5E4WA

Crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
109
structure length
109
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
molecule keywords Thioredoxin-1
molecule tags Transport protein
source organism Escherichia coli o157:h7
total genus 26
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5e4wA00
1K0MA 1SJ6A 1WE0A 1SK0A 3HY2A 2H1BA 2TRXA 1XVQA 2ON5A 1N8JA 2F3MA 4HQSA 1GWCA 2D2ZA 1E2YA 2NDOA 1FAAA 2EC4A 5HR2A 4KNDA 2WRTA 2H0GA 1HYUA 5HR1A 4GSSA 4RI6A 5A4UA 2JZRA 4NHZA 3ZLPA 3GRXA 3QAGA 1V57A 2GZZA 1ZCPA 4POLA 2VO4A 2VCZA 1E6BA 2CVKA 1U3IA 4F03A 4HU7A 1O73A 1EEJA 4ZL9A 5ELAA 1A2JA 4GTUA 1KEBA 5D96A 3LYKA 4K0NA 2VIMA 1QXHA 3LORA 4XCSA 1VRSD 3GA4A 2LSTA 1NM3A 2L59A 4DVCA 3VK9A 4IJ3A 1T00A 1EGRA 5ECOB 1PX6A 1UA5A 3TKQA 3QDNA 3QOUA 2XBQA 5DVBA 5IM9A 1T4ZA 1SD9A 2HFDA 3FR9A 2CAQA 5DCGA 3G7JA 3ZL5A 2I9HA 4G9HA 1MEKA 2LNTA 4LL4B 1YY7A 5DALA 5ECNB 3ZYWA 2ALBA 3LJRA 1JZOA 2C0DA 1BYEA 3EU4A 4IHUA 2FNOA 2YV7A 2DJ0A 5ECQB 5ECRB 5G30A 2DLXA 4MJAA 2H66A 1Z5YE 3GSTA 1FW1A 3ZTLA 3JCML 2K6VA 1LBKA 4F0CA 5A4WA 3ZRDA 1PL1A 5LCZA 2HZFA 1AC1A 2VL3A 4ZL8A 3LGCA 1EP8A 3UVHA 2GLRA 5ECKB 2CT6A 3I6AA 3TKPA 4FIWA 4AJ8A 2L6DA 3KGKA 4RUVA 1ML6A 2M80A 1SL0B 2NTOA 5IO0A 2ES7A 1VF3A 3WT2A 4K7OA 2A2RA 3DEXA 4GQCA 1XW6A 5D8IA 1THXA 3DD3A 1YQ1A 2I3YA 1TU7A 3HJOA 1XOAA 2QSIA 2C0FA 1A0FA 2VCQA 3H79A 2DJJA 1U6TA 1VGLA 2LTKA 3UIWA 2C3NA 3BOAA 1ZYEA 3GNJA 1FOVA 5DALB 4Q5NA 4CW9A 2F51A 5B6MA 4OFNA 4HJ2A 4KE3A 2FLSA 1Q4JA 4GQFA 3KD0A 2FWHA 4H86A 2CZ2A 3KMOA 4MLYA 1X0RA 2WS2A 2H74A 1EZKA 3F3QA 4IP6A 4HJMA 4JR4A 2CA8A 2R4VA 3F8UA 2YV9A 1OYJA 3VWVA 5B8BA 3BCKA 4I97A 5EY6A 3IV4A 4MF5A 4NPBA 5H5QA 1V9WA 5IQYA 1EWXA 1A2MA 1R7HA 3ZMKA 1OC3A 3TOTA 1Q98A 2PPTA 1A0RP 3TGZA 3IXRA 4ZB8A 2R3XA 3UOMA 1FHEA 2VL9A 4NAXA 3F3RA 1CQHA 16GSA 2JU5A 1W4VA 2FWFA 4IELA 2LUSA 1AQWA 2WJUA 1C72A 2GQKA 2HT9A 1RK4A 2EIQA 2VM2A 1FVJA 5IMCA 2H1DA 3FZ5A 2CAIA 5J9BA 1BAYA 1I5GA 4BWSA 2QGVA 3TB2A 5AGYA 1M9BA 3UEMA 5DDLA 1PKZA 2HNLA 6GSTA 3FEUA 2H8LA 5IMFA 1B9XC 1QFNA 11GSA 3HJPA 2FA4A 5CRDA 1PA3A 3M0FA 2JADA 3HVSA 3NIVA 2HE3A 2ZNMA 3RHCA 5ECLB 1GH2A 3GL5A 1BJXA 3TKSC 4YQVA 2O7KA 3HHVA 1ABAA 3M9JA 4OFTA 1MD3A 3HXSA 2CX3A 4WF4A 3VLNA 2RUFA 4GSTA 3H93A 7GSSA 4MH3A 2LNSA 4N30A 5HFGA 4NMUA 4PQIA 5E4WA 3GH9A 5KN2A 2K9FA 2L5OA 1K3LA 4N11A 2YWOA 2MBTA 3H8QA 2AAWA 14GSA 1B4PA 2GSSA 2J9HA 1GNWA 3SBCA 3D22A 3VWUA 2B3SA 5CRWA 1PRXA 2XPEA 4OO4A 3VFIA 1S3AA 4K2DA 1U87A 9GSSA 1SL1B 1ERTA 1U3AA 3LG6A 2X8CA 3NZNA 3V1WA 4XRDA 2E2GA 1GTAA 1XIYA 1Z6NA 5EVOA 4ML6A 3I9V2 3D4TA 2C0GA 1PD21 4WBJA 5IMVA 1J0FA 3MDKA 3W8SA 1XOBA 2GS3A 4JR6A 3L4NA 4MH2A 2VUPA 4BVXA 2F8FA 4WR4A 1VF2A 1USBA 3QFAC 5B8AA 4F82A 3FR6A 4GRFA 4V1Ag 17GSA 3IA1A 3TRPA 4LMWA 10GSA 4HI7A 3BJ5A 4WKWA 1AXDA 3PH9A 2LV3A 4Z7XA 1V58A 1TOFA 3AY8A 4G19A 2RM6A 1X9SB 1F3AA 2FHEA 3UBKA 5ENUA 2G2QA 1A8YA 3QAVA 1YEPA 1K3OA 3P90A 2B5YA 2FWGA 4TRXA 2PWJA 1SL2B 1R26A 1ERWA 2B6MA 5LNKe 4K0GA 3WGEA 2H73A 3KP8A 2BMXA 2IL3A 1KBNA 5IOXA 4KCEA 3I43A 3DXBA 1WOUA 2H6XA 5F05A 2FD3A 4QL9A 1DBYA 3PINA 4DSSA 2HYXA 2DC5A 5F0GA 4IN0A 22GSA 3CTFA 5ECSA 2XPDA 1TP9A 3F4SA 2MMOA 4XS1A 5AN1A 2XBIA 3UL3A 1V98A 4ISDA 3TJGA 4NV2A 3GUSA 2AHEA 1TRVA 5AIXA 2OADA 4O7HA 2NVLA 2TRCP 1Z3EA 1TI1A 3GL3A 4XHMA 5IMZA 3CSHA 4MF6A 1GNEA 5AISA 4V2NA 2HSYA 3VI7A 3DVXA 4NWYA 3IOSA 1GL8A 1PN9A 4JEDA 4K7IA 2V2GA 5DQYA 5G2ZA 4ECIA 1ZMAA 4ZBDA 3WD6A 3EURA 2RLIA 2N5BA 2FY6A 5GAND 3WGDA 3LXZA 1O6JA 2IJYA 3O76A 2TIRA 5JWOB 3US3A 3ZREA 3DYRA 4KDXA 4WBRD 5G31A 4DSRA 4BL7A 4YAVA 5DQSA 4DSSB 3GX0A 1OVNA 3H1NA 2IMFA 1HNBA 1MD4A 2CQ9A 3DWVA 3FHKA 3LWAA 4YQMA 5HR0A 8GSSA 1DSBA 4TXVA 1IYHA 2LRTA 3UAPA 1PGTA 2H72A 1M99A 4HZ2A 5INYA 1JZWA 3K8NA 4O92A 5EL8A 3G7IA 4K6XA 2VOCA 3J7Yb 1DE1A 5FHIA 4ZL7A 3UARA 1OKTA 4G2EA 3GFKA 3TUEA 3A2XA 3LEFA 4L8EA 4KSOA 2DMLA 4GXZA 5D9TA 3EMXA 4FYCA 2E0QA 3W6GA 2K8SA 2ZUPA 4XIHA 2C3TA 1F3BA 2OBIA 4MZCA 1K0NA 3RBTA 2FCHA 2DJKA 1B8XA 2OE1A 1SKSB 20GSA 1OE8A 3EC3A 1K0BA 4PGTA 1A8LA 1XXUA 1PSQA 2O8VB 1HD2A 5C00A 3APQA 1OE7A 2H0HA 2PBJA 3CYNA 4OMVA 3BBYA 1I9DA 1O8WA 3GHAA 3IAS2 4CDOA 3U6VA 1G0TA 2V6OA 3HDCA 4K9ZA 3M9KA 6GSVA 4TVEA 1EP7A 3IK9A 4WEYA 5HFIA 3A2VA 4GCIA 5JCUA 3WGXA 5CREA 3F0IA 1ZL9A 2VLVA 4HU9A 2XHFA 3E9JB 1SK2A 2YOIA 3G7YA 4TN8A 3VWWA 3MSZA 1YF1A 1M2BA 3FY7A 1WJKA 2DMMA 5GAPD 2L4QA 2LEGA 2C3QA 5ECMB 5J4UA 4XS4A 3D5JA 1AUCA 5DJLA 3HCZA 1VF4A 2C4JA 4EXJA 3KMNA 4KSMA 5J41A 2YN1A 1MDJA 4HZ4A 2GT5A 2MMZA 2OJLA 2WB9A 2OE0A 5KN3A 3L78A 1S3CA 5HFKA 2O85A 1GP1A 3VPTA 5ECHB 1YDKA 2B1KA 1H4OA 5GZZB 2GSRA 4TW5A 4BVYA 4GF0A 4HQZA 2NBSA 2IN3A 5ELGA 1EOGA 19GSA 3IHQA 5A5KA 4FYBA 2B7JA 1OAZA 1PMTA 3TOUA 2KLXA 1GSUA 4DSQA 4EVMA 2AB6A 3GH6A 3UVTA 1GTIA 2VCXA 1FG4A 1XFLA 4J56E 2JSYA 2OKAA 3D0ZA 2IMKA 3LFLA 2GDRA 2GQMA 4X1UA 4XS4B 3EMPA 4D73A 2P5RA 4E8HA 3UMAA 4PXOA 2LQOA 4MMMA 4TXOA 1WWJA 1J9BA 3FZAA 3TCOA 4ZILA 5FWGA 1THOA 4RQRA 2R37A 1UVZA 1Y6EA 3EVIA 3QR6A 2JACA 2KUCA 3RPNA 3KCMA 2R2JA 4K7NA 3KH9A 12GSA 3CMIA 2V32A 1JLVA 1GTUA 4PUAA 2M46A 1W89A 2MBSA 3GSSA 5D9VA 1DE2A 3IBHA 4NHWA 1AQVA 4I8BA 2KOKA 2LKUA 2X8GA 1X9MB 3KTBA 1ZOFA 2X8HA 4E8EA 3FR3A 1QQ2A 2HI7A 3GKKA 1SD8A 1JZRA 2H6ZA 2OA7A 2OE3A 3TJBA 4PUFC 4PURA 3TJJA 4D73B 2BJXA 3N9JA 4KX4A 1RW1A 1G7OA 3TDGA 2RUEA 3IPZA 4JU5A 2V41A 4TKYA 1TK5B 3BD2A 5KN0A 4TXOB 5DCHA 5KEJA 1X5DA 3KH7A 2ON7A 4I2TA 4YQUA 2JSZA 2O89A 2YJHA 3L9UA 3O6TA 1X5EA 1S3DA 2O87A 2I81A 2H1GA 3LSZA 4I5QA 2YPMA 4X43A 1IYIA 4NV5A 3GYKA 3KTLA 1XZOA 2YWIA 3EYTA 4ECBA 2VAFA 1XW9A 2KHPA 4J57E 5CP1A 3HVVA 1GRXA 2VL2A 2J23A 2Z9SA 2L5LA 4EC0A 1SJIA 2YWNA 5F8BA 1FO5A 1QUWA 1Z7RA 2B5XA 1EGOA 3P7XA 1QMVA 1SJZA 1MTCA 1FB6A 4N0ZA 1XW5A 2PERA 2V1MA 1JZDA 2XC2A 4WR5A 3CSIA 1HNAA 2MMAA 4KB3A 3L9SA 2DSAA 5IPGA 3F4TA 1NHOA 2VD1A 3APOA 3IAM2 4HDEA 2NPBA 6GSXA 2DJ2A 2MYGA 3UBLA 1FB0A 5COHA 4EDZA 3QMXA 5F07A 1YKAA 1M7TA 2OBKA 1M2DA 1AW9A 2QC7A 4I2UA 2DIZA 3LXTA 4EDYA 4AF2A 2H76A 4IJIA 1U88A 2VD0A 1GULA 1O8XA 1UN2A 5D9WA 1N2AA 4ACSA 4HS1A 4RQXA 4MDCA 4QQ7A 1XPVA 3CBUA 2AJQB 1TDIA 4O5RA 1V2AA 2IPAA 2R5GA 3DRNA 1XWBA 4YAPA 3UJ1A 2GGTA 2H75A 2H71A 3RHBA 2YNXA 6GSWA 2WDUA 3CSJA 3PGTA 4IW9A 3HYPA 3PR8A 3FK8A 2LRCA 4G10A 1YJ6A 5L71A 5H5SA 1XCCA 4WF5A 3HA9A 1OC8A 1EV9A 3R2QA 3HZ8A 4Q5FA 2EIRA 2X64A 3RPPA 2YJ7A 4N10A 2KP1A 2M72A 5G1LA 2L57A 1TRSA 3RDWA 4O32A 1PL2A 1GLQA 2MZCA 3GKMA 4QL7A 4BWQA 3QCPA 2IFQA 3ERWA 2I1UA 4OD7A 1CQGA 5C04A 4F9ZA 1HNCA 2C0EA 2PVQA 4JZQA 3KJYA 5CNWA 3U5RE 2F8AA 3EINA 3F4RA 4KDUA 5AIVA 4IP1A 1YF0A 3BCIA 3ZIJA 1SU9A 5HR3A 2LJKA 2IMEA 3CRTA 1V40A 3TKSE 2QKEA 1NW2A 3D6IA 3ZVJA 1JFUA 3KEBA 5GSSA 2FA8A 1K3YA 2WFCA 3L9VA 1ERUA 2CVDA 1Z7PA 5B7CA 2K18A 4ZXGA 2VLTA 1M0UA 3HJMA 1Z6MA 1GUKA 4KW6A 4AGSA 3F6DA 3QD9A 3L0HA 2GTUA 2VCTA 2WZ9A 4IGJA 3D21A 2IFQB 2IMDA 4MZBA 1TTZA 2WCIA 2LJAA 2L6CA 1M9AA 2IIYA 3E0UA 3IK7A 3ZVJD 2GVPA 4POMA 2WULA 3F6FA 1UC7A 5DAKA 2JL4A 4PNGA 3FZ4A 3CRUA 1KNGA 3VI5A 1B4QA 4HUAA 4L0WA 3OR5A 2A4VA 2X99A 1MDIA 1PX7A 4WXTA 4OWYA 1T4YA 4IQAA 2F9SA 4TR1A 5IIZA 1J08A 4MJBA 4L0UA 4V1Ap 1LJRA 2E7PA 4MA9A 5IPHA 1OC9A 2OACA 2B5EA 1MDKA 4TR4A 1XWGA 1AQXA 3ERGA 3C8EA 3VWXA 4EE0A 5A4VA 3DIEA 5KN1A 3DGQA 3KIJA 1SK1A 2KP2A 3TRQA 4GWRA 2K8VA 4IBPA 1A24A 3M8NA 13GSA 2HXKA 4PNFA 1JLWA 4KH7A 1GSQA 1KTEA 2H19A 1F37A 3GURA 3G9BA 4MCUA 4MPGA 4KGIA 2DIYA 2AV4A 3IDVA 4JBBA 3QPMA 4XS6A 5DAKB 5CRHA 5H5RA 4MPFA 3HZ4A 2PUKC 5F06A 1K0AA 1X5CA 2L4CA 4V2LA 5E59A 4RI7A 1O81A 4L5LA 1HQOA 1XWKA 3MAKA 4ULXA 4TR0A 3GKNA 2JZTA 4ZB6A 2H1AA 2DJ1A 6GSSA 4TR1B 4FO5A 3Q6OA 3HD5A 3D4MA 3C7MA 3GKXA 1WMJA 1YEXA 2VM1A 4BPYA 1OC9B 3LYPA 2C1YA 3C1SA 4WETA 4AJ6A 2GZPA 3IC4A 1ERVA 3ZZXA 1K0CA 1DUGA 3EWLA 5D73A 4EKZA 5JWRB 5J3RA 3EE2A 1NSWA 4KUNA 2CVBA 2FWEA 1GSSA 2H30A 1O7UA 2GT6A 3MWHA 2LRNA 4KAEA 1WPIA 4IQ1A 2YP6A 1XWCA 5IMDA 2VL2C 4LA1A 2B7KA 3KP9A 3P8WA 5IO2A 3ERFA 3P2AA 1XVWA 5JCGA 4NXIA 4ID0A 1SYRA 3FRCA 3EU3A 4ECJA 1YZXA 1H75A 4IVFA 1JHBA 1GSDA 4F2IA 3TJFA 4XTSA 2HRNA 1TRWA 2GQLA 2V6KA 5CO3A 3WT1A 4IS0A 5EPFA 3I69A 4EL1A 2LJRA 4TOPA 6GSUA 1GTBA 1GSEA 2R6KA 5HQPA 2N5FA 3TRXA 4IKHA 3VPQA 3IRAA 4EO3A 4DEJA 4EUYA 1XWAA 5JWQB 2I4AA 2H6YA 5ID2A 1R4WA 4TR3A 1TJDA 4GLTA 3E3EA 5CRGA 3CTGA 4LLRA 4X0XA 3ZIVA 2H70A 2DJ3A 3APSA 3FYGA 1GSFA 4BA7A 5CAXA 1TI3A 5IOWA 3C71A 1TW9A 4FYUA 1WRYA 2WGRA 1ILOA 4LMVA 3GX8A 4MABA 2YCDA 3ISOA 4K1FA 2LQQA 1A2LA 2HRFA 5DJMA 1R5PA 2RIIA 2H01A 4JE1A 1B48A 2JZSA 5CYYA 1URMA 1TXXA 2VCWA 2IMIA 2GZYA 5JCWA 4OCEA 3F9UA 3M3MA 5ECPB 1EEMA 3DVWA 2CZ3A 1YKCA 1BQ7A 2PU9C 1SKWB 4OCFA 4POBA 4KDYA 1SKRB 4P3YB 5FT3A 4J2FA 2CV4A 3FZ9A 5G5FA 5ID2B 3KXOA 4ZBBA 3DMLA 1GLPA 4JRRA 3A5WA 2YANA 3O3TA 1G6WA 3TKRA 1BG5A 4MF7A 2FGXA 3LQ7A 4K8MA 3Q74A 3VURA 2PMTA 1QK8A 3IR4A 1GSYA 5ABRA 5GSTA 1T3BA 3C1RA 5IMAA 2GSQA 1ZGNA 1WP0A 3KM6A 3Q18A 1T7PB 3ED3A 2YWMA 2ZCTA 1Z9HA 2BTOT 1F2EA 3C73A 4ZIJA 6GSYA 1ZYQB 2MMNA 5G1KA 2E2MA 1NHYA 2VLUA 3SWLA 2FUG2 2HZEA 4PQHA 4ZB9A 2LS5A 2YZUA 3ZFLA 3HKRA 4KA0A 3A3TA 2REMA 2P0GA 3ZITA 1EOHA 1SYXA 4ZBAA 1AAZA 4HEA2 5D9XA 2RM5A 4OO5A 2P5QA 4N0VA 3ME8A 3WYWA 18GSA 1FVKA 2GSTA 1ST9A 1M2AA 4XRAA 4PX1A 1TKDB 1EV4A 3IE3A 1Y25A 1K0DA 3ME7A 3FKFA 5ECIB 4EF0A 2N5AA 1ON4A 1RQMA 3GTUA 3CXGA 3FW2A 2C8UA 5G5EA 4F0BA 1PKWA 2G0FA 3M1GA 1ACVA 3S9FA 2P31A 3TJKA 3J7Yk 1X9WB 1VF1A 2EIOA 2HZEB 2IWTA 2C80A 1T1VA 2CX4A 1F6MC 2B1LA 4ML1A 3TKSA 4MZWA 3A2WA 5J5NA 3GV1A 3ZMLA 1K0OA 1G7EA 4MJCA 4GSNA 3HVXA 4LL1B 3ZFBA 1XBSA 1F9MA 4ECCA 3KZQA 4Q5RA 1LU4A 4Q5QA 1SENA 3QFBC 3MNGA 2DBCA 4POKA 3NOFA 5LD0A 1OKDA 1PQNA 2HLSA 4ILFA 2PGTA 3QAWA 1R5AA 2PN8A 1O85A 3GIXA 1TK0B 3GMFA 2A2SA 1AIUA 2AYTA 1GUHA 1TU8A 4YH2A 3H4KA 1BEDA 3F63A 1TRUA 1B9YC 2H0IA 3DKSA 4V2MA 1TK8B 1G6YA 3GTUB 4MP4A 3Q19A 3RAZA 1WIKA 2VCVA 1A23A 4L5OA 4CHSA 1GUMA 5B6NA 4MK3A 4OFMA 1QGVA 3W8JA 1BX9A 2YZHA 5D93A 2HSHA 1T8EB 4AJ7A 5J9CA 4FH8A 4PQ1A 2PVOC 4I6XA 3N5OA 2AUVA 5DBQA 3GN3A 1ZZYA 4MJEA 4HOJA 4KCAA
