5E4YA

Orthorhombic structure of the acetyl esterase mekb
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
347
Chain Sequence
NSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel esterase subfamily with alpha / beta-hydrolase fold suggested by structures of two bacterial enzymes homologous to l-homoserine O-acetyl transferases.
pubmed doi rcsb
source organism Pseudomonas veronii
molecule tags Hydrolase
molecule keywords Homoserine O-acetyltransferase
total genus 124
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2015-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5e4yA00
1MO2A 3WK9A 3C43A 1LZKA 1ZJ5A 5AKKA 3STUA 1AX9A 3VISA 4Z49A 1A7UA 3FCYA 4WCVA 2BUAA 4BP9A 3B5EA 2XLCA 3BIWA 5CT6A 1AMNA 4Y2JA 1EK1A 4J0KA 4QDZA 1AC5A 1XQWA 3VVLA 5I9IA 5BV7A 1ZIYA 2AJBA 3HACA 5FKJA 2PUHA 4OCZA 1TKRA 4IH1A 3KWJA 4N5IX 2WUFA 3ZLVA 1R9NA 4FLMA 3G0BA 3KDAA 5DTIA 4QE3A 1TQHA 2DR0A 3WA7A 3I2KA 1CVLA 3RKSA 5ESRA 2ES4A 1KEZA 1MX5A 4U2FA 4BVKA 4JNCA 3WA6A 5AKLA 4QWMA 1MX1A 4PSDA 3HXKA 1XZCA 5JAOA 2Z5GA 1MN6A 1T4MA 3IUQA 2PVSA 3FAKA 1UOPA 2XQIA 5DNUA 1PFQA 1A8QA 4FDMA 3WYDA 1Y37A 4EA6A 3FLAA 4AQDA 1XKTA 5ALGA 3AJAA 4MYDA 4EUSA 1YAJA 4ZWNA 4ETWA 4UBKA 3JWEA 5EFZA 4BC0A 3OTQA 3AINA 1L7QA 1HLGA 3O9MA 4G9EA 4BTLA 3HYSA 3QPAA 3AILA 1EI9A 4BAGA 4F0JA 3DKKA 1CLEA 3WKDA 5HK8A 1IVYA 1CUSA 2HL6A 1QIMA 5JZSA 4UPDA 2ZJFA 2PSEA 3AZPA 3EQ9A 2WHPA 1L7RA 3E4DA 1VJ5A 1XRLA 4B0PA 1QIHA 4QLAA 1CUHA 1K5PA 1CUVA 4EHBA 3FLEA 3VJLA 4AZ3A 4Y2YA 3UUEA 2XMRA 2OXEA 5JIBA 5ALMA 5HZGA 3WZMA 1UKAA 1GGVA 3F97A 3LS2A 2YYSA 4CCYA 4C01A 1CPYA 2VAVA 3FBWA 1ZI6A 2AJLI 4G4JA 3I1YA 4HVTA 2JGKA 4WDRA 3FOBA 2BUCA 4CG2A 2GZSA 3ZLUA 3R3XA 5CBKA 1XZGA 2QS9A 2PKYX 3QZUA 1FFDA 4ZGBA 1QFSA 1DQZA 5HCUA 4N8SA 4CFSA 1N8SA 4HTAA 1WM1A 4C88A 5FUMA 4BCDA 1BS9A 3GELA 5HF6A 5JZ9A 3LCRA 2B4KA 3O9VA 3ESAA 3G0CA 5DNVA 3D2AA 1VKHA 4K6HA 2EDAA 3R3VA 4B7ZA 3GBSA 1U4NA 2H7XA 5FOQA 2XT0A 4RPCA 2XUOA 1NX9A 1O6FA 4MYSA 3C6XA 3WK8A 3AIOA 4RGYA 1ISPA 1UK6A 3ED1A 1YAHA 5DTJA 4UUQA 4X00A 3E0XA 3HC7A 1Z68A 1CUIA 5CT9A 2WHPB 1P0PA 2WFMA 5ALNA 5ALZA 5ALIA 4X93A 4Q1VA 5CT8A 4RNCA 1C7IA 1Q83A 4ITVA 3WJ2A 4O08A 5BWBA 5CT5A 2DHEA 4BP8A 1VOTA 1ORWA 1AQLA 4IH4A 4UHFA 3O95A 3GUUA 1JJIA 4BCCA 4OU5A 2PBLA 3AZQA 4G4IA 5JATA 4MEAA 5A7FA 2J4FA 4M0MA 2XMQA 3H19A 1ZICA 5EHNA 4KAJA 1N5RA 1QTRA 3WK4A 3AFIA 2VJCA 5AI0A 1BN6A 3IBTA 3BDIA 2Y6UA 4INZA 3IUMA 3M82A 4IH9A 3JW8A 4C87A 1R4ZA 3WJ1A 2XQKA 4A5SA 2P8SA 5AKEA 4BAZA 4B80A 2JEYA 2ONCA 4HZGA 4EY8A 4X7BA 2WU4A 4GDMA 3B3QA 2V9ZA 4BE9A 4B82A 1BCRA 5DYWA 3V1MA 1JKMA 2OGTA 3ICWA 5JAPA 2ACEA 1DT3A 5KREA 1VA4A 3CCCA 1ODTC 2JF0A 5ALQA 3L1HA 3A6ZA 2GYVA 3U0VA 2DQYA 2HFKA 4DLNA 5J3JA 5JAHA 4KAFA 1S8OA 2JGMA 1K63A 4JEIA 5IVKA 4NS4A 5FDFA 5DLPA 1VLQA 2CUTA 4LHEA 2H9YA 3I6MA 4HS9A 5AK3A 2HA4A 3A70A 4HAIA 1ORVA 1XZFA 1E3QA 2BUBA 3DLTA 1IMJA 3O4HA 5AM3A 5AK5A 3L1IA 4G1FA 3DYIA 3LIPA 5C8ZA 3EF3A 4GWLA 3T4UA 3BL8A 4PW0A 1R88A 4MWSA 1P0QA 4W1PA 4QDTA 5JD4A 5A62A 1K8QA 5D7BA 1H2XA 4ZV7A 1AZWA 2VSQA 1E5TA 1AUOA 4OYLA 4H7KA 2XUJA 3M83A 4WY8A 3FSGA 1R9MA 2HDWA 3VJMA 4U2CA 3EIOA 2X76A 3L1JA 4BC1A 1Y7HA 4AB1A 4LYEA 2QVBA 5AKXA 3YASA 2JGIA 3OURA 5FPQA 2BGRA 1DWPA 2J3QA 3WQHA 1UFOA 4B85A 3WIOA 3STYA 3G0GA 4LXIA 1EB9A 5DJ5A 3VDXA 3TJMA 5SYNA 1BROA 3G9UA 3WL5A 4Y2TA 1W76A 1WB4A 5ALUA 4KEAA 4BDTA 4H7EA 2WIFA 3WL7A 1KU6A 2ZJ6A 2QOEA 5K3FB 4X71A 4J0GA 4K6KA 4ZV9A 5CXUA 2JIDA 1E8MA 3BXPA 3G02A 1EX9A 4KE8A 1QO7A 1EDDA 5AKHA 4J3JA 1XZHA 4P93A 2XMBA 4WJLA 5CMLA 1IZ8A 2E3JA 1CUDA 1GPNA 1UK7A 3I2JA 3ZI7A 1ACJA 4UBMA 5C81A 4MJ3A 5E4YA 4J7AA 2C0QA 4AX4A 4FLFA 4AZ0A 2BCEA 1YSCA 2QJRA 1XQVA 3CN7A 4EY4A 5LZ2A 3WI7A 1CUEA 4CCYB 1XLWA 4KE6A 2H1IA 3R3YA 1XRQA 1JMYA 4GW3A 3B12A 2QXUA 3HZOA 5AM1A 2WFZA 1ODSA 1JFRA 1O6GA 2WUDA 2WIJA 5ALHA 3TEJA 3STXA 3W9BA 1ODCA 2IIVA 2RAUA 4DTCA 4X6YA 4FFVA 2BGNA 1MPXA 1CUWA 1VE7A 2XUQA 5AICA 3ZWQA 2OAEA 1TCCA 4OB7A 1XZKA 2Q0XA 5BWCA 5AI4A 5ALTA 1GZ7A 4UHBA 1EB8A 4Q34A 1EDBA 4B9AA 4I19A 3STWA 4FNGA 1MAAA 4H7DA 2WG0A 4CG3A 1GKLA 1HBJA 4W1RA 1DX4A 1UK9A 1WCYA 4FBLA 3RLIA 5ALKA 2QUBA 1B6GA 3IDAA 4OB8A 3QM1A 2XMDA 5AI5A 4FBMA 4X97A 1QLWA 3R40A 4WY5A 5HQ3B 1UKBA 4DMFA 4U2EA 3R3ZA 1GQSA 2GBIA 2HRQA 1H22A 1FJ2A 4TGLA 2VJAA 3NGMA 2FX5A 2XUPA 3FVTA 5CTAA 4X92A 4NZZA 2XQFA 3DL7A 1H2WA 2GBFA 4F60A 1XQYA 5ISMA 1CUGA 3EQ7A 3WK7A 5ALSA 1UWCA 3SWWA 3BIXA 2D0DA 4UBJA 3H17A 4EY5A 1CUCA 3QYJA 2PL5A 4BVLA 3DOHA 3EBLA 1D07A 1XZEA 3F9CA 4F5ZA 1CQWA 1XKLA 2O2GA 3GA7A 3UMJA 3VKFA 2EDCA 4JYMA 2XQJA 3H1BA 5EIEA 1YS1X 2ZYHA 4Y9SA 2G4LA 2OCIA 3WWPA 2XUAA 3HRHA 2YH2A 4BE4A 2ACKA 5ALDA 1G42A 3QITA 3WK6A 1XRNA 2HRRA 1P0MA 1JU4A 4X85A 1HPLA 4HXGA 2O7RA 1BCSA 1XFDA 5FLKA 2RI6A 2IITA 4H7HA 1ZD5A 3LIIA 4UBNA 5JD6A 3BDVA 5A6VA 5IKXA 2OLEA 1LBTA 5HFNA 4FTWA 2I03A 4HRXA 4OSEA 2VQ6A 4CI9A 4BZWA 5CXXA 4DNFA 2DFPA 5YASA 1MAHA 2CJPA 5ALPA 3OM8A 4Y2QA 2O7VA 1XZBA 2WG2A 3FYUA 5JD5A 1G66A 3G0IA 3NUZA 1QE3A 5HF9A 2HHAA 5KBYA 1LLFA 1Q0ZA 2QTBA 5LZ5A 2IX9A 4YASA 4ZI5A 5D3ZA 4MXDA 4K6GA 2WIGA 3X3HA 1SFRA 4U2BA 3CN9A 1VZ3A 3PFCA 1LPBB 