NA 3ZO7A 1F5BA 1V9OA 1S9EB 2LMIA 2CRLA 2H1YA 3D1HA 4LSZB 1DRZA 1MWZA 5ETLA 2HRUA 4WFZA 2J0SD 1RTHA 1PTRA 4DPTA 2E5IA 4KO0A 4IOCQ 2VDIA 2PD1A 4BCAA 3DU5A 1YJNS 2B43A 4N8OA 1N6QA 3J7AN 3R3RA 2BJ8A 5HO4A 1YJUA 1F9FA 4DS5A 1C0TA 2WLGA 4UOCA 4WBFA 4NMXA 5CAAA 5D0HA 3P8BB 3KHHA 2XSJB 3DXSX 3FDSA 1UHAA 3TEHB 2DNMA 3QATA 4ECVA 3C6UA 3K8WA 3TX0A 4QIWD 4JI4F 3MECB 3UVJA 1XMBA 2AZ1A 2JSXA 3G8QA 1IKYB 4LF5J 2IVYA 3S8SA 1LV5A 4NI2A 3AAWB 5A8WA 1T8EA 4KR0B 4RW8A 2F8MA 5I4MA 1EKRA 1G1XA 2YPYA 3JSMB 3I9ZA 2JEIA 4M5MA 5KG6A 3CCVS 2XATA 2WVBA 4R8UB 3VNPA 1VHFA 5FUWA 4NCGA 4RNNA 2GVDB 2GIQA 5BYQA 3QMQA 2XZTB 4JV5F 5HN0A 3LP2A 3O8WA 3VGTA 2VHGA 1KN6A 2W8LA 2VPZB 3CDUA 1YJ7A 2Y8WA 2FHMA 2RSQA 5I3PA 2A2DA 4B3OA 4WZMA 2C2ZB 3BXYA 3OV7A 2W8KA 1Y4ZB 1JNRB 4V1Ak 2QG9B 3DOMB 4C98A 4U67Q 4EMDA 4JI4J 1WTJA 5KG3A 1QAJA 2UV8A 1CJUA 2UXDF 3BF4A 1Q7YT 4M5KA 2VB6A 2Y1IA 4IR1A 3VCDA 2MKKA 1CHOI 3UN5A 3I5AA 3CT9A 3CCUS 2V50A 1S9FA 2GGQA 3RYLA 1OMTA 2UUBJ 3GJTB 1R6VA 1SB6A 5E3CA 4JV5J 2HNZB 4CYUB 1JIHA 2ZKTA 1UW4A 4RUCA 2W7OA 5ETRA 2L08A 4DR2F 1A0OB 2MKJA 1MJBA 1R3NA 4FPRA 3RB6A 1T9UA 5A8RA 4J9MA 2RKIB 2GX8A 4UUWA 4USIA 2DK2A 3NGSA 4LFBF 1TUSA 4DUZF 4A48A 3BQ0A 2UXDJ 3NBPB 3VV2B 3SV4A 2OTLS 4L75A 1M1KT 3DMJB 3HSJA 2B6AA 1H2VZ 3OD2A 3ENVA 3W62A 3DOLA 2OP5A 4CM0A 2NXEA 2QQCA 2LU2A 3V6JA 2XSFA 1UEVA 4DHVA 2NPOA 5F0WA 2IU9A 4ECZA 1NEEA 3LP1B 2KO1A 3KLHB 3SQOP 2FUG9 3T1YJ 1WC4A 1T05B 2DHXA 3PYDA 3IM8A 3V4IA 4DR2J 1OY6A 3KJVB 4J9SA 1NDCA 1FK9A 3TIOA 2NU4I 4B6DA 2X52A 3MM7A 2OMOA 4WJBA 4LFBJ 1FTCA 3WBZA 4DUZJ 4O0IA 1NJWA 2DHHA 4OHVA 3GIKA 3V81A 5ETOA 1S72S 2DRBA 3IMQJ 3QQCD 2P2OA 3GV7B 3E2EA 1RCOB 2QGFB 2HHXA 3B4DA 3PW4A 1YTYA 3TJQA 2V4QA 3HI9A 2IRXA 1NHVA 3P5TL 1S7IA 1FVSA 3ZZUA 1S9GA 1CT2I 4H4KC 1U1KA 2BM1A 4RKUC 2W7PA 1DLOB 4ITSA 1U1QA 1OY8A 5KFCA 2PT0A 1FKOA 5C2GA 4OHZA 1W3SA 2HQ3A 1S1UA 2YKNB 4X4SA 3MOZA 2OI2A 2CWXA 4O3OA 3RU0A 3MOJB 3FQLA 4E6UA 2I9SA 3IP0A 2MJNA 2CQBA 2FYXA 3EEVA 2CJSC 4OJ3A 4XTTA 1T03B 3NEKA 1R43A 1JLEA 1TL1B 5EWEA 5L1KA 1WG1A 1OMUA 3M32A 3CJKA 3NWRA 3OL8A 4QWDA 4ZVRB 4BLGA 1P8GA 1S5ZA 4CO2A 3OTBA 4G87A 5ITHA 1U8SA 3S1TA 1KRUA 1UEKA 2VBWA 2FVRA 2VG5A 5DDRC 4K4UA 3BSWA 1DS3I 1S1VB 2V67A 1AB8A 1S49A 1YIJS 1FD8A 4CCHA 2BYCA 2AYGA 3PR4A 4B17A 4M5LA 4CO3A 5IFMA 2J9DE 3OFEA 2NUHA 2AGPA 1WACA 2AEFA 1BWEA 2YKMA 4PCQA 1FFGB 4PEOA 4NRTA 4EYHB 4K0KJ 2WCYA 3B8HA 1B4SA 1HV9A 2F8HA 1Q8BA 4NEZA 5KFBA 1MSWD 3FK4A 5DM7Q 1HD1A 4LJMA 4N76A 1TOTA 3R5AA 3VAJA 1MR7A 1OWXA 2PA8D 3PR5B 3FS8A 3HULA 2J5AA 2YH0A 4ES2A 3CC2S 2DRAA 5D4LA 3DLEA 1RTZA 3VWSA 4DQSA 3N6MA 4TY8B 3HDSA 2F1FA 3ENWA 3M8ZA 4LIRA 3OSPA 5F8HA 2H3EB 2YPZA 3MR7A 1VLYA 3ITHA 4B02A 1SIWB 3GJQB 3KK3A 3R2CJ 2G0CA 1RU2A 2OPSB 3ZZZA 2LECA 2AW0A 4UZBA 3PEHA 3VAFA 4J5OA 2HK3A 2ZUAA 4Y28C 3EDRB 1YITS 4C11B 5JHWC 1UFKA 2H51B 2AEMA 1S77D 1D8YA 1Z2IA 1K0TA 1SGNI 2VOOA 2C2KB 3D68A 1CULB 1Q4RA 2G0IA 4NLUA 1RXOB 1RTHB 3T5JA 3HHDA 1LXJA 4KO0B 4DV7F 2M4MA 1UJ5A 1UA1A 3FMBA 1QTMA 4NLTA 4U95A 1HBMB 1KQGB 3AJ2A 4ZPAA 3BQ1A 1RT6B 2V53A 2W2OP 2KJWA 2DGTA 1TFWA 1C0TB 1AFJA 4K5RA 4J9VA 3R6LB 5T7LB 2MLXA 1LR8A 4I4BA 2W2NP 2F9DA 4X4QA 4UF4A 4DV3F 3C6UB 1GX6A 4OHWA 4OYIA 3MM9B 2HVHA 2ORWA 4G3QA 3TV0A 2LQ8A 4K8RA 3VVTA 1VJWA 2TDTA 2X1GA 1U1PA 2V5HG 4HUSA 8AT1B 4RW8B 5KG5A 4OJHA 3NLCA 4S0MA 3GJRB 4GO7X 4MJKA 4KBIA 3C19A 1H6KX 3FCVA 2OMLA 4HT7A 4NCGB 2LA6A 1V3ZA 4BDPA 4C3KA 3OT9A 2HGNA 2QKXA 2V0KA 1DTTA 4P2MA 2OVOA 1FKPB 1T9YA 4TU7A 4IO9Q 2QRRA 2ZNYA 4B3OB 2DO4A 3GFXA 2VBZA 4TQRA 4DQRA 3NG8A 4D3HA 2ZM6J 4DV3J 1V1IA 1HLWA 3P96A 1S1TB 3R5CA 1A7GE 1KGQA 1ZBTA 2Z4PA 1JJ2R 5FLXU 1WGTA 2CVEA 1NK4A 5J1EB 4XIUA 3RAMA 1SC6A 2OPQA 2ZDPA 2MZSA 3DYAB 2I1RA 1NJIT 1YBAA 4F2RA 3ZXWA 3CUNA 4OX8A 3ZZ0A 3DXBA 3HSGA 2DY1A 1VI7A 1VDDA 2E5JA 5IXUA 3PJWA 3QGHA 5CYMA 3TUZC 1GXTA 1YBUA 2PMWA 3JTNA 4K4YA 3F56A 