5E5BA

Crystal structure of human spt16 n-terminal domain
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
431
structure length
431
Chain Sequence
AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structure of the human histone chaperone FACT Spt16 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 150
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e5bA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5e5bA02
4FLLA 2OAZA 4IKUA 3IU7A 4U73A 3CB6A 5JHUA 4FLJA 4A6VA 2Q93A 2Q94A 4OOKA 1WKMA 1WBQA 1R58A 1B6AA 4U69A 1XGSA 4IKTA 2NQ7A 1CHMA 5CLSA 1KQ0A 2GGCA 3TB5A 1PV9A 4KM3A 1XGMA 2GG9A 2IW2A 2P99A 3BITA 2BWVA 2GU6A 5D6EA 3IG4A 2B3LA 3FMQA 3IU8A 2P9AA 2BN7A 1XGNA 5D6FA 1W7VA 3Q6DA 1B59A 2NQ6A 4QR8A 5E2CA 3L24A 2GTXA 2Q95A 2V3YA 3FMRA 4IKRA 4U1BA 1WN1A 4U70A 2MATA 2GG0A 4Z7MA 1M35A 2BWSA 2BHDA 4PV4A 1C27A 5FCHA 2EVCA 2GU5A 4FO7A 2BWTA 2G6PA 2GG3A 3PKDA 4IPAA 2BH3A 2EVOA 3O5VA 4FLKA 1O0XA 5JFRA 4RZZA 4R60A 4U76A 5E5BA 4FUKA 3L7GA 1C21A 2EA4A 1KP0A 2V3XA 4RGZ1 2ADUA 2GGBA 1QXZA 3MX6A 4S2TP 1W2MA 1QZYA 4IKSA 1BOAA 4IF7A 5CIKA 1YJ3A 4ZNGA 4ZWUA 1C23A 4IU6A 3PKEA 2B3HA 3PKBA 2V6CA 1YVMA 2GA2A 2EA2A 1XGOA 1QXWA 2GG7A 4U6WA 1WY2A 1R5HA 4ZWOA 1XNZA 2DFIA 2P98A 2GZ5A 4RZYA 1YW8A 4S00A 2BHCA 1YW7A 2Q8KA 5CDLA 4U6EA 1QXYA 1YW9A 2GU7A 1N51A 1WL6A 1WLRA 3CB5A 2GG8A 3PN9A 4ZWPA 3IU9A 4U71A 2Q96A 4U75A 3BIQA 5CDVA 4U6ZA 1A16A 2B3KA 4JUQA 2OKNA 2GG5A 4PNCA 4EGEA 3D27A 4FO8A 2Q92A 2BWWA 1KQ9A 1C22A 3MR1A 4U6JA 5CNXA 2EVMA 2GG2A 4FKCA 2BHAA 2BWUA 3PKCA 2BWXA 1R5GA 1C24A 1BN5A 4IECA 5JI6A 3RORA 1JAWA 3OOOA 3RVAA 4S2RP 2V3ZA 4IDYA 5CE6A 3MATA 2BB7A 4B28A 3CTZA 3TAVA 2BWYA 3PEBA 4HXXA 2GU4A 3FM3A 4A6WA 4MATA 3S6BA 3OVKA 2HOWA 3QOCA 5CDEA 2BHBA 1Y1NA 4FLIA 1MATA 4U6CA 2ZSGA 3IL0A 3BIPA 1WL9A 4S01A 5FCFA 3I7MA 3PKAA
chains in the Genus database with same CATH superfamily