1W52X 3RM3A 2WILA 2X8BA 3H2JA 4P92A 4KR0A 1JJBA 2XI4A 5AKYA 4B84A 2WUGA 1H2YA 3U1TA 3LP5A 3D59A 4PSCA 4CG1A 1YB7A 4X94A 3KD2A 2JGFA 4Q3OA 5CT4A 1W4LA 4AN0A 3STTA 1WHTA 4PV7A 1Q84A 1BE0A 2QJWA 3W06A 2ROQA 2VT7A 5AI9A 1LZLA 1UT6A 3LLCA 4V2IA 3W2TA 4QZVA 1UXOA 1QIFA 3DJYA 4DMHA 4L0CA 3ILSA 1F6WA 2WFLB 2CB9A 1XLUA 1XRPA 2ZJ7A 5HFAA 3S2ZA 3ANSA 4WFIA 3HJUA 3M81A 5H3HA 1TAHA 1VXRA 4FKBA 1VE6A 2Y1KA 5LZ8A 3AIKA 2OGZA 5HKBA 1RP1A 1ZD3A 3DL4A 2JGEA 1NU6A 2ZYIA 4UFOA 3D5EA 1USWA 4N5HX 5K3AA 1CR6A 3P2MA 3DDUA 4P9NA 1SCQA 4BYMA 1OILA 5ALEA 2HU7A 2RHTA 1F8UA 1TCAA 2PPLA 3H1AA 1JT2A 3OC0A 4DMKA 2RGUA 2B61A 5T4HA 5JADA 5IVDA 4TPKA 1EA5A 4FOLA 5AO9A 3C6BA 4BRZA 4ZRDA 5IVIA 1LPOA 4AO7A 1X2BA 3M3DA 1E8DA 4GHWA 4DM7A 1YASA 4B83A 2JBWA 3O4GA 4WFJA 4J0CA 1XZLA 3D0KA 4PQEA 1CUFA 1BU8A 2QT9A 2DHCA 1GXSA 1MNQA 1X70A 4E14A 3C8HA 4FMPA 4Y2SA 3FSGD 3N0TA 2BJHA 5LYYA 1VZ2A 2XE4A 2J4CA 2ZVDA 2GBCA 4OD0A 1EH5A 1XZIA 2PX6A 3IUJA 1F0PA 4J0DA 3I6ZA 4Y7DA 4GXNA 5LKAA 3O0DA 1CUZA 2O2IA 4DGQA 5AIBA 1B41A 3ANTA 2OQVA 4M0EA 2G5PA 1U8EA 4X90A 3WKAA 5ALJA 4BDSA 1WPRA 3IB3A 2VJBA 5JAUA 1VA5A 1YR2A 1G5FA 3PI6A 1CUUA 3PUHA 3Q8WA 4UBOA 3WIBA 3D7RA 3HLKA 3I2GA 1HL7A 3GFFA 3OG9A 5E2IA 2OQIA 1YA8A 2PSHA 2HADA 2HA6A 4ZXFA 5SYMA 1YS2X 2XMSA 3IUNA 2HA3A 1DWQA 3WWEA 3G9ZA 3H2KA 2WIKA 3NOXA 4QA9A 3D3NA 5K5EA 4FWBA 4CIBA 5LZ9A 5A2GA 4BRSA 3D2CA 3TGLA 5LKRA 2VTVA 1ZIXA 2QR5A 3DEAA 1CUBA 5AKGA 4G5XA 3HABA 2V97A 3WWCA 4X91A 3C5WP 2WUEA 3QBJA 4ROTA 4WDQA 1LNSA 2HA7A 5T4FA 4J0IA 5CRIA 1TRHA 2EEPA 4L72A 1BEZA 3ICVA 1CV2A 3I1IA 4LXHA 2JGLA 2WJ3A 1WB6A 3HSSA 4DMCA 4BZZA 1U65A 1MJ5A 1CIJA 3G8YA 2BAGA 1L7AA 2C5FA 1EVEA 1H2ZA 2BFNA 5CURA 3MVEA 4W9RA 5F4ZA 3ESDA 2I3DA 3H2GA 1TIBA 2PSFA 1XRMA 4EZIA 5LZ7A 5JASA 1THTA 2GZRA 2HA2A 1AURA 4G8BA 2XUGA 3BF8A 4UHHA 3I6YA 4QWWA 3W9UA 2VA9A 2VF2A 5AM0A 2CBGA 3DYVA 1AKNA 2GYUA 3PF8A 4QNNA 2CKMA 1LPAB 2HIHA 1A88A 4Y2PA 2I78A 3ZV7A 1RWQA 1NU8A 5AM5A 2Y2VA 2XDWA 2XUKA 4MWTA 3V9AA 2WTMA 4GEGA 1CUAA 1WPXA 2ZSIA 2CMFA 3K2IA 5CH3A 2WM2A 4HRYA 4AO6A 5AKZA 5AM2A 2NW6A 2ZYSA 4C4XA 1A8SA 5LZ4A 5EHZA 5HQ3A 1BEEA 2PU5A 5I8PA 1QIEA 4X6XA 2OCLA 4U2DA 1N1MA 5ALFA 4LYDA 3WLAA 3C45A 1LGYA 1W6RA 4FNMA 4DNQA 1CRLA 1QIGA 2RIPA 2PSDA 1YB6A 2AJCA 4G8DA 1XROA 2XMZA 4FHZA 1X2EA 1J1IA 5AI6A 5EIAA 1MU0A 1H23A 5AHXA 3EQ8A 3PF9A 2WLSA 3QMVA 3KWFA 2WFLA 3D4LA 2XLBA 3FWHA 1WB5A 2FJPA 1DT5A 3R0VA 5AOAA 2C7BA 1R3DA 1MNAA 1XQXA 2RHWA 1K4YA 2G63A 1QGED 2V98A 3DNMA 3F96A 4Y2VA 1CQZA 5E4JA 3G9XA 3FVRA 1CEXA 4EBBA 3F67A 3T52A 1SCKA 3AUKA 3C87A 1DINA 7YASA 1UZAA 1FFCA 3RARA 4G9GA 4UBIA 2Z8XA 3D2BA 5ALRA 3VJKA 1XLVA 1SC9A 4B9EA 4Q3LA 5A7HA 5KWIA 1JI3A 1THGA 4W1SA 2HA5A 1MT3A 4YX9A 5HKAA 3C5VA 2HFJA 4QDUA 4AXBA 2PUJA 3Q0TA 4DNPA 3HI4A 2WQZA 4LXGA 5CW2A 4B6GA 1JJFA 2AXEA 4PNZA 4J03A 3WYNA 3C8DA 3V48A 1XRRA 5DNWA 3WWDA 1WHSA 1RYYA 1KU0A 2VT6A 3FYUB 1DQYA 4MQMA 4QEKA 3IURA 4G4GA 2ZSHA 4UHEA 2WSLA 5K3BA 1CUJA 3QMMA 2QUAA 1LPMA 5E4TA 1UOQA 4J0JA 1EINA 3H04A 5BOVA 4G8CA 4F21A 1TK3A 3C70A 2G5TA 2XMGA 2XUHA 3VXKA 1VXOA 4B81A 2XB6A 4BATA 4J0HA 3V1KA 5AKJA 4P08A 4AMYA 5AOBA 2VATA 4B0OA 5EHXA 3VVMA 5JYCA 2HU8A 2UZ0A 1QONA 1N5MA 1QIJA 4IHAA 4DSAA 1GPKA 4I3FA 2DHDA 3OOSA 4PO3X 5DYTA 1ZGBA 4OYYA 2Z8ZA 4FLEA 3QMWA 1R1DA 4S0XA 2PU7A 5K3CA 1DTEA 5LP1A 2ZYRA 1LPNA 3QVMA 2Z3ZA 5EIHA 3K9BA 2HM7A 2W22A 1E89A 4L9AA 4U2GA 3R41A 1HQDA 2Z3WA 4Q3KA 1GT6A 2J3DA 4LIPD 4RE5A 3F98A 5ALWA 2GYWA 3PFBA 3WWOA 1PV1A 4XVCA 5AM4A 1LPSA 3MGAA 3IULA 3DCNA 4GI1A 5FRDA 4CCWA 2BKLA 3WL6A 1SCIA 4KAAA 4D9JA 2HA0A 1QIKA 1IUOA 4X95A 4IQ4A 5AH0A 3W04A 4H18A 5ALXA 2DSNA 5LLSA 3F8SA 1QZ3A 3I2HA 1UKCA 4BCBA 4JUIA 4C89A 3TRDA 1DU4A 4ARBA 2CEKA 1HDEA 3PDCA 4BTVA 3FYUC 4NVRA 3FYTA 2DCMA 4ARAA 1WOMA 3DKRA 1SOMA 4H0CA 1PJAA 4EY6A 1J06A 5FV4A 1F0NA 1R50A 1CFJA 4UBLA 2QMQA 3W05A 3K6KA 4JYPA 2WJ4A 1EVQA 1QJ4A 5C7YA 2C0PA 2JEZA 4M0FA 3DD5A 4XWGA 5JALA 5ALLA 3H2HA 1ZD4A 4H35A 3CXUA 1A8UA 3ZPXA 1QOZA 3JYHA 4UFNA 5FPPA 3QH4A 1EXWA 5JZBA 4H77A 1TCBA 5K3DA 2XUIA 2YASA 3IVMA 1BN7A 5HF5A 5DWDA 3I28A 4Y2UA 3G7NA 4E46A 4E15A 5C8XA 3DOIA 3QPCA 2C5GA 3SC2A 1FFEA 2K2QB 4K2AA 1ZI9A 3RK4A 1MTZA 3NWOA 1T2NA 3A2NA 5EGNA 5ALYA 5T4EA 1ZI8A 5FP0A 4C6HA 5IVHA 4KYVA 3WMRA 1EDEA 3PUIA 3CCBA 2AJ8A 3G9TA 1LBSA 4A16A 1U2EA 1J2EA 2C58A 4MQLA 1GQRA 5AKIA 1FSSA 5T4BA 3WKBA 1MX9A 1JU3A 5ALVA 4QDXA 4BAUA 4HXEB 5I7UA 5K3EA 4MEBA 4Q05A 1IUNA 2R11A 1CUXA 1IUPA 1M33A 3I2IA 2RONA 3AZOA 5AJHA 3MUOA 1P0IA 2H7YA 3BJRA 4H7IA 4EB0A 2HU5A 4FFWA 2ORYA 5ALOA 5AOCA 4N8EA 3DQZA 4DYHA 3V1LA 1ZD2P 3R3WA 1DWOA 2PSJA 2CZQA 2VJDA 1OXMA 4A23A 3SK0A 2O2HA 4XJVA 5HF8A 4AN1A 4HXFB 1XZDA 2LIPA 5AIAA 4AO8A 4W1QA 4OUKX 3O4IA 3UUFA 1UK8A 1HKHA 1C4XA 2W6CX 1BRTA 3KOOA 4IO0A 1EHYA 4KE7A 4PF1A 5JANA 5EI5A 2WIDA 3V1NA 3WL8A 1XZAA 4XIIA 3HEAA 4DIUA 3C6YA 5DYYA 2Y6VA 3KSRA 5CH5A 3WK5A 1QTIA 4OU4A 2WHRA 4OPMA 4DSZA 4C4YA 4QLOA 4KE9A 3BJMA 1XZMA 4BB0A 4L3WA 4OB6A 1ACLA 2WJ6A 4Y2RA 1FFAA 1DX6A 4LKOA 2JGJA 1J07A 1ZOIA 3S8YA 3WKEA 1W75A 2QRUA 2AJDA 3C6ZA 5LIPA 4JH0A 5AI8A 2XMCA 4AMZA 4BVJA 3R3UA 2XUDA 4QDOA 3IIIA 4RE6A 4UFPA 