5E5BA

Crystal structure of human spt16 n-terminal domain
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
431
structure length
431
Chain Sequence
AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human histone chaperone FACT Spt16 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 150
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e5bA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5e5bA02
1PV9A 2EA4A 2GGBA 3IU8A 4Z7MA 4FUKA 2GG2A 5CIKA 2GG7A 2P9AA 1WY2A 3IL0A 2EVMA 1WL6A 1BN5A 2NQ7A 4U76A 5CLSA 2BWTA 4U6ZA 2B3KA 3FM3A 1WL9A 5JI6A 1JAWA 2BN7A 2DFIA 3BITA 3Q6DA 4FO7A 2GG8A 4JUQA 2Q92A 4U71A 2BWXA 3D27A 4ZNGA 2BHBA 2EA2A 3MR1A 2MATA 4FLLA 3S6BA 4A6WA 3MX6A 1WBQA 4ZWPA 3RORA 4U69A 1MATA 2BB7A 1YJ3A 2P98A 5FCFA 4PNCA 3I7MA 2BWUA 4B28A 1B6AA 2GG9A 2GA2A 5CE6A 3PKBA 3O5VA 2V6CA 3CB5A 2EVCA 2ZSGA 4IECA 3IU7A 1R5GA 3QOCA 3CTZA 4IPAA 4MATA 1A16A 2BWSA 4PV4A 5CDEA 3PKEA 2B3LA 4IKUA 2OKNA 1R5HA 2GU7A 4FO8A 1W7VA 2BWWA 4EGEA 2BHCA 2GU6A 4KM3A 4OOKA 5JHUA 2GG3A 1Y1NA 1YVMA 2GG0A 4IDYA 1C23A 4FLJA 2GG5A 1R58A 3FMRA 1YW7A 1QXYA 1M35A 1C22A 4S00A 4U6EA 3IG4A 2EVOA 1WN1A 4ZWOA 3TB5A 2GU4A 1QXWA 4IKSA 4R60A 4IKTA 2V3ZA 2Q8KA 4RZYA 1XNZA 1XGOA 4ZWUA 4IU6A 1KP0A 4S01A 2B3HA 2ADUA 5JFRA 1BOAA 4RZZA 2P99A 4FLKA 5E2CA 4FKCA 4HXXA 3L7GA 1YW9A 1QXZA 1WKMA 2G6PA 4QR8A 5FCHA 4U1BA 2Q96A 5CDVA 3PKAA 5D6FA 1XGNA 4IF7A 5E5BA 2HOWA 2IW2A 2V3XA 3OOOA 3FMQA 3PKDA 4U70A 3PEBA 4U6JA 4U75A 2GZ5A 5D6EA 2GU5A 4A6VA 4IKRA 2V3YA 3BIPA 1B59A 4RGZ1 1C27A 1CHMA 4U73A 1WLRA 4U6WA 5CDLA 2GGCA 2Q94A 2BWVA 1C21A 2Q93A 2OAZA 3RVAA 4U6CA 1C24A 3IU9A 4S2TP 1KQ9A 1KQ0A 4FLIA 1N51A 3TAVA 5CNXA 2BHDA 4S2RP 1XGSA 3BIQA 3PN9A 3PKCA 1XGMA 2BH3A 2Q95A 3MATA 2NQ6A 3L24A 2BHAA 2BWYA 1YW8A 1O0XA 3OVKA 1W2MA 1QZYA 3CB6A 2GTXA
chains in the Genus database with same CATH superfamily
1PV9A 2EA4A 2GGBA 3IU8A 4Z7MA 4FUKA 2GG2A 5CIKA 2GG7A 2P9AA 1WY2A 3IL0A 2EVMA 1WL6A 1BN5A 2NQ7A 4U76A 5CLSA 2BWTA 4U6ZA 2B3KA 3FM3A 1WL9A 5JI6A 1JAWA 2BN7A 2DFIA 3BITA 3Q6DA 4FO7A 2GG8A 4JUQA 2Q92A 4U71A 2BWXA 3D27A 4ZNGA 2BHBA 2EA2A 3MR1A 2MATA 4FLLA 3S6BA 4A6WA 3MX6A 1WBQA 4ZWPA 3RORA 4U69A 1MATA 2BB7A 1YJ3A 2P98A 5FCFA 