4FLLA 2OAZA 4IKUA 3IU7A 4U73A 3CB6A 5JHUA 4FLJA 4A6VA 2Q93A 2Q94A 4OOKA 1WKMA 1WBQA 1R58A 1B6AA 4U69A 1XGSA 4IKTA 2NQ7A 1CHMA 5CLSA 1KQ0A 2GGCA 3TB5A 1PV9A 4KM3A 1XGMA 2GG9A 2IW2A 2P99A 3BITA 2BWVA 2GU6A 5D6EA 3IG4A 2B3LA 3FMQA 3IU8A 2P9AA 2BN7A 1XGNA 5D6FA 1W7VA 3Q6DA 1B59A 2NQ6A 4QR8A 5E2CA 3L24A 2GTXA 2Q95A 2V3YA 3FMRA 4IKRA 4U1BA 1WN1A 4U70A 2MATA 2GG0A 4Z7MA 1M35A 2BWSA 2BHDA 4PV4A 1C27A 5FCHA 2EVCA 2GU5A 4FO7A 2BWTA 2G6PA 2GG3A 3PKDA 4IPAA 2BH3A 2EVOA 3O5VA 4FLKA 1O0XA 5JFRA 4RZZA 4R60A 4U76A 5E5BA 4FUKA 3L7GA 1C21A 2EA4A 1KP0A 2V3XA 4RGZ1 2ADUA 2GGBA 1QXZA 3MX6A 4S2TP 1W2MA 1QZYA 4IKSA 1BOAA 4IF7A 5CIKA 1YJ3A 4ZNGA 4ZWUA 1C23A 4IU6A 3PKEA 2B3HA 3PKBA 2V6CA 1YVMA 2GA2A 2EA2A 1XGOA 1QXWA 2GG7A 4U6WA 1WY2A 1R5HA 4ZWOA 1XNZA 2DFIA 2P98A 2GZ5A 4RZYA 1YW8A 4S00A 2BHCA 1YW7A 2Q8KA 5CDLA 4U6EA 1QXYA 1YW9A 2GU7A 1N51A 1WL6A 1WLRA 3CB5A 2GG8A 3PN9A 4ZWPA 3IU9A 4U71A 2Q96A 4U75A 3BIQA 5CDVA 4U6ZA 1A16A 2B3KA 4JUQA 2OKNA 2GG5A 4PNCA 4EGEA 3D27A 4FO8A 2Q92A 2BWWA 1KQ9A 1C22A 3MR1A 4U6JA 5CNXA 2EVMA 2GG2A 4FKCA 2BHAA 2BWUA 3PKCA 2BWXA 1R5GA 1C24A 1BN5A 4IECA 5JI6A 3RORA 1JAWA 3OOOA 3RVAA 4S2RP 2V3ZA 4IDYA 5CE6A 3MATA 2BB7A 4B28A 3CTZA 3TAVA 2BWYA 3PEBA 4HXXA 2GU4A 3FM3A 4A6WA 4MATA 3S6BA 3OVKA 2HOWA 3QOCA 5CDEA 2BHBA 1Y1NA 4FLIA 1MATA 4U6CA 2ZSGA 3IL0A 3BIPA 1WL9A 4S01A 5FCFA 3I7MA 3PKAA
chains in the Genus database with same CATH topology
4FLLA 2OAZA 4IKUA 3IU7A 4U73A 3CB6A 5JHUA 4FLJA 4A6VA 2Q93A 2Q94A 4OOKA 1WKMA 1WBQA 1R58A 1B6AA 4U69A 1XGSA 4IKTA 2NQ7A 1CHMA 5CLSA 1KQ0A 2GGCA 3TB5A 1PV9A 4KM3A 1XGMA 2GG9A 2IW2A 2P99A 3BITA 2BWVA 2GU6A 5D6EA 3IG4A 2B3LA 3FMQA 3IU8A 2P9AA 2BN7A 1XGNA 5D6FA 1W7VA 3Q6DA 1B59A 2NQ6A 4QR8A 5E2CA 3L24A 2GTXA 2Q95A 2V3YA 3FMRA 4IKRA 4U1BA 1WN1A 4U70A 2MATA 2GG0A 4Z7MA 1M35A 2BWSA 2BHDA 4PV4A 1C27A 5FCHA 2EVCA 2GU5A 4FO7A 2BWTA 2G6PA 2GG3A 3PKDA 4IPAA 2BH3A 2EVOA 3O5VA 4FLKA 1O0XA 5JFRA 4RZZA 4R60A 4U76A 5E5BA 4FUKA 3L7GA 1C21A 2EA4A 1KP0A 2V3XA 4RGZ1 2ADUA 2GGBA 1QXZA 3MX6A 4S2TP 1W2MA 1QZYA 4IKSA 1BOAA 4IF7A 5CIKA 1YJ3A 4ZNGA 4ZWUA 1C23A 4IU6A 3PKEA 2B3HA 3PKBA 2V6CA 1YVMA 2GA2A 2EA2A 1XGOA 1QXWA 2GG7A 4U6WA 1WY2A 1R5HA 4ZWOA 1XNZA 2DFIA 2P98A 2GZ5A 4RZYA 1YW8A 4S00A 2BHCA 1YW7A 2Q8KA 5CDLA 4U6EA 1QXYA 1YW9A 2GU7A 1N51A 1WL6A 1WLRA 3CB5A 2GG8A 3PN9A 4ZWPA 3IU9A 4U71A 2Q96A 4U75A 3BIQA 5CDVA 4U6ZA 1A16A 2B3KA 4JUQA 2OKNA 2GG5A 4PNCA 4EGEA 3D27A 4FO8A 2Q92A 2BWWA 1KQ9A 1C22A 3MR1A 4U6JA 5CNXA 2EVMA 2GG2A 4FKCA 2BHAA 2BWUA 3PKCA 2BWXA 1R5GA 1C24A 1BN5A 