3SX4A 3QPDA 4Y2XA 1ZGCA 3GROA 5CH8A 2QM0A 3A2LA 2OPHA 2XUFA 2PM8A 4H7JA 2OCKA 1Y7IA 1ZJ4A 6YASA 4BBZA 4GBGA 3H18A 2OAGA 3H0CA 4C4ZA 5JARA 3ESCA 2OGSA 3FNBA 2ECFA 3E1GA 2VAXA 3N2ZB 2OG1A 3GZJA 2D5LA 3OPMA 3DS8A 2FUKA 3AIMA 3A2MA 3FLBA 4DNOA 1I6WA 4E11A 1IZ7A 3BWXA 4I4CA 4CIAA 4KACA 1OCEA 5AP9A 4X3CA 4TVKA 5KWJA 1QFMA 5A7GA 5FXMA 4KRYA 2QKYA 4UHDA 3PICA 5EHQA 1EK2A 2QZPA 1XZJA 2B20A 1LPPA 5AK4A 5AK6A 3STVA 3BE8A 3I2FA 1ETHA 2WTNA 4ZREA 2H7CA 1FFBA 4X6UA 5K3FA 2VEOA 3BF7A 4YPVA 4KRXA 1QIDA 2DQZA 2Y2UA 1QO9A 4KJXA 4Q82A 5A71A 2I3ZA 4N8DA 4EY7A 1YA4A 1K6EA 1G4HA 4K5QA 2C4HA 4H7FA 3ESBA 2WU3A 4W63A 1GPLA 4YK7A 3MUNA 5C8VA 2OCGA 4UHCA 1AGYA 3H2IA 4NMWA 2YXPX 4XX1A 5HK9A 5IH7A 3E3AA 3ZLTA 1GKKA 2B9VA 1W1IA 1E66A 1JMKC 2V96A 3WKCA 2WHQA 4PSUA 3FCXA 3KXPA 2XQGA 5D6OA 2R8BA 3IA2A 5D3KA 3G0DA 2X5XA 1CUYA 2WKWA 2WG1A 4WFKA 3WZLA 1Q0RA 1E8NA 4GLBA 2QXTA 4GECA 2GBGA 2FJ0A 1QIIA 1C7JA 3PE6A 1YCDA 3O4JA 1UOOA
chains in the Genus database with same CATH superfamily
4ZAFA 1VJGA 1JZQA 1JP7A 1W35A 2VK4A 3GK3A 1SC6A 3KLPX 3MNFA 1MIHA 4RK0A 1DEXA 1X86B 1C9JA 2D13A 3WK9A 3C43A 1LZKA 1R6AA 2JD1A 3JD4A 2P0YA 3BSWA 3H2ZA 1N2XA 1ZJ5A 4M54A 1F1BA 3TQOA 5EXXA 4RENA 2CV1A 4RGBA 4MS3A 2P35A 4QO8A 1GL7A 3BHNA 4IIFA 2W8BA 3OZTA 5AKKA 3BTOA 3STUA 1DMRA 2GNPA 4Z9XA 3UB4A 3O84A 1A2BA 3WIEA 3SQDA 4OYRA 2HMWA 4TKLA 3HDTA 3FFBA 2CLKB 4WUVA 4WCVA 1ZK1A 1J2UA 3CZAA 1QR2A 1ZH6A 3PHCA 3PYMA 3R5JA 2XWSA 3IVAA 1SUPA 3ESRA 3FPHA 3ZR4B 3QYAA 3KZVA 5CFNA 1BJTA 4QDZA 5I9IA 1K08A 1LFDB 2VJMB 3WG9A 4NBWA 1ZIYA 1U7HA 1YMUA 4YJ2B 1JV2B 3UTCA 1YJAA 4R71A 1DCMA 1TKRA 1HK7A 4BEVA 1EP1B 1V71A 2FSHA 4KXUA 2VO1A 4BMZA 3ZU5A 1R9NA 2Q27A 5KYKA 3G0BA 4HRVA 3EY9A 1OX5A 3KM0A 4KK3A 5DTIA 1O94A 1SUCA 1QVVA 4OBXA 1KMCA 1U2SA 2QX4A 4LDZA 1F14A 1P3DA 1U0SY 2JJ1A 2EZ8A 3KETA 1TA9A 2D59A 3EXG1 5HG0A 2I8AA 3ZV6A 1N57A 2G80A 2WJYA 5LP6C 2QVLA 1RM3A 3UFBA 5K09A 3OUUA 4G81A 1V5WA 3TLGA 4YTEA 2C3OA 2EKZA 5IK2A 3T54A 4O02B 3FA2A 1V96A 2AK3A 1I1OA 1QG2A 1Z16A 2CYBA 2EGGA 2MWMA 3FG9A 3M5DA 4QNMA 4TZTA 5DASA 4ASUD 3GN1A 4OM8A 1FDUA 3F78A 5IC4A 1T3TA 3HXKA 5E1OA 3T4EA 1OB2A 1HQKA 2PMKA 1CIPA 3KDSE 4O3MA 1MN6A 4LW8A 1BOFA 1T4MA 3IUQA 3WS7A 2H00A 3RTEA 3EF1A 2ZOSA 4LMBA 5FPHA 3FAKA 1AM4D 2QRMA 2ASVA 2WZDA 1WZUA 3DOOA 3QKRA 2R751 3QVKA 1FL9A 3SF8B 4X1IA 1H9BA 1XD8A 1S7GA 3A9UA 3ICEA 2FXIA 4MW9A 4PAGA 5JJLA 3UOAB 2OD2A 3T1VA 1KWGA 1YR3A 4EB6B 1Z8HA 2XBUA 1BQEA 3EF0A 2Q6TA 2R6HA 2J32A 3OHMA 4FDMA 2O7QA 4NPAA 4WY2A 4B17A 3FLAA 5BRAA 1KDRA 4BQEA 1T36A 1BD3A 3IILA 5EIBC 4EMUA 1KJZA 5KOHA 4QYSA 2E55A 4GZ6A 3IOYA 3TIFA 3JYPA 3OOEA 2PLFA 4MMYB 1RLOA 1YAJA 1ZMTA 4NCKA 1UEJA 4L1KA 2R86A 1A77A 1MRSA 4OGKA 2PCJA 3PXDA 4ZWNA 1SXGA 3WLSA 1VL1A 3WXBA 4ETWA 4WADA 1PG0A 4AICA 5AVKA 4JZKA 3VNUA 3M5PA 5B6PA 1LV7A 3JWEA 2OP0A 4P34A 1OZAA 4CM4B 1NMQA 1HDRA 2GPNA 2R8PA 4V24A 6NULA 3I5XA 2Q5FA 3AINA 2Q99A 4ENVA 2DPXA 2K4MA 1L7QA 3CURA 5H4HA 3N8NA 1YQ9A 3CKLA 3LL4A 1NMXA 2ZEJA 4G9EA 1PWYE 5HBGA 3W5JA 1KEKA 3PQ8A 3P9IA 5CITA 1GAWA 2Y67A 2ZRLA 4XUCA 3T5DA 1VIVA 2XNJA 3Q9LA 4MA4A 3BWVA 5BW5A 1XL0A 3WB2A 5LYJA 3E9QA 4C6RA 1CF9A 3RRFA 1NUPA 1EP9A 3CHYA 2IA5A 1QHIA 3AILA 2ON6A 4RPHA 4XD7D 1B16A 1J7JA 1WPGA 2ACVA 3DZIA 4BX2A 4DMGA 2XA1A 1R0XA 4K9QA 2P2NA 4CPDA 4F0JA 4N3BA 4W5RA 4IIBA 5KINB 5DHQA 5PGMA 3WKDA 3L77A 1MH1A 1XRSB 2JCYA 4IKOA 4WK6A 1ADGA 1Z74A 2H8KA 1CUSA 1T36B 2FUEA 2HL6A 4N6NA 5LNK6 5IJAA 2OZPA 4QTYA 1TVKB 3A8TA 3LWZA 3HPQA 1GZ6A 1JYEA 2FW1A 4MI9A 4EB6A 1SUAA 4DR3B 1QAOA 3WJAA 3FCUB 3AZPA 1V43A 4G5RA 3SQLA 4G97A 5KWSA 1KAEA 1L7RA 4N12A 1B73A 3B89A 3E4DA 4R9UC 1CEEA 5G4KA 3AM4A 4XI9A 1QIHA 4ND1A 4QLAA 2Q6IA 4WN9B 2IS2A 4MZXA 2NVUB 1CUVA 3UWKA 4D98A 1ZZGA 3OKFA 4DREA 1ZC3A 3MQFA 5IT5A 3NEYA 1M1YB 4EB3A 3W5BA 3LFHA 3UUEA 3CW9A 2HU2A 1G5HA 4PAMA 5LQDA 1SC1A 1Q1EA 4PYOA 4N03A 1D2CA 1HT1E 3JZDA 4LDQA 4DFDA 3D31A 4RZ3A 2WSIA 3DKIA 3GVCA 4IGAA 2C2KA 2XTJA 1TRKA 3KJNA 4BNHA 1U31A 3EWIA 4P7FA 1GGVA 4IV0A 3A28A 3E9MA 2HBYA 3PJFA 2WSMA 3F97A 1H1DA 3DAOA 3JVUA 1R27A 3LS2A 1FP7A 4GWGA 4LSGA 4RM3A 4TXMA 3H4IA 3TMKA 3GFSA 4CCYA 4CKZA 4Q4HA 2YINC 4XYLA 3TR5A 1INLA 4Q4DA 1EUQA 1M76A 4HYYA 4AKSA 1TQDA 1UFVA 3CF6R 3EVDA 1KVTA 2VAVA 4MV8A 3Q40A 4MWBA 4RABA 4WOCA 4GGPA 3A3KA 4R2MA 3MAAC 4BVFA 1Y1KE 4ZT2A 2H2GA 2FMTA 4Q4LA 3LFUA 4TN1A 3AUFA 1KNQA 5LQJA 1AS3A 2JGKA 3BZWA 1RKUA 3NDIA 4PX5A 3TOCA 4A1FA 2XWPA 5GMOA 4FFSA 2WWWA 2PT7A 2BUCA 4DIOA 5ADHA 1KXJA 1M8KA 1PR0A 2L82A 3EIFA 3SJBA 5C7OO 4P4SB 2RMKA 1QWSA 3JQ8B 3B7WA 4BO9A 4H15A 5KQMA 3OIDA 2QS9A 4JP1A 4G23A 4M1MA 1O94C 2ONJA 4JOSA 3VH4A 3QZUA 1FFDA 4MVJM 4GLFA 3B1KA 4I4TF 1Y3FE 4N8SA 3ZCUA 2QJOA 4HTAA 5CB6A 4CBVA 3LHDA 3U7EB 4EJ2A 1QGAA 1VG1A 2PTHA 5HDQA 4BN5A 4ON9A 4C88A 2IHJA 2W8BB 2WF5A 3EDRA 2FKNA 2W4MA 3AB7A 5LR6A 3D8UA 3JALA 1RYDA 2BN4A 1BS9A 4IXMA 1DBWA 1KSFX 1P5HA 1A5SB 4XSVA 4ZVQA 1HLPA 5HF6A 4M87A 1XV5A 4KGVA 3R5KA 3T3NA 5IYZF 1BU5A 1BHJA 3TFOA 1Z0AA 4M6WA 1KQFA 3S1AA 3BQNB 3G0CA 4KX5A 2A9VA 5DX8A 4UDXX 1I8TA 2SHKA 3WMWA 1QMPA 5BW4A 5KWVA 1UBJS 5C1PA 5AW8A 1CYDA 2AXPA 1IK4A 1G3IA 4IGKA 2QNIA 