5E5BA

Crystal structure of human spt16 n-terminal domain
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
431
structure length
431
Chain Sequence
AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structure of the human histone chaperone FACT Spt16 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 150
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e5bA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5e5bA02
2BWSA 2GGCA 3PKCA 3CB6A 1WY2A 2BHDA 4Z7MA 2GTXA 3PN9A 5JFRA 5FCHA 3L24A 2B3LA 2HOWA 1QXZA 3IG4A 4U75A 4MATA 2EA2A 1C21A 4IU6A 2GZ5A 2BHAA 4IPAA 3OVKA 4ZWUA 4U6CA 1BN5A 2IW2A 1R5HA 3O5VA 4FLKA 2Q96A 3CTZA 3Q6DA 1YVMA 3CB5A 3PKEA 2NQ6A 3OOOA 1MATA 3BITA 4RZYA 2Q92A 2EVCA 2BWUA 4A6WA 4U6WA 3QOCA 2BWXA 1C24A 4B28A 2B3HA 2Q95A 5CDVA 3PKDA 2EVOA 4U1BA 3MX6A 2BB7A 4U6ZA 2GA2A 5E2CA 2V3YA 2OKNA 4RGZ1 2GU7A 4FLJA 3BIQA 5FCFA 1O0XA 3IU9A 5CDEA 2BWWA 2Q8KA 1C23A 4U70A 1YW8A 3L7GA 4U6JA 2GG5A 2GU6A 4IKRA 3I7MA 5CE6A 4U69A 5D6FA 4IDYA 2P98A 2G6PA 4FLIA 3MATA 5JI6A 1KQ0A 2BWVA 3IU8A 4QR8A 3D27A 4IECA 1M35A 1Y1NA 5CDLA 2GG0A 4FUKA 1QXYA 4R60A 1W2MA 1YJ3A 3FMRA 1WKMA 3FMQA 1XGNA 3BIPA 1XGSA 2P99A 2GG7A 3IL0A 2BH3A 1B59A 2P9AA 2GU5A 3PKAA 1QXWA 1WN1A 2NQ7A 3TB5A 4U6EA 4PV4A 3PKBA 5D6EA 1WL9A 1JAWA 4OOKA 4IF7A 2BHBA 2BHCA 2MATA 2Q94A 4RZZA 4PNCA 4FKCA 4ZNGA 2ADUA 2GG2A 1B6AA 4S2RP 3IU7A 4S01A 2GG3A 1XNZA 1WL6A 3S6BA 1W7VA 2GG9A 4IKUA 3PEBA 2BWYA 1YW7A 1C27A 2GU4A 4EGEA 3RORA 1C22A 2Q93A 4HXXA 4U71A 4IKTA 1N51A 2BN7A 1PV9A 2GG8A 3TAVA 2GGBA 1CHMA 2EA4A 3MR1A 5CLSA 1KQ9A 1KP0A 4IKSA 2EVMA 4KM3A 1R58A 1R5GA 4FO8A 3RVAA 2B3KA 4U76A 4JUQA 2BWTA 4ZWOA 4S00A 2V3ZA 5E5BA 1XGOA 1BOAA 1QZYA 1WBQA 1YW9A 4FO7A 5CIKA 4A6VA 4FLLA 2V6CA 1A16A 5CNXA 3FM3A 4S2TP 1XGMA 2V3XA 2DFIA 2ZSGA 4ZWPA 5JHUA 2OAZA 1WLRA 4U73A
chains in the Genus database with same CATH superfamily