4IECA 5JI6A 3RORA 1JAWA 3OOOA 3RVAA 4S2RP 2V3ZA 4IDYA 5CE6A 3MATA 2BB7A 4B28A 3CTZA 3TAVA 2BWYA 3PEBA 4HXXA 2GU4A 3FM3A 4A6WA 4MATA 3S6BA 3OVKA 2HOWA 3QOCA 5CDEA 2BHBA 1Y1NA 4FLIA 1MATA 4U6CA 2ZSGA 3IL0A 3BIPA 1WL9A 4S01A 5FCFA 3I7MA 3PKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLL A;  2OAZ A;  4IKU A;  3IU7 A;  4U73 A;  3CB6 A;  5JHU A;  4FLJ A;  4A6V A;  2Q93 A;  2Q94 A;  4OOK A;  1WKM A;  1WBQ A;  1R58 A;  1B6A A;  4U69 A;  1XGS A;  4IKT A;  2NQ7 A;  1CHM A;  5CLS A;  1KQ0 A;  2GGC A;  3TB5 A;  1PV9 A;  4KM3 A;  1XGM A;  2GG9 A;  2IW2 A;  2P99 A;  3BIT A;  2BWV A;  2GU6 A;  5D6E A;  3IG4 A;  2B3L A;  3FMQ A;  3IU8 A;  2P9A A;  2BN7 A;  1XGN A;  5D6F A;  1W7V A;  3Q6D A;  1B59 A;  2NQ6 A;  4QR8 A;  5E2C A;  3L24 A;  2GTX A;  2Q95 A;  2V3Y A;  3FMR A;  4IKR A;  4U1B A;  1WN1 A;  4U70 A;  2MAT A;  2GG0 A;  4Z7M A;  1M35 A;  2BWS A;  2BHD A;  4PV4 A;  1C27 A;  5FCH A;  2EVC A;  2GU5 A;  4FO7 A;  2BWT A;  2G6P A;  2GG3 A;  3PKD A;  4IPA A;  2BH3 A;  2EVO A;  3O5V A;  4FLK A;  1O0X A;  5JFR A;  4RZZ A;  4R60 A;  4U76 A;  5E5B A;  4FUK A;  3L7G A;  1C21 A;  2EA4 A;  1KP0 A;  2V3X A;  4RGZ 1;  2ADU A;  2GGB A;  1QXZ A;  3MX6 A;  4S2T P;  1W2M A;  1QZY A;  4IKS A;  1BOA A;  4IF7 A;  5CIK A;  1YJ3 A;  4ZNG A;  4ZWU A;  1C23 A;  4IU6 A;  3PKE A;  2B3H A;  3PKB A;  2V6C A;  1YVM A;  2GA2 A;  2EA2 A;  1XGO A;  1QXW A;  2GG7 A;  4U6W A;  1WY2 A;  1R5H A;  4ZWO A;  1XNZ A;  2DFI A;  2P98 A;  2GZ5 A;  4RZY A;  1YW8 A;  4S00 A;  2BHC A;  1YW7 A;  2Q8K A;  5CDL A;  4U6E A;  1QXY A;  1YW9 A;  2GU7 A;  1N51 A;  1WL6 A;  1WLR A;  3CB5 A;  2GG8 A;  3PN9 A;  4ZWP A;  3IU9 A;  4U71 A;  2Q96 A;  4U75 A;  3BIQ A;  5CDV A;  4U6Z A;  1A16 A;  2B3K A;  4JUQ A;  2OKN A;  2GG5 A;  4PNC A;  4EGE A;  3D27 A;  4FO8 A;  2Q92 A;  2BWW A;  1KQ9 A;  1C22 A;  3MR1 A;  4U6J A;  5CNX A;  2EVM A;  2GG2 A;  4FKC A;  2BHA A;  2BWU A;  3PKC A;  2BWX A;  1R5G A;  1C24 A;  1BN5 A;  4IEC A;  5JI6 A;  3ROR A;  1JAW A;  3OOO A;  3RVA A;  4S2R P;  2V3Z A;  4IDY A;  5CE6 A;  3MAT A;  2BB7 A;  4B28 A;  3CTZ A;  3TAV A;  2BWY A;  3PEB A;  4HXX A;  2GU4 A;  3FM3 A;  4A6W A;  4MAT A;  3S6B A;  3OVK A;  2HOW A;  3QOC A;  5CDE A;  2BHB A;  1Y1N A;  4FLI A;  1MAT A;  4U6C A;  2ZSG A;  3IL0 A;  3BIP A;  1WL9 A;  4S01 A;  5FCF A;  3I7M A;  3PKA A; 