5D4OA 2VQEF 4TQSA 3UEJA 2I5JA 2YX7A 5CYJA 5EUHA 4TU8A 3UNGC 4BWJA 4CO0A 1XR7A 2KG0A 2IC3A 5IM0A 5AE3A 3I0RB 5DEMA 5C42A 1U1NA 1TV6B 2FDNA 2KRBA 5ETVA 3ISNC 2GKTI 2W4DA 2D41A 2XZDB 2OGUA 1S79A 2YXLA 3D1QA 4Y2CA 3LP0B 2N17A 2B6AB 4AQYF 5FUYA 2A1BA 4KPCA 3M6VA 1NSPA 3QJPA 2PEBA 2D1CA 3TO9A 2BACA 2GMJA 1K7VA 2OHDA 3R7SB 2E5RA 4UW2A 4KSEB 3OLBA 4ZHRA 1WC6A 3N5FA 4F8RA 1MRLA 3PKMA 4HACB 1QDUB 5A8KA 5C2CA 3OBIA 2G4BA 2HNDA 3DRSA 4N56A 1Y3KA 3QRRA 3CF5Q 4USTA 1YWXA 1FK9B 2IYIA 3UFFA 4XK8C 2OFGX 5JMNA 2Y1JA 3W5ZA 1C0UA 1EETA 3D6FB 3L7PA 3PX0A 4XPCA 2QL9B 1HNZF 1IUJA 2XMWA 3CJ4A 3S6EA 2MZRA 1HQUB 3Q2TC 2QMXA 2G2OA 2BUSA 4JUZA 2C2MB 5HI7A 4J9KA 1MMDA 2L3MA 1YVFA 2KDOA 4PABA 5DDPC 3F0NA 4JI1F 3R5GA 3GQ8A 4ZP8A 1QVGR 1S9GB 2DR6A 5U2KA 5CABA 2K1RB 2UXCF 1Y11A 4YP3A 4ZVEA 4DR1F 3H5XA 3KLFA 2I5KA 1SI9A 4C2MA 2XYGB 2MZ1A 3FOQA 2B4VA 3LUYA 4HZCA 3KWDA 4UY8T 1RAJA 5E0OA 5L8RC 3NNHA 2AMCB 4G1QA 1UJ6A 1S1UB 3KDOA 2ALYB 4K50A 1LW0A 3RW6A 3D0IE 3UDEA 3MEDA 3PACA 3W2WA 2EEYA 3UCZP 1KGTA 1UVMA 1OS5A 3VGVA 3LGHA 2V9KA 5F0UA 3G6VA 4XDCA 1HNZJ 1S0VA 4NL5A 1U6FA 2IRUA 3DM2A 1S1WB 2CQCA 3FSXA 1KMAA 4YB1P 2Q43A 3CJKB 2ERWA 1WG4A 1J5EF 5B0FA 4JI1J 3EVMA 4G1PA 3HVWA 5FDLA 1M5SA 4P71A 2RHQB 3MAAA 2VG5B 1RAIB 1JKHB 2EFPA 3AA8A 5L1IA 3Q23A 3LPEA 1TVRB 1S0MA 4I6YA 1FYBA 4AE5A 2GHWA 3FVYA 2AT1B 2HFUA 4HHJA 4L73A 1TMJA 3IWLA 1AZSA 3MM8A 4G3SA 1SC3B 2XI3A 4DPWA 4MYUA 5A0YA 1QRLA 2U1AA 4ZN1A 3MPDA 1YJTA 5K8NA 2C2NA 2ZVIA 1HMVA 2V8DA 2F3CI 4ENOA 5B7WA 2W2PP 2AYEA 3KKFA 1JWWA 4KGZB 1RHJB 2HFNA 3FTTA 2I0XA 1WOPA 2AIRB 3TJ8A 4RNMA 3A4TA 2ROGA 2LEPA 1LFWA 2WSCC 3A3NB 3AB2B 4NZ6A 2BE2A 4A8WA 2CPJA 1WKJA 3BO2A 5KFQA 1KNZA 3DLEB 5B0AA 4CLPA 2JVRA 4EI2A 3F44A 1ZH5A 5HANA 1H0ZA 3H90A 2Y0BB 3NRBA 4HLBA 2OPPA 2JJ4D 3EMTA 4ECUA 4L72B 3UCGA 3NGTA 4OLPA 1VQ5S 5AE1A 4F4AA 2RS2A 4HI1A 3QGPA 3T19A 3VQTA 1AW0A 4FPIA 1TK5A 1QRGA 4F26A 4WF9Q 2QIVX 4L3KA 1FKAF 3DDKA 3SSRA 1FNOA 4NZ0A 2YKQA 2YY3A 3EPGA 4DX6A 1NM2A 1MW7A 3SYZA 3D8VA 1NPKA 2DJWA 3R1HA 1KR4A 1BMQB 5CHCB 3TJ9A 4UXHA 5DGBA 1FA0A 1SJ3P 4JI5F 4OYBA 2IHR1 1QD1A 5JVGQ 2L41A 4X4NA 1JXVA 3HP6A 2MJUA 2RDJA 2R7OA 4B08A 1FXDA 3UR0A 2J9DA 2LYVA 1RWNB 2W9CB 4OVOA 4CH1A 4I2PB 2J0WA 4U96A 3W2VB 4ZVGA 2OIHA 1NSAA 4C8MA 4NLQA 5CXTA 4L74A 2BJ1A 4PZVA 2FB0A 4QQBA 1S10A 1X5TA 2W25A 4EUVA 3GIMA 4P9SA 1RYRA 5B09A 1FTRA 1MROB 5G0RA 1WDDA 3DI6B 5BYSA 2L9WA 4C0OC 2M9KA 3IR5B 5D3GA 4DL7A 4JI5J 4YR0A 3KUHA 2CQDA 2GC8A 3W61A 1VK3A 2HHSA 3M2VB 1L0SA 1FXRA 3P4UB 3MMCA 2DY9A 5FLXY 2RF2A 3H5YA 3SCIE 5K5MA 3D5MA 2FPHX 5GADI 3HSZA 2FY1A 4QYRA 1B0PA 2HYIB 5AFUV 2WVFA 2VJVA 5LJ3Y 3P45B 2F4VF 3MM5A 2D3ZA 2N3LA 2NZ4A 5EWGA 2OPQB 3F73A 3MQGA 2K06A 2ELIA 3BGOP 1RADB 4LVOP 2QQ0A 4OI1A 2EG2A 4QPTA 4YDXA 3T5KA 3UN3A 2V2QA 4DG1A 4RL1A 3JAMU 1K73T 3DHOA 4QJVA 3D6TB 1PPFI 2DGUA 4C8NA 5L38A 3R27A 5D78A 4G6VB 1S12A 2BX6A 2GKVA 4ES3A 1Z1ZA 3J7YI 2YWGA 4B9SA 1H38A 4BHQA 5IM0B 1I6JA 2DEIA 1NSKL 4OJGA 3VAGA 2SGQI 2KB2A 3PFOA 2HS3A 4PG5A 4PYAA 4JYAF 2FZGB 4I2QA 1BQNA 1TR0A 3HT0A 1WELA 2F4VJ 1DFDA 4EA9A 3TZWA 4DL3A 4OZ3A 3MR3A 2CDQA 1XWLA 3DLHA 1TDTA 2FJVA 1WC0A 3Q24A 4KB7A 2CPZA 4XAKA 2N1AB 4QOTA 1Q5YA 2B9EA 1PYOB 1HQEA 4U8YA 4IG0B 2B9XA 2YKOA 3FCHA 3ULHA 5KG4A 3EZUA 4ZVSB 3J7ZT 2E5HA 1IXKA 3T5LA 3DRSB 2ROEA 5KFZA 2VFTA 3AB4B 2JRSA 2QLXA 1DAXA 3TISA 3J81U 1RUSA 1N4LA 1HBUA 1C0UB 1CJKB 4JYAJ 3DRRA 4DSKA 3TARA 5E5NA 5THWA 2DITA 3NGRA 1TL7B 2VUGA 1DQ9A 3WIUA 3CCZA 2D3UA 2O5DA 4BBYA 3OXGA 4EEYA 4JI7F 3IBCB 3RRGA 3PO5A 1Q8IA 2ZEJA 4KGMA 3OUPA 1MMNA 3EZ5A 1YP4A 2GO9A 3THTA 2UU9J 2JOQA 2X3DA 1HM8A 1TKZA 2GGPA 2Z30B 4RW7A 3VBKA 5IOLA 1RTDB 5ETTA 2H5EA 1FVQA 3U1LA 1M90T 1ZAXA 3M2RA 1KK5A 4OZ2A 1VC6A 3UNYA 4YR2A 1HR0J 3CXCR 5D6GA 3UDVA 3KLFB 4ILLA 1DBDA 2MSTA 4Y34A 3I0SA 2DH9A 5D0EA 4G1QB 2ZBQA 3HKZD 3BN4A 1KQKA 4RR5A 2PA3A 2YQ0A 2RQCA 