2BWSA 2GGCA 3PKCA 3CB6A 1WY2A 2BHDA 4Z7MA 2GTXA 3PN9A 5JFRA 5FCHA 3L24A 2B3LA 2HOWA 1QXZA 3IG4A 4U75A 4MATA 2EA2A 1C21A 4IU6A 2GZ5A 2BHAA 4IPAA 3OVKA 4ZWUA 4U6CA 1BN5A 2IW2A 1R5HA 3O5VA 4FLKA 2Q96A 3CTZA 3Q6DA 1YVMA 3CB5A 3PKEA 2NQ6A 3OOOA 1MATA 3BITA 4RZYA 2Q92A 2EVCA 2BWUA 4A6WA 4U6WA 3QOCA 2BWXA 1C24A 4B28A 2B3HA 2Q95A 5CDVA 3PKDA 2EVOA 4U1BA 3MX6A 2BB7A 4U6ZA 2GA2A 5E2CA 2V3YA 2OKNA 4RGZ1 2GU7A 4FLJA 3BIQA 5FCFA 1O0XA 3IU9A 5CDEA 2BWWA 2Q8KA 1C23A 4U70A 1YW8A 3L7GA 4U6JA 2GG5A 2GU6A 4IKRA 3I7MA 5CE6A 4U69A 5D6FA 4IDYA 2P98A 2G6PA 4FLIA 3MATA 5JI6A 1KQ0A 2BWVA 3IU8A 4QR8A 3D27A 4IECA 1M35A 1Y1NA 5CDLA 2GG0A 4FUKA 1QXYA 4R60A 1W2MA 1YJ3A 3FMRA 1WKMA 3FMQA 1XGNA 3BIPA 1XGSA 2P99A 2GG7A 3IL0A 2BH3A 1B59A 2P9AA 2GU5A 3PKAA 1QXWA 1WN1A 2NQ7A 3TB5A 4U6EA 4PV4A 3PKBA 5D6EA 1WL9A 1JAWA 4OOKA 4IF7A 2BHBA 2BHCA 2MATA 2Q94A 4RZZA 4PNCA 4FKCA 4ZNGA 2ADUA 2GG2A 1B6AA 4S2RP 3IU7A 4S01A 2GG3A 1XNZA 1WL6A 3S6BA 1W7VA 2GG9A 4IKUA 3PEBA 2BWYA 1YW7A 1C27A 2GU4A 4EGEA 3RORA 1C22A 2Q93A 4HXXA 4U71A 4IKTA 1N51A 2BN7A 1PV9A 2GG8A 3TAVA 2GGBA 1CHMA 2EA4A 3MR1A 5CLSA 1KQ9A 1KP0A 4IKSA 2EVMA 4KM3A 1R58A 1R5GA 4FO8A 3RVAA 2B3KA 4U76A 4JUQA 2BWTA 4ZWOA 4S00A 2V3ZA 5E5BA 1XGOA 1BOAA 1QZYA 1WBQA 1YW9A 4FO7A 5CIKA 4A6VA 4FLLA 2V6CA 1A16A 5CNXA 3FM3A 4S2TP 1XGMA 2V3XA 2DFIA 2ZSGA 4ZWPA 5JHUA 2OAZA 1WLRA 4U73A
chains in the Genus database with same CATH topology
2BWSA 2GGCA 3PKCA 3CB6A 1WY2A 2BHDA 4Z7MA 2GTXA 3PN9A 5JFRA 5FCHA 3L24A 2B3LA 2HOWA 1QXZA 3IG4A 4U75A 4MATA 2EA2A 1C21A 4IU6A 2GZ5A 2BHAA 4IPAA 3OVKA 4ZWUA 4U6CA 1BN5A 2IW2A 1R5HA 3O5VA 4FLKA 2Q96A 3CTZA 3Q6DA 1YVMA 3CB5A 3PKEA 2NQ6A 3OOOA 1MATA 3BITA 4RZYA 2Q92A 2EVCA 2BWUA 4A6WA 4U6WA 3QOCA 2BWXA 1C24A 4B28A 2B3HA 2Q95A 5CDVA 3PKDA 2EVOA 4U1BA 3MX6A 2BB7A 4U6ZA 2GA2A 5E2CA 2V3YA 2OKNA 4RGZ1 2GU7A 4FLJA 3BIQA 5FCFA 1O0XA 3IU9A 5CDEA 2BWWA 2Q8KA 1C23A 4U70A 1YW8A 3L7GA 4U6JA 2GG5A 2GU6A 4IKRA 3I7MA 5CE6A 4U69A 5D6FA 4IDYA 2P98A 2G6PA 4FLIA 3MATA 5JI6A 1KQ0A 2BWVA 3IU8A 4QR8A 3D27A 4IECA 1M35A 1Y1NA 5CDLA 2GG0A 4FUKA 1QXYA 4R60A 1W2MA 1YJ3A 3FMRA 1WKMA 3FMQA 1XGNA 3BIPA 1XGSA 2P99A 2GG7A 3IL0A 2BH3A 1B59A 2P9AA 2GU5A 3PKAA 1QXWA 1WN1A 2NQ7A 3TB5A 4U6EA 4PV4A 3PKBA 5D6EA 1WL9A 1JAWA 4OOKA 4IF7A 2BHBA 2BHCA 2MATA 2Q94A 4RZZA 4PNCA 4FKCA 4ZNGA 2ADUA 2GG2A 1B6AA 4S2RP 3IU7A 4S01A 2GG3A 1XNZA 1WL6A 3S6BA 1W7VA 2GG9A 4IKUA 3PEBA 2BWYA 1YW7A 1C27A 2GU4A 4EGEA 3RORA 1C22A 2Q93A 4HXXA 4U71A 4IKTA 1N51A 2BN7A 1PV9A 2GG8A 3TAVA 2GGBA 1CHMA 2EA4A 3MR1A 5CLSA 