#chains in the Genus database with same CATH topology
 4FLL A;  2OAZ A;  4IKU A;  3IU7 A;  4U73 A;  3CB6 A;  5JHU A;  4FLJ A;  4A6V A;  2Q93 A;  2Q94 A;  4OOK A;  1WKM A;  1WBQ A;  1R58 A;  1B6A A;  4U69 A;  1XGS A;  4IKT A;  2NQ7 A;  1CHM A;  5CLS A;  1KQ0 A;  2GGC A;  3TB5 A;  1PV9 A;  4KM3 A;  1XGM A;  2GG9 A;  2IW2 A;  2P99 A;  3BIT A;  2BWV A;  2GU6 A;  5D6E A;  3IG4 A;  2B3L A;  3FMQ A;  3IU8 A;  2P9A A;  2BN7 A;  1XGN A;  5D6F A;  1W7V A;  3Q6D A;  1B59 A;  2NQ6 A;  4QR8 A;  5E2C A;  3L24 A;  2GTX A;  2Q95 A;  2V3Y A;  3FMR A;  4IKR A;  4U1B A;  1WN1 A;  4U70 A;  2MAT A;  2GG0 A;  4Z7M A;  1M35 A;  2BWS A;  2BHD A;  4PV4 A;  1C27 A;  5FCH A;  2EVC A;  2GU5 A;  4FO7 A;  2BWT A;  2G6P A;  2GG3 A;  3PKD A;  4IPA A;  2BH3 A;  2EVO A;  3O5V A;  4FLK A;  1O0X A;  5JFR A;  4RZZ A;  4R60 A;  4U76 A;  5E5B A;  4FUK A;  3L7G A;  1C21 A;  2EA4 A;  1KP0 A;  2V3X A;  4RGZ 1;  2ADU A;  2GGB A;  1QXZ A;  3MX6 A;  4S2T P;  1W2M A;  1QZY A;  4IKS A;  1BOA A;  4IF7 A;  5CIK A;  1YJ3 A;  4ZNG A;  4ZWU A;  1C23 A;  4IU6 A;  3PKE A;  2B3H A;  3PKB A;  2V6C A;  1YVM A;  2GA2 A;  2EA2 A;  1XGO A;  1QXW A;  2GG7 A;  4U6W A;  1WY2 A;  1R5H A;  4ZWO A;  1XNZ A;  2DFI A;  2P98 A;  2GZ5 A;  4RZY A;  1YW8 A;  4S00 A;  2BHC A;  1YW7 A;  2Q8K A;  5CDL A;  4U6E A;  1QXY A;  1YW9 A;  2GU7 A;  1N51 A;  1WL6 A;  1WLR A;  3CB5 A;  2GG8 A;  3PN9 A;  4ZWP A;  3IU9 A;  4U71 A;  2Q96 A;  4U75 A;  3BIQ A;  5CDV A;  4U6Z A;  1A16 A;  2B3K A;  4JUQ A;  2OKN A;  2GG5 A;  4PNC A;  4EGE A;  3D27 A;  4FO8 A;  2Q92 A;  2BWW A;  1KQ9 A;  1C22 A;  3MR1 A;  4U6J A;  5CNX A;  2EVM A;  2GG2 A;  4FKC A;  2BHA A;  2BWU A;  3PKC A;  2BWX A;  1R5G A;  1C24 A;  1BN5 A;  4IEC A;  5JI6 A;  3ROR A;  1JAW A;  3OOO A;  3RVA A;  4S2R P;  2V3Z A;  4IDY A;  5CE6 A;  3MAT A;  2BB7 A;  4B28 A;  3CTZ A;  3TAV A;  2BWY A;  3PEB A;  4HXX A;  2GU4 A;  3FM3 A;  4A6W A;  4MAT A;  3S6B A;  3OVK A;  2HOW A;  3QOC A;  5CDE A;  2BHB A;  1Y1N A;  4FLI A;  1MAT A;  4U6C A;  2ZSG A;  3IL0 A;  3BIP A;  1WL9 A;  4S01 A;  5FCF A;  3I7M A;  3PKA A; 