1HYSB 1SL1A 1LW0B 1W2IA 5J2MA 3MCSA 2AQ4A 3C46A 3GYGA 1NUBA 4ELUA 3B6BA 2GKRI 4K4TA 2DNRA 2CPXA 1MN9A 1SXLA 4CLTA 4F0KA 1C1CA 3G8SA 5GMKa 3BDPA 4EGGA 1ULMA 3GG0A 3THPA 2NSCA 4ZCLA 8ATCB 4ICLA 4KGVB 5FDLB 2CUYA 4C9DA 2PDAA 1YJRA 1K1SA 1TFYA 1NSQA 4DR4F 3EJMA 2WB4A 2MSSA 5IC6B 2G0JA 5GMDA 1FO1A 1LW2A 4B9VA 1QRFA 4DDFA 4U9RA 2BJDA 1W26A 1HEVA 5FD1A 1AZSB 3R5JB 3GJSB 5A0YB 3LQVA 1HNIA 1E6VA 2ZZTA 4BS2A 2D9OA 1HMVB 5E3PA 2OSRA 2XMVA 3EICA 3VE5A 3Q22A 1N0UA 2BV3A 4J37A 2B3TB 1R27B 2MZQA 1I3OB 2HZCA 2A3JA 1KQAA 2J76E 4QYZJ 2UVUA 4DR4J 1Q53A 1NK6A 4PAAA 4KPZA 3PX4A 4PWDA 3C3LA 2VU5A 3DCAA 1KC8T 3TO7A 1OO0B 4K5SA 1HNXF 4X4TA 5AXLA 4ED6A 3R8YA 2OPPB 3LPYA 3J80U 1VQ6S 1RHMB 3FFIB 1WWHA 1FWPA 4B3TF 2QC3A 5IWAF 3T57A 3H2LA 3VAHA 1U45A 4B9NA 2VHEA 3CDWA 1UL3A 2O67A 4M9CA 2R2UA 3GR1A 2IC7A 2VQFJ 2PFDA 4ID5A 3OFGA 4QIGA 1HI8A 2PFFB 2F9JA 1VQSA 3I3XA 2DRDA 2HQFA 2HS4A 4MYOA 2Q6BA 3GR0A 3AXMA 3QIPA 5CQGA 1JXLA 1OSCA 2LDYA 3ELHA 2ACYA 3KNAA 1ROFA 4Y2MA 2Z57B 4M94A 1ZTWA 4EA8A 1CJTA 3T41A 2VODA 2P6SA 3D67A 4OZ0A 2OSQA 1O51A 3KOAA 2LCWA 1HNXJ 4QU7A 1X5OA 4WCEQ 5KFTA 2HHWA 3BREA 3VQSA 1UVJA 3HK2A 1EP4A 2WONA 3FEXB 4FNIA 5KG0A 2VV5A 3DRPA 3HXMA 4FCEA 1FE0A 2M88A 4H4KA 4CTAA 4AD6A 5DG3A 2N4DA 1WF1A 3M8WA 4B3TJ 3H59A 4W92B 3SEKC 2ABYA 1K8AT 1PC5A 3HJFA 3TW0A 2WK4A 1WEYA 2EI5A 4ES1A 1UA0A 4H4OA 3FBEA 2BRKA 5IT9Y 1EQ0A 2OEKA 3PJXA 1VC5A 3CCMS 4OZNA 1JJHA 2W0TA 3DHWC 1KK6A 1QLNA 2ZWOA 4B9LA 2BM0A 3SBMA 2IFXA 1H3DA 1CS4A 1MNEA 1HBOA 2EXUA 2HHUA 1T9WA 5DEPA 4DV4J 5IT4A 5KTQA 1FXLA 3OTOF 2OH2A 3I6PA 1LNQA 5KFAA 2KT3A 1VK8A 4F36A 1JXEA 2RIJA 1FX4A 5LOQA 3GONA 2N7YA 4KV8A 3MM6A 3HCXA 3KTQA 1RHKB 4RW4A 3CTRA 4M1KA 2JYYA 4ANCA 4CO5A 5FIIA 1NH8A 2ZZNA 1RWOB 1W25A 2V63A 1URRA 1NK8A 1LWFA 4MT1A 3UDLA 5I3UA 1N13A 2HFSA 2Q6CA 5F9NA 5JJBA 3JAMY 2VRWB 1U1MA 2RQ4A 3TK8A 1FRXA 3K5NA 3OL0A 4KH1B 1FDBA 1RT2B 3UPFA 1UVGA 2KI2A 1UVIA 1FI4A 3KG0A 3RG6A 2YWKA 9ATCB 3BR8A 1X60A 4DG1B 2WVCA 5LSRA 1TL3B 1QQ0A 4E8UA 1VQYA 4NASA 2O3DA 3OTOJ 1S6OA 4LF7F 4I6AA 4GVLA 4HVZA 3DRYA 3KY9A 1R89A 2DNPA 2CQ1A 1J2VA 1HNVA 1RT7A 4FF1A 4I2QB 1OQ6A 5LSOA 2F3JA 4AA7A 2C2DA 2KRRA 2B8PA 2AJ0A 1IQZA 3OH2A 3TQ1A 4KKOA 3Q1XA 2HBRB 3GFHA 1JK9B 4IH7A 3ZTRA 3ZFVA 2QLFB 2X1FA 1KBFA 1PBUA 3R6GB 1P6TA 4URSA 1BLUA 3HM9A 4WTOB 3BYRA 2JC0A 1HQEB 2MYFA 3EH0A 3C6TA 3MFHA 2YWFA 1VLOA 1GAOA 4ECYA 4LF7J 4CRJA 3JTOA 3CXLA 2Q1LA 1CC7A 1JLQB 4LRCA 1TKTA 3QT7A 2IM0A 3VGUA 1HBUB 2UZAA 4QYZK 3IXCA 3BS9A 1RKJA 4X66F 1MJ9A 2BA9A 4LBIA 1RBOB 3M6WA 1HPZB 2W4PA 1RWKB 3DLJA 1VIOA 2VG7A 4YDDB 2IBOA 4HI2A 3PVXA 3SQGB 1EARA 2KMRA 2BOPA 2DR5A 2XLJA 5F8GA 2H54B 1VJQA 4PXEA 1TKZB 2GGPB 4RW7B 4N77A 1BQMA 1UP1A 1IBLJ 3BKUA 4GI3C 4MKVA 1KQFB 4HT5A 3RB0A 3OL9A 3W64A 3MR6A 3V5RA 3EE3A 5L6VA 1XR5A 3I0SB 2R7VA 3DDIA 1NK5A 1REVA 4ZP9A 3IBFB 1EZZB 5KOWA 1M1HA 1P9GA 3OL6A 1I5OB 4R5PA 4HGUA 2CJBA 2CQPA 2M2BA 2ZFHA 5DGAA 1U24A 3IFEA 5J2MB 4X66J 5A2QU 1LEOA 3QRQA 3BGRA 2VKRA 1H7WA 1L3VA 3GLJA 5H9FJ 2GMLA 1RAOA 2IY5B 3HD2A 1EWWA 1NB7A 5DQIA 3RRKA 3G6XA 2FIUA 2Q3PA 2G9OA 3CDBA 2V2KA 5IT0A 3KHGA 3M8RA 3KNGA 3LTOA 2G2ZA 3CCRS 5FUXA 3BZQA 2V0LA 2HAFA 5J8CA 3IGJA 2KHDA 1AN1I 4ICLB 2D69A 5KFHA 1U48A 3ISZA 2D7SA 4I0WA 4LF4F 3PFEA 1RWWB 1OIAA 1VQ7S 1LW2B 2KVQE 3IN5A 4HH1A 4ZA1A 3ISND 2P9EA 3H25A 1Y10A 1Y0HA 2R7XA 4UY85 3EWGA 1S6PA 2CQ2A 2P2CB 1Q95G 1FERA 3SUCA 3MEEA 3O5TB 1VQLS 1HPTA 2QV6A 3PY8A 1BD6A 3N6LA 5J2PB 4OZ5A 3ZTSA 3DK5A 3AOAA 2RVJA 2DHSA 2G1DA 2CNKB 2N82B 3H2VE 2EFQA 3JSBA 3OPKA 3RB4A 4NRUA 3HKWA 3N6NA 4Z37A 4FYYB 3KK2B 1Q78A 2IUAA 3V6KA 1Y3JA 2XS7A 1R8PA 2AJFE 4OI4A 4LF4J 3QT8A 4PWDB 5ADXV 2RUGA 1O0PA 3CO0P 3MGJA 2XY5A 2C1EB 2J6TA 1I51B 3PYGA 5A6WA 5ADXU 4OQJA 4KYZA 4ISXA 3MI7X 3H98A 3VDUA 2BKOA 4Q7AA 1U26A 1WF2A 4WK3A 5KT4A 4LSNA 2MQQA 1SUQB 5K14A 4ZMMA 2SGPI 4LRDA 2R8HA 4RBVA 3GYNA 5DG9A 