1KQ9A 1KP0A 4IKSA 2EVMA 4KM3A 1R58A 1R5GA 4FO8A 3RVAA 2B3KA 4U76A 4JUQA 2BWTA 4ZWOA 4S00A 2V3ZA 5E5BA 1XGOA 1BOAA 1QZYA 1WBQA 1YW9A 4FO7A 5CIKA 4A6VA 4FLLA 2V6CA 1A16A 5CNXA 3FM3A 4S2TP 1XGMA 2V3XA 2DFIA 2ZSGA 4ZWPA 5JHUA 2OAZA 1WLRA 4U73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWS A;  2GGC A;  3PKC A;  3CB6 A;  1WY2 A;  2BHD A;  4Z7M A;  2GTX A;  3PN9 A;  5JFR A;  5FCH A;  3L24 A;  2B3L A;  2HOW A;  1QXZ A;  3IG4 A;  4U75 A;  4MAT A;  2EA2 A;  1C21 A;  4IU6 A;  2GZ5 A;  2BHA A;  4IPA A;  3OVK A;  4ZWU A;  4U6C A;  1BN5 A;  2IW2 A;  1R5H A;  3O5V A;  4FLK A;  2Q96 A;  3CTZ A;  3Q6D A;  1YVM A;  3CB5 A;  3PKE A;  2NQ6 A;  3OOO A;  1MAT A;  3BIT A;  4RZY A;  2Q92 A;  2EVC A;  2BWU A;  4A6W A;  4U6W A;  3QOC A;  2BWX A;  1C24 A;  4B28 A;  2B3H A;  2Q95 A;  5CDV A;  3PKD A;  2EVO A;  4U1B A;  3MX6 A;  2BB7 A;  4U6Z A;  2GA2 A;  5E2C A;  2V3Y A;  2OKN A;  4RGZ 1;  2GU7 A;  4FLJ A;  3BIQ A;  5FCF A;  1O0X A;  3IU9 A;  5CDE A;  2BWW A;  2Q8K A;  1C23 A;  4U70 A;  1YW8 A;  3L7G A;  4U6J A;  2GG5 A;  2GU6 A;  4IKR A;  3I7M A;  5CE6 A;  4U69 A;  5D6F A;  4IDY A;  2P98 A;  2G6P A;  4FLI A;  3MAT A;  5JI6 A;  1KQ0 A;  2BWV A;  3IU8 A;  4QR8 A;  3D27 A;  4IEC A;  1M35 A;  1Y1N A;  5CDL A;  2GG0 A;  4FUK A;  1QXY A;  4R60 A;  1W2M A;  1YJ3 A;  3FMR A;  1WKM A;  3FMQ A;  1XGN A;  3BIP A;  1XGS A;  2P99 A;  2GG7 A;  3IL0 A;  2BH3 A;  1B59 A;  2P9A A;  2GU5 A;  3PKA A;  1QXW A;  1WN1 A;  2NQ7 A;  3TB5 A;  4U6E A;  4PV4 A;  3PKB A;  5D6E A;  1WL9 A;  1JAW A;  4OOK A;  4IF7 A;  2BHB A;  2BHC A;  2MAT A;  2Q94 A;  4RZZ A;  4PNC A;  4FKC A;  4ZNG A;  2ADU A;  2GG2 A;  1B6A A;  4S2R P;  3IU7 A;  4S01 A;  2GG3 A;  1XNZ A;  1WL6 A;  3S6B A;  1W7V A;  2GG9 A;  4IKU A;  3PEB A;  2BWY A;  1YW7 A;  1C27 A;  2GU4 A;  4EGE A;  3ROR A;  1C22 A;  2Q93 A;  4HXX A;  4U71 A;  4IKT A;  1N51 A;  2BN7 A;  1PV9 A;  2GG8 A;  3TAV A;  2GGB A;  1CHM A;  2EA4 A;  3MR1 A;  5CLS A;  1KQ9 A;  1KP0 A;  4IKS A;  2EVM A;  4KM3 A;  1R58 A;  1R5G A;  4FO8 A;  3RVA A;  2B3K A;  4U76 A;  4JUQ A;  2BWT A;  4ZWO A;  4S00 A;  2V3Z A;  5E5B A;  1XGO A;  1BOA A;  1QZY A;  1WBQ A;  1YW9 A;  4FO7 A;  5CIK A;  4A6V A;  4FLL A;  2V6C A;  1A16 A;  5CNX A;  3FM3 A;  4S2T P;  1XGM A;  2V3X A;  2DFI A;  2ZSG A;  4ZWP A;  5JHU A;  2OAZ A;  1WLR A;  4U73 A; 