2H1OA 1OAAA 2VTEA 1EEHA 3ACDA 1ZN2A 5LOVB 2H7XA 2FMXA 1QANA 5A3QA 2IIQA 6ADHA 2PUAA 3AI3A 2JJ2D 3TRFA 4NK5A 2VYNA 4Q37A 4RPCA 4XDHA 1EYZA 2ZUCA 1WXEA 3IOMA 2XDYA 3IESA 2WE7A 3QW2A 4B73A 2R8XA 4MA0A 1TT7A 1WW8A 3HCPA 1C2TA 1O6FA 2JZCA 3K8ZA 3AIOA 1IZYA 4PLCA 4RGYA 1ISPA 1YAHA 7REQB 3BM5A 2BTOA 4UUQA 4X00A 2FPLA 4AS1A 2R84A 3E0XA 3REQB 4BUZA 5B57C 1P3Y1 3ILYA 4Z86A 3VR4D 4EGSA 1TQ6A 3L0DA 2HHCA 1NJSA 2ZIZA 1BXKA 1OZ0A 3H84A 1G2PA 4PLVA 1XAIA 4Z99A 3ZHOA 3CC8A 5CA0B 2ATIA 1IJKA 3S44A 5A9RA 5KUTA 1G8KA 3ONDA 5JJIA 4DDVA 3AESB 1K86A 2BHTA 3ZD8A 1P0PA 3A4YA 3SFZA 2C3MA 3RU2A 4Y1RA 3WB0A 3ZTYA 5MFZA 2IRWA 5ALNA 5ALZA 5ALIA 4U7HA 1C30B 3RRXA 2GTHA 4Q1VA 1MJGA 1WKBA 3F8TA 4FVTA 2Q41A 1FVHA 1VYTA 2B69A 4M53A 3T3GA 3DCYA 4NAVA 1C7IA 4MS4A 1RZRD 3WJ2A 3FOWA 1Z83A 1PFUA 2GESA 4I50F 4HFJA 2WU8A 3PNLA 5D85A 3EIXA 4JLUA 3PNKA 4OLAA 4GVXA 1ORWA 3V8EA 2KBEA 3DE3X 4NMLA 3GD7A 2DX7A 3DLPX 3AKYA 3RIMA 4UHFA 5H3LA 3O95A 4Z5XA 3GUUA 2QTFA 2FVYA 1ZJJA 4ZIRB 1JJIA 2XBLA 1XAJA 4N5MA 3CPJB 3WV4A 3GWZA 4A1OA 3E1SA 4F4IA 4JB0A 4G4IA 3BIJA 4LWOA 1N5LA 1QPGA 2LVBA 2C1ZA 2V8BA 2ZUWA 2EFEB 3GDGA 4URYR 1G5RA 4ZRMA 4DXHA 5A7FA 1SZCA 3KOMA 4CN8A 1ZXLA 4HTFA 1M2WA 4YRBA 3QWAA 3C14C 1FDSA 1O89A 2VHTA 5B4VA 2O8EB 4IDPA 3JARB 4A0GA 4PTYA 1ICEA 3AFIA 4JJ8A 5H59A 2WB4A 1RJEA 4JLVA 3N05A 1BN6A 1IY9A 3BS4A 3AQIA 1T6NA 1X1DA 2R6GA 4OJYA 1DWUA 2P9QA 2HT6A 3SS7X 5BN4A 3U3KA 5JUWA 3ZVNA 3KB2A 4AURA 1WE2A 1J33A 1R4ZA 3B1WA 4LC0A 4CTJA 1XPJA 4HGQA 5AKEA 2B36A 5GVSA 1UAAA 2JCXA 4XGKA 4CLDA 3QLUC 1W34A 2FTKE 2FSVA 2X19A 4EY8A 2WU4A 1WDTA 1SA0B 1FXSA 1Z7BA 2JGRA 3GJTA 3KWMA 4OAPA 4PYIA 4YHBA 1SM4A 1VYVA 2R5WA 3L46A 1CB7A 2OCBA 1E7RA 4YJGA 3VR3A 4BGVA 2V9ZA 3VPXA 1QMGA 4KZPA 1V9LA 2WYUA 2ATVA 4K26A 3HUTA 4TL8A 1G41A 4BNXA 4YAUA 1XN4A 1NULA 1M74A 3LQ1A 5CHYA 2DFKB 2ID4A 4HAYA 3PFIA 4M1OA 1E79A 1V25A 4KV9A 3SOZA 2NTNA 4GRAA 2A59A 4NZ9A 3VR5H 5B1EA 5KREA 3NHBA 3CCCA 5JMWA 3COSA 3KB1A 3EBPA 3SR0A 2JF0A 2NGRA 4UD6A 3ER8A 1N3LA 2PYZA 4ENUA 2EZ9A 1ECGA 1X8LA 4R8KA 4WA7A 1R0ZA 2ZSBA 3A6ZA 2PGIA 1O95D 2GBLC 4B3FX 4P7BA 1U3FA 4E5VA 3GUCA 2MJLA 1M0SA 2WV7A 3QVOA 4MEJA 4BBPA 1PTJA 1T6ZA 2B25A 2BGKA 1Q0PA 4L0MA 4PCVA 5IBQA 2FPOA 4U00A 4B4UA 3R20A 2RI1A 3JASB 3MF4A 3P2EA 1P1IA 3AEXA 2CZCA 3MUEA 3ZTTA 5JAHA 4MQUA 1YIDA 4B4OA 3C6KA 4O59O 4QUDA 4S2UA 1YVPA 2ECKA 2DPMA 4A2PA 1PJTA 1PDOA 1WF3A 1Y82A 2AE2A 2BTQA 3P0HA 1G19A 5BNFA 2XDQB 5IVKA 4AZWA 4MYRA 5JO9A 4NG5A 1QYXA 1QCYA 4EENA 3ITNA 1CY2A 4LXTA 3AQ4A 5KS2A 1V11B 3I6MA 4CKBB 3P9ZA 4HS9A 3QX7A 4AJJA 3AUJB 1M2OA 1UDBA 3N74A 2YQZA 3V8VA 3JYLA 3A70A 2RC5A 4I99A 1V0JA 1ORVA 1MV5A 2I4LA 2I9KA 2Q3MA 3DGEC 1RXWA 4R5MA 2VEDA 2FH5B 4EJ6A 1B8OA 3VZRA 5AM3A 3ONEA 1OFGA 1AK9A 2REQB 3H9GA 2ZU0C 1WUYA 3LIPA 4PQGA 4ETMA 5KMGB 2O8EA 5EC8A 4GOND 1T1IA 4LA4A 1QQTA 2WR8A 5FYQA 4MAFA 4Z8YA 3GJQA 5LBTA 2ODQA 1CY1A 1SKQA 2IPNA 3WGMA 1D2AA 4B3TB 1Z75A 1R88A 4LY9A 4TTQA 4X8OA 4CDGA 4CIWA 1FZTA 3GJ7A 4W1PA 2YS6A 5DSTA 4G2NA 3JQAA 3LYLA 5EXDA 3RANA 1IE3A 1K8QA 5KYWB 2YXLA 5LWHA 3F4BA 3KQVA 3IDZA 4ZV7A 2ZSFA 4M1EA 1E5TA 3RS2A 1EX1A 5IDWA 4E30A 1UP4A 5E9QA 4WY8A 1GG8A 3I0NA 2NO1A 2H1WA 1JAZA 3DDWA 1NXTA 1FYXA 2HDWA 4TS4A 1XHLA 3VJMA 5KDDA 4G84A 4L4YA 5M5BA 2O2EA 4IHQA 2D5IA 1XMSA 1Q1AA 2FPGA 3H8VA 4GP9A 1N75A 4EF6A 4A6XA 3L1JA 4C7OB 3QFCA 1ZD8A 2XCQA 1H65A 4P3PA 1Y7HA 4YJDA 1JHYA 3O73A 4HLUC 4AB1A 2CDAA 5TY0A 2WJIA 4DCNA 5EVCA 5IU6A 4OYHA 4RK7A 2J7PD 1B76A 4N01A 2HF9A 4ZZ3A 3PXUA 4GE3A 3OURA 3AV3A 1IAVA 4P33A 1YU6A 4RJLA 3TLMA 3V1MA 3WQHA 5EIFA 3ZKWB 4Q1BA 3FRHA 2B8EA 1UFOA 1KEEB 1SU4A 1DAIA 2Z98A 3AEZA 5FBZA 2I22A 5DISB 4BLTA 5KTYA 2XECA 4C3ZA 3LNTA 2PBZA 2I87A 4KMMA 2AV6A 1EB9A 2IPLA 2Z6UA 1CSEE 3VSDA 5A9TA 2O4UX 5A9SB 3TCXB 4HT3B 4QJIA 2Z9DA 2J33A 3E22B 3EIHA 3G9UA 1JEYB 1U0RA 2QEQA 5FNVA 4Y2TA 1KOLA 4N7RA 2OA0A 5KO2A 1OD6A 1WB4A 3FHJA 2A86A 2J0UB 1QNFA 2AHRA 3FDXA 5ALUA 1VBFA 4EUEA 1KIMA 2N47A 4BDTA 2PL3A 5BORA 3KO8A 2ZXFA 1F38A 4FFNA 4YUXA 4M98A 4OFXA 4NULA 2BMVA 3HBMA 5JMOA 4L3OA 4XD2A 3AFMA 1ZSYA 1Z2CA 2R7NA 5EAIA 3T9CA 4YMLA 1MCZA 1D03A 3QPUA 4ZV9A 4F5YA 2JLCA 3N58A 1UWVA 3ROPA 1XCMA 1WQ1R 1FUKA 1G16A 3U7FB 3JALB 2O8CB 3HB5X 1E8MA 1EX9A 4ZAYA 4DJDC 5I3ZA 3PZRA 5J2UF 1NN3A 1SURA 2APJA 2YWBA 3LHKA 2V1XA 2CLHB 1N3BA 2I3AA 3OM9A 4DXAA 5I4IA 2Q46A 2VF5X 4URXR 2DECA 3FRIA 3FI0A 2IGTA 2P3SA 1I0ZA 5HUJA 3I30X 3ASVA 3EVNA 3FKSD 3LXMA 3L79A 4WJLA 1D6NA 4FYXA 1XE3A 2GHRA 3CT6A 3TLBA 4TVOA 2E3JA 1CUDA 1CQPA 3OZDA 1A5TA 1E77A 2VZLA 4IJUA 1FW8A 2CXRA 4XB1A 3SNKA 3Q10A 5NULA 2VDRB 5JSHA 2QLJA 3PNSA 4WPGA 4AZ0A 4AYTA 1EMDA 1YSCA 1NBHA 1MJGM 1U3VA 2PZFA 5B1IA 1EM8B 4RPIA 1OQAA 1XQVA 1YIOA 1V41E 3K7EA 4WZBE 2LWIA 4GSLA 4EY4A 3KXDA 5C8YB 4PYLA 5IANA 3DL2A 4I50B 2EX1A 3QX3A 2O8VA 1X87A 4MV7A 4ZVTA 1KBQA 1V1MB 1S96A 4G25A 4IX1A 4MWDA 5JC8A 1JMYA 3EC2A 3IV9A 3OM1A 3QNWA 4F92B 3W5AA 4GW3A 1M7HA 1DJOA 5G2OA 4ZDWA 4HB0A 3RB8A 5AM1A 4YCMA 5DWVA 2EGUA 2YNMA 4QPDA 1O0BA 3ORRA 2WUDA 4LJ5A 3N76A 3ITEA 3TEJA 4C6TA 1KYVA 3W9BA 1K7XB 5BR1A 5ENVA 4TM7A 4HEHA 1TTTA 2QHXA 1SXIA 2V0NA 4PVCA 2OXIA 2CF6A 3HDVA 