3AD9C 3P6YC 1SKSA 5DZ6A 3BBBA 3QLHA 4E6TA 5GAGI 4PQUA 1D09B 3G8TA 1S99A 1DTQB 2HAIA 5H1SV 2A2CA 1M5VC 3POTA 1ZETA 5DQHA 1WC3A 3UN2A 3QIPB 3R1LA 2CQ4A 2E7WA 1XBTA 1RAGB 5C5JA 2YX4A 4LFAF 2QX0A 2NCKL 3QWUA 4A46A 2CPHA 3WIVA 4C8YA 2WONB 4LF9J 3KWMA 2QEXS 2XMJA 1G7CB 1C1BA 3QAUA 2XMMA 4NCAA 2JXDA 1N0VC 4MYTA 4FBTA 3EXYA 5EWFA 3KLVA 1P9YA 3BSSA 3CD6S 4LIWA 3VBJA 4PXCA 1NKEA 2KT5A 2PEHA 4QR2A 3OTDA 4H4OB 2CPYA 3MUTP 4F4KA 4DV0F 1JLBA 1KRPA 1TIHA 2E7XA 4U7CA 2RUSA 3MPYA 3R3TA 4FYVB 1HBOB 3LA0A 3CCES 4DCLA 2J87A 5AJ3F 4LFAJ 2AGQA 4QPXA 2VD4A 3KFWX 1LWEA 5KFNA 2B8TA 1QUPA 5J2NB 3FBBA 2ZH9A 3EVOA 2BMBA 2GIVA 3A8JA 2QPOA 2VPWB 3UCUP 2RDIA 3KLIA 1HWKA 4UOGA 2VF3A 3TI0A 1AFIA 3MM6B 2K3KA 5D8HB 1KS2A 3CB4A 2GZOA 2BJEA 4DSJA 4DV2F 4J9QA 4KHPF 3PHTA 2DXEA 1WKXA 2BKPA 3V4MA 4Y65A 1LWFB 2E1MC 2R8KA 2OLWA 5GADU 4FXWA 3SDEA 5KFGA 5DM6Q 2RAQA 4FDFA 3DOKB 2CQHA 3BSCA 1VQMS 3W63A 4H4MB 3ZC4A 3TAMA 5HMWA 3X1LB 3HHKA 3RBXA 1VC0A 3SMZA 1YJ9S 1D9DA 3C8YA 1LKZA 1ZA1B 1WHYA 1JLFB 1NUEA 3IS9B 5AJ3J 2HZAA 5H9FK 4OZ1A 4DFKA 1RT3B 2FZCB 4WP9A 1D9AA 4ECWA 4C8OA 3E8OA 5J2QA 3LH2S 3MXHP 5M2PA 2W9AA 1IWGA 1RTJA 2DNQA 3AT1B 2E5LF 2HVIA 3TDTA 5IS2A 3SEOA 4ELTA 1KQSR 1RT7B 4YEAA 1RZMA 4BC7A 2WOMA 4KHPJ 2M3DA 3FSBA 1KFDA 2JZMA 2E5GA 3R9LA 2PIIA 3DLGA 2RU9A 4KKOB 1N34J 3I32A 1ICEB 1DHMA 1FRJA 2DXFA 1WHVA 2HRYA 4PPDA 3ENQA 2EVZA 1NDPA 1OYVI 2C22A 5EDWA 3KHLA 3WC0A 1C2PA 2QLBB 5KT2A 2MB0B 3D1OA 1FY7A 4WYWA 3ZTPA 5K20B 1MU2B 4F4YA 2UXBF 1YBTA 2KXNB 1RT1B 3JQYA 2CWGA 2BEFA 1L5UA 4OI2A 4L9MA 4OI0A 4G3PA 2E5LJ 4LRAA 2NR0A 2L9DA 5IV4A 4GRSA 2IBKA 2GNKA 3UDCA 2DGOA 3OVBA 1V3WA 1HWLA 1GX5A 1P9QC 3D66A 1ZM4A 5LXYA 3IRXA 3MMBB 1PC4A 2HWIA 3L3CA 3CCQS 4KH0B 5HBMA 3A3PB 2HBYB 1X4HA 4KIAA 1NRKA 2PSZA 5HLFA 4WK1A 2UUTA 2VG7B 4IRKA 1OYEA 1FF2A 1H2UX 2XYHB 4OL8A 1RJJA 5F41A 3QT6A 3CNQP 3DC2A 3TOBA 2J7WA 1QM9A 3GQCA 2OUGA 2KN4A 1CJVA 2QA4S 3DKDA 5DDQC 1BQMB 2L48A 4CO1A 3LALA 1Q5VA 4A8XA 1RLCL 5KG2A 2UXBJ 1IY5A 1RYSA 2A18A 2AEJA 2MY7A 5A2QY 1REVB 2BXJA 3J7Z5 2LFVA 2LVWA 2HRTA 4LF8F 1I94F 5DAEA 4R5PB 1F60B 2F4FA 4A8KA 3BDEA 3T6JA 4IFYB 4MFGA 3T5HA 3Q8SB 3PM9A 3M9NB 4ZS6A 4LQ3A 2CQ3A 2OELA 3JSYA 2ATLA 2CXEA 3RW7A 5ADZA 3E59A 1BWVA 2DNHA 3TX8A 5T41A 4YHHF 5C25B 3H42A 1Q82T 1DY3A 4PRFA 3QSYB 3FZ2A 3MQHA 3ET6B 3IBWA 4JI8F 4JOUA 3K89A 4TU9A 1GTHA 2CNOB 3EXCX 3OU9A 1XEZA 1OCXA 4M5DA 3M4XA 3M30A 2EC2A 2M0GB 3N0VA 1GXUA 1PJ6A 3O1LA 5H9EJ 1NO8A 5EGYA 1VISA 4Y0FA 2FVCA 4ED2A 4LF8J 1R0RI 1J27A 1I94J 4DL0C 4ILRA 4CLZA 1VRTA 1D8ZA 3PKYA 1S6PB 3OVOA 4U6PA 1RT5A 1N56A 3FUYA 4ZVFA 3CJ5A 4F4XA 1R31A 4MFBB 4JI0F 3KMQA 1Q86T 4HL9A 2RB7A 4IG3B 3HHLC 3JB9k 3WC2A 4N5SA 3GG1A 1U09A 2VPYB 2WRMA 3ZZOA 3BEGB 3OR2A 2R7QA 4JB8B 4J7CA 1ZM9A 2DB1A 1SQEA 2IAJB 2W1BA 4EWTA 2E9RX 2HQGA 3U02A 4QZVB 4DL2A 3I96A 1RI7A 1RCXB 2CJKA 1PJ5A 4DLEA 1YDLA 1S76D 4FXDA 2MZTA 3HVTA 2VG6A 4ZDNA 2YTCA 2CZVC 1F9HA 2J7UA 3MEGA 4QBUA 1TURA 4DN9A 1KHWA 5AXMA 1B3TA 4HKQA 1RTIB 3C8VA 3ZZPA 1CSJA 2AJ4A 4LSNB 3ZTOA 1IKWA 4LVNP 2CPFA 3BBCA 1N5YA 2ATCB 4JI0J 1OYDA 3H2UB 2Z2YB 4IFVA 4ZIWA 3QLHB 3QSIA 2H4WB 3UO0A 4LREA 1U6BA 4P2FA 1SQFA 4IOBA 3POTB 1T95A 5LSLA 1XTZA 2DIUA 4ETZA 4HURA 4P2SA 1HQ2A 2RQKA 1HIYA 3QWPA 1Z90A 1LWCB 1YZ7A 3NOCA 1C1BB 4B9TA 2AD9A 3K7RA 5I42A 2FKOA 2VICA 3DLLQ 2RE1A 3MZIA 4IHFA 4WIIA 3EX7B 1WC5A 1CLFA 5CD4H 2OI5A 1TKXB 2DGWA 5DETA 1FFWB 1NPPA 3FSIA 5E33A 3RUBL 4A24A 1FX2A 2OPRA 4E98A 4O3SA 1U1LA 2FJXA 4ECTA 2XO6A 2KFYA 3KHRA 4L6V3 5HMZA 2QL7B 3NGDA 4DSLA 4KFBA 4W90B 4RWWA 3JYTA 1R0CB 1T9VA 4N6BA 2ASJA 2EW9A 1AUSL 4QIEA 1N33F 1WTBA 2RD5C 4B3SF 3IGNA 1MN7A 3C15A 1SQGA 3KLIB 4ZVPB 1SV5A 3CCWA 2ZZMA 1KVJA 1M8BA 2JX2A 1U1RA 3ILJA 1MR9A 1Y7PA 3PW2A 2DPIA 3NCRA 4ECSA 4MKAA 2GVZA 1YRXA 2SGFI 1QRMA 2M70A 2V4RA 1VR6A 3TO6A 3SDEB 5AXNA 2EFNA 3THVA 3AXKA 4E0DA 1GMWD 2XS5A 5BR8F 2MQPA 