#chains in the Genus database with same CATH topology
 2BWS A;  2GGC A;  3PKC A;  3CB6 A;  1WY2 A;  2BHD A;  4Z7M A;  2GTX A;  3PN9 A;  5JFR A;  5FCH A;  3L24 A;  2B3L A;  2HOW A;  1QXZ A;  3IG4 A;  4U75 A;  4MAT A;  2EA2 A;  1C21 A;  4IU6 A;  2GZ5 A;  2BHA A;  4IPA A;  3OVK A;  4ZWU A;  4U6C A;  1BN5 A;  2IW2 A;  1R5H A;  3O5V A;  4FLK A;  2Q96 A;  3CTZ A;  3Q6D A;  1YVM A;  3CB5 A;  3PKE A;  2NQ6 A;  3OOO A;  1MAT A;  3BIT A;  4RZY A;  2Q92 A;  2EVC A;  2BWU A;  4A6W A;  4U6W A;  3QOC A;  2BWX A;  1C24 A;  4B28 A;  2B3H A;  2Q95 A;  5CDV A;  3PKD A;  2EVO A;  4U1B A;  3MX6 A;  2BB7 A;  4U6Z A;  2GA2 A;  5E2C A;  2V3Y A;  2OKN A;  4RGZ 1;  2GU7 A;  4FLJ A;  3BIQ A;  5FCF A;  1O0X A;  3IU9 A;  5CDE A;  2BWW A;  2Q8K A;  1C23 A;  4U70 A;  1YW8 A;  3L7G A;  4U6J A;  2GG5 A;  2GU6 A;  4IKR A;  3I7M A;  5CE6 A;  4U69 A;  5D6F A;  4IDY A;  2P98 A;  2G6P A;  4FLI A;  3MAT A;  5JI6 A;  1KQ0 A;  2BWV A;  3IU8 A;  4QR8 A;  3D27 A;  4IEC A;  1M35 A;  1Y1N A;  5CDL A;  2GG0 A;  4FUK A;  1QXY A;  4R60 A;  1W2M A;  1YJ3 A;  3FMR A;  1WKM A;  3FMQ A;  1XGN A;  3BIP A;  1XGS A;  2P99 A;  2GG7 A;  3IL0 A;  2BH3 A;  1B59 A;  2P9A A;  2GU5 A;  3PKA A;  1QXW A;  1WN1 A;  2NQ7 A;  3TB5 A;  4U6E A;  4PV4 A;  3PKB A;  5D6E A;  1WL9 A;  1JAW A;  4OOK A;  4IF7 A;  2BHB A;  2BHC A;  2MAT A;  2Q94 A;  4RZZ A;  4PNC A;  4FKC A;  4ZNG A;  2ADU A;  2GG2 A;  1B6A A;  4S2R P;  3IU7 A;  4S01 A;  2GG3 A;  1XNZ A;  1WL6 A;  3S6B A;  1W7V A;  2GG9 A;  4IKU A;  3PEB A;  2BWY A;  1YW7 A;  1C27 A;  2GU4 A;  4EGE A;  3ROR A;  1C22 A;  2Q93 A;  4HXX A;  4U71 A;  4IKT A;  1N51 A;  2BN7 A;  1PV9 A;  2GG8 A;  3TAV A;  2GGB A;  1CHM A;  2EA4 A;  3MR1 A;  5CLS A;  1KQ9 A;  1KP0 A;  4IKS A;  2EVM A;  4KM3 A;  1R58 A;  1R5G A;  4FO8 A;  3RVA A;  2B3K A;  4U76 A;  4JUQ A;  2BWT A;  4ZWO A;  4S00 A;  2V3Z A;  5E5B A;  1XGO A;  1BOA A;  1QZY A;  1WBQ A;  1YW9 A;  4FO7 A;  5CIK A;  4A6V A;  4FLL A;  2V6C A;  1A16 A;  5CNX A;  3FM3 A;  4S2T P;  1XGM A;  2V3X A;  2DFI A;  2ZSG A;  4ZWP A;  5JHU A;  2OAZ A;  1WLR A;  4U73 A; 