chains in the Genus database with same CATH superfamily
1K0MA 1SJ6A 1WE0A 2UZ8A 1SK0A 3HY2A 2H1BA 2TRXA 1XVQA 2ON5A 1N8JA 2F3MA 4HQSA 1GWCA 2D2ZA 1E2YA 2NDOA 1FAAA 2EC4A 5HR2A 4KNDA 2WRTA 2H0GA 1HYUA 4FQUA 5HR1A 4O5QA 4GSSA 4RI6A 5A4UA 2JZRA 4NHZA 3ZLPA 3GRXA 3QAGA 1V57A 2GZZA 1ZCPA 4POLA 2VO4A 2VCZA 1E6BA 2CVKA 1U3IA 4F03A 4HU7A 1O73A 1EEJA 4ZL9A 5ELAA 1A2JA 4GTUA 1KEBA 5D96A 3LYKA 4K0NA 2VIMA 1QXHA 3LORA 4XCSA 1VRSD 3GA4A 2LSTA 1NM3A 2L59A 4DVCA 3VK9A 4IJ3A 1T00A 1EGRA 5ECOB 1PX6A 1UA5A 3TKQA 3QDNA 3QOUA 2XBQA 5DVBA 4G0IA 5IM9A 1T4ZA 1SD9A 2HFDA 3FR9A 2CAQA 5DCGA 3G7JA 3ZL5A 2I9HA 4G9HA 1MEKA 2LNTA 1S3RA 4LL4B 1YY7A 5DALA 5ECNB 3ZYWA 2ALBA 3LJRA 1JZOA 2C0DA 1BYEA 3EU4A 4IHUA 2FNOA 2YV7A 2DJ0A 5ECQB 5ECRB 5G30A 2DLXA 4MJAA 2H66A 1Z5YE 3GSTA 1FW1A 3ZTLA 3JCML 4Z2UA 2K6VA 1ZYNA 1LBKA 4F0CA 5A4WA 3ZRDA 3R3EA 1PL1A 5LCZA 2HZFA 4A5PA 1AC1A 2VL3A 4ZL8A 3LGCA 1EP8A 3UVHA 2GLRA 5ECKB 2CT6A 3I6AA 3TKPA 4FIWA 4AJ8A 4PTSA 2L6DA 3KGKA 4RUVA 1ML6A 2M80A 1SL0B 2NTOA 5IO0A 2ES7A 1VF3A 3WT2A 4K7OA 2A2RA 3DEXA 4GQCA 1XW6A 5D8IA 1THXA 3DD3A 1YQ1A 2I3YA 1TU7A 3HJOA 1XOAA 2QSIA 2C0FA 1A0FA 2VCQA 3H79A 2DJJA 1U6TA 1VGLA 2LTKA 3UIWA 2C3NA 3BOAA 1ZYEA 3GNJA 1FOVA 5DALB 4Q5NA 4CW9A 2F51A 5B6MA 4OFNA 4HJ2A 4KE3A 2FLSA 1Q4JA 4GQFA 3KD0A 2FWHA 4H86A 2CZ2A 3KMOA 4MLYA 1X0RA 2WS2A 2H74A 1EZKA 3F3QA 4IP6A 4HJMA 4JR4A 2CA8A 2R4VA 3F8UA 2YV9A 1OYJA 3VWVA 5B8BA 3BCKA 4I97A 5EY6A 3IV4A 4MF5A 4NPBA 3EPTA 5H5QA 1V9WA 5IQYA 2HRAA 1EWXA 1A2MA 1R7HA 3ZMKA 1OC3A 3TOTA 1Q98A 2PPTA 1ZYPA 1A0RP 3TGZA 3IXRA 4ZB8A 2A4HA 2R3XA 3UOMA 1FHEA 2VL9A 4NAXA 3F3RA 1CQHA 16GSA 2JU5A 1W4VA 2FWFA 4IELA 2LUSA 1AQWA 2WJUA 1C72A 2GQKA 2HT9A 1RK4A 2EIQA 2VM2A 1FVJA 5IMCA 2H1DA 3FZ5A 2CAIA 5J9BA 1BAYA 1I5GA 4BWSA 2QGVA 3TB2A 5AGYA 1M9BA 3UEMA 5DDLA 1PKZA 2HNLA 6GSTA 3FEUA 2H8LA 5IMFA 1B9XC 1QFNA 11GSA 3HJPA 2FA4A 5CRDA 1PA3A 3M0FA 2JADA 3HVSA 3NIVA 2HE3A 2ZNMA 3RHCA 5ECLB 1GH2A 3GL5A 1BJXA 3TKSC 4YQVA 2O7KA 3HHVA 1ABAA 3M9JA 4OFTA 1MD3A 3HXSA 2CX3A 4WF4A 3VLNA 2RUFA 4GSTA 3H93A 7GSSA 4MH3A 2LNSA 4N30A 5HFGA 4NMUA 4PQIA 5E4WA 3GH9A 5KN2A 2K9FA 2L5OA 1K3LA 4N11A 2YWOA 2MBTA 3H8QA 2AAWA 14GSA 1B4PA 2GSSA 2J9HA 1GNWA 3SBCA 3D22A 4EIQA 3VWUA 4K2XA 2B3SA 5CRWA 1PRXA 2XPEA 4OO4A 3VFIA 1S3AA 4K2DA 1U87A 9GSSA 1SL1B 1ERTA 1U3AA 3LG6A 2X8CA 3NZNA 3V1WA 4XRDA 2E2GA 1GTAA 1XIYA 1Z6NA 5EVOA 4ML6A 3I9V2 3D4TA 2C0GA 1PD21 4WBJA 5IMVA 1J0FA 3MDKA 3W8SA 1XOBA 2GS3A 4JR6A 3L4NA 4X4JA 4MH2A 2VUPA 4BVXA 2F8FA 4WR4A 1VF2A 1USBA 3QFAC 5B8AA 4F82A 3FR6A 4GRFA 4V1Ag 17GSA 3IA1A 3TRPA 4LMWA 10GSA 4HI7A 3BJ5A 4WKWA 1AXDA 3PH9A 2LV3A 4Z7XA 1V58A 3A5IA 1TOFA 3AY8A 4G19A 2RM6A 1X9SB 1F3AA 2FHEA 3UBKA 5ENUA 2G2QA 1A8YA 3QAVA 1YEPA 1K3OA 3P90A 2B5YA 2X4AA 2FWGA 4TRXA 2PWJA 1SL2B 1R26A 1ERWA 2B6MA 5LNKe 4K0GA 3WGEA 2H73A 3KP8A 2BMXA 2IL3A 1KBNA 5IOXA 4KCEA 3I43A 3DXBA 1WOUA 2H6XA 5F05A 2FD3A 4QL9A 1DBYA 3PINA 4DSSA 2HYXA 4BVXB 2DC5A 5F0GA 4IN0A 22GSA 3CTFA 5ECSA 2XPDA 1TP9A 2DKHA 3F4SA 2MMOA 4XS1A 5AN1A 2XBIA 3UL3A 1V98A 4ISDA 3TJGA 4NV2A 3GUSA 2AHEA 1TRVA 5AIXA 2OADA 4O7HA 2NVLA 2TRCP 1Z3EA 1TI1A 3GL3A 4XHMA 5IMZA 3CSHA 4MF6A 1GNEA 5AISA 4V2NA 2HSYA 3VI7A 3DVXA 3HVNA 4NWYA 3IOSA 1GL8A 1PN9A 4JEDA 4K7IA 2V2GA 2A2PA 5DQYA 5G2ZA 4ECIA 1ZMAA 4ZBDA 3WD6A 3EURA 2RLIA 2N5BA 2R0PA 2FY6A 5GAND 3WGDA 3LXZA 1O6JA 2IJYA 3O76A 2TIRA 5JWOB 3US3A 3ZREA 3DYRA 4KDXA 4WBRD 5G31A 4DSRA 4BL7A 4YAVA 5DQSA 4DSSB 3GX0A 1OVNA 3H1NA 2IMFA 1HNBA 1MD4A 2CQ9A 3DWVA 3FHKA 3LWAA 4YQMA 5HR0A 8GSSA 1DSBA 4TXVA 1IYHA 2LRTA 4G0KA 3UAPA 1PGTA 2H72A 1M99A 4HZ2A 5INYA 1JZWA 3K8NA 4O92A 5EL8A 3G7IA 4K6XA 2VOCA 3J7Yb 1DE1A 5FHIA 4ZL7A 3UARA 1OKTA 4G2EA 4Z2RA 3GFKA 3TUEA 3A2XA 3LEFA 4L8EA 4KSOA 2DMLA 4GXZA 5D9TA 3EMXA 4FYCA 2E0QA 3W6GA 2K8SA 2ZUPA 4XIHA 2C3TA 1F3BA 2OBIA 4MZCA 1K0NA 4K5SA 3RBTA 2FCHA 5BRTA 2DJKA 1B8XA 2OE1A 1SKSB 20GSA 1OE8A 3EC3A 1K0BA 4PGTA 1A8LA 1XXUA 1PSQA 2O8VB 1HD2A 5C00A 3APQA 2QA2A 4BL7B 1OE7A 2H0HA 2PBJA 3CYNA 4OMVA 3BBYA 1I9DA 1O8WA 3GHAA 3IAS2 4CDOA 3U6VA 1G0TA 2V6OA 3HDCA 4K9ZA 3M9KA 6GSVA 4TVEA 1EP7A 3IK9A 4WEYA 5HFIA 3A2VA 4GCIA 5JCUA 3WGXA 5CREA 3F0IA 1ZL9A 2VLVA 4HU9A 2XHFA 3E9JB 1SK2A 2YOIA 3G7YA 4TN8A 3VWWA 3MSZA 1YF1A 1M2BA 3FY7A 1WJKA 2DMMA 5GAPD 2HRKA 2L4QA 2LEGA 2C3QA 5ECMB 5J4UA 4XS4A 3D5JA 1AUCA 5DJLA 3HCZA 1VF4A 2C4JA 4EXJA 3KMNA 4KSMA 5J41A 2YN1A 1MDJA 4HZ4A 2GT5A 2MMZA 2OJLA 2WB9A 2OE0A 5KN3A 3L78A 1PN0A 1S3CA 5HFKA 2O85A 1GP1A 3VPTA 5ECHB 1YDKA 2B1KA 1H4OA 4CY6A 5GZZB 2GSRA 4TW5A 4BVYA 4GF0A 4HQZA 2NBSA 2IN3A 5ELGA 1EOGA 19GSA 3IHQA 5A5KA 4FYBA 2B7JA 5KOXA 1OAZA 1PMTA 3TOUA 2KLXA 1GSUA 4DSQA 4EVMA 2AB6A 3GH6A 3UVTA 1GTIA 2VCXA 1FG4A 1XFLA 4J56E 2JSYA 2OKAA 3D0ZA 2IMKA 3LFLA 2GDRA 2GQMA 4X1UA 4XS4B 3EMPA 4D73A 2P5RA 4E8HA 3UMAA 4PXOA 2LQOA 4MMMA 4TXOA 1WWJA 1J9BA 3FZAA 3TCOA 4ZILA 5FWGA 1THOA 4YKGA 4RQRA 2R37A 1UVZA 1Y6EA 3EVIA 3QR6A 2JACA 2KUCA 3RPNA 3KCMA 2R2JA 4K7NA 3KH9A 12GSA 3CMIA 2V32A 1JLVA 1GTUA 4BVYB 4PUAA 2M46A 1W89A 2MBSA 3GSSA 5D9VA 1DE2A 3IBHA 4NHWA 1AQVA 4I8BA 2KOKA 2LKUA 2X8GA 1X9MB 3KTBA 1ZOFA 2X8HA 3IC8A 4E8EA 3FR3A 1QQ2A 2HI7A 1PFOA 3GKKA 1SD8A 1JZRA 2H6ZA 2OA7A 2OE3A 3TJBA 4PUFC 4PURA 3TJJA 4D73B 2BJXA 3N9JA 4KX4A 1RW1A 1G7OA 3TDGA 2RUEA 3IPZA 4JU5A 4K5RA 2V41A 4TKYA 1TK5B 3BD2A 5KN0A 4TXOB 5DCHA 5KEJA 1X5DA 3KH7A 2ON7A 3FMWA 4I2TA 4YQUA 2JSZA 2O89A 2YJHA 3L9UA 3O6TA 1X5EA 1S3DA 2O87A 2I81A 2H1GA 3LSZA 4I5QA 2YPMA 4ICYA 4X43A 1IYIA 4NV5A 3GYKA 3KTLA 1XZOA 2YWIA 3EYTA 4ECBA 2VAFA 1XW9A 2KHPA 4J57E 5CP1A 3HVVA 1GRXA 2VL2A 2J23A 2Z9SA 2L5LA 4EC0A 1SJIA 2YWNA 5F8BA 1FO5A 1QUWA 3IHGA 1Z7RA 2B5XA 1EGOA 3P7XA 1QMVA 1SJZA 1MTCA 1FB6A 4N0ZA 1XW5A 2PERA 2V1MA 1JZDA 2XC2A 4WR5A 3CSIA 1HNAA 2MMAA 4KB3A 3L9SA 2DSAA 5IPGA 3F4TA 1NHOA 2VD1A 3APOA 4MNNA 3IAM2 4HDEA 2NPBA 6GSXA 2DJ2A 2MYGA 3UBLA 1FB0A 5COHA 4EDZA 3QMXA 5F07A 1YKAA 1M7TA 2OBKA 1M2DA 1AW9A 2QC7A 4I2UA 2DIZA 3LXTA 4EDYA 4AF2A 2H76A 4IJIA 1U88A 2VD0A 1GULA 1O8XA 1UN2A 5D9WA 1N2AA 4ACSA 4HS1A 4RQXA 4MDCA 4QQ7A 1XPVA 3CBUA 2AJQB 1TDIA 4O5RA 1V2AA 2IPAA 2R5GA 3DRNA 1XWBA 4YAPA 3UJ1A 2GGTA 2H75A 2H71A 3RHBA 2YNXA 6GSWA 2WDUA 5KOWA 3CSJA 3PGTA 4IW9A 3HYPA 3PR8A 3FK8A 2LRCA 4G10A 1YJ6A 5L71A 5H5SA 1XCCA 4WF5A 3HA9A 1OC8A 1EV9A 3R2QA 3HZ8A 4Q5FA 2EIRA 2X64A 3RPPA 2YJ7A 4N10A 2KP1A 2M72A 5G1LA 2L57A 1TRSA 3RDWA 4O32A 1PL2A 1GLQA 2MZCA 3GKMA 4QL7A 4BWQA 3QCPA 2IFQA 3ERWA 2I1UA 4OD7A 1CQGA 5C04A 4F9ZA 1HNCA 2C0EA 2PVQA 4JZQA 3KJYA 5CNWA 3U5RE 2F8AA 3EINA 3F4RA 4KDUA 5AIVA 4IP1A 1YF0A 3BCIA 3ZIJA 1SU9A 5HR3A 2LJKA 2IMEA 3CRTA 1V40A 3TKSE 2QKEA 1NW2A 3D6IA 3ZVJA 1JFUA 3KEBA 5GSSA 2FA8A 1K3YA 2WFCA 3L9VA 1ERUA 2CVDA 1Z7PA 5B7CA 2K18A 4ZXGA 2VLTA 1M0UA 3HJMA 1Z6MA 1GUKA 4KW6A 4AGSA 3F6DA 3QD9A 3L0HA 2GTUA 2VCTA 2WZ9A 4IGJA 3D21A 2IFQB 2IMDA 4MZBA 1TTZA 2WCIA 2LJAA 2L6CA 1M9AA 2IIYA 2X49A 3E0UA 3IK7A 3ZVJD 2GVPA 4POMA 2WULA 3F6FA 1UC7A 5DAKA 2JL4A 4PNGA 3FZ4A 3CRUA 1KNGA 3VI5A 1B4QA 4HUAA 4L0WA 3OR5A 3MIXA 2A4VA 2X99A 1MDIA 1PX7A 4WXTA 4HSCX 4OWYA 1T4YA 4IQAA 2F9SA 4TR1A 5IIZA 1J08A 4MJBA 4L0UA 4V1Ap 1LJRA 2E7PA 4MA9A 5IPHA 1OC9A 2OACA 2B5EA 1MDKA 4TR4A 1XWGA 1AQXA 3ERGA 3C8EA 3VWXA 4EE0A 5A4VA 3DIEA 5KN1A 3MYDA 3DGQA 3KIJA 1SK1A 2KP2A 3TRQA 4GWRA 2K8VA 4IBPA 1A24A 3M8NA 13GSA 2HXKA 4PNFA 1JLWA 4KH7A 1GSQA 1KTEA 2H19A 1F37A 3GURA 3G9BA 4MCUA 4MPGA 4KGIA 2DIYA 2AV4A 3IDVA 4JBBA 3QPMA 4XS6A 5DAKB 5CRHA 5H5RA 4MPFA 3HZ4A 2PUKC 5F06A 1K0AA 1X5CA 2L4CA 4V2LA 5E59A 4RI7A 1O81A 4L5LA 3PPUA 1HQOA 1XWKA 3MAKA 4ULXA 4TR0A 3GKNA 2JZTA 4ZB6A 2H1AA 2DJ1A 6GSSA 4TR1B 4FO5A 3Q6OA 3HD5A 3D4MA 3C7MA 3GKXA 1WMJA 1YEXA 2VM1A 4BPYA 1OC9B 3LYPA 2C1YA 3C1SA 4WETA 4AJ6A 4G0LA 2GZPA 3IC4A 1ERVA 3ZZXA 1K0CA 1DUGA 3EWLA 5D73A 4EKZA 5JWRB 5J3RA 3EE2A 1NSWA 4KUNA 2CVBA 2FWEA 1GSSA 2H30A 1O7UA 2GT6A 3MWHA 2LRNA 4KAEA 1WPIA 4IQ1A 1M3JA 2YP6A 1XWCA 5IMDA 2VL2C 4LA1A 2B7KA 3KP9A 3P8WA 4YKFA 5IO2A 1M3IA 3ERFA 3P2AA 1XVWA 5JCGA 4NXIA 4ID0A 2R0CA 1SYRA 3FRCA 3EU3A 4ECJA 1YZXA 1H75A 4IVFA 1JHBA 1GSDA 4F2IA 3TJFA 4XTSA 1XG8A 2HSMA 2HRNA 1TRWA 2GQLA 2V6KA 5CO3A 4EIPA 2DKIA 3WT1A 4IS0A 5EPFA 4BIKA 3I69A 4EL1A 2LJRA 4TOPA 6GSUA 1GTBA 1GSEA 2R6KA 5HQPA 4O5UA 2N5FA 3TRXA 4IKHA 3VPQA 3IRAA 4EO3A 4DEJA 4EUYA 1XWAA 5JWQB 2I4AA 2H6YA 5ID2A 1R4WA 4TR3A 1TJDA 4GLTA 3E3EA 5CRGA 3CTGA 4LLRA 4X0XA 3ZIVA 2H70A 2DJ3A 3APSA 3FYGA 1GSFA 4BA7A 5CAXA 1TI3A 5IOWA 3C71A 1TW9A 4FYUA 1WRYA 2WGRA 1ILOA 4LMVA 3GX8A 4MABA 2YCDA 3ISOA 4K1FA 2LQQA 1A2LA 2HRFA 5DJMA 1R5PA 2RIIA 2H01A 4JE1A 1B48A 2JZSA 5CYYA 1URMA 1TXXA 2VCWA 5BMUA 2IMIA 2GZYA 5JCWA 4OCEA 3F9UA 3M3MA 5ECPB 1EEMA 3DVWA 2CZ3A 1YKCA 1BQ7A 2PU9C 1SKWB 4OCFA 4POBA 4KDYA 1SKRB 4P3YB 5FT3A 4J2FA 2CV4A 3FZ9A 5G5FA 5ID2B 3KXOA 4ZBBA 3DMLA 1GLPA 4JRRA 3A5WA 2YANA 3O3TA 1G6WA 3TKRA 1BG5A 4MF7A 2FGXA 3LQ7A 4K8MA 3Q74A 3CQFA 3VURA 2PMTA 1QK8A 3IR4A 1GSYA 5ABRA 5GSTA 1T3BA 3C1RA 5IMAA 2GSQA 1ZGNA 1WP0A 3KM6A 3Q18A 1T7PB 3ED3A 2YWMA 2ZCTA 1Z9HA 2BTOT 1F2EA 3C73A 4ZIJA 6GSYA 4KF9A 1ZYQB 2MMNA 5G1KA 2E2MA 1NHYA 2VLUA 3SWLA 4USSA 2FUG2 2HZEA 4PQHA 4ZB9A 2LS5A 2YZUA 2R0GA 3ZFLA 3HKRA 4KA0A 3A3TA 2REMA 2P0GA 3ZITA 1EOHA 1SYXA 4ZBAA 1AAZA 4HEA2 5D9XA 2RM5A 4OO5A 2QA1A 2P5QA 4N0VA 3ME8A 3WYWA 18GSA 1FVKA 2GSTA 1ST9A 1M2AA 4XRAA 4PX1A 1TKDB 1EV4A 3IE3A 1Y25A 1K0DA 3ME7A 3FKFA 5ECIB 4EF0A 2N5AA 1ON4A 1RQMA 3GTUA 3CXGA 3FW2A 2C8UA 5G5EA 4F0BA 4CY8A 1PKWA 2G0FA 3M1GA 1ACVA 3S9FA 2P31A 3TJKA 3J7Yk 1X9WB 1VF1A 2EIOA 2HZEB 2IWTA 2C80A 1T1VA 2CX4A 1F6MC 2B1LA 3LW9A 4ML1A 3TKSA 4MZWA 3A2WA 5J5NA 3GV1A 3ZMLA 1K0OA 1G7EA 4MJCA 4GSNA 3HVXA 4LL1B 3ZFBA 1XBSA 1F9MA 4ECCA 3KZQA 4Q5RA 1LU4A 4Q5QA 1SENA 3QFBC 3MNGA 2DBCA 4POKA 3NOFA 5LD0A 1OKDA 1PQNA 2HLSA 4ILFA 2PGTA 3QAWA 1R5AA 2PN8A 1O85A 3GIXA 1TK0B 3GMFA 2A2SA 1AIUA 2AYTA 1GUHA 1FOHA 1TU8A 4YH2A 3H4KA 1BEDA 3F63A 1TRUA 1B9YC 2H0IA 3DKSA 4V2MA 1TK8B 1G6YA 3GTUB 4MP4A 3Q19A 3RAZA 1WIKA 2VCVA 1A23A 4L5OA 4CHSA 1GUMA 5B6NA 4MK3A 4OFMA 1QGVA 3W8JA 1BX9A 2YZHA 5D93A 2HSHA 1T8EB 4AJ7A 5J9CA 4FH8A 4Z2TA 4PQ1A 2PVOC 4I6XA 3N5OA 2AUVA 5DBQA 3GN3A 1ZZYA 4MJEA 4HOJA 4KCAA