2LXFA 1U0HA 5K8PA 3OH3A 2KU7A 3TAMB 5F8LA 4EABA 2MKHA 4JV0A 4Q2MA 1S6QA 4DX5A 4G65A 1N33J 1K44A 1ZOTA 5J2QB 4FF3A 3PYFA 3HMJG 3DNCA 3OJUA 4B3SJ 1LQ9A 4Z7CA 2AP6A 4C8LA 1BC6A 4NZ7A 5KFIA 1LK7A 4JBCA 2KMPA 1XR6A 4GC6A 1XERA 3VBLA 2XG8A 3EGZA 2YWEA 4OI3A 1KVIA 7WGAA 2QA1A 1BUXA 1WEXA 1RWPB 1GMWA 3O3LA 2LQBA 4QWCA 2YNGA 2KCXA 4KC5A 2CAJA 3Q8PB 2KM8C 3DLGB 4URQU 4W98A 1X4AA 4FF2A 1BUSA 1U7LA 1TBRR 3UOEA 2ICYA 5H9EK 2XEXA 1L3TA 3MR2A 5BR8J 5M2UA 1KOHA 2R42A 3CJ0A 2WVJA 2XCAA 4DFJA 1TU0B 1PYSB 4KQZA 3PO4A 2P6AC 3W8PA 4N27A 4JV2A 3HT3A 2PQ8A 3R2DJ 2W7AA 4CM2A 2QLJB 3MD3A 1E6YB 1FARA 1WGCA 5HMXA 3TRGA 3W1YC 2HLTA 2EWHA 3K2YA 1AROP 5ETKA 1F3FA 2J0XA 3US5A 1IKVA 5ETPA 4W4MA 2VZ9A 3G82A 3H0PA 4ATNA 3G87A 3OFHA 5D15A 2KFZA 2UUCF 3IRXB 1SGPI 2JFDA 3G86A 3LANA 2ROPA 4LR7A 5HLFB 3KYLA 4ZVQB 2LP4A 3CVKA 3Q2SC 2QMWA 1X4BA 2BABA 4IO1A 3LWLA 3TNVA 4EZ9A 3TWDA 5IV3A 2Q4JA 1QSSA 2G2YA 4WYLA 1CJVB 3M8SA 2RRBA 1YJWS 4WE1A 2CG4A 4YB7A 2IPOB 1H73A 1ZAWA 2KKHA 3FZBA 4TN2A 2GMHA 2DGSA 4C3MA 1K7UA 5AT1B 4ED5A 3D3BJ 2EFGA 3H5UA 2HEKA 2HNYA 3TUIC 1D3WA 2XCPA 4DI6A 2QZ8A 3OHAA 3RR8A 1W4RA 1NJYA 1DQ8A 1SSQA 1YKWA 2HHTA 4CLFA 1UFWA 2JLGA 4F7VA 3FMWA 4NLYA 1DJ0A 3GE9A 3HJVA 2UUCJ 1H74A 2BANB 5F8NA 1SJQA 1BHNA 2QE5A 1T94A 1IBKF 4O4GB 5LM7E 3R7BB 1HA1A 5J8FA 3R5BA 1M0SA 3U1NA 3MR5A 2QQEA 2HPUA 1WUUA 2CZ9A 4DCOB 3GMGA 2JLEA 3AY0A 4KQLA 4CT8A 4PG6A 3CCLS 4IQMA 4EK2A 4RNFA 1FXJA 3ONQA 1U2CA 4IDKA 2FTRA 2Y8YA 1S48A 5KFWA 3M30B 4DSFA 4OHXA 5JUMA 1KLMB 4M5JA 1XNQF 4ECRA 3FCWA 1TK8A 4O3QA 3MECA 2CWHA 4OZJA 4DCPB 1VRTB 2BW7A 2LB7A 2EBEA 4RWXA 4HZDA 4FYXB 4ED1A 4FBUA 1ACMB 3IAS9 2PMHA 1RAHB 2G1HA 1FESA 4GVBA 3HZEA 3HVRA 1N6QB 4OX6A 2NPFA 4ZVHA 3JSMA 1IBKJ 1H2TZ 1V6HA 3CULA 3TVYA 4R36A 1CGII 3UI3A 2FD2A 4UUXA 3CC7S 2MZJA 4YOEA 3HPOA 1JLAA 2GVDA 2ENNA 3OR2B 2IM1A 3QPIA 3CDAA 4EQYA 5DLGA 4USUA 3MCMA 4JI3F 1X0PA 3CIZA 4YY3F 3J81j 3CJRA 3QJJA 3VBPA 4ZP7A 3UVJB 2KG1A 3EGVA 3SFGA 5D77A 3HVTB 4K2XA 1XNQJ 3DHXA 3A8IA 4LF2A 1PCAA 3KXDA 1D0EA 2B4OA 3AQOA 4U7UD 2YQ1A 3PW7A 2NYIA 4CP5A 4NI2B 1RE1B 5A8WB 3W7BA 2UUAF 3R3IA 2WLDA 4GKKF 2OEJA 4KT0C 4USVA 4DV7J 5IC4B 2N52A 2FJAB 1G95A 2QYGA 4I69A 4Y00A 3SGBI 1S0OA 4IFVB 2JFKA 4RPFA 1W2BR 3LP2B 1ZPVA 1SJ1A 2QIAA 4DPOA 4KE5A 2JEJA 5HATA 3GSDA 5CZXA 1YQHA 5E3AA 1TGSI 3BGFA 1NK0A 2HNZA 2GHVC 3HHEA 1Q16B 5GAGU 3B78A 2UUWA 4AMLA 3OFFA 3MPVA 3AFGA 2FJWA 2RJZA 2FC8A 4P52A 3G6YA 5I3QA 1EX8A 4F67A 4NLRA 4ZLPA 2RKIA 2QIFA 4R25A 1T9XA 3KWEA 1VQPS 1YJVA 1CJUB 3BV8A 4DUTA 1HWUA 3OUYA 2XHWA 2NQPA 3SPTA 3DGPA 2JH3A 2ZKUA 5KFVA 3EYZA 2DXDA 1KWMA 1U47A 2ZVSA 1N8RT 4LT6A 4X4UA 3NBPA 5I42B 4ZCMA 4GKKJ 2J9RA 2V34A 1WEZA 4A8MP 3MUVP 3DMJA 3ILOA 1RBAA 4QCLA 1TL5A 2R9LA 4K7QA 3UR3C 2LXIA 3N4WA 2UVRA 2FVQA 1RISA 1TP7A 3X3UA 1PTQA 2KFNA 2V8PA 1G97A 5LMNF 4O23A 1AUDA 1RB0A 3Q0AA 4Z7YA 5M2RA 2QLWA 1SVDA 1TL4A 5A8RB 1APSA 1HWJA 2NUUG 2ZE2A 5DRKA 3FBFA 2GQQA 1NZ8A 2DT9A 3KMSA 4X64F 4GC7A 1RBLA 3PYEA 6FD1A 5CZVA 3KJNB 3PCOB 1YGYA 3G2XA 3W66A 4EGLA 4C4WA 2Z58B 2NYHA 4FS2A 2ZBIA 2ILZA 1IBCB 3DOLB 4N69A 2Z0GA 3IA0A 2ZUGA 5HQ8A 1WKLA 2OD1A 2NXUA 2F7VA 1HI0P 2GVZB 1FNXH 4ZLJA 4FKXA 2VQEJ 2ZJRQ 5LMNJ 1SGDI 4ED7A 3V4IB 1DLOA 2LQ5A 1U0HB 4NYZA 4NLWA 4X65F 2CPIA 2MHNA 4USHA 3P3DA 1CE3A 3K57A 4PWWA 2LXUA 3MM7B 3OVAA 4KNRA 1YP3A 1S6QB 3OQ2A 3CD5A 4ALZA 4LFCF 2C3OA 4X64J 2HKEA 3HX9A 1QVFR 1SL0A 2OEGA 1KK4A 3OXLA 2UVVA 2IDLA 1TELA 4DV1F 3V81B 3PJ9A 4M28A 3G9CA 1T11A 2SXLA 2HW3A 4AQYJ 2GAGC 4LMZA 2CNLB 3J7A1 1SKUB 2MGZA 2EG1A 2UZ3A 1N52B 1V67A 4ERDA 1T03A 4CO4A 2HFVA 3H40A 2KMOA 3Q89A 5KT5A 1KBRA 3JTPA 4PKDB 2GV1A 1WOSA 5LMUF 4Z2XA 3KDNA 5EHHA 2OJ3A 7FD1A 3EUNA 3WHIA 2B5JA 5EX3A 1FKOB 3I5BA 4AT1B 3LW5C 4P7TA 4WKYA 1EB0A 4X65J 1Q8LA 2W0WA 2YWHA 1KTVA 4Y2AA 2XO7A 1UEUA 3CEDA 3CSKA 2ZHBA 3BPSP 1KSPA 1U5KA 4LFCJ 2V0IA 2DNZA 4QIVA 3ILLA 