5E5BA

Crystal structure of human spt16 n-terminal domain
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
431
structure length
431
Chain Sequence
b'AVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Structure of the human histone chaperone FACT Spt16 N-terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 150
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2015-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5e5bA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5e5bA02
1R5GA 3OVKA 3PKCA 4IF7A 4RZYA 3MX6A 2GG9A 1C27A 1XGNA 3OOOA 1WL6A 3IL0A 3FMQA 1B59A 5D6FA 4ZWUA 2OAZA 4ZWPA 1XGOA 1MATA 2GG7A 4FLIA 4U6ZA 2BWYA 3RVAA 1Y1NA 3PN9A 5FCHA 4EGEA 2GG0A 3MR1A 1W7VA 4IDYA 5JI6A 5CDVA 4U75A 3CB5A 1WY2A 2G6PA 4U6JA 4IKRA 2B3LA 2GU4A 1QXYA 1XNZA 2BB7A 2NQ6A 2BHDA 5E2CA 1W2MA 1C22A 1JAWA 1R5HA 1QZYA 2EVCA 2ADUA 1BN5A 5CE6A 3TB5A 2BWVA 2Q8KA 2DFIA 5CNXA 4U1BA 4FUKA 3Q6DA 4RGZ1 2GU5A 2BWXA 5CDEA 2IW2A 1WKMA 1YW8A 2BHAA 4U6CA 4U73A 4HXXA 2EA4A 1XGMA 2ZSGA 4RZZA 1WBQA 4FLLA 5E5BA 2BWSA 3FMRA 3PKAA 1A16A 4FLJA 1KQ0A 3L7GA 3IU7A 3I7MA 4JUQA 5JHUA 3RORA 2EA2A 5FCFA 2V6CA 3IG4A 3PKBA 1XGSA 2BHCA 2GG5A 2GGBA 2Q94A 2GG3A 2GZ5A 4U70A 1KQ9A 2EVOA 2BWUA 2GA2A 2GGCA 2BWWA 4U71A 3FM3A 3BITA 4KM3A 2EVMA 2GU7A 2V3YA 3O5VA 2P99A 1WL9A 2V3ZA 1R58A 3L24A 5CIKA 2Q93A 4QR8A 2P98A 2V3XA 2NQ7A 3IU9A 4IPAA 3MATA 1C23A 4U69A 3CB6A 4FKCA 4ZNGA 1B6AA 1C21A 1KP0A 1WLRA 4FLKA 1O0XA 2P9AA 2BN7A 4A6WA 3CTZA 2Q95A 4ZWOA 4FO7A 4B28A 1PV9A 1YJ3A 2Q96A 4IECA 2B3HA 2GG8A 5JFRA 2GG2A 2BHBA 3D27A 4OOKA 4FO8A 4MATA 2BWTA 3PEBA 1YW7A 4U76A 3PKDA 2MATA 3BIPA 3TAVA 1YW9A 2GTXA 4S2TP 4IU6A 4S00A 4R60A 1CHMA 4PV4A 4IKTA 5D6EA 4Z7MA 1QXWA 4IKSA 1WN1A 3BIQA 3QOCA 4S01A 2B3KA 2Q92A 4PNCA 2HOWA 4S2RP 1QXZA 1YVMA 3S6BA 4A6VA 2BH3A 5CDLA 5CLSA 2GU6A 4IKUA 1M35A 1C24A 3PKEA 2OKNA 4U6EA 4U6WA 3IU8A 1N51A 1BOAA
chains in the Genus database with same CATH superfamily
1R5GA 3OVKA 3PKCA 4IF7A 4RZYA 3MX6A 2GG9A 1C27A 1XGNA 3OOOA 1WL6A 3IL0A 3FMQA 1B59A 5D6FA 4ZWUA 2OAZA 4ZWPA 1XGOA 1MATA 2GG7A 4FLIA 4U6ZA 2BWYA 3RVAA 1Y1NA 3PN9A 5FCHA 4EGEA 2GG0A 3MR1A 1W7VA 4IDYA 5JI6A 5CDVA 4U75A 3CB5A 1WY2A 2G6PA 4U6JA 4IKRA 2B3LA 2GU4A 1QXYA 1XNZA 2BB7A 2NQ6A 2BHDA 5E2CA 1W2MA 1C22A 1JAWA 1R5HA 1QZYA 2EVCA 2ADUA 1BN5A 5CE6A 3TB5A 2BWVA 2Q8KA 2DFIA 5CNXA 4U1BA 4FUKA 3Q6DA 4RGZ1 2GU5A 2BWXA 5CDEA 2IW2A 1WKMA 1YW8A 2BHAA 4U6CA 4U73A 4HXXA 2EA4A 1XGMA 2ZSGA 4RZZA 1WBQA 4FLLA 