4PNCA 3I7MA 2BWUA 4B28A 1B6AA 2GG9A 2GA2A 5CE6A 3PKBA 3O5VA 2V6CA 3CB5A 2EVCA 2ZSGA 4IECA 3IU7A 1R5GA 3QOCA 3CTZA 4IPAA 4MATA 1A16A 2BWSA 4PV4A 5CDEA 3PKEA 2B3LA 4IKUA 2OKNA 1R5HA 2GU7A 4FO8A 1W7VA 2BWWA 4EGEA 2BHCA 2GU6A 4KM3A 4OOKA 5JHUA 2GG3A 1Y1NA 1YVMA 2GG0A 4IDYA 1C23A 4FLJA 2GG5A 1R58A 3FMRA 1YW7A 1QXYA 1M35A 1C22A 4S00A 4U6EA 3IG4A 2EVOA 1WN1A 4ZWOA 3TB5A 2GU4A 1QXWA 4IKSA 4R60A 4IKTA 2V3ZA 2Q8KA 4RZYA 1XNZA 1XGOA 4ZWUA 4IU6A 1KP0A 4S01A 2B3HA 2ADUA 5JFRA 1BOAA 4RZZA 2P99A 4FLKA 5E2CA 4FKCA 4HXXA 3L7GA 1YW9A 1QXZA 1WKMA 2G6PA 4QR8A 5FCHA 4U1BA 2Q96A 5CDVA 3PKAA 5D6FA 1XGNA 4IF7A 5E5BA 2HOWA 2IW2A 2V3XA 3OOOA 3FMQA 3PKDA 4U70A 3PEBA 4U6JA 4U75A 2GZ5A 5D6EA 2GU5A 4A6VA 4IKRA 2V3YA 3BIPA 1B59A 4RGZ1 1C27A 1CHMA 4U73A 1WLRA 4U6WA 5CDLA 2GGCA 2Q94A 2BWVA 1C21A 2Q93A 2OAZA 3RVAA 4U6CA 1C24A 3IU9A 4S2TP 1KQ9A 1KQ0A 4FLIA 1N51A 3TAVA 5CNXA 2BHDA 4S2RP 1XGSA 3BIQA 3PN9A 3PKCA 1XGMA 2BH3A 2Q95A 3MATA 2NQ6A 3L24A 2BHAA 2BWYA 1YW8A 1O0XA 3OVKA 1W2MA 1QZYA 3CB6A 2GTXA
chains in the Genus database with same CATH topology
1PV9A 2EA4A 2GGBA 3IU8A 4Z7MA 4FUKA 2GG2A 5CIKA 2GG7A 2P9AA 1WY2A 3IL0A 2EVMA 1WL6A 1BN5A 2NQ7A 4U76A 5CLSA 2BWTA 4U6ZA 2B3KA 3FM3A 1WL9A 5JI6A 1JAWA 2BN7A 2DFIA 3BITA 3Q6DA 4FO7A 2GG8A 4JUQA 2Q92A 4U71A 2BWXA 3D27A 4ZNGA 2BHBA 2EA2A 3MR1A 2MATA 4FLLA 3S6BA 4A6WA 3MX6A 1WBQA 4ZWPA 3RORA 4U69A 1MATA 2BB7A 1YJ3A 2P98A 5FCFA 4PNCA 3I7MA 2BWUA 4B28A 1B6AA 2GG9A 2GA2A 5CE6A 3PKBA 3O5VA 2V6CA 3CB5A 2EVCA 2ZSGA 4IECA 3IU7A 1R5GA 3QOCA 3CTZA 4IPAA 4MATA 1A16A 2BWSA 4PV4A 5CDEA 3PKEA 2B3LA 4IKUA 2OKNA 1R5HA 2GU7A 4FO8A 1W7VA 2BWWA 4EGEA 2BHCA 2GU6A 4KM3A 4OOKA 5JHUA 2GG3A 1Y1NA 1YVMA 2GG0A 4IDYA 1C23A 4FLJA 2GG5A 1R58A 3FMRA 1YW7A 1QXYA 1M35A 1C22A 4S00A 4U6EA 3IG4A 2EVOA 1WN1A 4ZWOA 3TB5A 2GU4A 1QXWA 4IKSA 4R60A 4IKTA 2V3ZA 2Q8KA 4RZYA 1XNZA 1XGOA 4ZWUA 4IU6A 1KP0A 4S01A 2B3HA 2ADUA 5JFRA 1BOAA 4RZZA 2P99A 4FLKA 5E2CA 4FKCA 4HXXA 3L7GA 1YW9A 1QXZA 1WKMA 2G6PA 4QR8A 5FCHA 4U1BA 2Q96A 5CDVA 3PKAA 5D6FA 1XGNA 4IF7A 5E5BA 2HOWA 2IW2A 2V3XA 3OOOA 3FMQA 3PKDA 4U70A 3PEBA 4U6JA 4U75A 2GZ5A 5D6EA 2GU5A 4A6VA 4IKRA 2V3YA 3BIPA 1B59A 4RGZ1 1C27A 1CHMA 4U73A 1WLRA 4U6WA 