1TDJA 3LLVA 2F9LA 3BD7A 3F4KA 4GMXA 3MYRA 3NFRA 5I9NA 2IWHA 1AMOA 4OXXA 2QD3A 1RWPA 4FFVA 4ZALA 2ICAA 1L2TA 1OFHA 3W5IA 1CUWA 1Q7BA 3UICA 1RWWA 5A4FS 1PW5A 1RD4A 4F12A 3ZWQA 1X1RA 4EW2A 1VBNA 3P0EA 1UT5A 4BQOA 4LE1A 1E4EB 3TIXB 1TCCA 2RHJA 2VDPB 2ZJ1A 3MSCA 2OP1A 1V7QA 1NJ5A 5GTDA 4UE2A 1LVUA 1XWFA 5FL7D 1F7VA 4L4SA 2RK3A 1Q6ZA 3REOA 5BWCA 4DB2A 2I71A 1N6OA 3K9FC 3HWRA 1GZ7A 4PIMA 4AKHA 3T4XA 3PGXA 2VYQA 1C1DA 3G85A 5KQSA 1OXTA 4GC9A 3RSFA 4UHBA 3QLVA 4R9SA 4M22A 4CQMA 3KALA 4CUZA 4B9AA 4GOMD 2BLLA 3NM6B 1R12A 4YB8A 3T9FA 1QP8A 4H7DA 5IJZA 4WJZA 3AHGA 2DKFA 3TSWA 1L7OA 1T2FA 3UMCA 3EXG2 1Z5NA 4L07A 1R4AA 3KU1A 4R8MA 3O8DA 4DG9A 3EZNA 2XSZD 2JJMA 1W2HA 5E6SA 3RVRA 1GQYA 4INOA 3AHIA 4W1RA 1DX4A 1P4GA 3A6GA 4MB0A 4C2BA 3FETA 1WCYA 4XYBA 5COQA 1YQQA 1RRCA 4OQPA 1C3JA 4C30A 4MIYA 1XPRA 2RHOA 2BFDA 1YOBA 3RLIA 1W0JA 4WECA 3VU3A 1MXHA 2QRHA 4BKRA 1SVIA 3IDAA 1QM5A 4BUJA 1U2ZA 3OQHA 1ZBQA 2G07A 1DC6A 1E7QA 1ZPDA 1FS6A 4DC9A 4CL3A 4FNAA 4ZO4A 1HM5A 3DAHA 2I2DA 1EDZA 1UKBA 1JQAA 3O21A 4Q9KA 2Q07A 2BM1A 3Q11A 3FWZA 3UM9A 3R3ZA 3M6WA 4OBEA 4P0QB 1DOHA 2AQHA 2GBIA 3QKRB 3QE4A 4N39A 1PT9A 3ML1A 4WHMA 3OPQA 1E1CA 2BH2A 2LTAA 4BNMA 3RFFA 1LBIA 2Z1NA 3CE6A 3S8EA 1YC5A 1ZOOA 1Q15A 3G8CA 3IEIA 1EGQA 1V4BA 3C3DA 4QARA 4YRZA 2YYAA 4FGSA 2EWVA 1E1DA 2P78A 5AXAA 2WB2A 4P5PA 1NVFA 2XUPA 3L84A 1G59A 3QKSA 5BVGA 2WMYA 4R41A 5TEVA 3O8CA 1HRKA 1OV6A 1D6JA 1WUKS 1N6KA 2F9FA 2VHYA 3KKQA 1NI5A 3L1UA 3MTDA 4KXVA 5D3QA 4BFZA 5AVQA 3BT7A 4GC5A 4HWPA 4NZZA 4OVKA 4PNHA 2YJGA 1QAQA 1SPBS 2LXNA 4OHBA 4CF4A 4L08A 2GBFA 3LP6A 4TMZA 2NM0A 3RUAA 1GTMA 1UBHS 5ISMA 3ZQUA 1GY8A 1JHZA 5K4GA 2NTYC 4TYYA 3GUVA 4L28A 4KI7A 1Q11A 3C7CB 2QE6A 5AK0A 3CH7A 3VHQA 1B6SA 4AF8A 2B1QA 2EP8A 3I6BA 4IZHA 4QBHA 4F5DA 1NJFA 5ALSA 1MB2A 3VH3A 1M0WA 4HV4A 1UWCA 2YWXA 4RUKA 5EGSA 1V6SA 4YJ2A 1BYIA 3P1JA 2VDWB 3C39A 5IMSA 3IQGX 1IG0A 5GQSA 3DTYA 4R1OA 2W0MA 2FPPA 3E5MA 3EGOA 3HI6A 2MSDB 4LJYA 2GPAA 3QYJA 2AWOA 1UZNA 4YCLA 3VV2A 3DOHA 2QNRA 4LTMA 3L0OA 3P9PA 4O4JA 1FY2A 1IQPA 1RYBA 2JI8A 2O2ZA 3UAOA 1E7WA 1JMVA 1XZEA 3ELUA 3PHHA 4G5SA 1G9TA 4MV5A 4PSKA 4YONB 4N6OA 4C14A 4Y2GA 2K2WA 2FMKA 3EGVA 2BKUA 4MVJE 5CA1F 3L5OA 2RHBA 2C5EA 4ZPJA 2JIZA 4TTIA 4CLEA 1I3MA 3PLRA 4BLSA 2UZ4A 2AHOA 2BELA 4MS3B 1U8XX 3H8WA 4D99A 4DWVA 1X9IA 3LCVB 4OK3A 9LDBA 4QT4A 3GRVA 3TD6A 4ZICA 1KO5A 2XCLA 1L8LA 3UCFA 3W34A 4RIIA 1LDMA 2VKTA 2MYNA 2XQJA 3U37A 4A6EA 2J3HA 3H3FA 4F71A 5GONF 1I2BA 1JFTA 3LQ4A 2Y1OA 4RLFA 5DBEX 4JV5B 3AJ8A 1MOQA 3OICA 2UU9B 1VJDA 1H4TA 3DFUA 1JXMA 8AT1A 3THWB 1ZP6A 3ZEIA 4G86A 4ZQFA 3OT1A 3KVNA 4OHYA 1XJ0A 1HORA 4BE4A 2PGOA 2N9UA 3BH7A 4G85A 3DHWC 1JFSA 1PN3A 3FFWA 3N07A 2X3UA 3B9QA 4IGFA 1Y1LA 2QX9A 3WK6A 2VBGA 3X2EA 2MR5A 4XEUA 3LBFA 3U1BA 1XRNA 1XZ8A 2ZRAA 2ZTHA 3DULA 4XRGA 4QUGA 5GZ3A 1ISHA 1PF7E 3IDOA 3K94A 4F9EA 2HRRA 5CB4A 4CU5A 4JKYA 2RGWA 4JBGA 4YGXB 1M7GA 3BK1A 4DB4A 3AY0A 4OQZA 2EZTA 1TI7A 4X85A 3VAAA 1FS4A 1ZJYA 2UVPB 4U2KA 1TM5E 5DM60 2IXEA 5ELXA 3EVCA 3Q5DA 1KK0A 1CZKA 3A1SA 1D5WA 4HI0E 4XIGS 2EZ4A 3G7UA 1XFDA 1EFPA 1J5PA 5KU1A 5FLKA 1JWAB 4AIIA 2RG1A 5MN6A 1RYMA 3I32A 4MVCA 3HDGA 1A9OA 1USUA 3M6VA 4H7HA 4M99A 4QTXA 4E2XA 1TEZA 2YV3A 3KYIB 1ECFA 1PX0A 2IJGX 3EFOB 3EOBI 2FEKA 1FIUA 3DW3X 4GI2A 4BWVA 2XT9A 1HDCA 1M10A 3ICPA 1I7SB 1N6HA 1PKXA 1OV4A 1UJBA 3E7WA 3AJ9A 3G89A 4RMNA 1G63A 1O77A 1S2IA 1SHUX 1GRQA 2JZOA 5J2TF 3TEFA 4AP9A 4DLTA 1H4SA 2MINA 4FTWA 3CINA 2VAMA 4L51A 4TMVA 3ZWXA 4CV1A 4HG2A 5HE9A 4FFBA 3SHVA 3T5BA 3K2BA 1U2RA 2VNIA 5AW9A 2P1ZA 3UG7A 5G1PA 1BGVA 4MHTA 3P32A 1M5UA 3PE3A 2DFPA 4G5HA 1MP0A 2VFAA 3NI2A 3NWEA 2DHRA 3OQJA 3E3OA 4Q9NA 3TE7A 4BMYA 3CB2A 1G7SA 3MTBA 4JC0A 1RKXA 1L7EA 2O2JA 4KPEC 3U7GA 1W5FA 2DQ4A 1MAHA 2CJPA 3R0IA 1UAYA 4GR9A 5D01A 2COUA 3TIVA 2XJ4A 3EQZA 4PZZA 5ALPA 3SIPA 1NY5A 3EA4A 4IIVA 3LCJA 4JYBA 1H42A 2AB0A 1QJCA 1X39A 2H5IA 2PKQO 4GZMA 4B8YA 1O9GA 4E2YA 4L5JA 5FUWA 3M4YA 3U7RA 1QG0A 3FZGA 4DPKA 1ZL2A 1BKYA 4W9NA 4FEGA 5SV2A 1M2HA 1QZXA 5A4IS 1JEOA 2YS7A 3H83A 3DTVD 3EXHC 1VPEA 2QP4A 2HSZA 2OO7A 2ZYUX 1VKJA 3KQKA 2BFEA 2H16A 4IRMA 1TZ2A 1B1AA 3NETA 3GRCA 5LZ5A 2FSVC 3WB9A 1L4KA 3MSXA 3IJEB 4Z4CA 4NMXB 3KUDA 5GONA 3X1KA 1MDBA 4TKUB 1TUGA 1Y1PA 4K6GA 2QZ9A 1RQRA 4O2AB 3C5CA 1KF0A 1R37A 2YMMA 4UUPA 1KOGA 4H3SA 1EK0A 1QVRA 1EDOA 2EF1A 3X3HA 1SFRA 2VZ0A 2R7LA 1A69A 4U2BA 2IVFA 6ABPA 4RHTA 3R2JA 3B6IA 1YULA 4BWYA 4KR3A 1AKYA 3INTA 1PW7A 1KYYA 3KWLA 5E9WA 1WDKA 1JJBA 3QXGA 1G0NA 1QBKC 1HE8B 4TOIA 5K8VA 4AJ4A 3OE5A 5C8DA 2AK2A 3HWSA 3ZIDA 3D5TA 3ETEA 2WUGA 5IH3A 4B84A 1RWBA 1H2YA 3RABA 1NP7A 3U1TA 3QEMA 4AMVA 4NCAA 2YX1A 1YR8A 2HSEA 4PSCA 1HH4A 4CG1A 3V4FA 2RH8A 2QAJA 4LYYA 5F78A 3ZS9A 2LD4A 2J41A 3KD2A 1NYQA 3CLUD 4ZOLF 1Y0BA 4Q3OA 4DLLA 4DPLA 4RY9A 3PEWA 1PJ4A 5U4QA 1S2LA 4LNUA 4B47A 2VQEB 1T5OA 2WTEA 1AHPA 3DO8A 4XFKA 4CM9D 1E2QA 4XFDA 3MWDA 3P97A 4RY2A 1V5EA 1Q84A 1HYEA 5FWAA 1V8FA 1YJQA 1OBCA 3PP8A 1PU2A 4Q7KA 3UA4A 1ORDA 2QTRA 2VT7A 1B23P 3AGPA 4TLLB 3RKUA 3L0CA 4FDLA 1PR6A 5AI9A 3IAEA 1K1EA 1QK4A 3QKWA 1WZCA 4Y1FA 1M2NA 4ZI7A 4GFDA 2XYHA 2REBA 1XYYA 3MIIA 