chains in the Genus database with same CATH topology
1K0MA 1SJ6A 1WE0A 2UZ8A 1SK0A 3HY2A 2H1BA 2TRXA 1XVQA 2ON5A 1N8JA 2F3MA 4HQSA 1GWCA 2D2ZA 1E2YA 2NDOA 1FAAA 2EC4A 5HR2A 4KNDA 2WRTA 2H0GA 1HYUA 4FQUA 5HR1A 4O5QA 4GSSA 4RI6A 5A4UA 2JZRA 4NHZA 3ZLPA 3GRXA 3QAGA 1V57A 2GZZA 1ZCPA 4POLA 2VO4A 2VCZA 1E6BA 2CVKA 1U3IA 4F03A 4HU7A 1O73A 1EEJA 4ZL9A 5ELAA 1A2JA 4GTUA 1KEBA 5D96A 3LYKA 4K0NA 2VIMA 1QXHA 3LORA 4XCSA 1VRSD 3GA4A 2LSTA 1NM3A 2L59A 4DVCA 3VK9A 4IJ3A 1T00A 1EGRA 5ECOB 1PX6A 1UA5A 3TKQA 3QDNA 3QOUA 2XBQA 5DVBA 4G0IA 5IM9A 1T4ZA 1SD9A 2HFDA 3FR9A 2CAQA 5DCGA 3G7JA 3ZL5A 2I9HA 4G9HA 1MEKA 2LNTA 4LL4B 1YY7A 5DALA 5ECNB 3ZYWA 2ALBA 3LJRA 1JZOA 2C0DA 1BYEA 3EU4A 4IHUA 2FNOA 2YV7A 2DJ0A 5ECQB 5ECRB 5G30A 2DLXA 4MJAA 2H66A 1Z5YE 3GSTA 1FW1A 3ZTLA 3JCML 4Z2UA 2K6VA 1ZYNA 1LBKA 4F0CA 5A4WA 3ZRDA 3R3EA 1PL1A 5LCZA 2HZFA 4A5PA 1AC1A 2VL3A 4ZL8A 3LGCA 1EP8A 3UVHA 2GLRA 5ECKB 2CT6A 3I6AA 3TKPA 4FIWA 4AJ8A 4PTSA 2L6DA 3KGKA 4RUVA 1ML6A 2M80A 1SL0B 2NTOA 5IO0A 2ES7A 1VF3A 3WT2A 4K7OA 2A2RA 3DEXA 4GQCA 1XW6A 5D8IA 1THXA 3DD3A 1YQ1A 2I3YA 1TU7A 3HJOA 1XOAA 2QSIA 2C0FA 1A0FA 2VCQA 3H79A 2DJJA 1U6TA 1VGLA 2LTKA 3UIWA 2C3NA 3BOAA 1ZYEA 3GNJA 1FOVA 5DALB 4Q5NA 4CW9A 2F51A 5B6MA 4OFNA 4HJ2A 4KE3A 2FLSA 1Q4JA 4GQFA 3KD0A 2FWHA 4H86A 2CZ2A 3KMOA 4MLYA 1X0RA 2WS2A 2H74A 1EZKA 3F3QA 4IP6A 4HJMA 4JR4A 2CA8A 2R4VA 3F8UA 2YV9A 1OYJA 3VWVA 5B8BA 3BCKA 4I97A 5EY6A 3IV4A 4MF5A 4NPBA 3EPTA 5H5QA 1V9WA 5IQYA 2HRAA 1EWXA 1A2MA 1R7HA 3ZMKA 1OC3A 3TOTA 1Q98A 2PPTA 1ZYPA 1A0RP 3TGZA 3IXRA 4ZB8A 2A4HA 2R3XA 3UOMA 1FHEA 2VL9A 4NAXA 3F3RA 1CQHA 16GSA 2JU5A 1W4VA 2FWFA 4IELA 2LUSA 1AQWA 2WJUA 1C72A 2GQKA 2HT9A 1RK4A 2EIQA 2VM2A 1FVJA 5IMCA 2H1DA 3FZ5A 2CAIA 5J9BA 1BAYA 1I5GA 4BWSA 2QGVA 3TB2A 5AGYA 1M9BA 3UEMA 5DDLA 1PKZA 2HNLA 6GSTA 3FEUA 2H8LA 5IMFA 1B9XC 1QFNA 11GSA 3HJPA 2FA4A 5CRDA 1PA3A 3M0FA 2JADA 3HVSA 3NIVA 2HE3A 2ZNMA 3RHCA 5ECLB 1GH2A 3GL5A 1BJXA 3TKSC 4YQVA 2O7KA 3HHVA 1ABAA 3M9JA 4OFTA 1MD3A 3HXSA 2CX3A 4WF4A 3VLNA 2RUFA 4GSTA 3H93A 7GSSA 4MH3A 2LNSA 4N30A 5HFGA 4NMUA 4PQIA 5E4WA 3GH9A 5KN2A 2K9FA 2L5OA 1K3LA 4N11A 2YWOA 2MBTA 3H8QA 2AAWA 14GSA 1B4PA 2GSSA 2J9HA 1GNWA 3SBCA 3D22A 4EIQA 3VWUA 4K2XA 2B3SA 5CRWA 1PRXA 2XPEA 4OO4A 3VFIA 1S3AA 4K2DA 1U87A 9GSSA 1SL1B 1ERTA 1U3AA 3LG6A 2X8CA 3NZNA 3V1WA 4XRDA 2E2GA 1GTAA 1XIYA 1Z6NA 5EVOA 4ML6A 3I9V2 3D4TA 2C0GA 1PD21 4WBJA 5IMVA 1J0FA 3MDKA 3W8SA 1XOBA 2GS3A 4JR6A 3L4NA 4X4JA 4MH2A 2VUPA 4BVXA 2F8FA 4WR4A 1VF2A 1USBA 3QFAC 5B8AA 4F82A 3FR6A 4GRFA 4V1Ag 17GSA 3IA1A 3TRPA 4LMWA 10GSA 4HI7A 3BJ5A 4WKWA 1AXDA 3PH9A 2LV3A 4Z7XA 1V58A 3A5IA 1TOFA 3AY8A 4G19A 2RM6A 1X9SB 1F3AA 2FHEA 3UBKA 5ENUA 2G2QA 1A8YA 3QAVA 1YEPA 1K3OA 3P90A 2B5YA 2X4AA 2FWGA 4TRXA 2PWJA 1SL2B 1R26A 1ERWA 2B6MA 5LNKe 4K0GA 3WGEA 2H73A 3KP8A 2BMXA 2IL3A 1KBNA 5IOXA 4KCEA 3I43A 3DXBA 1WOUA 2H6XA 5F05A 2FD3A 4QL9A 1DBYA 3PINA 4DSSA 2HYXA 4BVXB 2DC5A 5F0GA 4IN0A 22GSA 3CTFA 5ECSA 2XPDA 1TP9A 2DKHA 3F4SA 2MMOA 4XS1A 5AN1A 2XBIA 3UL3A 1V98A 4ISDA 3TJGA 4NV2A 3GUSA 2AHEA 1TRVA 5AIXA 2OADA 4O7HA 2NVLA 2TRCP 1Z3EA 1TI1A 3GL3A 4XHMA 5IMZA 3CSHA 4MF6A 1GNEA 5AISA 4V2NA 2HSYA 3VI7A 3DVXA 4NWYA 3IOSA 1GL8A 1PN9A 4JEDA 4K7IA 2V2GA 2A2PA 5DQYA 5G2ZA 4ECIA 1ZMAA 4ZBDA 3WD6A 3EURA 2RLIA 2N5BA 2R0PA 2FY6A 5GAND 3WGDA 3LXZA 1O6JA 2IJYA 3O76A 2TIRA 5JWOB 3US3A 3ZREA 3DYRA 4KDXA 4WBRD 5G31A 4DSRA 4BL7A 4YAVA 5DQSA 4DSSB 3GX0A 1OVNA 3H1NA 2IMFA 1HNBA 1MD4A 2CQ9A 3DWVA 3FHKA 3LWAA 4YQMA 5HR0A 8GSSA 1DSBA 4TXVA 1IYHA 2LRTA 4G0KA 3UAPA 1PGTA 2H72A 1M99A 4HZ2A 5INYA 1JZWA 3K8NA 4O92A 5EL8A 3G7IA 4K6XA 2VOCA 3J7Yb 1DE1A 5FHIA 4ZL7A 3UARA 1OKTA 4G2EA 4Z2RA 3GFKA 3TUEA 3A2XA 3LEFA 4L8EA 4KSOA 2DMLA 4GXZA 5D9TA 3EMXA 4FYCA 2E0QA 3W6GA 2K8SA 2ZUPA 4XIHA 2C3TA 1F3BA 2OBIA 4MZCA 1K0NA 4K5SA 3RBTA 2FCHA 5BRTA 2DJKA 1B8XA 2OE1A 1SKSB 20GSA 1OE8A 3EC3A 1K0BA 4PGTA 1A8LA 1XXUA 1PSQA 2O8VB 1HD2A 5C00A 3APQA 2QA2A 4BL7B 1OE7A 2H0HA 2PBJA 3CYNA 4OMVA 3BBYA 1I9DA 1O8WA 3GHAA 3IAS2 4CDOA 3U6VA 1G0TA 2V6OA 3HDCA 4K9ZA 3M9KA 6GSVA 4TVEA 1EP7A 3IK9A 4WEYA 5HFIA 3A2VA 4GCIA 5JCUA 3WGXA 5CREA 3F0IA 1ZL9A 2VLVA 4HU9A 2XHFA 3E9JB 1SK2A 2YOIA 3G7YA 4TN8A 3VWWA 3MSZA 1YF1A 1M2BA 3FY7A 1WJKA 2DMMA 5GAPD 2HRKA 2L4QA 2LEGA 2C3QA 5ECMB 5J4UA 4XS4A 3D5JA 1AUCA 5DJLA 3HCZA 1VF4A 2C4JA 4EXJA 3KMNA 4KSMA 5J41A 2YN1A 1MDJA 4HZ4A 2GT5A 2MMZA 2OJLA 2WB9A 2OE0A 5KN3A 3L78A 1PN0A 1S3CA 5HFKA 2O85A 1GP1A 3VPTA 5ECHB 1YDKA 2B1KA 1H4OA 4CY6A 5GZZB 2GSRA 4TW5A 4BVYA 4GF0A 4HQZA 2NBSA 2IN3A 5ELGA 1EOGA 19GSA 3IHQA 5A5KA 4FYBA 2B7JA 5KOXA 1OAZA 1PMTA 3TOUA 2KLXA 1GSUA 4DSQA 4EVMA 2AB6A 3GH6A 3UVTA 1GTIA 2VCXA 1FG4A 1XFLA 4J56E 2JSYA 2OKAA 3D0ZA 2IMKA 3LFLA 2GDRA 2GQMA 4X1UA 4XS4B 3EMPA 4D73A 2P5RA 4E8HA 3UMAA 4PXOA 2LQOA 4MMMA 4TXOA 1WWJA 1J9BA 3FZAA 3TCOA 4ZILA 5FWGA 1THOA 4YKGA 4RQRA 2R37A 1UVZA 1Y6EA 3EVIA 3QR6A 2JACA 2KUCA 3RPNA 3KCMA 2R2JA 4K7NA 3KH9A 12GSA 3CMIA 2V32A 1JLVA 1GTUA 4BVYB 4PUAA 2M46A 1W89A 2MBSA 3GSSA 5D9VA 1DE2A 3IBHA 4NHWA 1AQVA 4I8BA 2KOKA 2LKUA 2X8GA 1X9MB 3KTBA 1ZOFA 2X8HA 3IC8A 4E8EA 3FR3A 1QQ2A 2HI7A 3GKKA 1SD8A 1JZRA 2H6ZA 2OA7A 2OE3A 3TJBA 4PUFC 4PURA 3TJJA 4D73B 2BJXA 3N9JA 4KX4A 1RW1A 1G7OA 3TDGA 2RUEA 3IPZA 4JU5A 4K5RA 2V41A 4TKYA 1TK5B 3BD2A 5KN0A 4TXOB 5DCHA 5KEJA 1X5DA 3KH7A 2ON7A 3FMWA 4I2TA 4YQUA 2JSZA 2O89A 2YJHA 3L9UA 3O6TA 1X5EA 1S3DA 2O87A 2I81A 2H1GA 3LSZA 4I5QA 2YPMA 4ICYA 4X43A 1IYIA 4NV5A 3GYKA 3KTLA 1XZOA 2YWIA 3EYTA 4ECBA 2VAFA 1XW9A 2KHPA 4J57E 5CP1A 3HVVA 1GRXA 2VL2A 2J23A 2Z9SA 2L5LA 4EC0A 1SJIA 2YWNA 5F8BA 1FO5A 1QUWA 3IHGA 1Z7RA 2B5XA 1EGOA 3P7XA 1QMVA 1SJZA 1MTCA 1FB6A 4N0ZA 1XW5A 2PERA 2V1MA 1JZDA 2XC2A 4WR5A 3CSIA 1HNAA 2MMAA 4KB3A 3L9SA 2DSAA 5IPGA 3F4TA 1NHOA 2VD1A 3APOA 4MNNA 3IAM2 4HDEA 2NPBA 6GSXA 2DJ2A 2MYGA 3UBLA 1FB0A 5COHA 4EDZA 3QMXA 5F07A 1YKAA 1M7TA 2OBKA 1M2DA 1AW9A 2QC7A 4I2UA 2DIZA 3LXTA 4EDYA 4AF2A 2H76A 4IJIA 1U88A 2VD0A 1GULA 1O8XA 1UN2A 5D9WA 1N2AA 4ACSA 4HS1A 4RQXA 4MDCA 4QQ7A 1XPVA 3CBUA 2AJQB 1TDIA 4O5RA 1V2AA 2IPAA 2R5GA 3DRNA 1XWBA 4YAPA 3UJ1A 2GGTA 2H75A 2H71A 3RHBA 2YNXA 6GSWA 2WDUA 5KOWA 3CSJA 3PGTA 4IW9A 3HYPA 3PR8A 3FK8A 2LRCA 4G10A 1YJ6A 5L71A 5H5SA 1XCCA 4WF5A 3HA9A 1OC8A 1EV9A 3R2QA 3HZ8A 4Q5FA 2EIRA 2X64A 3RPPA 2YJ7A 4N10A 2KP1A 2M72A 5G1LA 2L57A 1TRSA 3RDWA 4O32A 1PL2A 1GLQA 2MZCA 3GKMA 4QL7A 4BWQA 3QCPA 2IFQA 3ERWA 2I1UA 4OD7A 1CQGA 5C04A 4F9ZA 1HNCA 2C0EA 2PVQA 4JZQA 3KJYA 5CNWA 3U5RE 2F8AA 3EINA 3F4RA 4KDUA 5AIVA 4IP1A 1YF0A 3BCIA 3ZIJA 1SU9A 5HR3A 2LJKA 2IMEA 3CRTA 1V40A 3TKSE 2QKEA 1NW2A 3D6IA 3ZVJA 1JFUA 3KEBA 5GSSA 2FA8A 1K3YA 2WFCA 3L9VA 1ERUA 2CVDA 1Z7PA 5B7CA 2K18A 4ZXGA 2VLTA 1M0UA 3HJMA 1Z6MA 1GUKA 4KW6A 4AGSA 3F6DA 3QD9A 3L0HA 2GTUA 2VCTA 2WZ9A 4IGJA 3D21A 2IFQB 2IMDA 4MZBA 1TTZA 2WCIA 2LJAA 2L6CA 1M9AA 2IIYA 2X49A 3E0UA 3IK7A 3ZVJD 2GVPA 4POMA 2WULA 3F6FA 1UC7A 5DAKA 2JL4A 4PNGA 3FZ4A 3CRUA 1KNGA 3VI5A 1B4QA 4HUAA 4L0WA 3OR5A 3MIXA 2A4VA 2X99A 1MDIA 1PX7A 4WXTA 4OWYA 1T4YA 4IQAA 2F9SA 4TR1A 5IIZA 1J08A 4MJBA 4L0UA 4V1Ap 1LJRA 2E7PA 4MA9A 5IPHA 1OC9A 2OACA 2B5EA 1MDKA 4TR4A 1XWGA 1AQXA 3ERGA 3C8EA 3VWXA 4EE0A 5A4VA 3DIEA 5KN1A 3MYDA 3DGQA 3KIJA 1SK1A 2KP2A 3TRQA 4GWRA 2K8VA 4IBPA 1A24A 3M8NA 13GSA 2HXKA 4PNFA 1JLWA 4KH7A 1GSQA 1KTEA 2H19A 1F37A 3GURA 3G9BA 4MCUA 4MPGA 4KGIA 2DIYA 2AV4A 3IDVA 4JBBA 3QPMA 4XS6A 5DAKB 5CRHA 5H5RA 4MPFA 3HZ4A 2PUKC 5F06A 1K0AA 1X5CA 2L4CA 4V2LA 5E59A 4RI7A 1O81A 4L5LA 3PPUA 1HQOA 1XWKA 3MAKA 4ULXA 4TR0A 3GKNA 2JZTA 4ZB6A 2H1AA 2DJ1A 6GSSA 4TR1B 4FO5A 3Q6OA 3HD5A 3D4MA 3C7MA 3GKXA 1WMJA 1YEXA 2VM1A 4BPYA 1OC9B 3LYPA 2C1YA 3C1SA 4WETA 4AJ6A 4G0LA 2GZPA 3IC4A 1ERVA 3ZZXA 1K0CA 1DUGA 3EWLA 5D73A 4EKZA 5JWRB 5J3RA 3EE2A 1NSWA 4KUNA 2CVBA 2FWEA 1GSSA 2H30A 1O7UA 2GT6A 3MWHA 2LRNA 4KAEA 1WPIA 4IQ1A 2YP6A 1XWCA 5IMDA 2VL2C 4LA1A 2B7KA 3KP9A 3P8WA 4YKFA 5IO2A 3ERFA 3P2AA 1XVWA 5JCGA 4NXIA 4ID0A 2R0CA 1SYRA 3FRCA 3EU3A 4ECJA 1YZXA 1H75A 4IVFA 1JHBA 