5CDLA 2GGCA 2Q94A 2BWVA 1C21A 2Q93A 2OAZA 3RVAA 4U6CA 1C24A 3IU9A 4S2TP 1KQ9A 1KQ0A 4FLIA 1N51A 3TAVA 5CNXA 2BHDA 4S2RP 1XGSA 3BIQA 3PN9A 3PKCA 1XGMA 2BH3A 2Q95A 3MATA 2NQ6A 3L24A 2BHAA 2BWYA 1YW8A 1O0XA 3OVKA 1W2MA 1QZYA 3CB6A 2GTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV9 A;  2EA4 A;  2GGB A;  3IU8 A;  4Z7M A;  4FUK A;  2GG2 A;  5CIK A;  2GG7 A;  2P9A A;  1WY2 A;  3IL0 A;  2EVM A;  1WL6 A;  1BN5 A;  2NQ7 A;  4U76 A;  5CLS A;  2BWT A;  4U6Z A;  2B3K A;  3FM3 A;  1WL9 A;  5JI6 A;  1JAW A;  2BN7 A;  2DFI A;  3BIT A;  3Q6D A;  4FO7 A;  2GG8 A;  4JUQ A;  2Q92 A;  4U71 A;  2BWX A;  3D27 A;  4ZNG A;  2BHB A;  2EA2 A;  3MR1 A;  2MAT A;  4FLL A;  3S6B A;  4A6W A;  3MX6 A;  1WBQ A;  4ZWP A;  3ROR A;  4U69 A;  1MAT A;  2BB7 A;  1YJ3 A;  2P98 A;  5FCF A;  4PNC A;  3I7M A;  2BWU A;  4B28 A;  1B6A A;  2GG9 A;  2GA2 A;  5CE6 A;  3PKB A;  3O5V A;  2V6C A;  3CB5 A;  2EVC A;  2ZSG A;  4IEC A;  3IU7 A;  1R5G A;  3QOC A;  3CTZ A;  4IPA A;  4MAT A;  1A16 A;  2BWS A;  4PV4 A;  5CDE A;  3PKE A;  2B3L A;  4IKU A;  2OKN A;  1R5H A;  2GU7 A;  4FO8 A;  1W7V A;  2BWW A;  4EGE A;  2BHC A;  2GU6 A;  4KM3 A;  4OOK A;  5JHU A;  2GG3 A;  1Y1N A;  1YVM A;  2GG0 A;  4IDY A;  1C23 A;  4FLJ A;  2GG5 A;  1R58 A;  3FMR A;  1YW7 A;  1QXY A;  1M35 A;  1C22 A;  4S00 A;  4U6E A;  3IG4 A;  2EVO A;  1WN1 A;  4ZWO A;  3TB5 A;  2GU4 A;  1QXW A;  4IKS A;  4R60 A;  4IKT A;  2V3Z A;  2Q8K A;  4RZY A;  1XNZ A;  1XGO A;  4ZWU A;  4IU6 A;  1KP0 A;  4S01 A;  2B3H A;  2ADU A;  5JFR A;  1BOA A;  4RZZ A;  2P99 A;  4FLK A;  5E2C A;  4FKC A;  4HXX A;  3L7G A;  1YW9 A;  1QXZ A;  1WKM A;  2G6P A;  4QR8 A;  5FCH A;  4U1B A;  2Q96 A;  5CDV A;  3PKA A;  5D6F A;  1XGN A;  4IF7 A;  5E5B A;  2HOW A;  2IW2 A;  2V3X A;  3OOO A;  3FMQ A;  3PKD A;  4U70 A;  3PEB A;  4U6J A;  4U75 A;  2GZ5 A;  5D6E A;  2GU5 A;  4A6V A;  4IKR A;  2V3Y A;  3BIP A;  1B59 A;  4RGZ 1;  1C27 A;  1CHM A;  4U73 A;  1WLR A;  4U6W A;  5CDL A;  2GGC A;  2Q94 A;  2BWV A;  1C21 A;  2Q93 A;  2OAZ A;  3RVA A;  4U6C A;  1C24 A;  3IU9 A;  4S2T P;  1KQ9 A;  1KQ0 A;  4FLI A;  1N51 A;  3TAV A;  5CNX A;  2BHD A;  4S2R P;  1XGS A;  3BIQ A;  3PN9 A;  3PKC A;  1XGM A;  2BH3 A;  2Q95 A;  3MAT A;  2NQ6 A;  3L24 A;  2BHA A;  2BWY A;  1YW8 A;  1O0X A;  3OVK A;  1W2M A;  1QZY A;  3CB6 A;  2GTX A; 