1P72A 2VCEA 4S0ZA 3RS4A 3UJAA 1QU3A 2PA3A 1KI8A 1S1CA 2D0PB 2JIMA 3O91A 1FDTA 5C1IA 4L0CA 3B3JA 7YASA 1BH2A 2ZE8A 3PENA 3DHNA 1H05A 4MCJA 1P0FA 2PRIA 3L6DA 3LUFA 4UUNA 4JB3A 1IWBB 4KFUA 2ZJ7A 4KTVE 4QECA 4FFMA 5EPUA 5EYPA 3EPRA 4JUAA 3ZE1B 2IQ5A 2JIQA 4ZYTA 3I9KA 3T7RA 3Q2IA 3B1XA 1FPQA 3KFLA 1DIOB 1RKQA 2IU4A 2VF4X 5H3HA 3VBCA 3JY6A 3RW9A 1J97A 3QI2A 4FKBA 5H5JA 2FZ4A 4QELA 4B6PA 3TW6A 1CDDA 1YVRA 3A04A 4QG7A 3QMPA 3P2JA 4EL5A 1QGUA 4ZDKA 1KMQA 5CVDA 1PR9A 1PZFA 5KYTA 3ONWA 1IVNA 1RP1A 1ZD3A 2B92A 1E6KA 1LDEA 2WE8A 3DL4A 1SQ0A 2D62A 4V39A 4KXLA 3E7XA 4EG0A 3H05A 5EJ8A 1ZMRA 2JGEA 3CLRD 4CT5A 3SM9A 1TO2E 2UYYA 2IY9A 3L0YA 2ZYIA 4UFOA 4M8KA 3D5EA 3M9LA 4OV6B 1USWA 3NHSA 4P31A 4K6CA 1YZYA 2IOQA 4N5HX 5K3AA 3KUCA 5I7FA 2RBEA 4G65A 3ZW7A 5C4IA 1EX6A 2VK8A 1OU0A 4Q12A 2ZAYA 4TUYB 1C14A 3MTQA 1X6VA 3ZJYA 5ERYA 1BE8A 1SCQA 3FX2A 4PAQA 1KI4A 3AR3A 3U26A 2UZ1B 1XDWA 2ZYGA 4PLYA 5ALEA 4EI9A 3VZSA 1X77A 2BJWA 2CN1A 4BNGA 2QYTA 2DAPA 3EMBA 1T0BA 3GOQA 3K31A 1NASA 3KDPA 3W3AH 4P80A 1F5NA 1XA4A 1GGHA 1ZEJA 3LMKA 1ORIA 1LD3A 1SZDA 4NONA 5D87A 2PS1A 2WWYA 4I8IA 4OFBA 2P3LA 1FXWA 1Q3TA 1TCAA 3HKEA 3S70A 4D4IA 1QHXA 2M32A 4U7DA 1OZFA 1SUFA 1JT2A 1I2MA 2PO5A 4A6PA 1R00A 2GF9A 2LUOA 2RGUA 2VZEA 2WF7A 2J59A 5I4CA 3EZ6A 4F2PA 1J2YA 2DR2A 2CE2X 5JADA 4PGFA 5C5IA 4LRTB 4UPEA 1TECE 1TZKA 4KXXA 3TLYA 1I9GA 1KFEB 1SQSA 3O4VA 4ZOQI 2WPDA 1ISMA 5AO9A 1DI0A 4KP7A 4QXMA 4CV2A 4TS3A 2IEBA 1URPA 4D82A 4DJJA 3NONA 1X2BA 2EFJA 2HCJB 2GZ1A 2PGXA 2ORVA 4X1YA 5CDSA 3LUBA 1JSZA 3R77A 4GHWA 5AJUA 4D8YA 5LMUB 3NBQA 1WZEA 2G77B 1YASA 3H7IA 2V6JA 3FCEA 3NRBA 4I6JA 4NG4A 3VMFA 2OBXA 1XVLA 4RF2A 2VTDA 1MIOA 4WFJA 2IOFA 2MMGA 4J4TA 4RS4A 4J0CA 1XZLA 3D0KA 5CLGA 3ROGA 1CEQA 3CRRA 4JP3A 5ITWA 5KYNA 3ZE7A 1CTQA 2GETA 4KPYA 1BU8A 1GAQA 5HEKA 1WD7A 3AR7A 2UZIR 3G8BA 4TV9A 1P80A 4WCFA 3ZGXA 1KQPA 1APBA 3IKLA 2DMRA 4J76A 3IH5A 1MNQA 5KKNB 4DC0A 3C8HA 1S02A 3AKZA 4LFAB 3WP1B 4P32A 4WGGA 4WCFC 4RTQA 3OU7A 4KOEC 2QU7A 3SZMA 4C0WA 4YPOA 5LYYA 4I1PA 2IBSA 3EYWA 3QBEA 2XE4A 1KNXA 1LVGA 4OHRA 3AVYA 5T3YA 1A9SA 4UPVA 4OD0A 2OPBA 1CHDA 1GLGA 1IRXA 1SR8A 1DEAA 2BF7A 1V7CA 1D4FA 1U6KA 2IZ1A 1WHTB 3KLOA 4MVJD 4LK3A 3VU9A 1NQTA 4AZTA 4DV1B 4J0DA 2Q4DA 3JZIA 3KNZA 4PLZA 1K0UA 1T9DA 3VR0A 4D8UA 3USZA 1FX0A 1CS4C 3NC4A 4RC9A 3K2QA 1FDOA 4GLLA 1XMVA 4XYMA 2OOKA 4UCXA 4AZVA 1B41A 1X1CA 4IDBA 1L7XA 3ANTA 3AFGA 4MKZA 4O4LB 2J1LA 4ZP1A 3SAJA 3QNUA 3KPYA 1P62B 4M88A 4EVQA 2WVAA 3F47A 3KYDB 2HPVA 2C2XA 4JA2A 2IUYA 2BR4A 3IS3A 4MA5A 4M0KA 4JSYA 1EG7A 4YT5A 2GXAA 1U8EA 4X90A 3IAAA 3SNHA 4HWRA 1C5KA 2QVXX 3BBLA 3F9IA 1P2VA 3K1YA 1PGOA 5TS2A 3IPXA 2OYCA 5JAQA 3ROXA 3O8RA 3ENVA 2ODPA 2ZAOA 3IB3A 1LA2A 2GM4A 1N1DA 2V7TA 1D1SA 4OJTA 1IHUA 4F3TA 2DBZA 4U02A 1T4CA 3RRMA 3IL2A 1V45E 2I6SA 2R6CA 4TMFA 5AESA 2BR5A 3PI6A 4LGCA 3PUHA 1H8HD 3AVPA 3IMGA 4TQAA 2LGJA 3ESYA 3QOYA 2HK6A 3D7RA 3UUGA 4EY3A 2P27A 2PGJA 3BYZA 4WKGA 1ISJA 5AVOA 1WMDA 1NKVA 1HL7A 1JH9A 3EFHA 3KJQA 3EJ6A 4Q0MA 2YHSA 5E2IA 4X62B 3MJVA 5DN6D 4V0NA 4NESA 4X61A 2GCOB 2HA6A 3RJTA 1HC7A 3UGTA 1IJFA 5CDFA 1DDGA 1E3TA 2W98A 3HGQA 1E2KA 1PRYA 1YDEA 1GNSA 2ADOA 1TW2A 2HA3A 1IEXA 2JKYA 3IUNA 5EWMB 3WWEA 4ZEMA 4HMOA 4GNKA 2ZKIA 1K7SN 2NSJA 5IAGA 3H2KA 1P8JA 2HMYB 4L2IB 4C0KA 4CIBA 4Q1CA 4LF4B 5LLDA 3R8CA 1RXEA 1XU9A 4FX2A 3B85A 1I1HA 4YV7A 1UDAA 3HH8A 3FWKA 1A9PA 5CBPA 3NTRA 3HKCA 1H69A 1NPDA 3D2CA 3EAQA 1ZGAA 3H13A 3ZWVA 5LKRA 3OPNA 4NY1A 1NXXA 4F1JA 1YE3A 1QU2A 2X6QA 3RE1A 5IT9A 5JRJA 2W2KB 5JYEA 3R6WA 1JJ7A 4MTLA 1T13A 1TYZA 2ORIA 4HBGA 1P7ZA 2HXSA 2OLJA 1H6CA 3AC0A 3VR5A 1G4UR 1OYYA 4G0QA 3L8YA 3M5CA 4DR2B 2CLDX 5KYUB 2BFAA 2QMZA 3IMCA 3HABA 4GI3A 2WKQA 2YJ3A 3WWCA 3HWWA 1EVKA 3W77A 3TUJC 3U44B 4X91A 4ZQBA 2IYAA 3WO0A 1GL9B 1Y8QB 2QN6A 2O9JA 1QV6A 4JLMA 1RABA 4FOSA 4NFLA 1AV7A 4ROTA 4B5KA 4ZYVA 4LJ6A 1V37A 1T8PA 1FTYA 1QBGA 2HA7A 4O2BA 4HF7A 2O3QA 4J0IA 3IOEA 1BJRE 4PZCA 4RV4A 2R68A 3HB1A 1V7PC 1DHTA 1E5XA 1PVVA 2JFQA 3IEUA 3WIUA 1EVJA 1SBZA 2R44A 4MMXB 4KYTA 1JL3A 3OTOB 1JVNA 2IVZA 1F8XA 4JI1B 4B6JA 1SVOA 3D4IA 5D84A 4RXTA 5GJWC 3RJZA 1EBBA 1CV2A 4LHSA 2F8MA 3WL4A 4IOKA 1XMIA 1Z0IA 5EP1A 1FSGA 1PZXA 1Y6GA 1RXIA 4FINA 5E9AA 1NI4A 3GEDA 1BH6A 5EHGA 1U9ZA 2A5JA 2BE7A 3L8EA 4OHPA 4JI8B 2OG2A 3DZDA 5EJGA 4FFOA 2BAGA 1M2VA 5C51B 1L7AA 1JLLA 4RVSA 1R6XA 4ZCPA 2V6IA 4HWOA 4F2DA 1PK7A 4HAVA 2KS6A 1MC4A 3Q85A 3WRYC 2FEWB 5BWLA 2K7ZA 1Q0UA 3IBGA 3MB5A 3BJZA 3C4QA 3MT9A 2BFNA 2SKCA 1KRHA 4GKBA 4RJIA 1PUXA 5TQ0B 3UOGA 3VU9B 4E2ZA 4XQ0A 1WXQA 1A9YA 2HPAA 4FDUA 3KQTA 4W9RA 1N5OX 2TMKA 3CVJA 4QLBA 1ZYUA 3H2GA 4HC4A 2PSFA 3O8BA 1DRJA 4EZIA 4KQXA 3E9RA 4H6WA 5JROA 5JXJA 1Y5IA 1J20A 2GZRA 4BNDA 4JEMA 4I7EA 1UPAA 3TW0A 4YALA 3I6YA 4QWWA 2JGDB 1NHWA 1NLYA 1PJLA 2WJAA 3KX2A 2G40A 3V8NA 3WLNA 1DC3A 2DWQA 5HTKA 3SXUA 4FWTA 3AJRA 4JELA 2VF2A 2VOEA 1TU3A 3E5RA 2A9QA 4D42A 2CBGA 3I76A 4I4TB 4TRMA 1AKNA 4DQKA 1WXDA 3PK0A 1LPAB 1FB5A 5EUQB 1SHJA 1E61A 3H65A 1M73E 4ITRC 4US0R 3KQQA 1UBMS 3TI7A 3PFKA 1GD1O 2R2AA 3O8QA 4P84A 3ZV7A 3CONA 4A8JA 4LNAA 1A9RA 1NU8A 3W7BA 3WLLA 5JXHA 3ND6A 