4Q44A 5BJRA 4M8LA 4DV1J 2M5YA 5HSPA 4ZPCA 3BPDA 2CNNB 1JLEB 3TP2A 3Q8RB 1CT4I 3G82B 2Q79A 3M32B 1RHQB 1X7VA 2VIHA 1UWBA 3CJQA 1U4BA 3NAIA 1T7PA 1NDLA 4MIAA 2UXCJ 2H48B 1HJAI 1O6XA 4OIXA 1BXNA 4DR1J 2IRYA 1N5QA 4CIOA 1PCEA 1M5HA 1FHTA 4WKRA 2DHAA 3NNAA 4TY8A 2YKMB 2GFFA 1CSOI 4ZVUB 1SC1B 2M7SA 4K59A 2N7CA 3W8GA 3QJLA 2PI4A 4QU6A 2E1RA 2AU0A 1SPBP 2OPSA 3H20A 4J9NA 3F1XA 2DISA 5B0BA 2L7XA 4MK8A 4C11A 1LOUA 3NOGA 1J5EJ 1GH8A 1FJ7A 2JHEA 4QWBA 4E1PA 4RNOA 1ZPWX 2EKNA 3GILA 1THJA 4DS4A 3C2PA 1CULA 3IRWP 1WSVA 2JEFA 1M8NA 5AE2A 2C2RA 3KUGA 4RU2A 7FDRA 1HBMA 1I1GA 4A8YA 3EZOA 4DR3F 3ITHB 4AFFA 2YKAA 1REGX 2HHVA 1RT6A 3KK3B 3BJIA 2XULA 3UD5A 3H8YA 5GAHI 1TAUA 2Y1LB 5T7LA 3DLKA 2HIYA 2MQOA 3B54A 1BE4A 4L3NA 1K47A 1NU4A 4IDKB 2ODDA 3KK1A 3MWBA 3U7JA 1XBWA 4BWMA 4AXIA 2GJ2A 1X4SA 2AX1A 3D28A 3VF0B 1RK8A 1UKUA 2WB1D 5A76A 3W65A 4J9PA 4KHMA 4J91A 5ETMA 2VFUA 2AJ1A 1N4IA 4IRCA 2X1BA 3TUJC 4I7FA 3MM9A 3TA0A 4RUHA 4X2BA 2DNLA 2E1AA 2GHPA 2QT7A 2IU8A 1FCAA 1NMEB 3AOBA 1F9EB 1PSDA 4C0HA 4GVBB 2HQCA 2ZOGA 4DQQA 3OTCA 1R8AA 1FRIA 5D4NA 4UQTA 1SJRA 3OW5A 1WD6A 2HVZA 2UUBF 1KDNA 1WHWA 4K2JA 1JLAB 1KRRA 1V3SA 4DR3J 3EG4A 1T0TV 1D9FA 1JJCB 1FKPA 4M63A 3ADAC 5LJ5Y 1WNEA 1RAAB 1XN9A 2ZC4A 1U8WA 2B9WA 1Y5LB 3BGUA 1YX2A 2CIMA 3OR1A 5SZTA 3CJ2A 3VALA 4KGXB 3M9OB 4F3QA 2OI6A 3MEKA 4DL4A 5JXSA 1S1TA 9RUBA 2AYBA 4WP8A 4KY3A 2MQ8A 2JWNA 2P8IA 4K6RA 3FBCA 1IVZA 3VZHA 2WCXA 2QA4G 5J1EA 3M8YA 6AT1B 2V8GA 4XO0A 3PRVA 1XNRF 3DYAA 4TVAB 3GCXP 3L4BC 1IR2A 4PG4A 1IJFB 4WU3A 1DTTB 4ELVA 4DPUA 2JEGA 5F8IA 1JLCA 2V0NA 5FJ4A 3UFCX 3V2UC 3L9ZA 2XS2A 3A8EA 4DUYF 5C7PA 4A8SA 2H4YB 3TOQA 3VGSA 4P74A 4N7TA 4IHHA 3T1YF 3GQ7A 2HSEB 2EK1A 6FDRA 3HFZB 4GMKA 1T02A 2WVEA 3TZYA 4O3PA 2BBEA 1A6LA 3P47A 1FRKA 3FJ2A 3M6UA 3I0RA 3CWJA 3OUYB 3PG9A 3P1BA 2WBMA 1TV6A 4YQWA 3DGPB 4E2FB 3UEYA 2IA0A 1X9SA 3RAXA 2JZ5A 4OI6A 2QSWA 3K5MA 1F3VA 3PMOA 1YK9A 1U0SA 4AL6A 1XA6A 2ZOFA 5KFFA 2R2RA 3BKFA 5CA5A 2F5GA 4KGKA 1XNRJ 1ELOA 3LP0A 3U1MA 1NK9A 3TAQA 5CYMB 1VFJA 4M5HA 2BRLA 4UOFA 1RP5A 4LF6F 2LA4A 2OTJS 2I5JB 1TZ0A 4DUYJ 2ZD1A 1Q8KA 1ZS6A 1S0NA 3EDQB 4UZCA 1YG0A 3TVZA 1U2FA 3B82A 2J0QD 4IH5A 2ZBPA 4HACA 2IC3B 1QSYA 5C42B 3BH7B 4Q0BA 2ZE2B 2IM3A 3LOUA 2DNOA 1WF0A 1AA1B 2MTLA 5KT7A 4ZPBA 1Z7KB 2OKQA 1VHIA 4AL5A 4F3MA 4J9LA 1IM4A 5DJBA 1K1QA 5E3RA 2OD4A 2HIQA 5LT5A 1YRTA 2DCUB 1UWAA 1RAFB 5F9LA 3PW5A 4R37A 3HHLD 1HM0A 3FGVA 1HQUA 5KFMA 3MMAA 1KOOA 4TNOA 5BYRA 3BSAA 1X31C 4GKJF 1FRLA 4X62F 4ZHRB 4ZPVR 4LF6J 2SGEI 8RUCA 1Q79A 1K7TA 5A8KB 1KLNA 2LEAA 2K1RA 2HNDB 1QY7A 3TA1A 1H0HB 2QN6B 3VBMA 1C4CA 4MIBA 4PG7A 5D0RA 4IH6A 2OEFA 2COLA 3EVWA 1VRUA 2EPIA 1EETB 4ETXA 2OD6A 2MMYA 1YI2S 3P49B 3MDFA 1EJ7L 3HHLA 2E1CA 2ASDA 2ZH1A 2AHOB 3GQ9A 4K4WA 3OGZA 3BO3A 2OI7A 3MAQA 2X3GA 2MQMA 2DIPA 4ZJLA 4C97A 2FHOB 3RZAA 3R2WA 5CYQA 1BY9A 4K0KF 1FJGF 4TYBA 5K8OA 2B51A 2I38A 2MGZB 3NL0A 4KAIA 1V1HA 2B9YA 2AKWB 3CCSS 3AH6A 1B0TA 1S1WA 1FD2A 3DDNA 1X0FA 2XHCA 1NB2A 3DLBA 4NLDA 4C6AA 2BJ7A 4GKJJ 3GV8B 1PYTA 4WFYA 4X62J 3NY0A 2B5JB 2BVZA 3NCQA 1N5SA 5IQQA 3M8PA 1SJFA 2OO4A 2DHGA 1B99A 3IM9A 5SUHA 1PAEX 3FSCA 2XMUA 1JKHA 3BH6B 1UPPA 4LF1A 3AQPA 5HQLA 2M5XA 4RBTA 1TVRA 1TKDA 4N8NA 9WGAA 3IWXA 3SXLA 3QNWB 3HF5A 2KHCA 1XIQA 4CLYA 3ILIA 2PMZD 4Y6IA 5HL7Q 3MEDB 3W2WB 3P5BP 1QUVA 2CADA 4YB6A 4P72A 1GXLA 2MDAA 4OYPA 1RA6A 3DM2B 1HKAA 3OSNA 4JI7J 1FJGJ 5BXIA 4ZJQA 1UWBB 2FHKA 1MWQA 1HBNA 3FWWA 2R2TA 2V68A 2MLZA 2R7UA 4OV1A 3MAAB 5F8MA 2JNJA 2RHSB 3JQJA 2E1PA 2UV8G 1WI6A 1XX6A 2YQPA 2HBQB 2I6WA 1DS2I 2NXJA 2XMKA 4OJ1A 2AWZA 3MM8B 1R6YA 1OPIA 3GIIA 4Q8EA 2V9WA 2K2PA 2N71A 4KJIA 3E51A 3QGIA 3QAHA 4M95A 3NGKA 3ZNJ1 4AL7A 3BYPA 3NWGA 3A1YG 3V6DA 1N32F 2DBBA 1F0XA 2I8EA 2Y1RI 2Y0SD 3KLEA 2SGDI 3BSYA 3QFWA 3OH4A 1GTEA 2ILYA 2LLZA 4PUOA 2HLUA 3GOXA 2KZMA 2XQCA 1PJUA 2BE2B 1NKBA 2DYAA 4EFAC 