#chains in the Genus database with same CATH homology
 4FLL A;  2OAZ A;  4IKU A;  3IU7 A;  4U73 A;  3CB6 A;  5JHU A;  4FLJ A;  4A6V A;  2Q93 A;  2Q94 A;  4OOK A;  1WKM A;  1WBQ A;  1R58 A;  1B6A A;  4U69 A;  1XGS A;  4IKT A;  2NQ7 A;  1CHM A;  5CLS A;  1KQ0 A;  2GGC A;  3TB5 A;  1PV9 A;  4KM3 A;  1XGM A;  2GG9 A;  2IW2 A;  2P99 A;  3BIT A;  2BWV A;  2GU6 A;  5D6E A;  3IG4 A;  2B3L A;  3FMQ A;  3IU8 A;  2P9A A;  2BN7 A;  1XGN A;  5D6F A;  1W7V A;  3Q6D A;  1B59 A;  2NQ6 A;  4QR8 A;  5E2C A;  3L24 A;  2GTX A;  2Q95 A;  2V3Y A;  3FMR A;  4IKR A;  4U1B A;  1WN1 A;  4U70 A;  2MAT A;  2GG0 A;  4Z7M A;  1M35 A;  2BWS A;  2BHD A;  4PV4 A;  1C27 A;  5FCH A;  2EVC A;  2GU5 A;  4FO7 A;  2BWT A;  2G6P A;  2GG3 A;  3PKD A;  4IPA A;  2BH3 A;  2EVO A;  3O5V A;  4FLK A;  1O0X A;  5JFR A;  4RZZ A;  4R60 A;  4U76 A;  5E5B A;  4FUK A;  3L7G A;  1C21 A;  2EA4 A;  1KP0 A;  2V3X A;  4RGZ 1;  2ADU A;  2GGB A;  1QXZ A;  3MX6 A;  4S2T P;  1W2M A;  1QZY A;  4IKS A;  1BOA A;  4IF7 A;  5CIK A;  1YJ3 A;  4ZNG A;  4ZWU A;  1C23 A;  4IU6 A;  3PKE A;  2B3H A;  3PKB A;  2V6C A;  1YVM A;  2GA2 A;  2EA2 A;  1XGO A;  1QXW A;  2GG7 A;  4U6W A;  1WY2 A;  1R5H A;  4ZWO A;  1XNZ A;  2DFI A;  2P98 A;  2GZ5 A;  4RZY A;  1YW8 A;  4S00 A;  2BHC A;  1YW7 A;  2Q8K A;  5CDL A;  4U6E A;  1QXY A;  1YW9 A;  2GU7 A;  1N51 A;  1WL6 A;  1WLR A;  3CB5 A;  2GG8 A;  3PN9 A;  4ZWP A;  3IU9 A;  4U71 A;  2Q96 A;  4U75 A;  3BIQ A;  5CDV A;  4U6Z A;  1A16 A;  2B3K A;  4JUQ A;  2OKN A;  2GG5 A;  4PNC A;  4EGE A;  3D27 A;  4FO8 A;  2Q92 A;  2BWW A;  1KQ9 A;  1C22 A;  3MR1 A;  4U6J A;  5CNX A;  2EVM A;  2GG2 A;  4FKC A;  2BHA A;  2BWU A;  3PKC A;  2BWX A;  1R5G A;  1C24 A;  1BN5 A;  4IEC A;  5JI6 A;  3ROR A;  1JAW A;  3OOO A;  3RVA A;  4S2R P;  2V3Z A;  4IDY A;  5CE6 A;  3MAT A;  2BB7 A;  4B28 A;  3CTZ A;  3TAV A;  2BWY A;  3PEB A;  4HXX A;  2GU4 A;  3FM3 A;  4A6W A;  4MAT A;  3S6B A;  3OVK A;  2HOW A;  3QOC A;  5CDE A;  2BHB A;  1Y1N A;  4FLI A;  1MAT A;  4U6C A;  2ZSG A;  3IL0 A;  3BIP A;  1WL9 A;  4S01 A;  5FCF A;  3I7M A;  3PKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...