4X1YB 2X9NA 2X1HA 3A6EA 3P52A 1GLNA 4ENWA 4YV1A 2KBFA 1RHRA 5BQXA 2PYIA 1JA9A 2WSSA 1VI6A 3E35A 2B8TA 2XUKA 3VO9A 2RSLA 5DULA 4NOJA 4D3FA 5I7WA 1BAPA 1U4OA 1QH1A 3RIYA 4Q1FA 3D2LA 4MULA 3VAYA 4PPGA 4UTZA 3U4AA 4KQ6A 2XCSB 4F2HA 1NVUQ 1L6RA 4WZAA 4NNPA 1CUAA 2I62A 2O07A 3ASZA 3OZFA 4FC7A 3TXXA 4AYWA 4YP6A 3RFTA 3CZMA 2EJTA 3C48A 1DBPA 4RH1A 4BJ1A 4FFLA 2Y1XA 4NZNA 3COVA 4K6FA 2ZSKA 2JJQA 4MUMA 4AO6A 1II8B 4JXJA 3BGDA 3I73A 2UZ1A 3LQQA 4QICA 1VJ0A 2P9GA 3FNEA 3JRXA 4YXWA 3DXZA 2HBZA 4AJLA 2C84A 1TX4B 1R4NB 5KYXA 2CXUA 1YQEA 5LZ4A 3I01A 5EHZA 3BMXA 4L4RA 3B9BA 4Y3UA 2BP7B 3N8HA 2PU5A 5I8PA 5CX4A 3OZCA 3EC1A 2E18A 4O1HA 3F6CA 1MEOA 1QFYA 4MJLA 4E08A 5JRDS 2V6BA 3HJNA 3MS7A 4I6GA 1OY1A 5FO0A 2NU8A 1YZVA 1QQ7A 3P2KA 3H9UA 5FPSA 1SCNE 1GQOA 3OLQA 3JQPA 1T5DX 1SZJG 2OYRA 1Y98A 5JNSA 5FNZA 1NC3A 1Q74A 1W6RA 2JFVA 1XDBA 1L5HB 4E3WA 4EG4A 4DNQA 2G67A 2VSYA 2RIPA 3ZI4A 1KJQA 3CRZA 3QQPA 4PSAA 1Z8NA 1OVGA 2HV9A 2AJCA 2VI5A 2PYDA 2RH5A 4RY0A 3TVDA 2P4QA 2II6A 2REXB 4LHVA 1ZSNA 5CLHA 3RTCA 3T1NA 3WOHA 1L5OA 5A4JA 1R5OA 3ZHQA 4G0VA 1QF9A 5AI6A 3DQQA 3TZCA 1A4IA 4YRJA 4XDGA 2AE1A 1H66A 4Y6QA 1P2BA 1X7HA 2DOKA 3BRWA 2F7SA 3EZFA 3TINA 5AHXA 4MVJI 1SXJD 3E15A 5JHGB 3PWTA 3QMVA 1I32A 1P1CA 3MCWA 4HLCA 2E7ZA 2XLBA 1OT3A 3FWHA 1ZHFA 2OMEA 1DT5A 1HV8A 3HCCA 2J6HA 3R0VA 3FFXA 4RKYA 5AOAA 3TTVA 5A4MS 4KPUB 1Q19A 2HCRA 5DHFA 2OBFA 4AG3A 2B82A 2QD2A 2LNDA 4KQHA 2HUPA 4QJBA 2G3YA 4GQIA 1COZA 2GPTA 2P9FA 2ANCA 2RHWA 2ZRQA 2YRFA 5K1ZA 4YT8A 1N8KA 1B15A 4ZT4A 1QGED 1LRLA 3L40A 3OHSX 5EJ9A 4XR4A 4GD3Q 5E3IA 3FWYA 1QH9A 4J16A 1RRVA 3MJDA 2BEVB 3JQFA 1TYEB 4R8LA 1LDYA 2QNBA 3EQ6A 2YFKA 1VCHA 3EPJA 4WXEA 1YVUA 4ZEXA 3H0EA 1CEXA 4B46A 4EGQA 2BMDA 1JEQA 4YJ3F 3IQEA 3E18A 1SCKA 3P9CA 4HFNA 5EJ6A 4TYNA 5FYDA 4LNUB 4RIFA 3C87A 1YK0A 2XPCA 4KKVA 1GTVA 4CF5A 2EP5A 1KJJA 2XE7A 5KYGA 3P27A 5CIQA 3LBYA 4G9GA 3ZCRA 4TTSA 4KDCA 3GLGB 2R47A 1NJGA 4X1KB 13PKA 3TAHA 1K89A 3D2BA 5AW5A 3W8EA 3DFZA 3M49A 5C5CA 3QEMB 2CFSA 3OZGA 4G36A 3NBXX 3TOVA 3VJKA 4ZYZA 1JIQA 2WDZA 1KO1A 1B3RA 1GPWB 3HUFA 1MZPA 5FO1A 5FA8A 3CLUC 1WVMA 4AMBA 3U4IA 4OQFA 3WGOA 3ZWNA 2AQKA 1AKRA 3OPVA 1UJ4A 3Q7QA 2EXXA 1THGA 4UTOA 2HA5A 2FR0A 3RSHA 3SIXA 3TZKA 2GCPA 4OHFA 3QE0A 1XQ9A 3BWBA 121PA 2Z09A 4YX9A 1WDWB 2NZJA 2OHOA 3GZNB 1Y42X 3F4LA 2KHZA 3EEFA 2F8SA 4RJKA 2YFQA 5BOSB 5IG2A 2YMLA 4CLOB 2HFJA 3QXCA 3L6EA 4TWAA 5JV5A 1NQAO 5IMBA 3QVXA 2YUTA 4O2AA 4PGAA 4GZ3A 4YQYA 2XYRA 5BSVA 1XWWA 3QKIA 4DNPA 3HI4A 5CW2A 2VSXA 3KT6A 2PZJA 3NV9A 3HPRA 2AXEA 4MWGA 4PNZA 2RARA 1RQPA 3E9YA 3A1UA 1P7WA 1M34E 2ERYA 2UKDA 2Z4TA 3HVUA 5KNBA 1VCNA 3EZ7A 4FOOA 3BH6A 4UU8A 4DLAA 4H6PA 2Q3CA 4JAVC 4MI3A 1J8DA 4W8HA 4Q7EA 1XRRA 1ZS9A 4HH4A 3GH1A 1KDOA 2F3QA 2WWTA 1OWPA 2QA5A 1RCFA 2YCBA 1WSBA 2CHVA 1UOEA 3GQVA 1RYYA 2XKAA 4IRXA 3WJ7A 3ZUPA 4RULA 3B3GA 5CPFA 1HYHA 4L9SA 1P45A 4NOKA 4MQMA 3B8EA 4XUGB 3CYFA 2OBLA 5A05A 3ZHVA 2JNWA 3FDZB 4UVIA 1KPIA 3F3SA 3ESQA 3F1KA 1BDHA 4Z9AA 5IM4A 5CB8A 2VCYA 3UA3A 3O5AA 3LLMA 5C31A 1JDUA 2WSLA 4I9NA 2GCIA 3MCTA 4UHEA 4AU1A 4GG1A 5EJFA 4WIAA 2W9XA 1WETA 2HSWA 4EELA 3TGPA 2D2XA 1W581 1D1TA 4TT3D 1L5SA 3NTOA 3VOBA 4DAOA 4ZAWA 3ZU4A 4FYMA 3SDBA 3OO1A 1Z3IX 2N42A 2V6GA 1GIAA 4NDNE 5G0SA 4XVUA 4JUDX 4RZSA 3WP0A 2MINB 3L4JA 1KZ1A 3JQGA 5J4VA 1C3VA 4MUEA 3C5HA 3CWZA 2YZMA 3ME5A 2QENA 2AOXA 5AJTA 4V0LA 4RNDB 2AL7A 2AF3C 4G8CA 1TK3A 2C97A 2X4LA 1RRMA 3LZCA 4AX8A 4YIKA 1IN7A 2XUHA 4YJ3A 3EDYA 1WTAA 3VXKA 3ZDBA 3BD6A 3UH1A 3MWEB 4PTLA 3W90A 1VXOA 4GXRA 5C0OE 3N2GB 4B81A 4ARUA 1FYWA 4REQB 1GU1A 1JWBB 2HMUA 4ZI7F 3ITKA 5E6UB 3BXOA 3HG7A 1RJWA 2ZR0A 3NNSA 1EFPB 1IBRA 2GPWA 1P9LA 2IU3A 3IHLA 3PVCA 4GX5A 1E0DA 4UVDA 1SCJA 5F2OA 4CJXA 3AR9A 1GSIA 2JKZA 2Q2VA 4NU6A 3NOVA 4LBVA 2A4MA 4MICA 3TXYA 1ZCBA 2UZ0A 1KAQA 2J5RA 1Y6JA 3NHFA 3G9QA 1DG1G 4PO9A 4XQ9A 3ZKAA 3ZTWA 4AP5A 4KVGA 4YRSA 1BD4A 3CX7A 1P5FA 1JH8A 3Q9UA 5C4MA 3NUQA 4WSOA 1EWTA 1YZKA 3B70A 5TJ9A 2QM7A 2E4VA 4BX0A 2BHSA 4PO3X 3V6MA 3KG2A 2FPMA 3FNHA 1XQ1A 4HB3A 3OY7A 4OYYA 4G5YA 1C4WA 4WLNA 4EFMA 4FLEA 4XIYA 5MGBA 4OF4A 1S2MA 2AOUA 4MLDA 2YC4C 4TTJA 4HYEA 1R1DA 4BKOA 4G0ZA 2XNSA 3HBAA 3F2VA 3RT9A 7GPBA 1DG3A 5IJ9B 1AUQA 1PL8A 1PLJA 2IBMA 2PSSA 3LGAA 4L78A 3A06A 4EPXA 3H5AA 4HZIA 2FSGA 3K9BA 3K09C 2GUGA 2JHAA 3PNQA 1I0IA 1XTSA 1N34B 5DRYA 5JSZB 2C8KA 5EMNA 5JNLA 4IHJA 3GY0A 2P5YA 4I5IA 4Z53A 5FWXB 1HQDA 3TDNA 2W90A 1UC8A 2E1PA 2WYHA 2XYPA 4B32A 3V3KA 1QZZA 2FMHA 4AY2A 2XB9A 1VP9A 2VNKA 3UWOA 4R3UC 4LF5B 4ESHA 5J2UB 3H5RA 1CJSA 1I5RA 4BZQA 1Y9AA 2GYWA 1BWRA 1IEVA 1PV1A 3HFSA 1L5VA 3PFBA 4XVCA 2RGNC 4W5HA 5GIPE 3NPMA 2PX8A 2YJ6A 3LP8A 4OAQA 5BSEA 4TTAA 4L5BA 4DN6A 1Y5MA 4AFNA 1V5IA 2AFHA 16PKA 2R87A 2GTIA 2Y1CA 3UGJA 2FPPB 1OH6A 3Q7TA 5EJAA 3MGAA 4MUGA 2FAXA 1FU4A 1Y4AE 1O5TA 4ER7A 1LDGA 3IULA 3VPAA 1Y7LA 2Y1DA 4YV2A 2TS1A 5DHUA 3VTAA 1NN1A 1UQTA 3OESA 4BMCA 4GPBA 1Q7TA 1GZVA 4BO8A 3AETB 5EWJA 4ZK6A 4P1ZA 2A3NA 4CCWA 1TIPA 4DLYA 2UYOA 4M1WA 2QL5A 4KAAA 4UOQA 3SHWA 5LB2A 3UFXA 4IFEA 4RWEA 3PHLA 3AVTA 4B3DA 2VYVA 4GKAA 2AF4C 3W4IA 3H1EA 2FA9A 1QIKA 3R0QA 1EFAA 2C2OA 2P7HA 