2E9TA 3KWCA 1OVOA 1IR0A 4PPZA 1VBXA 2R8GA 3VAKA 2DNYA 2AV5A 1URNA 3LGNA 5E41A 2W0VA 2FVSA 1SBRA 1CBKA 5C24A 4DV6F 2KYXA 2F65A 3IAM9 3DLKB 3GPAA 3B4MA 2P6TA 1LR7A 2K9HA 3KK1B 4NA2A 2FY8A 2FGOA 5DZ7A 2ZM6F 1N32J 2W9CA 1UVLA 2HVEA 1TBNA 2VBYA 1X74A 3OH1A 1WG5A 4I2PA 3VBIA 1JNZB 2A20A 4I7FB 2CFXA 2N4CA 2VH7A 1OQ3A 3W2VA 3IGVA 3O2IA 2V6AA 1KEKA 3NZ2A 2NXNA 3SCLE 1X5PA 3W9JA 3M9MB 3K58A 2XNRA 2Z2LA 1P27B 1R7IA 3K17A 4EU0A 1MROA 1GMUA 3D6HB 2FLPA 1ITPA 1MLAA 4PXDA 3DI6A 3TZXA 3C66A 4CQ1A 4DV6J 4J90A 2NS1B 2BJ3A 2NU2I 4Q45A 4RU9A 2WHOA 3W9HA 1H98A 1ZZNA 4ILMA 3M2VA 4IKAA 2GQ2A 5IWAJ 5DQGA 2BZ2A 4DZDA 1WSRA 1NXUA 3OR1B 2ZJPQ 3GB0A 3PZPA 3BRKX 5HAOA 4EA7A 2VDHA 3ZZRA 4NYPA 4ER8A 2GS8A 4CLLA 3KJFB 3WX4A 3HO1A 4MKYA 3R1WA 4WWSA 3L09A 2V1CC 4RW9A 3CDEA 1QJHA 1YZ6A 1HNWF 5G0RB 3G71S 4CNZA 4ZCKA 5K9FA 1UVFA 3GCWP 3UD4P 1XATA 1NJXA 5D3GB 5B0GA 2IMWP 2HGLA 1J5OA 1VRQC 3GUEA 1JLCB 1GQEA 3CMES 2XI2A 2J8AA 5HROA 2ZITA 4YB5A 4RO0A 4FKDA 3T3FA 1FDDA 2MPUA 1U1OA 4WZQA 3MMCB 1QAYA 4E1KA 1MT1A 3Q83A 2RF2B 1X4GA 3NNCA 4OV6A 1TQLA 2P9CA 1XQIA 4M2AA 2DPJA 3BR9A 2HZVA 3MM5B 1XMQF 3SCKE 2E66A 4LRFA 4HTIA 5F3ZA 4ECQA 5AXKA 4DOZA 3NS6A 2MKCA 4ZCIA 3OTMA 1RKIA 1HNWJ 2KJVA 2JA1A 1VYAA 5LXRA 4WXWA 1B7YB 3NS7B 1UZHA 2V2VA 1R0BG 4YN3B 3U27A 4F2SA 4FYDA 1X4DA 2ZD1B 2DCLA 4IG0A 3NS5A 4HEA9 2RILA 1UFLA 1NBEB 3FEZA 2VD3A 2AZ3A 2MLYA 3VHQA 1B0VA 4AUKA 2WVDA 4Q0BB 4HHUA 4C7QA 5HMYA 1HHQA 3RBEA 1IQTA 3RBZA 1NJZA 4DCJB 2MXYA 1WOOA 1BQNB 1FFSB 1F5CA 3W5XA 1DURA 2H9ZA 1UJ4A 4OMFG 3TWZA 2XY6A 4H7OA 2IJFA 2DIVA 1CJKA 2PE8A 1XMQJ 1VDHA 4AYBD 3OXFA 2E29A 2R3VA 3TYTA 1IN0A 4DPXA 2ARPF 1KHVA 5KFSA 2ZC3A 1LFPA 1TL7A 3FC3A 2JLFA 5JVHQ 1Q0NA 2VONA 2MY8A 2C3PA 1MG7A 3MMAB 3OTEA 3FKBA 2BQUA 2RT3A 2E73A 2RC4A 3H5SA 3J81Y 5KFEA 1T3OA 3D0GE 2XMAA 1RTDA 4KHRA 5K8MA 1LK5A 3MTJA 5GAEI 2HHPA 4Y2KA 3PX6A 2M8HA 2R2SA 1FWKA 2Y0MA 1ULKA 2HK2A 2VC0A 4ED3A 2GVIA 1PGZA 1VRUB 3IC1A 4ZIVA 3DRRB 4DL5A 4DEZA 3QRPA 3HHLB 1QAXA 1L3SA 2YKPA 1NAQA 4OX7A 1HYSA 3KUEA 3RTVA 3OH0A 2JVOA 5CYQB 4CLUA 2ZH7A 2XRCA 2Z2ZA 3D00A 1KP6A 4P7VA 1G2EA 3M2RB 1FE4A 2L8EA 4DWIA 4HR2A 3M8PB 3NGUA 2V8HA 4A4JA 4Y2IA 2K3IA 2GGOA 3A3OB 3NMRA 3A12A 4DR7F 2CWFA 1Y5IB 2DGVA 1RDRA 1RU1A 4R0EA 2W9BA 2RRNA 3PIOQ 1F1BB 4NEYA 1K0VA 1R0AA 4MH8A 1Z4UA 3CD0A 3DU6A 2XY7A 3UQSA 2VASA 4NA3A 1C1CB 1PG5B 2ADBA 4X84A 5DLFA 1NZAA 1HBNB 4RX6A 3HHNB 1RWUA 4F0HA 1IBMF 4MPIA 4DQPA 4KNXA 3GFZA 2VFVA 1CG2A 3MTKA 4NE9C 5T14A 2FHJD 2A6MA 3MCNA 3BQ2A 2B7CB 5KG7A 4B9MA 1JMTA 3LAMA 2ORVA 3M1VA 2WBRA 3D3CJ 4QWAA 2DR7A 3I4PA 3SV3A 2VOPA 2CVIA 2QSFA 3MCOA 2QTWA 2ACMA 4USWA 5L9XA 4DR7J 3EGNA 3PRBA 1HNIB 1Y1CA 4ZK7M 3W9IA 1RT4A 2CG8A 2YQ3A 1E6VB 1TBOA 2CPEA 4KPXA 2HS0A 1VBYA 3AJDA 4QR1A 3FFIA 2EFOA 4DJBA 1WI8A 1FJCA 1VS3A 3V6DB 4R7PA 1SSTA 4WFBQ 1T3NA 3LGMA 3LWMA 4MK9A 2QJ3A 2FHJA 3KLEB 4I64A 4LQ9A 4DLGA 1LWXA 4CNYA 4MK7A 4PUOB 3EGWB 4NXNF 2LQ9A 1IBMJ 2UP1A 2FJDB 2C3MA 1NHKL 3J80Y 4MAKA 3GZ7A 4QW9A 2WTFA 1EAYC 1K9MT 1FWLA 3HLUA 1ULRA 1RGVA 1XMOF 2YNFA 4NLSA 4PG8A 4QR0A 4C0BA 4RW6A 1NHUA 4WPAA 5C24B 5F3TA 4FS1A 1BMOA 3CMAS 1RHRB 2ICXA 2EBGA 2O1PA 2RNEA 3IR7B 4WTYA 2CJQA 3AODA 1X8DA 3M7VA 5GAHU 4DMZA 4YUDA 3FEYB 1OMSA 1YU6C 2KH9A 4I67A 2AJ2A 4ID5B 5LL6d 1RSCA 1HHSA 2I2YA 2DKVA 3W3SA 2BQ3A 1JJ4A 4NXNJ 3TZZA 2GQCA 3EPIA 1X4FA 4F0MA 3SSQA 4HYKA 3SGQI 2DD8S 3K5OA 1XMOJ 1FEEA 4NPOA 3TANA 1CJTB 5IT9U 2V0JA 2GAHC 4TLRA 5MAOA 3MD1A 3D54A 1YTPA 1EP4B 1GNKA 3QZ7A 3BBFA 3T9ZA 1G6BA 3DRPB 3SSSA 4CTAB 3ETMA 3N5BA 3E01A 4KTQA 3MFIA 1OY9A 2KM8B 3K5LA 3OHBA 2A0FB 1YLXA 4M5GA 1O5JA 4TXSA 3DN9A 2ERRA 4MKBA 3UD3P 5KFYA 4WIQA 1X9MA 5GVQA
chains in the Genus database with same CATH topology