#chains in the Genus database with same CATH topology
 1PV9 A;  2EA4 A;  2GGB A;  3IU8 A;  4Z7M A;  4FUK A;  2GG2 A;  5CIK A;  2GG7 A;  2P9A A;  1WY2 A;  3IL0 A;  2EVM A;  1WL6 A;  1BN5 A;  2NQ7 A;  4U76 A;  5CLS A;  2BWT A;  4U6Z A;  2B3K A;  3FM3 A;  1WL9 A;  5JI6 A;  1JAW A;  2BN7 A;  2DFI A;  3BIT A;  3Q6D A;  4FO7 A;  2GG8 A;  4JUQ A;  2Q92 A;  4U71 A;  2BWX A;  3D27 A;  4ZNG A;  2BHB A;  2EA2 A;  3MR1 A;  2MAT A;  4FLL A;  3S6B A;  4A6W A;  3MX6 A;  1WBQ A;  4ZWP A;  3ROR A;  4U69 A;  1MAT A;  2BB7 A;  1YJ3 A;  2P98 A;  5FCF A;  4PNC A;  3I7M A;  2BWU A;  4B28 A;  1B6A A;  2GG9 A;  2GA2 A;  5CE6 A;  3PKB A;  3O5V A;  2V6C A;  3CB5 A;  2EVC A;  2ZSG A;  4IEC A;  3IU7 A;  1R5G A;  3QOC A;  3CTZ A;  4IPA A;  4MAT A;  1A16 A;  2BWS A;  4PV4 A;  5CDE A;  3PKE A;  2B3L A;  4IKU A;  2OKN A;  1R5H A;  2GU7 A;  4FO8 A;  1W7V A;  2BWW A;  4EGE A;  2BHC A;  2GU6 A;  4KM3 A;  4OOK A;  5JHU A;  2GG3 A;  1Y1N A;  1YVM A;  2GG0 A;  4IDY A;  1C23 A;  4FLJ A;  2GG5 A;  1R58 A;  3FMR A;  1YW7 A;  1QXY A;  1M35 A;  1C22 A;  4S00 A;  4U6E A;  3IG4 A;  2EVO A;  1WN1 A;  4ZWO A;  3TB5 A;  2GU4 A;  1QXW A;  4IKS A;  4R60 A;  4IKT A;  2V3Z A;  2Q8K A;  4RZY A;  1XNZ A;  1XGO A;  4ZWU A;  4IU6 A;  1KP0 A;  4S01 A;  2B3H A;  2ADU A;  5JFR A;  1BOA A;  4RZZ A;  2P99 A;  4FLK A;  5E2C A;  4FKC A;  4HXX A;  3L7G A;  1YW9 A;  1QXZ A;  1WKM A;  2G6P A;  4QR8 A;  5FCH A;  4U1B A;  2Q96 A;  5CDV A;  3PKA A;  5D6F A;  1XGN A;  4IF7 A;  5E5B A;  2HOW A;  2IW2 A;  2V3X A;  3OOO A;  3FMQ A;  3PKD A;  4U70 A;  3PEB A;  4U6J A;  4U75 A;  2GZ5 A;  5D6E A;  2GU5 A;  4A6V A;  4IKR A;  2V3Y A;  3BIP A;  1B59 A;  4RGZ 1;  1C27 A;  1CHM A;  4U73 A;  1WLR A;  4U6W A;  5CDL A;  2GGC A;  2Q94 A;  2BWV A;  1C21 A;  2Q93 A;  2OAZ A;  3RVA A;  4U6C A;  1C24 A;  3IU9 A;  4S2T P;  1KQ9 A;  1KQ0 A;  4FLI A;  1N51 A;  3TAV A;  5CNX A;  2BHD A;  4S2R P;  1XGS A;  3BIQ A;  3PN9 A;  3PKC A;  1XGM A;  2BH3 A;  2Q95 A;  3MAT A;  2NQ6 A;  3L24 A;  2BHA A;  2BWY A;  1YW8 A;  1O0X A;  3OVK A;  1W2M A;  1QZY A;  3CB6 A;  2GTX A; 