3KZCA 2OC4A 1WZ2A 1N5IA 4R9RA 3PPIA 4D3ZA 4ANFA 3L8GA 5KSWB 1NE7A 3R7BA 2J9ZB 4H18A 3A2KA 3ZWCA 1XKQA 3V97A 3OU6A 1ITZA 1KS9A 5LLSA 3G23A 2FFQA 3NTVA 1U3CA 4XJXA 3ZCPA 2QG4A 5C18A 2ODWA 5LCXA 3SK0A 1XIVA 3TRDA 1X0XA 4ARBA 1HDEA 2IOYA 2WF6A 3ECSA 1C8LA 2NACA 2NYAA 3ZQ6A 4AG6A 4ALNA 2C4NA 3PDCA 4O3FA 4FIDA 4ZYYA 2Y0PA 1JHRA 2JBAA 3C85A 3U48A 3FYTA 5CW1A 1AQYA 1NXQA 4NZMA 3X0DA 1SOMA 3WFZA 3B53X 1PJAA 4EY6A 2P9ZA 1NIPA 1CU1A 4H9GA 5IW8A 2FOIA 1J06A 1WCV1 3REFA 1H3EA 3UGKA 4G5FA 5J59A 3OFVA 4MPTA 1E6WA 3BE6A 1M67A 4GI5A 3TB4A 3OZVA 2BFDB 4UBLA 1IBMB 3DDNA 3HFJA 1LX7A 4K40A 5TDHA 3O38A 1SGWA 3WGTA 5DZSA 4EHIA 3L7MA 5A6SA 3W05A 3CNLA 4I5EA 3K9NA 1H8HA 4RADA 3G3EA 5T6MA 2OY0A 1YFLA 2IUUA 1DNPA 1G60A 1D7AA 1HTWA 1EVQA 1S3FA 2J6BA 2J87A 2GZHA 2YRXA 3GLHB 3KR0A 2G28A 4DTIA 2FK7A 4F96A 4B3MB 1NUHA 2GILA 4CF6A 5BV2P 4N65A 1O87A 2JEZA 4RTLA 3ZJ4A 2WYVA 2YXDA 5SICE 4CM1A 4TX1A 4ENRA 1CEYA 1DXHA 5B58T 3MTEA 4M0FA 5JNRA 1XXHA 2H2IA 2I7VA 1E63A 4GOJA 5KHAA 2EQBA 4CQMB 3DUFB 1RWXA 2IK8A 2QSZA 5JS6A 1IVSA 3DTNA 3BSYA 3L92A 4RVOA 3FB4A 1ZD4A 4H35A 2HIMA 4OHZA 2RGBA 1A8UA 1P4SA 4EYEA 1HO3A 3KR9A 3M4ZA 3RWOA 1QOZA 4FP9A 4ZVNA 5FPPA 5L53A 1TLFA 2XXAB 4FCTA 2H3HA 1OHHA 5FTKA 1TCBA 5K3DA 4E13A 1NUUA 3O9ZA 1WBJB 2B21A 4E5KA 1ZU5A 2E37A 3EGXB 5DI3B 2AN3A 1YR6A 3IVMA 3HR8A 4EA9A 1C80A 2ATEA 2NO6A 1B6RA 3I4LA 2BKVA 5KJFA 2YHIA 4QX6A 1VIMA 4IWYA 3QXSA 3ZWOA 2BW0A 2R1ZA 3JD2A 1E3MA 5TX7A 4S1VA 1QS0A 4Q3DA 1UMBB 1UMDB 3DMHA 5BSKA 4MWOA 2PUEA 3ZX5A 3LYUA 3DOIA 4KSYA 2H1HA 4JWTA 3TS1A 1W5BA 1FQKA 1T0JB 1RP7A 2PMBA 2WJGA 2X0NA 4ZXPA 2R00A 3RYTC 4B3IA 1NURA 1QHSA 3TB6A 4MGEA 1MTZA 4DOMA 3ENQA 3IVGA 3QA3E 4C6TB 5HPYB 3LXXA 4RS3A 3PA8A 2DQKA 5ALYA 3O8LA 5EGNA 3Q6NA 3M8KA 3UVEA 4GYJA 5FP0A 4C6HA 4CFZA 4DWJA 2JAQA 4WCDA 4L16A 3UF0A 4BMVA 5IVHA 4TMXA 4KYVA 5E9JA 2PEZA 4IUCS 3SM3A 4A2CA 2FWJA 3PUIA 4RZUA 2IYQA 2LW7A 5H81A 2A35A 4W8GA 4DA6A 4YLEA 3HU2A 2VPTA 1SU7A 3OZXA 1J2EA 1W25A 2CHQA 2Z0MA 3PPWA 4O8CA 5DM0A 1IU9A 2EU8A 4GPEA 1GZSA 4NXNB 1FNBA 5AFSA 3U56A 5ED4A 1GRCA 4ZTUB 4DEXA 2VR1A 1MX9A 2BKAA 3F74A 3H5VA 5CFZA 3QUCA 1JU3A 4L6IA 4H1VA 4PY2A 5B55A 3D6FA 1QQAA 4BAUA 5I7UA 3NWBA 3DAFA 4H17A 3ZY6A 4Q05A 1IUNA 2QV0A 4OHVA 3K0KA 3SEAA 5I7RA 2CK3A 5LVAA 3F7TA 5G40A 1D8AA 2ZIFA 3H42B 2FDXA 1F8GA 5HHTA 1CUXA 1D2EA 3D8HA 3CO0S 3K1TA 3LUGA 4PIPA 4US1R 3LUJA 1SEPA 4H0FA 5IXSA 1DUSA 2W00A 3WBFA 3L4BC 3T41A 3WLKX 2AC2A 1U8FO 5TF4A 3H5NA 3CW2A 5D51S 1HE1C 2AEEA 4Z0TA 4Z4QA 3BMCA 3MUOA 2G08A 3I62A 1XMXA 1Y9DA 3EVFA 3IHKA 4RA9B 4WUTA 2WWRA 3BJRA 3OEHA 2F9MA 3AHCA 3OTWA 2HYDA 1EA7A 3C4JA 3GRZA 2ZRMA 4NCXA 3EULA 5SYAA 3LCCA 4E5MA 2Q6LA 4X60A 3B5IA 2W6QA 2ZTUA 3K9HA 4BJ6A 2ATXA 2X77A 1N2BA 3ODPA 1AKVA 2AEMA 2GERA 1MOSA 1T3HA 3PQ7A 4NJEB 3BPSA 4J3FA 4NABA 3SHTA 4WL0A 5CGZA 1VCIA 4QDKA 5JJ5A 4II7A 1P2GA 1YI0A 4BFUA 1EFRA 2LV8A 4QHSA 5DBFA 1OLSB 2JD0A 3OZUA 1J49A 1E7SA 1V6CA 3E22A 1XZDA 4XJVA 4DSUA 3LUAA 1JEYA 2WVGA 3BILA 4WOPA 5DBOA 3U4MA 3EGWA 3L0ZA 3K0AB 3BMNB 4LVUA 1PQUA 3IBFA 4M7OA 4MPJA 3O82A 4X9XA 4YI5A 4AECA 4U9IS 3RSOA 4ES6A 2Z57A 1K7YA 1WXXA 2ZVPX 4L9WA 5FWDA 4DRXA 2O8BB 4KN9S 4WKBA 4NEQA 4OUKX 2VDJA 3O4IA 4KIFA 5ER9A 3IUSA 3UUFA 5K3OA 1S8FA 4UDNA 1CZUA 1UK8A 3PGKA 4EF5A 2W6CX 1RI2A 3VU0A 5EMMA 4KBFA 4CEIA 1P9RA 3UJ9A 5LQRA 2VF7A 5JANA 4P4TA 3CR3C 2Q4TA 1ODLA 4B34A 4DABA 4JT2A 4RK4A 2G7ZA 1BEUB 4R68A 3PD7A 3H11A 2XR1A 2GSWA 3HN2A 4PYKA 3TXAA 4OGLA 5I01A 4QXAA 4RQBA 4BJ5A 1O6CA 3OF3A 4K0KB 3INYA 2D2IA 3EG5A 4XIIA 2BZGA 1Z5WA 3M9WA 3C6YA 5EY5B 4DIUA 2DPYA 4L8LA 5GINE 5F33A 5BSRA 1AZSC 4JN6B 3KSRA 2GEFA 4JT9A 5TPWA 3TO5A 4BTEA 4KUGA 5CH5A 4C2AA 3NASA 2XBMA 5A0TA 1LUAA 3KYJB 3D8NA 5AVJA 4QLOA 4C4YA 4EVRA 3BJMA 3K20A 1W30A 3W2FA 5EP2A 3UPDA 1ACLA 4ENPA 3FXAA 1WD5A 4Y2RA 1EUDA 1D6MA 4Z2YA 4D7AA 4MRMB 1RW4A 4F11A 1GEEA 3SYMA 3TAXA 5KMGA 3S8YA 5ANRB 2P2YA 3DNFA 3SZLA 2JH9A 5BMOA 4MZDA 1Q77A 3K9GA 3O2NA 1ECPA 1IOVA 1IN6A 2FZCA 3CA8A 4LQDA 5IKOA 4AMZA 4F46A 1IOWA 1GU7A 2A0KA 3FUTA 1D0SA 2I7XA 3NJRA 3RVPA 5KVVA 1NY6A 3IIIA 3IMKA 4CUJA 2XGGA 1J22A 4OJKA 4OTZA 4RE6A 2P1DA 4IKEA 3QE2A 4W9NC 4NHOA 1V11A 3D6JA 4KAXA 1P0CA 2YXEA 2FE4A 2J5KA 1FSFA 2ZIEA 4R6XA 3FE2A 1ZR4A 3GLUA 5CH8A 4BHTA 5EVJA 4EH1A 1NSYA 1P18A 3AY3A 3DR3A 3OQNA 4B6EA 1YR9A 2OQRA 2DKOA 4NP6A 1J0DA 1XNJA 2AEJA 2SCUB 2HF8A 4KYUA 4M2LA 5I7HA 4HH3C 4HWSA 2XY4A 1DBRA 3E9EA 1LDBA 3IHTA 5TPZD 1RJ9B 1ZJ4A 4YI3A 6LDHA 4CIVA 4CETA 2XCRB 4JXZA 1UZUA 2HSGA 3EVZA 1HDXA 1UDRA 1JEEA 1I2AA 2VIIA 3H18A 4GBGA 2WMNB 4IMJB 4S1WA 5LUAA 3FSJX 4JJKA 1U3GA 4Q6BA 1FP1D 1Z38A 2PN1A 1VHDA 3BB3A 1BMFD 2ENUA 2J3IA 2ZS7A 3FNBA 1NBME 1XP8A 3JQ7B 4RLQA 3IRUA 5EFOA 3ABZA 2J31A 3EA0A 1U2DA 4ZOLB 3F6SA 1N1GA 1A96A 1M2JA 4OLHA 1WZNA 1BCRB 2D5LA 3EASA 3EEBA 3H97A 3KJZA 3L43A 3L8CA 3R09A 1GYRA 1HE3A 4RA6A 2C2WA 2JHGA 4F4DA 1EVZA 3AIMA 1PR4A 2CCGA 2TSYB 3FLBA 1I6WA 1XA0A 4JZYA 2OMKA 1SA0A 4EMBA 2SBTA 2GK4A 2E5WA 1F2VA 4I4CA 3VYTB 3KK0A 3L6CA 2Q0QA 2WLTA 4KACA 1ZK0A 3QVGB 1ZNWA 3UK0A 4JI7B 3SIRA 3FZYA 3NT4A 4PLWA 4GEKA 3ORSA 5JWHA 2QM8A 2X3FA 3AF2A 2CHUA 2PJZA 3QBTA 4TT8A