#chains in the Genus database with same CATH homology
 2BWS A;  2GGC A;  3PKC A;  3CB6 A;  1WY2 A;  2BHD A;  4Z7M A;  2GTX A;  3PN9 A;  5JFR A;  5FCH A;  3L24 A;  2B3L A;  2HOW A;  1QXZ A;  3IG4 A;  4U75 A;  4MAT A;  2EA2 A;  1C21 A;  4IU6 A;  2GZ5 A;  2BHA A;  4IPA A;  3OVK A;  4ZWU A;  4U6C A;  1BN5 A;  2IW2 A;  1R5H A;  3O5V A;  4FLK A;  2Q96 A;  3CTZ A;  3Q6D A;  1YVM A;  3CB5 A;  3PKE A;  2NQ6 A;  3OOO A;  1MAT A;  3BIT A;  4RZY A;  2Q92 A;  2EVC A;  2BWU A;  4A6W A;  4U6W A;  3QOC A;  2BWX A;  1C24 A;  4B28 A;  2B3H A;  2Q95 A;  5CDV A;  3PKD A;  2EVO A;  4U1B A;  3MX6 A;  2BB7 A;  4U6Z A;  2GA2 A;  5E2C A;  2V3Y A;  2OKN A;  4RGZ 1;  2GU7 A;  4FLJ A;  3BIQ A;  5FCF A;  1O0X A;  3IU9 A;  5CDE A;  2BWW A;  2Q8K A;  1C23 A;  4U70 A;  1YW8 A;  3L7G A;  4U6J A;  2GG5 A;  2GU6 A;  4IKR A;  3I7M A;  5CE6 A;  4U69 A;  5D6F A;  4IDY A;  2P98 A;  2G6P A;  4FLI A;  3MAT A;  5JI6 A;  1KQ0 A;  2BWV A;  3IU8 A;  4QR8 A;  3D27 A;  4IEC A;  1M35 A;  1Y1N A;  5CDL A;  2GG0 A;  4FUK A;  1QXY A;  4R60 A;  1W2M A;  1YJ3 A;  3FMR A;  1WKM A;  3FMQ A;  1XGN A;  3BIP A;  1XGS A;  2P99 A;  2GG7 A;  3IL0 A;  2BH3 A;  1B59 A;  2P9A A;  2GU5 A;  3PKA A;  1QXW A;  1WN1 A;  2NQ7 A;  3TB5 A;  4U6E A;  4PV4 A;  3PKB A;  5D6E A;  1WL9 A;  1JAW A;  4OOK A;  4IF7 A;  2BHB A;  2BHC A;  2MAT A;  2Q94 A;  4RZZ A;  4PNC A;  4FKC A;  4ZNG A;  2ADU A;  2GG2 A;  1B6A A;  4S2R P;  3IU7 A;  4S01 A;  2GG3 A;  1XNZ A;  1WL6 A;  3S6B A;  1W7V A;  2GG9 A;  4IKU A;  3PEB A;  2BWY A;  1YW7 A;  1C27 A;  2GU4 A;  4EGE A;  3ROR A;  1C22 A;  2Q93 A;  4HXX A;  4U71 A;  4IKT A;  1N51 A;  2BN7 A;  1PV9 A;  2GG8 A;  3TAV A;  2GGB A;  1CHM A;  2EA4 A;  3MR1 A;  5CLS A;  1KQ9 A;  1KP0 A;  4IKS A;  2EVM A;  4KM3 A;  1R58 A;  1R5G A;  4FO8 A;  3RVA A;  2B3K A;  4U76 A;  4JUQ A;  2BWT A;  4ZWO A;  4S00 A;  2V3Z A;  5E5B A;  1XGO A;  1BOA A;  1QZY A;  1WBQ A;  1YW9 A;  4FO7 A;  5CIK A;  4A6V A;  4FLL A;  2V6C A;  1A16 A;  5CNX A;  3FM3 A;  4S2T P;  1XGM A;  2V3X A;  2DFI A;  2ZSG A;  4ZWP A;  5JHU A;  2OAZ A;  1WLR A;  4U73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...