1GSDA 4F2IA 3TJFA 4XTSA 2HSMA 2HRNA 1TRWA 2GQLA 2V6KA 5CO3A 4EIPA 2DKIA 3WT1A 4IS0A 5EPFA 3I69A 4EL1A 2LJRA 4TOPA 6GSUA 1GTBA 1GSEA 2R6KA 5HQPA 4O5UA 2N5FA 3TRXA 4IKHA 3VPQA 3IRAA 4EO3A 4DEJA 4EUYA 1XWAA 5JWQB 2I4AA 2H6YA 5ID2A 1R4WA 4TR3A 1TJDA 4GLTA 3E3EA 5CRGA 3CTGA 4LLRA 4X0XA 3ZIVA 2H70A 2DJ3A 3APSA 3FYGA 1GSFA 4BA7A 5CAXA 1TI3A 5IOWA 3C71A 1TW9A 4FYUA 1WRYA 2WGRA 1ILOA 4LMVA 3GX8A 4MABA 2YCDA 3ISOA 4K1FA 2LQQA 1A2LA 2HRFA 5DJMA 1R5PA 2RIIA 2H01A 4JE1A 1B48A 2JZSA 5CYYA 1URMA 1TXXA 2VCWA 5BMUA 2IMIA 2GZYA 5JCWA 4OCEA 3F9UA 3M3MA 5ECPB 1EEMA 3DVWA 2CZ3A 1YKCA 1BQ7A 2PU9C 1SKWB 4OCFA 4POBA 4KDYA 1SKRB 4P3YB 5FT3A 4J2FA 2CV4A 3FZ9A 5G5FA 5ID2B 3KXOA 4ZBBA 3DMLA 1GLPA 4JRRA 3A5WA 2YANA 3O3TA 1G6WA 3TKRA 1BG5A 4MF7A 2FGXA 3LQ7A 4K8MA 3Q74A 3VURA 2PMTA 1QK8A 3IR4A 1GSYA 5ABRA 5GSTA 1T3BA 3C1RA 5IMAA 2GSQA 1ZGNA 1WP0A 3KM6A 3Q18A 1T7PB 3ED3A 2YWMA 2ZCTA 1Z9HA 2BTOT 1F2EA 3C73A 4ZIJA 6GSYA 4KF9A 1ZYQB 2MMNA 5G1KA 2E2MA 1NHYA 2VLUA 3SWLA 4USSA 2FUG2 2HZEA 4PQHA 4ZB9A 2LS5A 2YZUA 2R0GA 3ZFLA 3HKRA 4KA0A 3A3TA 2REMA 2P0GA 3ZITA 1EOHA 1SYXA 4ZBAA 1AAZA 4HEA2 5D9XA 2RM5A 4OO5A 2QA1A 2P5QA 4N0VA 3ME8A 3WYWA 18GSA 1FVKA 2GSTA 1ST9A 1M2AA 4XRAA 4PX1A 1TKDB 1EV4A 3IE3A 1Y25A 1K0DA 3ME7A 3FKFA 5ECIB 4EF0A 2N5AA 1ON4A 1RQMA 3GTUA 3CXGA 3FW2A 2C8UA 5G5EA 4F0BA 4CY8A 1PKWA 2G0FA 3M1GA 1ACVA 3S9FA 2P31A 3TJKA 3J7Yk 1X9WB 1VF1A 2EIOA 2HZEB 2IWTA 2C80A 1T1VA 2CX4A 1F6MC 2B1LA 3LW9A 4ML1A 3TKSA 4MZWA 3A2WA 5J5NA 3GV1A 3ZMLA 1K0OA 1G7EA 4MJCA 4GSNA 3HVXA 4LL1B 3ZFBA 1XBSA 1F9MA 4ECCA 3KZQA 4Q5RA 1LU4A 4Q5QA 1SENA 3QFBC 3MNGA 2DBCA 4POKA 3NOFA 5LD0A 1OKDA 1PQNA 2HLSA 4ILFA 2PGTA 3QAWA 1R5AA 2PN8A 1O85A 3GIXA 1TK0B 3GMFA 2A2SA 1AIUA 2AYTA 1GUHA 1FOHA 1TU8A 4YH2A 3H4KA 1BEDA 3F63A 1TRUA 1B9YC 2H0IA 3DKSA 4V2MA 1TK8B 1G6YA 3GTUB 4MP4A 3Q19A 3RAZA 1WIKA 2VCVA 1A23A 4L5OA 4CHSA 1GUMA 5B6NA 4MK3A 4OFMA 1QGVA 3W8JA 1BX9A 2YZHA 5D93A 2HSHA 1T8EB 4AJ7A 5J9CA 4FH8A 4Z2TA 4PQ1A 2PVOC 4I6XA 3N5OA 2AUVA 5DBQA 3GN3A 1ZZYA 4MJEA 4HOJA 4KCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0M A;  1SJ6 A;  1WE0 A;  1SK0 A;  3HY2 A;  2H1B A;  2TRX A;  1XVQ A;  2ON5 A;  1N8J A;  2F3M A;  4HQS A;  1GWC A;  2D2Z A;  1E2Y A;  2NDO A;  1FAA A;  2EC4 A;  5HR2 A;  4KND A;  2WRT A;  2H0G A;  1HYU A;  5HR1 A;  4GSS A;  4RI6 A;  5A4U A;  2JZR A;  4NHZ A;  3ZLP A;  3GRX A;  3QAG A;  1V57 A;  2GZZ A;  1ZCP A;  4POL A;  2VO4 A;  2VCZ A;  1E6B A;  2CVK A;  1U3I A;  4F03 A;  4HU7 A;  1O73 A;  1EEJ A;  4ZL9 A;  5ELA A;  1A2J A;  4GTU A;  1KEB A;  5D96 A;  3LYK A;  4K0N A;  2VIM A;  1QXH A;  3LOR A;  4XCS A;  1VRS D;  3GA4 A;  2LST A;  1NM3 A;  2L59 A;  4DVC A;  3VK9 A;  4IJ3 A;  1T00 A;  1EGR A;  5ECO B;  1PX6 A;  1UA5 A;  3TKQ A;  3QDN A;  3QOU A;  2XBQ A;  5DVB A;  5IM9 A;  1T4Z A;  1SD9 A;  2HFD A;  3FR9 A;  2CAQ A;  5DCG A;  3G7J A;  3ZL5 A;  2I9H A;  4G9H A;  1MEK A;  2LNT A;  4LL4 B;  1YY7 A;  5DAL A;  5ECN B;  3ZYW A;  2ALB A;  3LJR A;  1JZO A;  2C0D A;  1BYE A;  3EU4 A;  4IHU A;  2FNO A;  2YV7 A;  2DJ0 A;  5ECQ B;  5ECR B;  5G30 A;  2DLX A;  4MJA A;  2H66 A;  1Z5Y E;  3GST A;  1FW1 A;  3ZTL A;  3JCM L;  2K6V A;  1LBK A;  4F0C A;  5A4W A;  3ZRD A;  1PL1 A;  5LCZ A;  2HZF A;  1AC1 A;  2VL3 A;  4ZL8 A;  3LGC A;  1EP8 A;  3UVH A;  2GLR A;  5ECK B;  2CT6 A;  3I6A A;  3TKP A;  4FIW A;  4AJ8 A;  2L6D A;  3KGK A;  4RUV A;  1ML6 A;  2M80 A;  1SL0 B;  2NTO A;  5IO0 A;  2ES7 A;  1VF3 A;  3WT2 A;  4K7O A;  2A2R A;  3DEX A;  4GQC A;  1XW6 A;  5D8I A;  1THX A;  3DD3 A;  1YQ1 A;  2I3Y A;  1TU7 A;  3HJO A;  1XOA A;  2QSI A;  2C0F A;  1A0F A;  2VCQ A;  3H79 A;  2DJJ A;  1U6T A;  1VGL A;  2LTK A;  3UIW A;  2C3N A;  3BOA A;  1ZYE A;  3GNJ A;  1FOV A;  5DAL B;  4Q5N A;  4CW9 A;  2F51 A;  5B6M A;  4OFN A;  4HJ2 A;  4KE3 A;  2FLS A;  1Q4J A;  4GQF A;  3KD0 A;  2FWH A;  4H86 A;  2CZ2 A;  3KMO A;  4MLY A;  1X0R A;  2WS2 A;  2H74 A;  1EZK A;  3F3Q A;  4IP6 A;  4HJM A;  4JR4 A;  2CA8 A;  2R4V A;  3F8U A;  2YV9 A;  1OYJ A;  3VWV A;  5B8B A;  3BCK A;  4I97 A;  5EY6 A;  3IV4 A;  4MF5 A;  4NPB A;  5H5Q A;  1V9W A;  5IQY A;  1EWX A;  1A2M A;  1R7H A;  3ZMK A;  1OC3 A;  3TOT A;  1Q98 A;  2PPT A;  1A0R P;  3TGZ A;  3IXR A;  4ZB8 A;  2R3X A;  3UOM A;  1FHE A;  2VL9 A;  4NAX A;  3F3R A;  1CQH A;  16GS A;  2JU5 A;  1W4V A;  2FWF A;  4IEL A;  2LUS A;  1AQW A;  2WJU A;  1C72 A;  2GQK A;  2HT9 A;  1RK4 A;  2EIQ A;  2VM2 A;  1FVJ A;  5IMC A;  2H1D A;  3FZ5 A;  2CAI A;  5J9B A;  1BAY A;  1I5G A;  4BWS A;  2QGV A;  3TB2 A;  5AGY A;  1M9B A;  3UEM A;  5DDL A;  1PKZ A;  2HNL A;  6GST A;  3FEU A;  2H8L A;  5IMF A;  1B9X C;  1QFN A;  11GS A;  3HJP A;  2FA4 A;  5CRD A;  1PA3 A;  3M0F A;  2JAD A;  3HVS A;  3NIV A;  2HE3 A;  2ZNM A;  3RHC A;  5ECL B;  1GH2 A;  3GL5 A;  1BJX A;  3TKS C;  4YQV A;  2O7K A;  3HHV A;  1ABA A;  3M9J A;  4OFT A;  1MD3 A;  3HXS A;  2CX3 A;  4WF4 A;  3VLN A;  2RUF A;  4GST A;  3H93 A;  7GSS A;  4MH3 A;  2LNS A;  4N30 A;  5HFG A;  4NMU A;  4PQI A;  5E4W A;  3GH9 A;  5KN2 A;  2K9F A;  2L5O A;  1K3L A;  4N11 A;  2YWO A;  2MBT A;  3H8Q A;  2AAW A;  14GS A;  1B4P A;  2GSS A;  2J9H A;  1GNW A;  3SBC A;  3D22 A;  3VWU A;  2B3S A;  5CRW A;  1PRX A;  2XPE A;  4OO4 A;  3VFI A;  1S3A A;  4K2D A;  1U87 A;  9GSS A;  1SL1 B;  1ERT A;  1U3A A;  3LG6 A;  2X8C A;  3NZN A;  3V1W A;  4XRD A;  2E2G A;  1GTA A;  1XIY A;  1Z6N A;  5EVO A;  4ML6 A;  3I9V 2;  3D4T A;  2C0G A;  1PD2 1;  4WBJ A;  5IMV A;  1J0F A;  3MDK A;  3W8S A;  1XOB A;  2GS3 A;  4JR6 A;  3L4N A;  4MH2 A;  2VUP A;  4BVX A;  2F8F A;  4WR4 A;  1VF2 A;  1USB A;  3QFA C;  5B8A A;  4F82 A;  3FR6 A;  4GRF A;  4V1A g;  17GS A;  3IA1 A;  3TRP A;  4LMW A;  10GS A;  4HI7 A;  3BJ5 A;  4WKW A;  1AXD A;  3PH9 A;  2LV3 A;  4Z7X A;  1V58 A;  1TOF A;  3AY8 A;  4G19 A;  2RM6 A;  1X9S B;  1F3A A;  2FHE A;  3UBK A;  5ENU A;  2G2Q A;  1A8Y A;  3QAV A;  1YEP A;  1K3O A;  3P90 A;  2B5Y A;  2FWG A;  4TRX A;  2PWJ A;  1SL2 B;  1R26 A;  1ERW A;  2B6M A;  5LNK e;  4K0G A;  3WGE A;  2H73 A;  3KP8 A;  2BMX A;  2IL3 A;  1KBN A;  5IOX A;  4KCE A;  3I43 A;  3DXB A;  1WOU A;  2H6X A;  5F05 A;  2FD3 A;  4QL9 A;  1DBY A;  3PIN A;  4DSS A;  2HYX A;  2DC5 A;  5F0G A;  4IN0 A;  22GS A;  3CTF A;  5ECS A;  2XPD A;  1TP9 A;  3F4S A;  2MMO A;  4XS1 A;  5AN1 A;  2XBI A;  3UL3 A;  1V98 A;  4ISD A;  3TJG A;  4NV2 A;  3GUS A;  2AHE A;  1TRV A;  5AIX A;  2OAD A;  4O7H A;  2NVL A;  2TRC P;  1Z3E A;  1TI1 A;  3GL3 A;  4XHM A;  5IMZ A;  3CSH A;  4MF6 A;  1GNE A;  5AIS A;  4V2N A;  2HSY A;  3VI7 A;  3DVX A;  4NWY A;  3IOS A;  1GL8 A;  1PN9 A;  4JED A;  4K7I A;  2V2G A;  5DQY A;  5G2Z A;  4ECI A;  1ZMA A;  4ZBD A;  3WD6 A;  3EUR A;  2RLI A;  2N5B A;  2FY6 A;  5GAN D;  3WGD A;  3LXZ A;  1O6J A;  2IJY A;  3O76 A;  2TIR A;  5JWO B;  3US3 A;  3ZRE A;  3DYR A;  4KDX A;  4WBR D;  5G31 A;  4DSR A;  4BL7 A;  4YAV A;  5DQS A;  4DSS B;  3GX0 A;  1OVN A;  3H1N A;  2IMF A;  1HNB A;  1MD4 A;  2CQ9 A;  3DWV A;  3FHK A;  3LWA A;  4YQM A;  5HR0 A;  8GSS A;  1DSB A;  4TXV A;  1IYH A;  2LRT A;  3UAP A;  1PGT A;  2H72 A;  1M99 A;  4HZ2 A;  5INY A;  1JZW A;  3K8N A;  4O92 A;  5EL8 A;  3G7I A;  4K6X A;  2VOC A;  3J7Y b;  1DE1 A;  5FHI A;  4ZL7 A;  3UAR A;  1OKT A;  4G2E A;  3GFK A;  3TUE A;  3A2X A;  3LEF A;  4L8E A;  4KSO A;  2DML A;  4GXZ A;  5D9T A;  3EMX A;  4FYC A;  2E0Q A;  3W6G A;  2K8S A;  2ZUP A;  4XIH A;  2C3T A;  1F3B A;  2OBI A;  4MZC A;  1K0N A;  3RBT A;  2FCH A;  2DJK A;  1B8X A;  2OE1 A;  1SKS B;  20GS A;  1OE8 A;  3EC3 A;  1K0B A;  4PGT A;  1A8L A;  1XXU A;  1PSQ A;  2O8V B;  1HD2 A;  5C00 A;  3APQ A;  1OE7 A;  2H0H A;  2PBJ A;  3CYN A;  4OMV A;  3BBY A;  1I9D A;  1O8W A;  3GHA A;  3IAS 2;  4CDO A;  3U6V A;  1G0T A;  2V6O A;  3HDC A;  4K9Z A;  3M9K A;  6GSV A;  4TVE A;  1EP7 A;  3IK9 A;  4WEY A;  5HFI A;  3A2V A;  4GCI A;  5JCU A;  3WGX A;  5CRE A;  3F0I A;  1ZL9 A;  2VLV A;  4HU9 A;  2XHF A;  3E9J B;  1SK2 A;  2YOI A;  3G7Y A;  4TN8 A;  3VWW A;  3MSZ A;  1YF1 A;  1M2B A;  3FY7 A;  1WJK A;  2DMM A;  5GAP D;  2L4Q A;  2LEG A;  2C3Q A;  5ECM B;  5J4U A;  4XS4 A;  3D5J A;  1AUC A;  5DJL A;  3HCZ A;  1VF4 A;  2C4J A;  4EXJ A;  3KMN A;  4KSM A;  5J41 A;  2YN1 A;  1MDJ A;  4HZ4 A;  2GT5 A;  2MMZ A;  2OJL A;  2WB9 A;  2OE0 A;  5KN3 A;  3L78 A;  1S3C A;  5HFK A;  2O85 A;  1GP1 A;  3VPT A;  5ECH B;  1YDK A;  2B1K A;  1H4O A;  5GZZ B;  2GSR A;  4TW5 A;  4BVY A;  4GF0 A;  4HQZ A;  2NBS A;  2IN3 A;  5ELG A;  1EOG A;  19GS A;  3IHQ A;  5A5K A;  4FYB A;  2B7J A;  1OAZ A;  1PMT A;  3TOU A;  2KLX A;  1GSU A;  4DSQ A;  4EVM A;  2AB6 A;  3GH6 A;  3UVT A;  1GTI A;  2VCX A;  1FG4 A;  1XFL A;  4J56 E;  2JSY A;  2OKA A;  3D0Z A;  2IMK A;  3LFL A;  2GDR A;  2GQM A;  4X1U A;  4XS4 B;  3EMP A;  4D73 A;  2P5R A;  4E8H A;  3UMA A;  4PXO A;  2LQO A;  4MMM A;  4TXO A;  1WWJ A;  1J9B A;  3FZA A;  3TCO A;  4ZIL A;  5FWG A;  1THO A;  4RQR A;  2R37 A;  1UVZ A;  1Y6E A;  3EVI A;  3QR6 A;  2JAC A;  2KUC A;  3RPN A;  3KCM A;  2R2J A;  4K7N A;  3KH9 A;  12GS A;  3CMI A;  2V32 A;  1JLV A;  1GTU A;  4PUA A;  2M46 A;  1W89 A;  2MBS A;  3GSS A;  5D9V A;  1DE2 A;  3IBH A;  4NHW A;  1AQV A;  4I8B A;  2KOK A;  2LKU A;  2X8G A;  1X9M B;  3KTB A;  1ZOF A;  2X8H A;  