4DQIA 4RW9B 5KFAA 2IA6A 2KT3A 5AFUU 1U47A 2KXHA 2ZVSA 1N8RT 1QE1A 1VK8A 2L08A 4LT6A 4DR2F 4X4UA 1JXEA 3NBPA 5I42B 2MKJA 2RIJA 2F8EX 4ZCMA 1WEZA 1R3NA 3BM7A 4FPRA 1NKCA 4A8MP 3CC4S 3RB6A 3MUVP 2N7YA 4KV8A 5A8RA 3MM6A 4J9MA 2RKIB 3QO9A 1VOMA 2GX8A 3DMJA 3GV5B 4NLVA 1RT2A 3KTQA 4QCLA 1TL5A 2R9LA 2WSFC 3BGLA 4USIA 4UUWA 4RW4A 3UR3C 3CTRA 4WFAQ 4M1KA 1J5OB 2BUNA 1N36F 4CO5A 2LXIA 3N4WA 2DK2A 2UVRA 5HROB 2FVQA 4LFBF 4M2BA 2GW8A 2B4PA 1RISA 5FIIA 3CIMA 3OJSA 1NH8A 1TP7A 2C3UA 3X3UA 2ZZNA 2KFNA 4DUZF 1W25A 1G97A 1URRA 4A48A 5LMNF 3D0HE 3BQ0A 1NK8A 1LWFA 1TL3A 3UDLA 4O23A 5I3UA 1AUDA 2CQIA 1HWIA 3NBPB 2Q6CA 3G96A 5F9NA 5JJBA 1J2ZA 3JAMY 3Q0AA 3SV4A 2YNIA 5M2RA 2OTLS 1U1MA 2QLWA 2RQ4A 1N48A 3TK8A 1FRXA 3K5NA 1TL4A 3CJ3A 4KV8B 5A8RB 1M1KT 1APSA 1FDBA 1VMBA 3DMJB 1HWJA 1RT2B 2B6AA 1H2VZ 2NUUG 2KI2A 4RW4B 3UPFA 1UVIA 2ZE2A 4N47A 5DRKA 1JLGA 3ENVA 3KG0A 2GQQA 3DOLA 2YWKA 2DT9A 2OP5A 4F50A 3KMSA 3BR8A 4X64F 4DG1B 4GC7A 2LU2A 5LSRA 1TL3B 3V6JA 2XSFA 5I3UB 1UEVA 4DHVA 3CGIA 1CVJA 1QQ0A 6FD1A 5CZVA 4E8UA 1VQYA 2NPOA 5F0WA 3FRYA 2IU9A 4ECZA 1NEEA 3LP1B 2KO1A 3KLHB 2O3DA 1YGYA 2FUG9 4EGLA 1T05B 2DHXA 1S6OA 3VR1A 4LF7F 4C4WA 2DR8A 3V4IA 4FS2A 2Q66A 2ZBIA 2ILZA 4I6AA 3DOLB 1ZM2A 4N69A 1HFEL 2Z0GA 2ZUGA 3IA0A 3PHEA 3KJVB 4HVZA 1G3OA 3DRYA 1IJEB 4J9SA 1R89A 5HQ8A 1FK9A 2CQ1A 3TIOA 1J2VA 2DNPA 2NXUA 2F7VA 1HNVA 1RT7A 1DARA 3OL7A 3HZGA 4FF1A 2UU9F 4I2QB 1KRVA 1OQ6A 5LSOA 1YP2A 2F3JA 4AA7A 3MM7A 1HI0P 2OMOA 3UWTA 4WJBA 4WXOA 2C2DA 1FNXH 2KRRA 4ED8A 2AJ0A 1VGYA 1VBZA 1IQZA 1FTCA 3WBZA 2ZJRQ 3TQ1A 4KKOA 3Q1XA 4O0IA 4ED7A 3GFHA 4K4ZA 1JK9B 1VIXA 4IH7A 3V4IB 1HR0F 1FDAA 1R8HA 2XGQA 2ZHAA 1NJWA 2K8GA 3ZFVA 1DLOA 2LQ5A 4OHVA 4I56A 3GIKA 5KFDA 4NYZA 4NLWA 3V81A 2DVIA 2YVSA 2X1FA 4X65F 1S72S 2CPIA 2MHNA 3GV7B 2P2OA 2DRBA 4USHA 3E2EA 2HHXA 1P6TA 1HNVB 3B4DA 3P3DA 3PW0A 3PW4A 3UW1A 2HWTA 1YTYA 3K57A 2V4QA 3HI9A 2IRXA 2LXUA 3I82A 2GO8A 3MM7B 4URSA 3J7YU 2VA2A 1BLUA 3HM9A 3OVAA 4KNRA 1YP3A 1S6QB 3OQ2A 4RNHA 4DN0A 3CD5A 4ALZA 4LFCF 1NHVA 3P5TL 4BC9A 2C3OA 2JC0A 1FVSA 1JLQA 1HQEB 1S9GA 3ZZUA 2MYFA 4A8OA 1N88A 3K5PA 3EH0A 4H4KC 3HX9A 1QVFR 3C6TA 1X4CA 1SL0A 2OEGA 1U1KA 2BM1A 1YSJA 4RKUC 1KK4A 2XWYA 3OXLA 3MFHA 2YWFA 2W7PA 2UVVA 1DLOB 1GAOA 4HTJA 4ITSA 1U1QA 4DV1F 3V81B 5KFCA 3IO1A 2PT0A 4ECYA 1HPZA 4G3IA 4M28A 3G9CA 2SXLA 2HW3A 4LMZA 1FKOA 3JTOA 3J7A1 4NLXA 2MGZA 2EG1A 2Q1LA 1FJGF 1CC7A 1N52B 4OHZA 1V67A 4ERDA 1T03A 1P1LA 1JLQB 4CO4A 2HQ3A 1TKTA 3H40A 1S1UA 2YKNB 5KT5A 2IM0A 3MMJA 3LF0A 4LSLA 1HBUB 3JTPA 3SQGA 4PKDB 2GV1A 4K4XA 3C6TB 4X4SA 4IQXA 3MOZA 2UZAA 3KLGA 4O3OA 5LMUF 3RU0A 3IXCA 3BS9A 4Z2XA 2XLIA 2QO3A 2XMTA 1RKJA 5CCLA 3FQLA 4X66F 4DV6F 5EHHA 4E6UA 2BA9A 2R7WA 2I9SA 2VFRA 2OJ3A 7FD1A 3M6WA 3EUNA 2B5JA 2DGXA 1HPZB 1NH7A 2MJNA 1CEZA 2W4PA 2CQBA 5F42A 5EX3A 3DLJA 1FKOB 5KFPA 3I5BA 3EEVA 2ALZA 1F2GA 3LW5C 2NLWA 1VIOA 4P7TA 2VG7A 4OJ3A 4YDDB 2ZH2A 4WKYA 2IBOA 2V4JA 1T03B 1TKTB 4HI2A 1Q8LA 3PVXA 2FGCA 3SQGB 2W0WA 1IKXA 2YWHA 2BOPA 1R43A 2DR5A 1ZYQA 1B64A 2XLJA 5F8GA 4ZPWR 2MHEA 1JLEA 1KTVA 1TL1B 4PXEA 4NYOA 4UQGA 4Y2AA 2XO7A 5EWEA 5L1KA 1WG1A 1YRUA 1F5AA 3M32A 1TKZB 1UEUA 1ZAVA 2GGPB 3CEDA 3CJKA 3CSKA 4RW7B 4N77A 2ZHBA 1KSPA 1BQMA 1UP1A 3OL8A 2V0IA 4QWDA 3MUMP 2ZH3A 4XDDA 1P8GA 2DNZA 2GJIA 4JI2F 4CO2A 1OSDA 4QIVA 3OTBA 1KQFB 4G87A 2MKIA 4HT5A 5ITHA 1U8SA 3S1TA 1KRUA 2HWHA 2VBWA 3DFEA 5DO2A 3RB0A 3OL9A 2FVRA 4Q44A 5BJRA 3MR6A 4M8LA 1KTQA 3BSNA 3V5RA 2VG5A 5L6VA 1XR5A 5DDRC 2M5YA 2XZWA 4K4UA 3I0SB 2R7VA 4ZPCA 3H4DA 1REVA 3BSWA 1S1VB 1NK5A 1JLEB 1AXQA 3TP2A 3Q8RB 3N28A 1S49A 4ZP9A 2Q79A 1FD8A 3M32B 3I3AA 2BYCA 1YIJS 1TAQA 3PR4A 5KOWA 1X7VA 2AYGA 4B17A 4CCHA 2MKSA 2C42A 2ZH8A 1UWBA 5DS7A 3OL6A 4CO3A 4R5PA 2CJBA 5IFMA 1U4BA 2CQPA 2M2BA 3NAIA 2J9DE 1T7PA 2ZFHA 2HGMA 3OFEA 2NUHA 2AGPA 1WACA 4MIAA 5DGAA 1U24A 3IFEA 5J2MB 1BWEA 1N54B 4OIXA 3BGRA 3WDOA 2YKMA 4PCQA 2IRYA 2VKRA 1H7WA 1L3VA 2ZH6A 3S7RA 5H9FJ 1N5QA 2GMLA 1DQAA 4NRTA 3PDNA 4CIOA 4EYHB 5DG7A 2KYZA 1NB7A 3B8HA