5E5BA 2BWSA 3FMRA 3PKAA 1A16A 4FLJA 1KQ0A 3L7GA 3IU7A 3I7MA 4JUQA 5JHUA 3RORA 2EA2A 5FCFA 2V6CA 3IG4A 3PKBA 1XGSA 2BHCA 2GG5A 2GGBA 2Q94A 2GG3A 2GZ5A 4U70A 1KQ9A 2EVOA 2BWUA 2GA2A 2GGCA 2BWWA 4U71A 3FM3A 3BITA 4KM3A 2EVMA 2GU7A 2V3YA 3O5VA 2P99A 1WL9A 2V3ZA 1R58A 3L24A 5CIKA 2Q93A 4QR8A 2P98A 2V3XA 2NQ7A 3IU9A 4IPAA 3MATA 1C23A 4U69A 3CB6A 4FKCA 4ZNGA 1B6AA 1C21A 1KP0A 1WLRA 4FLKA 1O0XA 2P9AA 2BN7A 4A6WA 3CTZA 2Q95A 4ZWOA 4FO7A 4B28A 1PV9A 1YJ3A 2Q96A 4IECA 2B3HA 2GG8A 5JFRA 2GG2A 2BHBA 3D27A 4OOKA 4FO8A 4MATA 2BWTA 3PEBA 1YW7A 4U76A 3PKDA 2MATA 3BIPA 3TAVA 1YW9A 2GTXA 4S2TP 4IU6A 4S00A 4R60A 1CHMA 4PV4A 4IKTA 5D6EA 4Z7MA 1QXWA 4IKSA 1WN1A 3BIQA 3QOCA 4S01A 2B3KA 2Q92A 4PNCA 2HOWA 4S2RP 1QXZA 1YVMA 3S6BA 4A6VA 2BH3A 5CDLA 5CLSA 2GU6A 4IKUA 1M35A 1C24A 3PKEA 2OKNA 4U6EA 4U6WA 3IU8A 1N51A 1BOAA
chains in the Genus database with same CATH topology
1R5GA 3OVKA 3PKCA 4IF7A 4RZYA 3MX6A 2GG9A 1C27A 1XGNA 3OOOA 1WL6A 3IL0A 3FMQA 1B59A 5D6FA 4ZWUA 2OAZA 4ZWPA 1XGOA 1MATA 2GG7A 4FLIA 4U6ZA 2BWYA 3RVAA 1Y1NA 3PN9A 5FCHA 4EGEA 2GG0A 3MR1A 1W7VA 4IDYA 5JI6A 5CDVA 4U75A 3CB5A 1WY2A 2G6PA 4U6JA 4IKRA 2B3LA 2GU4A 1QXYA 1XNZA 2BB7A 2NQ6A 2BHDA 5E2CA 1W2MA 1C22A 1JAWA 1R5HA 1QZYA 2EVCA 2ADUA 1BN5A 5CE6A 3TB5A 2BWVA 2Q8KA 2DFIA 5CNXA 4U1BA 4FUKA 3Q6DA 4RGZ1 2GU5A 2BWXA 5CDEA 2IW2A 1WKMA 1YW8A 2BHAA 4U6CA 4U73A 4HXXA 2EA4A 1XGMA 2ZSGA 4RZZA 1WBQA 4FLLA 5E5BA 2BWSA 3FMRA 3PKAA 1A16A 4FLJA 1KQ0A 3L7GA 3IU7A 3I7MA 4JUQA 5JHUA 3RORA 2EA2A 5FCFA 2V6CA 3IG4A 3PKBA 1XGSA 2BHCA 2GG5A 2GGBA 2Q94A 2GG3A 2GZ5A 4U70A 1KQ9A 2EVOA 2BWUA 2GA2A 2GGCA 2BWWA 4U71A 3FM3A 3BITA 4KM3A 2EVMA 2GU7A 2V3YA 3O5VA 2P99A 1WL9A 2V3ZA 1R58A 3L24A 5CIKA 2Q93A 4QR8A 2P98A 2V3XA 2NQ7A 3IU9A 4IPAA 3MATA 1C23A 4U69A 3CB6A 4FKCA 4ZNGA 1B6AA 1C21A 1KP0A 1WLRA 4FLKA 1O0XA 2P9AA 2BN7A 4A6WA 3CTZA 2Q95A 4ZWOA 4FO7A 4B28A 1PV9A 1YJ3A 2Q96A 4IECA 2B3HA 2GG8A 5JFRA 2GG2A 2BHBA 3D27A 4OOKA 4FO8A 4MATA 2BWTA 3PEBA 1YW7A 4U76A 3PKDA 2MATA 3BIPA 3TAVA 1YW9A 2GTXA 4S2TP 4IU6A 4S00A 4R60A 1CHMA 4PV4A 4IKTA 5D6EA 4Z7MA 1QXWA 4IKSA 1WN1A 3BIQA 3QOCA 4S01A 2B3KA 2Q92A 4PNCA 2HOWA 4S2RP 1QXZA 1YVMA 3S6BA 4A6VA 2BH3A 5CDLA 5CLSA 2GU6A 4IKUA 1M35A 1C24A 3PKEA 2OKNA 4U6EA 4U6WA 3IU8A 1N51A 1BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5G A;  3OVK A;  3PKC A;  4IF7 A;  4RZY A;  3MX6 A;  2GG9 A;  1C27 A;  1XGN A;  3OOO A;  1WL6 A;  3IL0 A;  3FMQ A;  1B59 A;  5D6F A;  4ZWU A;  