4E8E A;  3FR3 A;  1QQ2 A;  2HI7 A;  3GKK A;  1SD8 A;  1JZR A;  2H6Z A;  2OA7 A;  2OE3 A;  3TJB A;  4PUF C;  4PUR A;  3TJJ A;  4D73 B;  2BJX A;  3N9J A;  4KX4 A;  1RW1 A;  1G7O A;  3TDG A;  2RUE A;  3IPZ A;  4JU5 A;  2V41 A;  4TKY A;  1TK5 B;  3BD2 A;  5KN0 A;  4TXO B;  5DCH A;  5KEJ A;  1X5D A;  3KH7 A;  2ON7 A;  4I2T A;  4YQU A;  2JSZ A;  2O89 A;  2YJH A;  3L9U A;  3O6T A;  1X5E A;  1S3D A;  2O87 A;  2I81 A;  2H1G A;  3LSZ A;  4I5Q A;  2YPM A;  4X43 A;  1IYI A;  4NV5 A;  3GYK A;  3KTL A;  1XZO A;  2YWI A;  3EYT A;  4ECB A;  2VAF A;  1XW9 A;  2KHP A;  4J57 E;  5CP1 A;  3HVV A;  1GRX A;  2VL2 A;  2J23 A;  2Z9S A;  2L5L A;  4EC0 A;  1SJI A;  2YWN A;  5F8B A;  1FO5 A;  1QUW A;  1Z7R A;  2B5X A;  1EGO A;  3P7X A;  1QMV A;  1SJZ A;  1MTC A;  1FB6 A;  4N0Z A;  1XW5 A;  2PER A;  2V1M A;  1JZD A;  2XC2 A;  4WR5 A;  3CSI A;  1HNA A;  2MMA A;  4KB3 A;  3L9S A;  2DSA A;  5IPG A;  3F4T A;  1NHO A;  2VD1 A;  3APO A;  3IAM 2;  4HDE A;  2NPB A;  6GSX A;  2DJ2 A;  2MYG A;  3UBL A;  1FB0 A;  5COH A;  4EDZ A;  3QMX A;  5F07 A;  1YKA A;  1M7T A;  2OBK A;  1M2D A;  1AW9 A;  2QC7 A;  4I2U A;  2DIZ A;  3LXT A;  4EDY A;  4AF2 A;  2H76 A;  4IJI A;  1U88 A;  2VD0 A;  1GUL A;  1O8X A;  1UN2 A;  5D9W A;  1N2A A;  4ACS A;  4HS1 A;  4RQX A;  4MDC A;  4QQ7 A;  1XPV A;  3CBU A;  2AJQ B;  1TDI A;  4O5R A;  1V2A A;  2IPA A;  2R5G A;  3DRN A;  1XWB A;  4YAP A;  3UJ1 A;  2GGT A;  2H75 A;  2H71 A;  3RHB A;  2YNX A;  6GSW A;  2WDU A;  3CSJ A;  3PGT A;  4IW9 A;  3HYP A;  3PR8 A;  3FK8 A;  2LRC A;  4G10 A;  1YJ6 A;  5L71 A;  5H5S A;  1XCC A;  4WF5 A;  3HA9 A;  1OC8 A;  1EV9 A;  3R2Q A;  3HZ8 A;  4Q5F A;  2EIR A;  2X64 A;  3RPP A;  2YJ7 A;  4N10 A;  2KP1 A;  2M72 A;  5G1L A;  2L57 A;  1TRS A;  3RDW A;  4O32 A;  1PL2 A;  1GLQ A;  2MZC A;  3GKM A;  4QL7 A;  4BWQ A;  3QCP A;  2IFQ A;  3ERW A;  2I1U A;  4OD7 A;  1CQG A;  5C04 A;  4F9Z A;  1HNC A;  2C0E A;  2PVQ A;  4JZQ A;  3KJY A;  5CNW A;  3U5R E;  2F8A A;  3EIN A;  3F4R A;  4KDU A;  5AIV A;  4IP1 A;  1YF0 A;  3BCI A;  3ZIJ A;  1SU9 A;  5HR3 A;  2LJK A;  2IME A;  3CRT A;  1V40 A;  3TKS E;  2QKE A;  1NW2 A;  3D6I A;  3ZVJ A;  1JFU A;  3KEB A;  5GSS A;  2FA8 A;  1K3Y A;  2WFC A;  3L9V A;  1ERU A;  2CVD A;  1Z7P A;  5B7C A;  2K18 A;  4ZXG A;  2VLT A;  1M0U A;  3HJM A;  1Z6M A;  1GUK A;  4KW6 A;  4AGS A;  3F6D A;  3QD9 A;  3L0H A;  2GTU A;  2VCT A;  2WZ9 A;  4IGJ A;  3D21 A;  2IFQ B;  2IMD A;  4MZB A;  1TTZ A;  2WCI A;  2LJA A;  2L6C A;  1M9A A;  2IIY A;  3E0U A;  3IK7 A;  3ZVJ D;  2GVP A;  4POM A;  2WUL A;  3F6F A;  1UC7 A;  5DAK A;  2JL4 A;  4PNG A;  3FZ4 A;  3CRU A;  1KNG A;  3VI5 A;  1B4Q A;  4HUA A;  4L0W A;  3OR5 A;  2A4V A;  2X99 A;  1MDI A;  1PX7 A;  4WXT A;  4OWY A;  1T4Y A;  4IQA A;  2F9S A;  4TR1 A;  5IIZ A;  1J08 A;  4MJB A;  4L0U A;  4V1A p;  1LJR A;  2E7P A;  4MA9 A;  5IPH A;  1OC9 A;  2OAC A;  2B5E A;  1MDK A;  4TR4 A;  1XWG A;  1AQX A;  3ERG A;  3C8E A;  3VWX A;  4EE0 A;  5A4V A;  3DIE A;  5KN1 A;  3DGQ A;  3KIJ A;  1SK1 A;  2KP2 A;  3TRQ A;  4GWR A;  2K8V A;  4IBP A;  1A24 A;  3M8N A;  13GS A;  2HXK A;  4PNF A;  1JLW A;  4KH7 A;  1GSQ A;  1KTE A;  2H19 A;  1F37 A;  3GUR A;  3G9B A;  4MCU A;  4MPG A;  4KGI A;  2DIY A;  2AV4 A;  3IDV A;  4JBB A;  3QPM A;  4XS6 A;  5DAK B;  5CRH A;  5H5R A;  4MPF A;  3HZ4 A;  2PUK C;  5F06 A;  1K0A A;  1X5C A;  2L4C A;  4V2L A;  5E59 A;  4RI7 A;  1O81 A;  4L5L A;  1HQO A;  1XWK A;  3MAK A;  4ULX A;  4TR0 A;  3GKN A;  2JZT A;  4ZB6 A;  2H1A A;  2DJ1 A;  6GSS A;  4TR1 B;  4FO5 A;  3Q6O A;  3HD5 A;  3D4M A;  3C7M A;  3GKX A;  1WMJ A;  1YEX A;  2VM1 A;  4BPY A;  1OC9 B;  3LYP A;  2C1Y A;  3C1S A;  4WET A;  4AJ6 A;  2GZP A;  3IC4 A;  1ERV A;  3ZZX A;  1K0C A;  1DUG A;  3EWL A;  5D73 A;  4EKZ A;  5JWR B;  5J3R A;  3EE2 A;  1NSW A;  4KUN A;  2CVB A;  2FWE A;  1GSS A;  2H30 A;  1O7U A;  2GT6 A;  3MWH A;  2LRN A;  4KAE A;  1WPI A;  4IQ1 A;  2YP6 A;  1XWC A;  5IMD A;  2VL2 C;  4LA1 A;  2B7K A;  3KP9 A;  3P8W A;  5IO2 A;  3ERF A;  3P2A A;  1XVW A;  5JCG A;  4NXI A;  4ID0 A;  1SYR A;  3FRC A;  3EU3 A;  4ECJ A;  1YZX A;  1H75 A;  4IVF A;  1JHB A;  1GSD A;  4F2I A;  3TJF A;  4XTS A;  2HRN A;  1TRW A;  2GQL A;  2V6K A;  5CO3 A;  3WT1 A;  4IS0 A;  5EPF A;  3I69 A;  4EL1 A;  2LJR A;  4TOP A;  6GSU A;  1GTB A;  1GSE A;  2R6K A;  5HQP A;  2N5F A;  3TRX A;  4IKH A;  3VPQ A;  3IRA A;  4EO3 A;  4DEJ A;  4EUY A;  1XWA A;  5JWQ B;  2I4A A;  2H6Y A;  5ID2 A;  1R4W A;  4TR3 A;  1TJD A;  4GLT A;  3E3E A;  5CRG A;  3CTG A;  4LLR A;  4X0X A;  3ZIV A;  2H70 A;  2DJ3 A;  3APS A;  3FYG A;  1GSF A;  4BA7 A;  5CAX A;  1TI3 A;  5IOW A;  3C71 A;  1TW9 A;  4FYU A;  1WRY A;  2WGR A;  1ILO A;  4LMV A;  3GX8 A;  4MAB A;  2YCD A;  3ISO A;  4K1F A;  2LQQ A;  1A2L A;  2HRF A;  5DJM A;  1R5P A;  2RII A;  2H01 A;  4JE1 A;  1B48 A;  2JZS A;  5CYY A;  1URM A;  1TXX A;  2VCW A;  2IMI A;  2GZY A;  5JCW A;  4OCE A;  3F9U A;  3M3M A;  5ECP B;  1EEM A;  3DVW A;  2CZ3 A;  1YKC A;  1BQ7 A;  2PU9 C;  1SKW B;  4OCF A;  4POB A;  4KDY A;  1SKR B;  4P3Y B;  5FT3 A;  4J2F A;  2CV4 A;  3FZ9 A;  5G5F A;  5ID2 B;  3KXO A;  4ZBB A;  3DML A;  1GLP A;  4JRR A;  3A5W A;  2YAN A;  3O3T A;  1G6W A;  3TKR A;  1BG5 A;  4MF7 A;  2FGX A;  3LQ7 A;  4K8M A;  3Q74 A;  3VUR A;  2PMT A;  1QK8 A;  3IR4 A;  1GSY A;  5ABR A;  5GST A;  1T3B A;  3C1R A;  5IMA A;  2GSQ A;  1ZGN A;  1WP0 A;  3KM6 A;  3Q18 A;  1T7P B;  3ED3 A;  2YWM A;  2ZCT A;  1Z9H A;  2BTO T;  1F2E A;  3C73 A;  4ZIJ A;  6GSY A;  1ZYQ B;  2MMN A;  5G1K A;  2E2M A;  1NHY A;  2VLU A;  3SWL A;  2FUG 2;  2HZE A;  4PQH A;  4ZB9 A;  2LS5 A;  2YZU A;  3ZFL A;  3HKR A;  4KA0 A;  3A3T A;  2REM A;  2P0G A;  3ZIT A;  1EOH A;  1SYX A;  4ZBA A;  1AAZ A;  4HEA 2;  5D9X A;  2RM5 A;  4OO5 A;  2P5Q A;  4N0V A;  3ME8 A;  3WYW A;  18GS A;  1FVK A;  2GST A;  1ST9 A;  1M2A A;  4XRA A;  4PX1 A;  1TKD B;  1EV4 A;  3IE3 A;  1Y25 A;  1K0D A;  3ME7 A;  3FKF A;  5ECI B;  4EF0 A;  2N5A A;  1ON4 A;  1RQM A;  3GTU A;  3CXG A;  3FW2 A;  2C8U A;  5G5E A;  4F0B A;  1PKW A;  2G0F A;  3M1G A;  1ACV A;  3S9F A;  2P31 A;  3TJK A;  3J7Y k;  1X9W B;  1VF1 A;  2EIO A;  2HZE B;  2IWT A;  2C80 A;  1T1V A;  2CX4 A;  1F6M C;  2B1L A;  4ML1 A;  3TKS A;  4MZW A;  3A2W A;  5J5N A;  3GV1 A;  3ZML A;  1K0O A;  1G7E A;  4MJC A;  4GSN A;  3HVX A;  4LL1 B;  3ZFB A;  1XBS A;  1F9M A;  4ECC A;  3KZQ A;  4Q5R A;  1LU4 A;  4Q5Q A;  1SEN A;  3QFB C;  3MNG A;  2DBC A;  4POK A;  3NOF A;  5LD0 A;  1OKD A;  1PQN A;  2HLS A;  4ILF A;  2PGT A;  3QAW A;  1R5A A;  2PN8 A;  1O85 A;  3GIX A;  1TK0 B;  3GMF A;  2A2S A;  1AIU A;  2AYT A;  1GUH A;  1TU8 A;  4YH2 A;  3H4K A;  1BED A;  3F63 A;  1TRU A;  1B9Y C;  2H0I A;  3DKS A;  4V2M A;  1TK8 B;  1G6Y A;  3GTU B;  4MP4 A;  3Q19 A;  3RAZ A;  1WIK A;  2VCV A;  1A23 A;  4L5O A;  4CHS A;  1GUM A;  5B6N A;  4MK3 A;  4OFM A;  1QGV A;  3W8J A;  1BX9 A;  2YZH A;  5D93 A;  2HSH A;  1T8E B;  4AJ7 A;  5J9C A;  4FH8 A;  4PQ1 A;  2PVO C;  4I6X A;  3N5O A;  2AUV A;  5DBQ A;  3GN3 A;  1ZZY A;  4MJE A;  4HOJ A;  4KCA A; 
#chains in the Genus database with same CATH topology
 1K0M A;  1SJ6 A;  1WE0 A;  2UZ8 A;  1SK0 A;  3HY2 A;  2H1B A;  2TRX A;  1XVQ A;  2ON5 A;  1N8J A;  2F3M A;  4HQS A;  1GWC A;  2D2Z A;  1E2Y A;  2NDO A;  1FAA A;  2EC4 A;  5HR2 A;  4KND A;  2WRT A;  2H0G A;  1HYU A;  4FQU A;  5HR1 A;  4O5Q A;  4GSS A;  4RI6 A;  5A4U A;  2JZR A;  4NHZ A;  3ZLP A;  3GRX A;  3QAG A;  1V57 A;  2GZZ A;  1ZCP A;  4POL A;  2VO4 A;  2VCZ A;  1E6B A;  2CVK A;  1U3I A;  4F03 A;  4HU7 A;  1O73 A;  1EEJ A;  4ZL9 A;  5ELA A;  1A2J A;  4GTU A;  1KEB A;  5D96 A;  3LYK A;  4K0N A;  2VIM A;  1QXH A;  3LOR A;  4XCS A;  1VRS D;  3GA4 A;  2LST A;  1NM3 A;  2L59 A;  4DVC A;  3VK9 A;  4IJ3 A;  1T00 A;  1EGR A;  5ECO B;  1PX6 A;  1UA5 A;  3TKQ A;  3QDN A;  3QOU A;  2XBQ A;  5DVB A;  4G0I A;  5IM9 A;  1T4Z A;  1SD9 A;  2HFD A;  3FR9 A;  2CAQ A;  5DCG A;  3G7J A;  3ZL5 A;  2I9H A;  4G9H A;  1MEK A;  2LNT A;  1S3R A;  4LL4 B;  1YY7 A;  5DAL A;  5ECN B;  3ZYW A;  2ALB A;  3LJR A;  1JZO A;  2C0D A;  1BYE A;  3EU4 A;  4IHU A;  2FNO A;  2YV7 A;  2DJ0 A;  5ECQ B;  5ECR B;  5G30 A;  2DLX A;  4MJA A;  2H66 A;  1Z5Y E;  3GST A;  1FW1 A;  3ZTL A;  3JCM L;  4Z2U A;  2K6V A;  1ZYN A;  1LBK A;  4F0C A;  5A4W A;  3ZRD A;  3R3E A;  1PL1 A;  5LCZ A;  2HZF A;  4A5P A;  1AC1 A;  2VL3 A;  4ZL8 A;  3LGC A;  1EP8 A;  3UVH A;  2GLR A;  5ECK B;  2CT6 A;  3I6A A;  3TKP A;  4FIW A;  4AJ8 A;  4PTS A;  2L6D A;  3KGK A;  4RUV A;  1ML6 A;  2M80 A;  1SL0 B;  2NTO A;  5IO0 A;  2ES7 A;  1VF3 A;  3WT2 A;  4K7O A;  2A2R A;  3DEX A;  4GQC A;  1XW6 A;  5D8I A;  1THX A;  3DD3 A;  1YQ1 A;  2I3Y A;  1TU7 A;  3HJO A;  1XOA A;  2QSI A;  2C0F A;  1A0F A;  2VCQ A;  3H79 A;  2DJJ A;  1U6T A;  1VGL A;  2LTK A;  3UIW A;  2C3N A;  3BOA A;  1ZYE A;  3GNJ A;  1FOV A;  5DAL B;  4Q5N A;  4CW9 A;  2F51 A;  5B6M A;  4OFN A;  4HJ2 A;  4KE3 A;  2FLS A;  1Q4J A;  4GQF A;  3KD0 A;  2FWH A;  4H86 A;  2CZ2 A;  3KMO A;  4MLY A;  1X0R A;  2WS2 A;  2H74 A;  1EZK A;  3F3Q A;  4IP6 A;  4HJM A;  4JR4 A;  2CA8 A;  2R4V A;  3F8U A;  2YV9 A;  1OYJ A;  3VWV A;  5B8B A;  3BCK A;  4I97 A;  5EY6 A;  3IV4 A;  4MF5 A;  4NPB A;  3EPT