#chains in the Genus database with same CATH homology
 1PV9 A;  2EA4 A;  2GGB A;  3IU8 A;  4Z7M A;  4FUK A;  2GG2 A;  5CIK A;  2GG7 A;  2P9A A;  1WY2 A;  3IL0 A;  2EVM A;  1WL6 A;  1BN5 A;  2NQ7 A;  4U76 A;  5CLS A;  2BWT A;  4U6Z A;  2B3K A;  3FM3 A;  1WL9 A;  5JI6 A;  1JAW A;  2BN7 A;  2DFI A;  3BIT A;  3Q6D A;  4FO7 A;  2GG8 A;  4JUQ A;  2Q92 A;  4U71 A;  2BWX A;  3D27 A;  4ZNG A;  2BHB A;  2EA2 A;  3MR1 A;  2MAT A;  4FLL A;  3S6B A;  4A6W A;  3MX6 A;  1WBQ A;  4ZWP A;  3ROR A;  4U69 A;  1MAT A;  2BB7 A;  1YJ3 A;  2P98 A;  5FCF A;  4PNC A;  3I7M A;  2BWU A;  4B28 A;  1B6A A;  2GG9 A;  2GA2 A;  5CE6 A;  3PKB A;  3O5V A;  2V6C A;  3CB5 A;  2EVC A;  2ZSG A;  4IEC A;  3IU7 A;  1R5G A;  3QOC A;  3CTZ A;  4IPA A;  4MAT A;  1A16 A;  2BWS A;  4PV4 A;  5CDE A;  3PKE A;  2B3L A;  4IKU A;  2OKN A;  1R5H A;  2GU7 A;  4FO8 A;  1W7V A;  2BWW A;  4EGE A;  2BHC A;  2GU6 A;  4KM3 A;  4OOK A;  5JHU A;  2GG3 A;  1Y1N A;  1YVM A;  2GG0 A;  4IDY A;  1C23 A;  4FLJ A;  2GG5 A;  1R58 A;  3FMR A;  1YW7 A;  1QXY A;  1M35 A;  1C22 A;  4S00 A;  4U6E A;  3IG4 A;  2EVO A;  1WN1 A;  4ZWO A;  3TB5 A;  2GU4 A;  1QXW A;  4IKS A;  4R60 A;  4IKT A;  2V3Z A;  2Q8K A;  4RZY A;  1XNZ A;  1XGO A;  4ZWU A;  4IU6 A;  1KP0 A;  4S01 A;  2B3H A;  2ADU A;  5JFR A;  1BOA A;  4RZZ A;  2P99 A;  4FLK A;  5E2C A;  4FKC A;  4HXX A;  3L7G A;  1YW9 A;  1QXZ A;  1WKM A;  2G6P A;  4QR8 A;  5FCH A;  4U1B A;  2Q96 A;  5CDV A;  3PKA A;  5D6F A;  1XGN A;  4IF7 A;  5E5B A;  2HOW A;  2IW2 A;  2V3X A;  3OOO A;  3FMQ A;  3PKD A;  4U70 A;  3PEB A;  4U6J A;  4U75 A;  2GZ5 A;  5D6E A;  2GU5 A;  4A6V A;  4IKR A;  2V3Y A;  3BIP A;  1B59 A;  4RGZ 1;  1C27 A;  1CHM A;  4U73 A;  1WLR A;  4U6W A;  5CDL A;  2GGC A;  2Q94 A;  2BWV A;  1C21 A;  2Q93 A;  2OAZ A;  3RVA A;  4U6C A;  1C24 A;  3IU9 A;  4S2T P;  1KQ9 A;  1KQ0 A;  4FLI A;  1N51 A;  3TAV A;  5CNX A;  2BHD A;  4S2R P;  1XGS A;  3BIQ A;  3PN9 A;  3PKC A;  1XGM A;  2BH3 A;  2Q95 A;  3MAT A;  2NQ6 A;  3L24 A;  2BHA A;  2BWY A;  1YW8 A;  1O0X A;  3OVK A;  1W2M A;  1QZY A;  3CB6 A;  2GTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...