A;  5H5Q A;  1V9W A;  5IQY A;  2HRA A;  1EWX A;  1A2M A;  1R7H A;  3ZMK A;  1OC3 A;  3TOT A;  1Q98 A;  2PPT A;  1ZYP A;  1A0R P;  3TGZ A;  3IXR A;  4ZB8 A;  2A4H A;  2R3X A;  3UOM A;  1FHE A;  2VL9 A;  4NAX A;  3F3R A;  1CQH A;  16GS A;  2JU5 A;  1W4V A;  2FWF A;  4IEL A;  2LUS A;  1AQW A;  2WJU A;  1C72 A;  2GQK A;  2HT9 A;  1RK4 A;  2EIQ A;  2VM2 A;  1FVJ A;  5IMC A;  2H1D A;  3FZ5 A;  2CAI A;  5J9B A;  1BAY A;  1I5G A;  4BWS A;  2QGV A;  3TB2 A;  5AGY A;  1M9B A;  3UEM A;  5DDL A;  1PKZ A;  2HNL A;  6GST A;  3FEU A;  2H8L A;  5IMF A;  1B9X C;  1QFN A;  11GS A;  3HJP A;  2FA4 A;  5CRD A;  1PA3 A;  3M0F A;  2JAD A;  3HVS A;  3NIV A;  2HE3 A;  2ZNM A;  3RHC A;  5ECL B;  1GH2 A;  3GL5 A;  1BJX A;  3TKS C;  4YQV A;  2O7K A;  3HHV A;  1ABA A;  3M9J A;  4OFT A;  1MD3 A;  3HXS A;  2CX3 A;  4WF4 A;  3VLN A;  2RUF A;  4GST A;  3H93 A;  7GSS A;  4MH3 A;  2LNS A;  4N30 A;  5HFG A;  4NMU A;  4PQI A;  5E4W A;  3GH9 A;  5KN2 A;  2K9F A;  2L5O A;  1K3L A;  4N11 A;  2YWO A;  2MBT A;  3H8Q A;  2AAW A;  14GS A;  1B4P A;  2GSS A;  2J9H A;  1GNW A;  3SBC A;  3D22 A;  4EIQ A;  3VWU A;  4K2X A;  2B3S A;  5CRW A;  1PRX A;  2XPE A;  4OO4 A;  3VFI A;  1S3A A;  4K2D A;  1U87 A;  9GSS A;  1SL1 B;  1ERT A;  1U3A A;  3LG6 A;  2X8C A;  3NZN A;  3V1W A;  4XRD A;  2E2G A;  1GTA A;  1XIY A;  1Z6N A;  5EVO A;  4ML6 A;  3I9V 2;  3D4T A;  2C0G A;  1PD2 1;  4WBJ A;  5IMV A;  1J0F A;  3MDK A;  3W8S A;  1XOB A;  2GS3 A;  4JR6 A;  3L4N A;  4X4J A;  4MH2 A;  2VUP A;  4BVX A;  2F8F A;  4WR4 A;  1VF2 A;  1USB A;  3QFA C;  5B8A A;  4F82 A;  3FR6 A;  4GRF A;  4V1A g;  17GS A;  3IA1 A;  3TRP A;  4LMW A;  10GS A;  4HI7 A;  3BJ5 A;  4WKW A;  1AXD A;  3PH9 A;  2LV3 A;  4Z7X A;  1V58 A;  3A5I A;  1TOF A;  3AY8 A;  4G19 A;  2RM6 A;  1X9S B;  1F3A A;  2FHE A;  3UBK A;  5ENU A;  2G2Q A;  1A8Y A;  3QAV A;  1YEP A;  1K3O A;  3P90 A;  2B5Y A;  2X4A A;  2FWG A;  4TRX A;  2PWJ A;  1SL2 B;  1R26 A;  1ERW A;  2B6M A;  5LNK e;  4K0G A;  3WGE A;  2H73 A;  3KP8 A;  2BMX A;  2IL3 A;  1KBN A;  5IOX A;  4KCE A;  3I43 A;  3DXB A;  1WOU A;  2H6X A;  5F05 A;  2FD3 A;  4QL9 A;  1DBY A;  3PIN A;  4DSS A;  2HYX A;  4BVX B;  2DC5 A;  5F0G A;  4IN0 A;  22GS A;  3CTF A;  5ECS A;  2XPD A;  1TP9 A;  2DKH A;  3F4S A;  2MMO A;  4XS1 A;  5AN1 A;  2XBI A;  3UL3 A;  1V98 A;  4ISD A;  3TJG A;  4NV2 A;  3GUS A;  2AHE A;  1TRV A;  5AIX A;  2OAD A;  4O7H A;  2NVL A;  2TRC P;  1Z3E A;  1TI1 A;  3GL3 A;  4XHM A;  5IMZ A;  3CSH A;  4MF6 A;  1GNE A;  5AIS A;  4V2N A;  2HSY A;  3VI7 A;  3DVX A;  3HVN A;  4NWY A;  3IOS A;  1GL8 A;  1PN9 A;  4JED A;  4K7I A;  2V2G A;  2A2P A;  5DQY A;  5G2Z A;  4ECI A;  1ZMA A;  4ZBD A;  3WD6 A;  3EUR A;  2RLI A;  2N5B A;  2R0P A;  2FY6 A;  5GAN D;  3WGD A;  3LXZ A;  1O6J A;  2IJY A;  3O76 A;  2TIR A;  5JWO B;  3US3 A;  3ZRE A;  3DYR A;  4KDX A;  4WBR D;  5G31 A;  4DSR A;  4BL7 A;  4YAV A;  5DQS A;  4DSS B;  3GX0 A;  1OVN A;  3H1N A;  2IMF A;  1HNB A;  1MD4 A;  2CQ9 A;  3DWV A;  3FHK A;  3LWA A;  4YQM A;  5HR0 A;  8GSS A;  1DSB A;  4TXV A;  1IYH A;  2LRT A;  4G0K A;  3UAP A;  1PGT A;  2H72 A;  1M99 A;  4HZ2 A;  5INY A;  1JZW A;  3K8N A;  4O92 A;  5EL8 A;  3G7I A;  4K6X A;  2VOC A;  3J7Y b;  1DE1 A;  5FHI A;  4ZL7 A;  3UAR A;  1OKT A;  4G2E A;  4Z2R A;  3GFK A;  3TUE A;  3A2X A;  3LEF A;  4L8E A;  4KSO A;  2DML A;  4GXZ A;  5D9T A;  3EMX A;  4FYC A;  2E0Q A;  3W6G A;  2K8S A;  2ZUP A;  4XIH A;  2C3T A;  1F3B A;  2OBI A;  4MZC A;  1K0N A;  4K5S A;  3RBT A;  2FCH A;  5BRT A;  2DJK A;  1B8X A;  2OE1 A;  1SKS B;  20GS A;  1OE8 A;  3EC3 A;  1K0B A;  4PGT A;  1A8L A;  1XXU A;  1PSQ A;  2O8V B;  1HD2 A;  5C00 A;  3APQ A;  2QA2 A;  4BL7 B;  1OE7 A;  2H0H A;  2PBJ A;  3CYN A;  4OMV A;  3BBY A;  1I9D A;  1O8W A;  3GHA A;  3IAS 2;  4CDO A;  3U6V A;  1G0T A;  2V6O A;  3HDC A;  4K9Z A;  3M9K A;  6GSV A;  4TVE A;  1EP7 A;  3IK9 A;  4WEY A;  5HFI A;  3A2V A;  4GCI A;  5JCU A;  3WGX A;  5CRE A;  3F0I A;  1ZL9 A;  2VLV A;  4HU9 A;  2XHF A;  3E9J B;  1SK2 A;  2YOI A;  3G7Y A;  4TN8 A;  3VWW A;  3MSZ A;  1YF1 A;  1M2B A;  3FY7 A;  1WJK A;  2DMM A;  5GAP D;  2HRK A;  2L4Q A;  2LEG A;  2C3Q A;  5ECM B;  5J4U A;  4XS4 A;  3D5J A;  1AUC A;  5DJL A;  3HCZ A;  1VF4 A;  2C4J A;  4EXJ A;  3KMN A;  4KSM A;  5J41 A;  2YN1 A;  1MDJ A;  4HZ4 A;  2GT5 A;  2MMZ A;  2OJL A;  2WB9 A;  2OE0 A;  5KN3 A;  3L78 A;  1PN0 A;  1S3C A;  5HFK A;  2O85 A;  1GP1 A;  3VPT A;  5ECH B;  1YDK A;  2B1K A;  1H4O A;  4CY6 A;  5GZZ B;  2GSR A;  4TW5 A;  4BVY A;  4GF0 A;  4HQZ A;  2NBS A;  2IN3 A;  5ELG A;  1EOG A;  19GS A;  3IHQ A;  5A5K A;  4FYB A;  2B7J A;  5KOX A;  1OAZ A;  1PMT A;  3TOU A;  2KLX A;  1GSU A;  4DSQ A;  4EVM A;  2AB6 A;  3GH6 A;  3UVT A;  1GTI A;  2VCX A;  1FG4 A;  1XFL A;  4J56 E;  2JSY A;  2OKA A;  3D0Z A;  2IMK A;  3LFL A;  2GDR A;  2GQM A;  4X1U A;  4XS4 B;  3EMP A;  4D73 A;  2P5R A;  4E8H A;  3UMA A;  4PXO A;  2LQO A;  4MMM A;  4TXO A;  1WWJ A;  1J9B A;  3FZA A;  3TCO A;  4ZIL A;  5FWG A;  1THO A;  4YKG A;  4RQR A;  2R37 A;  1UVZ A;  1Y6E A;  3EVI A;  3QR6 A;  2JAC A;  2KUC A;  3RPN A;  3KCM A;  2R2J A;  4K7N A;  3KH9 A;  12GS A;  3CMI A;  2V32 A;  1JLV A;  1GTU A;  4BVY B;  4PUA A;  2M46 A;  1W89 A;  2MBS A;  3GSS A;  5D9V A;  1DE2 A;  3IBH A;  4NHW A;  1AQV A;  4I8B A;  2KOK A;  2LKU A;  2X8G A;  1X9M B;  3KTB A;  1ZOF A;  2X8H A;  3IC8 A;  4E8E A;  3FR3 A;  1QQ2 A;  2HI7 A;  1PFO A;  3GKK A;  1SD8 A;  1JZR A;  2H6Z A;  2OA7 A;  2OE3 A;  3TJB A;  4PUF C;  4PUR A;  3TJJ A;  4D73 B;  2BJX A;  3N9J A;  4KX4 A;  1RW1 A;  1G7O A;  3TDG A;  2RUE A;  3IPZ A;  4JU5 A;  4K5R A;  2V41 A;  4TKY A;  1TK5 B;  3BD2 A;  5KN0 A;  4TXO B;  5DCH A;  5KEJ A;  1X5D A;  3KH7 A;  2ON7 A;  3FMW A;  4I2T A;  4YQU A;  2JSZ A;  2O89 A;  2YJH A;  3L9U A;  3O6T A;  1X5E A;  1S3D A;  2O87 A;  2I81 A;  2H1G A;  3LSZ A;  4I5Q A;  2YPM A;  4ICY A;  4X43 A;  1IYI A;  4NV5 A;  3GYK A;  3KTL A;  1XZO A;  2YWI A;  3EYT A;  4ECB A;  2VAF A;  1XW9 A;  2KHP A;  4J57 E;  5CP1 A;  3HVV A;  1GRX A;  2VL2 A;  2J23 A;  2Z9S A;  2L5L A;  4EC0 A;  1SJI A;  2YWN A;  5F8B A;  1FO5 A;  1QUW A;  3IHG A;  1Z7R A;  2B5X A;  1EGO A;  3P7X A;  1QMV A;  1SJZ A;  1MTC A;  1FB6 A;  4N0Z A;  1XW5 A;  2PER A;  2V1M A;  1JZD A;  2XC2 A;  4WR5 A;  3CSI A;  1HNA A;  2MMA A;  4KB3 A;  3L9S A;  2DSA A;  5IPG A;  3F4T A;  1NHO A;  2VD1 A;  3APO A;  4MNN A;  3IAM 2;  4HDE A;  2NPB A;  6GSX A;  2DJ2 A;  2MYG A;  3UBL A;  1FB0 A;  5COH A;  4EDZ A;  3QMX A;  5F07 A;  1YKA A;  1M7T A;  2OBK A;  1M2D A;  1AW9 A;  2QC7 A;  4I2U A;  2DIZ A;  3LXT A;  4EDY A;  4AF2 A;  2H76 A;  4IJI A;  1U88 A;  2VD0 A;  1GUL A;  1O8X A;  1UN2 A;  5D9W A;  1N2A A;  4ACS A;  4HS1 A;  4RQX A;  4MDC A;  4QQ7 A;  1XPV A;  3CBU A;  2AJQ B;  1TDI A;  4O5R A;  1V2A A;  2IPA A;  2R5G A;  3DRN A;  1XWB A;  4YAP A;  3UJ1 A;  2GGT A;  2H75 A;  2H71 A;  3RHB A;  2YNX A;  6GSW A;  2WDU A;  5KOW A;  3CSJ A;  3PGT A;  4IW9 A;  3HYP A;  3PR8 A;  3FK8 A;  2LRC A;  4G10 A;  1YJ6 A;  5L71 A;  5H5S A;  1XCC A;  4WF5 A;  3HA9 A;  1OC8 A;  1EV9 A;  3R2Q A;  3HZ8 A;  4Q5F A;  2EIR A;  2X64 A;  3RPP A;  2YJ7 A;  4N10 A;  2KP1 A;  2M72 A;  5G1L A;  2L57 A;  1TRS A;  3RDW A;  4O32 A;  1PL2 A;  1GLQ A;  2MZC A;  3GKM A;  4QL7 A;  4BWQ A;  3QCP A;  2IFQ A;  3ERW A;  2I1U A;  4OD7 A;  1CQG A;  5C04 A;  4F9Z A;  1HNC A;  2C0E A;  2PVQ A;  4JZQ A;  3KJY A;  5CNW A;  3U5R E;  2F8A A;  3EIN A;  3F4R A;  4KDU A;  5AIV A;  4IP1 A;  1YF0 A;  3BCI A;  3ZIJ A;  1SU9 A;  5HR3 A;  2LJK A;  2IME A;  3CRT A;  1V40 A;  3TKS E;  2QKE A;  1NW2 A;  3D6I A;  3ZVJ A;  1JFU A;  3KEB A;  5GSS A;  2FA8 A;  1K3Y A;  2WFC A;  3L9V A;  1ERU A;  2CVD A;  1Z7P A;  5B7C A;  2K18 A;  4ZXG A;  2VLT A;  1M0U A;  3HJM A;  1Z6M A;  1GUK A;  4KW6 A;  4AGS A;  3F6D A;  3QD9 A;  3L0H A;  2GTU A;  2VCT A;  2WZ9 A;  4IGJ A;  3D21 A;  2IFQ B;  2IMD A;  4MZB A;  1TTZ A;  2WCI A;  2LJA A;  2L6C A;  1M9A A;  2IIY A;  2X49 A;  3E0U A;  3IK7 A;  3ZVJ D;  2GVP A;  4POM A;  2WUL A;  3F6F A;  1UC7 A;  5DAK A;  2JL4 A;  4PNG A;  3FZ4 A;  3CRU A;  1KNG A;  3VI5 A;  1B4Q A;  4HUA A;  4L0W A;  3OR5 A;  3MIX A;  2A4V A;  2X99 A;  1MDI A;  1PX7 A;  4WXT A;  4HSC X;  4OWY A;  1T4Y A;  4IQA A;  2F9S A;  4TR1 A;  5IIZ A;  1J08 A;  4MJB A;  4L0U A;  4V1A p;  1LJR A;  2E7P A;  4MA9 A;  5IPH A;  1OC9 A;  2OAC A;  2B5E A;  1MDK A;  4TR4 A;  1XWG A;  1AQX A;  3ERG A;  3C8E A;  3VWX A;  4EE0 A;  5A4V A;  3DIE A;  5KN1 A;  3MYD A;  3DGQ A;  3KIJ A;  1SK1 A;  2KP2 A;  3TRQ A;  4GWR A;  2K8V A;  4IBP A;  1A24 A;  3M8N A;  13GS A;  2HXK A;  4PNF A;  1JLW A;  4KH7 A;  1GSQ A;  1KTE A;  2H19 A;  1F37 A;  3GUR A;  3G9B A;  4MCU A;  4MPG A;  4KGI A;  2DIY A;  2AV4 A;  3IDV A;  4JBB A;  3QPM A;  4XS6 A;  5DAK B;  5CRH A;  5H5R A;  4MPF A;  3HZ4 A;  2PUK C;  5F06 A;  1K0A A;  1X5C A;  2L4C A;  4V2L A;  5E59 A;  4RI7 A;  1O81 A;  4L5L A;  3PPU A;  1HQO A;  1XWK A;  3MAK A;  4ULX A;  4TR0 A;  3GKN A;  2JZT A;  4ZB6 A;  2H1A A;  2DJ1 A;  6GSS A;  4TR1 B;  4FO5 A;  3Q6O A;  3HD5 A;  3D4M A;  3C7M A;  3GKX A;  1WMJ A;  1YEX A;  2VM1 A;  4BPY A;  1OC9 B;  3LYP A;  2C1Y A;  3C1S A;  4WET A;  4AJ6 A;  4G0L A;  2GZP A;  3IC4 A;  1ERV A;  3ZZX A;  1K0C A;  1DUG A;  3EWL A;  5D73 A;  4EKZ A;  5JWR B;  5J3R A;  3EE2 A;  1NSW A;  4KUN A;  2CVB A;  2FWE A;  1GSS A;  2H30 A;  1O7U A;  2GT6 A;  3MWH A;  2LRN A;  4KAE A;  1WPI A;  4IQ1 A;  1M3J A;  2YP6 A;  1XWC A;  5IMD A;  2VL2 C;  4LA1 A;  2B7K A;  3KP9 A;  3P8W A;  4YKF A;  5IO2 A;  1M3I A;  3ERF A;  3P2A A;  1XVW A;  5JCG A;  4NXI A;  4ID0 A;  2R0C A;  1SYR A;  3FRC A;  3EU3 A;  4ECJ A;  1YZX A;  1H75 A;  4IVF A;  1JHB A;  1GSD A;  4F2I A;  3TJF A;  4XTS A;  1XG8 A;  2HSM A;  2HRN A;  1TRW A;  2GQL A;  2V6K A;  5CO3 A;  4EIP A;  2DKI A;  3WT1 A;  4IS0 A;  5EPF A;  4BIK A;  3I69 A;  4EL1 A;  2LJR A;  4TOP A;  6GSU A;  1GTB A;  1GSE A;  2R6K A;  5HQP A;  4O5U A;  2N5F A;  3TRX A;  4IKH A;  3VPQ A;  3IRA A;  4EO3 A;  4DEJ A;  4EUY A;  1XWA A;  5JWQ B;  2I4A A;  2H6Y A;  5ID2 A;  1R4W A;  4TR3 A;  1TJD A;  4GLT A;  3E3E A;  5CRG A;  3CTG A;  4LLR A;  4X0X A;  3ZIV A;  2H70 A;  2DJ3 A;  3APS A;  3FYG A;  1GSF A;  4BA7 A;  5CAX A;  1TI3 A;  5IOW A;  3C71 A;  1TW9 A;  4FYU A;  1WRY A;  2WGR A;  1ILO A;  4LMV A;  3GX8 A;  4MAB A;  2YCD A;  3ISO A;  4K1F A;  2LQQ A;  1A2L A;  2HRF A;  5DJM A;  1R5P A;  2RII A;  2H01 A;  4JE1 A;  1B48 A;  2JZS A;  5CYY A;  1URM A;  1TXX A;  2VCW A;  5BMU A;  2IMI A;  2GZY A;  5JCW A;  4OCE A;  3F9U A;  3M3M A;  5ECP B;  1EEM A;  3DVW A;  2CZ3 A;  1YKC A;  1BQ7 A;  2PU9 C;  1SKW B;  4OCF A;  4POB A;  4KDY A;  1SKR B;  4P3Y B;  5FT3 A;  4J2F A;  2CV4 A;  3FZ9 A;  5G5F A;  5ID2 B;  3KXO A;  4ZBB A;  3DML A;  1GLP A;  4JRR A;  3A5W A;  2YAN A;  3O3T A;  1G6W A;  3TKR A;  1BG5 A;  4MF7 A;  2FGX A;  3LQ7 A;  4K8M A;  3Q74 A;  3CQF A;  3VUR A;  2PMT A;  1QK8 A;  3IR4 A;  1GSY A;  5ABR A;  5GST A;  1T3B A;  3C1R A;  5IMA A;  2GSQ A;  1ZGN A;  1WP0 A;  3KM6 A;  3Q18 A;  1T7P B;  3ED3 A;  2YWM A;  2ZCT A;  1Z9H A;  2BTO T;  1F2E A;  3C73 A;  4ZIJ A;  6GSY A;  4KF9 A;  1ZYQ B;  2MMN A;  5G1K A;  2E2M A;  1NHY A;  2VLU A;  3SWL A;  4USS A;  2FUG 2;  2HZE A;  4PQH A;  4ZB9 A;  2LS5 A;  2YZU A;  2R0G A;  3ZFL A;  3HKR A;  4KA0 A;  3A3T A;  2REM A;  2P0G A;  3ZIT A;  1EOH A;  1SYX A;  4ZBA A;  1AAZ A;  4HEA 2;  5D9X A;  2RM5 A;  4OO5 A;  2QA1 A;  2P5Q A;  4N0V A;  3ME8 A;  3WYW A;  18GS A;  1FVK A;  2GST A;  1ST9 A;  1M2A A;  4XRA A;  4PX1 A;  1TKD B;  1EV4 A;  3IE3 A;  1Y25 A;  1K0D A;  3ME7 A;  3FKF A;  5ECI B;  4EF0 A;  2N5A A;  1ON4 A;  1RQM A;  3GTU A;  3CXG A;  3FW2 A;  2C8U A;  5G5E A;  4F0B A;  4CY8 A;  1PKW A;  2G0F A;  3M1G A;  1ACV A;  3S9F A;  2P31 A;  3TJK A;  3J7Y k;  1X9W B;  1VF1 A;  2EIO A;  2HZE B;  2IWT A;  2C80 A;  1T1V A;  2CX4 A;  1F6M C;  2B1L A;  3LW9 A;  4ML1 A;  3TKS A;  4MZW A;  3A2W A;  5J5N A;  3GV1 A;  3ZML A;  1K0O A;  1G7E A;  4MJC A;  4GSN A;  3HVX A;  4LL1 B;  3ZFB A;  1XBS A;  1F9M A;  4ECC A;  3KZQ A;  4Q5R A;  1LU4 A;  4Q5Q A;  1SEN A;  3QFB C;  3MNG A;  2DBC A;  4POK A;  3NOF A;  5LD0 A;  1OKD A;  1PQN A;  2HLS A;  4ILF A;  2PGT A;  3QAW A;  1R5A A;  2PN8 A;  1O85 A;  3GIX A;  1TK0 B;  3GMF A;  2A2S A;  1AIU A;  2AYT A;  1GUH A;  1FOH A;  1TU8 A;  4YH2 A;  3H4K A;  1BED A;  3F63 A;  1TRU A;  1B9Y C;  2H0I A;  3DKS A;  4V2M A;  1TK8 B;  1G6Y A;  3GTU B;  4MP4 A;  3Q19 A;  3RAZ A;  1WIK A;  2VCV A;  1A23 A;  4L5O A;  4CHS A;  1GUM A;  5B6N A;  4MK3 A;  4OFM A;  1QGV A;  3W8J A;  1BX9 A;  2YZH A;  5D93 A;  2HSH A;  1T8E B;  4AJ7 A;  5J9C A;  4FH8 A;  4Z2T A;  4PQ1 A;  2PVO C;  4I6X A;  3N5O A;  2AUV A;  5DBQ A;  3GN3 A;  1ZZY A;  4MJE A;  4HOJ A;  4KCA A; 
#chains in the Genus database with same CATH homology
 1K0M A;  1SJ6 A;  1WE0 A;  2UZ8 A;  1SK0 A;  3HY2 A;  2H1B A;  2TRX A;  1XVQ A;  2ON5 A;  1N8J A;  2F3M A;  4HQS A;  1GWC A;  2D2Z A;  1E2Y A;  2NDO A;  1FAA A;  2EC4 A;  5HR2 A;  4KND A;  2WRT A;  2H0G A;  1HYU A;  4FQU A;  5HR1 A;  4O5Q A;  4GSS A;  4RI6 A;  5A4U A;  2JZR A;  4NHZ A;  3ZLP A;  3GRX A;  3QAG A;  1V57 A;  2GZZ A;  1ZCP A;  4POL A;  2VO4 A;  2VCZ A;  1E6B A;  2CVK A;  1U3I A;  4F03 A;  4HU7 A;  1O73 A;  1EEJ A;  4ZL9 A;  5ELA A;  1A2J A;  4GTU A;  1KEB A;  5D96 A;  3LYK A;  4K0N A;  2VIM A;  1QXH A;  3LOR A;  4XCS A;  1VRS D;  3GA4 A;  2LST A;  1NM3 A;  2L59 A;  4DVC A;  3VK9 A;  4IJ3 A;  1T00 A;  1EGR A;  5ECO B;  1PX6 A;  1UA5 A;  3TKQ A;  3QDN A;  3QOU A;  2XBQ A;  5DVB A;  4G0I A;  5IM9 A;  1T4Z A;  1SD9 A;  2HFD A;  3FR9 A;  2CAQ A;  5DCG A;  3G7J A;  3ZL5 A;  2I9H A;  4G9H A;  1MEK A;  2LNT A;  4LL4 B;  1YY7 A;  5DAL A;  5ECN B;  3ZYW A;  2ALB A;  3LJR A;  1JZO A;  2C0D A;  1BYE A;  3EU4 A;  4IHU A;  2FNO A;  2YV7 A;  2DJ0 A;  5ECQ B;  5ECR B;  5G30 A;  2DLX A;  4MJA A;  2H66 A;  1Z5Y E;  3GST A;  1FW1 A;  3ZTL A;  3JCM L;  4Z2U A;  2K6V A;  1ZYN A;  1LBK A;  4F0C A;  5A4W A;  3ZRD A;  3R3E A;  1PL1 A;  5LCZ A;  2HZF A;  4A5P A;  1AC1 A;  2VL3 A;  4ZL8 A;  3LGC A;  1EP8 A;  3UVH A;  2GLR A;  5ECK B;  2CT6 A;  3I6A A;  3TKP A;  4FIW A;  4AJ8 A;  4PTS A;  2L6D A;  3KGK A;  4RUV A;  1ML6 A;  2M80 A;  1SL0 B;  2NTO A;  5IO0 A;  2ES7 A;  1VF3 A;  3WT2 A;  4K7O A;  2A2R A;  3DEX A;  4GQC A;  1XW6 A;  5D8I A;  1THX A;  3DD3 A;  1YQ1 A;  2I3Y A;  1TU7 A;  3HJO A;  1XOA A;  2QSI A;  2C0F A;  1A0F A;  2VCQ A;  3H79 A;  2DJJ A;  1U6T A;  1VGL A;  2LTK A;  3UIW A;  2C3N A;  3BOA A;  1ZYE A;  3GNJ A;  1FOV A;  5DAL B;  4Q5N A;  4CW9 A;  2F51 A;  5B6M A;  4OFN A;  4HJ2 A;  4KE3 A;  2FLS A;  1Q4J A;  4GQF A;  3KD0 A;  2FWH A;  4H86 A;  2CZ2 A;  3KMO A;  4MLY A;  1X0R A;  2WS2 A;  2H74 A;  1EZK A;  3F3Q A;  4IP6 A;  4HJM A;  4JR4 A;  2CA8 A;  2R4V A;  3F8U A;  2YV9 A;  1OYJ A;  3VWV A;  5B8B A;  3BCK A;  4I97 A;  5EY6 A;  3IV4 A;  4MF5 A;  4NPB A;  3EPT A;  5H5Q A;  1V9W A;  5IQY A;  2HRA A;  1EWX A;  1A2M A;  1R7H A;  3ZMK A;  1OC3 A;  3TOT A;  1Q98 A;  2PPT A;  1ZYP A;  1A0R P;  3TGZ A;  3IXR A;  4ZB8 A;  2A4H A;  2R3X A;  3UOM A;  1FHE A;  2VL9 A;  4NAX A;  3F3R A;  1CQH A;  16GS A;  2JU5 A;  1W4V A;  2FWF A;  4IEL A;  2LUS A;  1AQW A;  2WJU A;  1C72 A;  2GQK A;  2HT9 A;  1RK4 A;  2EIQ A;  2VM2 A;  1FVJ A;  5IMC A;  2H1D A;  3FZ5 A;  2CAI A;  5J9B A;  1BAY A;  1I5G A;  4BWS A;  2QGV A;  3TB2 A;  5AGY A;  1M9B A;  3UEM A;  5DDL A;  1PKZ A;  2HNL A;  6GST A;  3FEU A;  2H8L A;  5IMF A;  1B9X C;  1QFN A;  11GS A;  3HJP A;  2FA4 A;  5CRD A;  1PA3 A;  3M0F A;  2JAD A;  3HVS A;  3NIV A;  2HE3 A;  2ZNM A;  3RHC A;  5ECL B;  1GH2 A;  3GL5 A;  1BJX A;  3TKS C;  4YQV A;  2O7K A;  3HHV A;  1ABA A;  3M9J A;  4OFT A;  1MD3 A;  3HXS A;  2CX3 A;  4WF4 A;  3VLN A;  2RUF A;  4GST A;  3H93 A;  7GSS A;  4MH3 A;  2LNS A;  4N30 A;  5HFG A;  4NMU A;  4PQI A;  5E4W A;  3GH9 A;  5KN2 A;  2K9F A;  2L5O A;  1K3L A;  4N11 A;  2YWO A;  2MBT A;  3H8Q A;  2AAW A;  14GS A;  1B4P A;  2GSS A;  2J9H A;  1GNW A;  3SBC A;  3D22 A;  4EIQ A;  3VWU A;  4K2X A;  2B3S A;  5CRW A;  1PRX A;  2XPE A;  4OO4 A;  3VFI A;  1S3A A;  4K2D A;  1U87 A;  9GSS A;  1SL1 B;  1ERT A;  1U3A A;  3LG6 A;  2X8C A;  3NZN A;  3V1W A;  4XRD A;  2E2G A;  1GTA A;  1XIY A;  1Z6N A;  5EVO A;  4ML6 A;  3I9V 2;  3D4T A;  2C0G A;  1PD2 1;  4WBJ A;  5IMV A;  1J0F A;  3MDK A;  3W8S A;  1XOB A;  2GS3 A;  4JR6 A;  3L4N A;  4X4J A;  4MH2 A;  2VUP A;  4BVX A;  2F8F A;  4WR4 A;  1VF2 A;  1USB A;  3QFA C;  5B8A A;  4F82 A;  3FR6 A;  4GRF A;  4V1A g;  17GS A;  3IA1 A;  3TRP A;  4LMW A;  10GS A;  4HI7 A;  3BJ5 A;  4WKW A;  1AXD A;  3PH9 A;  2LV3 A;  4Z7X A;  1V58 A;  3A5I A;  1TOF A;  3AY8 A;  4G19 A;  2RM6 A;  1X9S B;  1F3A A;  2FHE A;  3UBK A;  5ENU A;  2G2Q A;  1A8Y A;  3QAV A;  1YEP A;  1K3O A;  3P90 A;  2B5Y A;  2X4A A;  2FWG A;  4TRX A;  2PWJ A;  1SL2 B;  1R26 A;  1ERW A;  2B6M A;  5LNK e;  4K0G A;  3WGE A;  2H73 A;  3KP8 A;  2BMX A;  2IL3 A;  1KBN A;  5IOX A;  4KCE A;  3I43 A;  3DXB A;  1WOU A;  2H6X A;  5F05 A;  2FD3 A;  4QL9 A;  1DBY A;  3PIN A;  4DSS A;  2HYX A;  4BVX B;  2DC5 A;  5F0G A;  4IN0 A;  22GS A;  3CTF A;  5ECS A;  2XPD A;  1TP9 A;  2DKH A;  3F4S A;  2MMO A;  4XS1 A;  5AN1 A;  2XBI A;  3UL3 A;  1V98 A;  4ISD A;  3TJG A;  4NV2 A;  3GUS A;  2AHE A;  1TRV A;  5AIX A;  2OAD A;  4O7H A;  2NVL A;  2TRC P;  1Z3E A;  1TI1 A;  3GL3 A;  4XHM A;  5IMZ A;  3CSH A;  4MF6 A;  1GNE A;  5AIS A;  4V2N A;  2HSY A;  3VI7 A;  3DVX A;  4NWY A;  3IOS A;  1GL8 A;  1PN9 A;  4JED A;  4K7I A;  2V2G A;  2A2P A;  5DQY A;  5G2Z A;  4ECI A;  1ZMA A;  4ZBD A;  3WD6 A;  3EUR A;  2RLI A;  2N5B A;  2R0P A;  2FY6 A;  5GAN D;  3WGD A;  3LXZ A;  1O6J A;  2IJY A;  3O76 A;  2TIR A;  5JWO B;  3US3 A;  3ZRE A;  3DYR A;  4KDX A;  4WBR D;  5G31 A;  4DSR A;  4BL7 A;  4YAV A;  5DQS A;  4DSS B;  3GX0 A;  1OVN A;  3H1N A;  2IMF A;  1HNB A;  1MD4 A;  2CQ9 A;  3DWV A;  3FHK A;  3LWA A;  4YQM A;  5HR0 A;  8GSS A;  1DSB A;  4TXV A;  1IYH A;  2LRT A;  4G0K A;  3UAP A;  1PGT A;  2H72 A;  1M99 A;  4HZ2 A;  5INY A;  1JZW A;  3K8N A;  4O92 A;  5EL8 A;  3G7I A;  4K6X A;  2VOC A;  3J7Y b;  1DE1 A;  5FHI A;  4ZL7 A;  3UAR A;  1OKT A;  4G2E A;  4Z2R A;  3GFK A;  3TUE A;  3A2X A;  3LEF A;  4L8E A;  4KSO A;  2DML A;  4GXZ A;  5D9T A;  3EMX A;  4FYC A;  2E0Q A;  3W6G A;  2K8S A;  2ZUP A;  4XIH A;  2C3T A;  1F3B A;  2OBI A;  4MZC A;  1K0N A;  4K5S A;  3RBT A;  2FCH A;  5BRT A;  2DJK A;  1B8X A;  2OE1 A;  1SKS B;  20GS A;  1OE8 A;  3EC3 A;  1K0B A;  4PGT A;  1A8L A;  1XXU A;  1PSQ A;  2O8V B;  1HD2 A;  5C00 A;  3APQ A;  2QA2 A;  4BL7 B;  1OE7 A;  2H0H A;  2PBJ A;  3CYN A;  4OMV A;  3BBY A;  1I9D A;  1O8W A;  3GHA A;  3IAS 2;  4CDO A;  3U6V A;  1G0T A;  2V6O A;  3HDC A;  4K9Z A;  3M9K A;  6GSV A;  4TVE A;  1EP7 A;  3IK9 A;  4WEY A;  5HFI A;  3A2V A;  4GCI A;  5JCU A;  3WGX A;  5CRE A;  3F0I A;  1ZL9 A;  2VLV A;  4HU9 A;  2XHF A;  3E9J B;  1SK2 A;  2YOI A;  3G7Y A;  4TN8 A;  3VWW A;  3MSZ A;  1YF1 A;  1M2B A;  3FY7 A;  1WJK A;  2DMM A;  5GAP D;  2HRK A;  2L4Q A;  2LEG A;  2C3Q A;  5ECM B;  5J4U A;  4XS4 A;  3D5J A;  1AUC A;  5DJL A;  3HCZ A;  1VF4 A;  2C4J A;  4EXJ A;  3KMN A;  4KSM A;  5J41 A;  2YN1 A;  1MDJ A;  4HZ4 A;  2GT5 A;  2MMZ A;  2OJL A;  2WB9 A;  2OE0 A;  5KN3 A;  3L78 A;  1PN0 A;  1S3C A;  5HFK A;  2O85 A;  1GP1 A;  3VPT A;  5ECH B;  1YDK A;  2B1K A;  1H4O A;  4CY6 A;  5GZZ B;  2GSR A;  4TW5 A;  4BVY A;  4GF0 A;  4HQZ A;  2NBS A;  2IN3 A;  5ELG A;  1EOG A;  19GS A;  3IHQ A;  5A5K A;  4FYB A;  2B7J A;  5KOX A;  1OAZ A;  1PMT A;  3TOU A;  2KLX A;  1GSU A;  4DSQ A;  4EVM A;  2AB6 A;  3GH6 A;  3UVT A;  1GTI A;  2VCX A;  1FG4 A;  1XFL A;  4J56 E;  2JSY A;  2OKA A;  3D0Z A;  2IMK A;  3LFL A;  2GDR A;  2GQM A;  4X1U A;  4XS4 B;  3EMP A;  4D73 A;  2P5R A;  4E8H A;  3UMA A;  4PXO A;  2LQO A;  4MMM A;  4TXO A;  1WWJ A;  1J9B A;  3FZA A;  3TCO A;  4ZIL A;  5FWG A;  1THO A;  4YKG A;  4RQR A;  2R37 A;  1UVZ A;  1Y6E A;  3EVI A;  3QR6 A;  2JAC A;  2KUC A;  3RPN A;  3KCM A;  2R2J A;  4K7N A;  3KH9 A;  12GS A;  3CMI A;  2V32 A;  1JLV A;  1GTU A;  4BVY B;  4PUA A;  2M46 A;  1W89 A;  2MBS A;  3GSS A;  5D9V A;  1DE2 A;  3IBH A;  4NHW A;  1AQV A;  4I8B A;  2KOK A;  2LKU A;  2X8G A;  1X9M B;  3KTB A;  1ZOF A;  2X8H A;  3IC8 A;  4E8E A;  3FR3 A;  1QQ2 A;  2HI7 A;  3GKK A;  1SD8 A;  1JZR A;  2H6Z A;  2OA7 A;  2OE3 A;  3TJB A;  4PUF C;  4PUR A;  3TJJ A;  4D73 B;  2BJX A;  3N9J A;  4KX4 A;  1RW1 A;  1G7O A;  3TDG A;  2RUE A;  3IPZ A;  4JU5 A;  4K5R A;  2V41 A;  4TKY A;  1TK5 B;  3BD2 A;  5KN0 A;  4TXO B;  5DCH A;  5KEJ A;  1X5D A;  3KH7 A;  2ON7 A;  3FMW A;  4I2T A;  4YQU A;  2JSZ A;  2O89 A;  2YJH A;  3L9U A;  3O6T A;  1X5E A;  1S3D A;  2O87 A;  2I81 A;  2H1G A;  3LSZ A;  4I5Q A;  2YPM A;  4ICY A;  4X43 A;  1IYI A;  4NV5 A;  3GYK A;  3KTL A;  1XZO A;  2YWI A;  3EYT A;  4ECB A;  2VAF A;  1XW9 A;  2KHP A;  4J57 E;  5CP1 A;  3HVV A;  1GRX A;  2VL2 A;  2J23 A;  2Z9S A;  2L5L A;  4EC0 A;  1SJI A;  2YWN A;  5F8B A;  1FO5 A;  1QUW A;  3IHG A;  1Z7R A;  2B5X A;  1EGO A;  3P7X A;  1QMV A;  1SJZ A;  1MTC A;  1FB6 A;  4N0Z A;  1XW5 A;  2PER A;  2V1M A;  1JZD A;  2XC2 A;  4WR5 A;  3CSI A;  1HNA A;  2MMA A;  4KB3 A;  3L9S A;  2DSA A;  5IPG A;  3F4T A;  1NHO A;  2VD1 A;  3APO A;  4MNN A;  3IAM 2;  4HDE A;  2NPB A;  6GSX A;  2DJ2 A;  2MYG A;  3UBL A;  1FB0 A;  5COH A;  4EDZ A;  3QMX A;  5F07 A;  1YKA A;  1M7T A;  2OBK A;  1M2D A;  1AW9 A;  2QC7 A;  4I2U A;  2DIZ A;  3LXT A;  4EDY A;  4AF2 A;  2H76 A;  4IJI A;  1U88 A;  2VD0 A;  1GUL A;  1O8X A;  1UN2 A;  5D9W A;  1N2A A;  4ACS A;  4HS1 A;  4RQX A;  4MDC A;  4QQ7 A;  1XPV A;  3CBU A;  2AJQ B;  1TDI A;  4O5R A;  1V2A A;  2IPA A;  2R5G A;  3DRN A;  1XWB A;  4YAP A;  3UJ1 A;  2GGT A;  2H75 A;  2H71 A;  3RHB A;  2YNX A;  6GSW A;  2WDU A;  5KOW A;  3CSJ A;  3PGT A;  4IW9 A;  3HYP A;  3PR8 A;  3FK8 A;  2LRC A;  4G10 A;  1YJ6 A;  5L71 A;  5H5S A;  1XCC A;  4WF5 A;  3HA9 A;  1OC8 A;  1EV9 A;  3R2Q A;  3HZ8 A;  4Q5F A;  2EIR A;  2X64 A;  3RPP A;  2YJ7 A;  4N10 A;  2KP1 A;  2M72 A;  5G1L A;  2L57 A;  1TRS A;  3RDW A;  4O32 A;  1PL2 A;  1GLQ A;  2MZC A;  3GKM A;  4QL7 A;  4BWQ A;  3QCP A;  2IFQ A;  3ERW A;  2I1U A;  4OD7 A;  1CQG A;  5C04 A;  4F9Z A;  1HNC A;  2C0E A;  2PVQ A;  4JZQ A;  3KJY A;  5CNW A;  3U5R E;  2F8A A;  3EIN A;  3F4R A;  4KDU A;  5AIV A;  4IP1 A;  1YF0 A;  3BCI A;  3ZIJ A;  1SU9 A;  5HR3 A;  2LJK A;  2IME A;  3CRT A;  1V40 A;  3TKS E;  2QKE A;  1NW2 A;  3D6I A;  3ZVJ A;  1JFU A;  3KEB A;  5GSS A;  2FA8 A;  1K3Y A;  2WFC A;  3L9V A;  1ERU A;  2CVD A;  1Z7P A;  5B7C A;  2K18 A;  4ZXG A;  2VLT A;  1M0U A;  3HJM A;  1Z6M A;  1GUK A;  4KW6 A;  4AGS A;  3F6D A;  3QD9 A;  3L0H A;  2GTU A;  2VCT A;  2WZ9 A;  4IGJ A;  3D21 A;  2IFQ B;  2IMD A;  4MZB A;  1TTZ A;  2WCI A;  2LJA A;  2L6C A;  1M9A A;  2IIY A;  2X49 A;  3E0U A;  3IK7 A;  3ZVJ D;  2GVP A;  4POM A;  2WUL A;  3F6F A;  1UC7 A;  5DAK A;  2JL4 A;  4PNG A;  3FZ4 A;  3CRU A;  1KNG A;  3VI5 A;  1B4Q A;  4HUA A;  4L0W A;  3OR5 A;  3MIX A;  2A4V A;  2X99 A;  1MDI A;  1PX7 A;  4WXT A;  4OWY A;  1T4Y A;  4IQA A;  2F9S A;  4TR1 A;  5IIZ A;  1J08 A;  4MJB A;  4L0U A;  4V1A p;  1LJR A;  2E7P A;  4MA9 A;  5IPH A;  1OC9 A;  2OAC A;  2B5E A;  1MDK A;  4TR4 A;  1XWG A;  1AQX A;  3ERG A;  3C8E A;  3VWX A;  4EE0 A;  5A4V A;  3DIE A;  5KN1 A;  3MYD A;  3DGQ A;  3KIJ A;  1SK1 A;  2KP2 A;  3TRQ A;  4GWR A;  2K8V A;  4IBP A;  1A24 A;  3M8N A;  13GS A;  2HXK A;  4PNF A;  1JLW A;  4KH7 A;  1GSQ A;  1KTE A;  2H19 A;  1F37 A;  3GUR A;  3G9B A;  4MCU A;  4MPG A;  4KGI A;  2DIY A;  2AV4 A;  3IDV A;  4JBB A;  3QPM A;  4XS6 A;  5DAK B;  5CRH A;  5H5R A;  4MPF A;  3HZ4 A;  2PUK C;  5F06 A;  1K0A A;  1X5C A;  2L4C A;  4V2L A;  5E59 A;  4RI7 A;  1O81 A;  4L5L A;  3PPU A;  1HQO A;  1XWK A;  3MAK A;  4ULX A;  4TR0 A;  3GKN A;  2JZT A;  4ZB6 A;  2H1A A;  2DJ1 A;  6GSS A;  4TR1 B;  4FO5 A;  3Q6O A;  3HD5 A;  3D4M A;  3C7M A;  3GKX A;  1WMJ A;  1YEX A;  2VM1 A;  4BPY A;  1OC9 B;  3LYP A;  2C1Y A;  3C1S A;  4WET A;  4AJ6 A;  4G0L A;  2GZP A;  3IC4 A;  1ERV A;  3ZZX A;  1K0C A;  1DUG A;  3EWL A;  5D73 A;  4EKZ A;  5JWR B;  5J3R A;  3EE2 A;  1NSW A;  4KUN A;  2CVB A;  2FWE A;  1GSS A;  2H30 A;  1O7U A;  2GT6 A;  3MWH A;  2LRN A;  4KAE A;  1WPI A;  4IQ1 A;  2YP6 A;  1XWC A;  5IMD A;  2VL2 C;  4LA1 A;  2B7K A;  3KP9 A;  3P8W A;  4YKF A;  5IO2 A;  3ERF A;  3P2A A;  1XVW A;  5JCG A;  4NXI A;  4ID0 A;  2R0C A;  1SYR A;  3FRC A;  3EU3 A;  4ECJ A;  1YZX A;  1H75 A;  4IVF A;  1JHB A;  1GSD A;  4F2I A;  3TJF A;  4XTS A;  2HSM A;  2HRN A;  1TRW A;  2GQL A;  2V6K A;  5CO3 A;  4EIP A;  2DKI A;  3WT1 A;  4IS0 A;  5EPF A;  3I69 A;  4EL1 A;  2LJR A;  4TOP A;  6GSU A;  1GTB A;  1GSE A;  2R6K A;  5HQP A;  4O5U A;  2N5F A;  3TRX A;  4IKH A;  3VPQ A;  3IRA A;  4EO3 A;  4DEJ A;  4EUY A;  1XWA A;  5JWQ B;  2I4A A;  2H6Y A;  5ID2 A;  1R4W A;  4TR3 A;  1TJD A;  4GLT A;  3E3E A;  5CRG A;  3CTG A;  4LLR A;  4X0X A;  3ZIV A;  2H70 A;  2DJ3 A;  3APS A;  3FYG A;  1GSF A;  4BA7 A;  5CAX A;  1TI3 A;  5IOW A;  3C71 A;  1TW9 A;  4FYU A;  1WRY A;  2WGR A;  1ILO A;  4LMV A;  3GX8 A;  4MAB A;  2YCD A;  3ISO A;  4K1F A;  2LQQ A;  1A2L A;  2HRF A;  5DJM A;  1R5P A;  2RII A;  2H01 A;  4JE1 A;  1B48 A;  2JZS A;  5CYY A;  1URM A;  1TXX A;  2VCW A;  5BMU A;  2IMI A;  2GZY A;  5JCW A;  4OCE A;  3F9U A;  3M3M A;  5ECP B;  1EEM A;  3DVW A;  2CZ3 A;  1YKC A;  1BQ7 A;  2PU9 C;  1SKW B;  4OCF A;  4POB A;  4KDY A;  1SKR B;  4P3Y B;  5FT3 A;  4J2F A;  2CV4 A;  3FZ9 A;  5G5F A;  5ID2 B;  3KXO A;  4ZBB A;  3DML A;  1GLP A;  4JRR A;  3A5W A;  2YAN A;  3O3T A;  1G6W A;  3TKR A;  1BG5 A;  4MF7 A;  2FGX A;  3LQ7 A;  4K8M A;  3Q74 A;  3VUR A;  2PMT A;  1QK8 A;  3IR4 A;  1GSY A;  5ABR A;  5GST A;  1T3B A;  3C1R A;  5IMA A;  2GSQ A;  1ZGN A;  1WP0 A;  3KM6 A;  3Q18 A;  1T7P B;  3ED3 A;  2YWM A;  2ZCT A;  1Z9H A;  2BTO T;  1F2E A;  3C73 A;  4ZIJ A;  6GSY A;  4KF9 A;  1ZYQ B;  2MMN A;  5G1K A;  2E2M A;  1NHY A;  2VLU A;  3SWL A;  4USS A;  2FUG 2;  2HZE A;  4PQH A;  4ZB9 A;  2LS5 A;  2YZU A;  2R0G A;  3ZFL A;  3HKR A;  4KA0 A;  3A3T A;  2REM A;  2P0G A;  3ZIT A;  1EOH A;  1SYX A;  4ZBA A;  1AAZ A;  4HEA 2;  5D9X A;  2RM5 A;  4OO5 A;  2QA1 A;  2P5Q A;  4N0V A;  3ME8 A;  3WYW A;  18GS A;  1FVK A;  2GST A;  1ST9 A;  1M2A A;  4XRA A;  4PX1 A;  1TKD B;  1EV4 A;  3IE3 A;  1Y25 A;  1K0D A;  3ME7 A;  3FKF A;  5ECI B;  4EF0 A;  2N5A A;  1ON4 A;  1RQM A;  3GTU A;  3CXG A;  3FW2 A;  2C8U A;  5G5E A;  4F0B A;  4CY8 A;  1PKW A;  2G0F A;  3M1G A;  1ACV A;  3S9F A;  2P31 A;  3TJK A;  3J7Y k;  1X9W B;  1VF1 A;  2EIO A;  2HZE B;  2IWT A;  2C80 A;  1T1V A;  2CX4 A;  1F6M C;  2B1L A;  3LW9 A;  4ML1 A;  3TKS A;  4MZW A;  3A2W A;  5J5N A;  3GV1 A;  3ZML A;  1K0O A;  1G7E A;  4MJC A;  4GSN A;  3HVX A;  4LL1 B;  3ZFB A;  1XBS A;  1F9M A;  4ECC A;  3KZQ A;  4Q5R A;  1LU4 A;  4Q5Q A;  1SEN A;  3QFB C;  3MNG A;  2DBC A;  4POK A;  3NOF A;  5LD0 A;  1OKD A;  1PQN A;  2HLS A;  4ILF A;  2PGT A;  3QAW A;  1R5A A;  2PN8 A;  1O85 A;  3GIX A;  1TK0 B;  3GMF A;  2A2S A;  1AIU A;  2AYT A;  1GUH A;  1FOH A;  1TU8 A;  4YH2 A;  3H4K A;  1BED A;  3F63 A;  1TRU A;  1B9Y C;  2H0I A;  3DKS A;  4V2M A;  1TK8 B;  1G6Y A;  3GTU B;  4MP4 A;  3Q19 A;  3RAZ A;  1WIK A;  2VCV A;  1A23 A;  4L5O A;  4CHS A;  1GUM A;  5B6N A;  4MK3 A;  4OFM A;  1QGV A;  3W8J A;  1BX9 A;  2YZH A;  5D93 A;  2HSH A;  1T8E B;  4AJ7 A;  5J9C A;  4FH8 A;  4Z2T A;  4PQ1 A;  2PVO C;  4I6X A;  3N5O A;  2AUV A;  5DBQ A;  3GN3 A;  1ZZY A;  4MJE A;  4HOJ A;  4KCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...