2OAZ A;  4ZWP A;  1XGO A;  1MAT A;  2GG7 A;  4FLI A;  4U6Z A;  2BWY A;  3RVA A;  1Y1N A;  3PN9 A;  5FCH A;  4EGE A;  2GG0 A;  3MR1 A;  1W7V A;  4IDY A;  5JI6 A;  5CDV A;  4U75 A;  3CB5 A;  1WY2 A;  2G6P A;  4U6J A;  4IKR A;  2B3L A;  2GU4 A;  1QXY A;  1XNZ A;  2BB7 A;  2NQ6 A;  2BHD A;  5E2C A;  1W2M A;  1C22 A;  1JAW A;  1R5H A;  1QZY A;  2EVC A;  2ADU A;  1BN5 A;  5CE6 A;  3TB5 A;  2BWV A;  2Q8K A;  2DFI A;  5CNX A;  4U1B A;  4FUK A;  3Q6D A;  4RGZ 1;  2GU5 A;  2BWX A;  5CDE A;  2IW2 A;  1WKM A;  1YW8 A;  2BHA A;  4U6C A;  4U73 A;  4HXX A;  2EA4 A;  1XGM A;  2ZSG A;  4RZZ A;  1WBQ A;  4FLL A;  5E5B A;  2BWS A;  3FMR A;  3PKA A;  1A16 A;  4FLJ A;  1KQ0 A;  3L7G A;  3IU7 A;  3I7M A;  4JUQ A;  5JHU A;  3ROR A;  2EA2 A;  5FCF A;  2V6C A;  3IG4 A;  3PKB A;  1XGS A;  2BHC A;  2GG5 A;  2GGB A;  2Q94 A;  2GG3 A;  2GZ5 A;  4U70 A;  1KQ9 A;  2EVO A;  2BWU A;  2GA2 A;  2GGC A;  2BWW A;  4U71 A;  3FM3 A;  3BIT A;  4KM3 A;  2EVM A;  2GU7 A;  2V3Y A;  3O5V A;  2P99 A;  1WL9 A;  2V3Z A;  1R58 A;  3L24 A;  5CIK A;  2Q93 A;  4QR8 A;  2P98 A;  2V3X A;  2NQ7 A;  3IU9 A;  4IPA A;  3MAT A;  1C23 A;  4U69 A;  3CB6 A;  4FKC A;  4ZNG A;  1B6A A;  1C21 A;  1KP0 A;  1WLR A;  4FLK A;  1O0X A;  2P9A A;  2BN7 A;  4A6W A;  3CTZ A;  2Q95 A;  4ZWO A;  4FO7 A;  4B28 A;  1PV9 A;  1YJ3 A;  2Q96 A;  4IEC A;  2B3H A;  2GG8 A;  5JFR A;  2GG2 A;  2BHB A;  3D27 A;  4OOK A;  4FO8 A;  4MAT A;  2BWT A;  3PEB A;  1YW7 A;  4U76 A;  3PKD A;  2MAT A;  3BIP A;  3TAV A;  1YW9 A;  2GTX A;  4S2T P;  4IU6 A;  4S00 A;  4R60 A;  1CHM A;  4PV4 A;  4IKT A;  5D6E A;  4Z7M A;  1QXW A;  4IKS A;  1WN1 A;  3BIQ A;  3QOC A;  4S01 A;  2B3K A;  2Q92 A;  4PNC A;  2HOW A;  4S2R P;  1QXZ A;  1YVM A;  3S6B A;  4A6V A;  2BH3 A;  5CDL A;  5CLS A;  2GU6 A;  4IKU A;  1M35 A;  1C24 A;  3PKE A;  2OKN A;  4U6E A;  4U6W A;  3IU8 A;  1N51 A;  1BOA A; 
#chains in the Genus database with same CATH topology
 1R5G A;  3OVK A;  3PKC A;  4IF7 A;  4RZY A;  3MX6 A;  2GG9 A;  1C27 A;  1XGN A;  3OOO A;  1WL6 A;  3IL0 A;  3FMQ A;  1B59 A;  5D6F A;  4ZWU A;  2OAZ A;  4ZWP A;  1XGO A;  1MAT A;  2GG7 A;  4FLI A;  4U6Z A;  2BWY A;  3RVA A;  1Y1N A;  3PN9 A;  5FCH A;  4EGE A;  2GG0 A;  3MR1 A;  1W7V A;  4IDY A;  5JI6 A;  5CDV A;  4U75 A;  3CB5 A;  1WY2 A;  2G6P A;  4U6J A;  4IKR A;  2B3L A;  2GU4 A;  1QXY A;  1XNZ A;  2BB7 A;  2NQ6 A;  2BHD A;  5E2C A;  1W2M A;  1C22 A;  1JAW A;  1R5H A;  1QZY A;  2EVC A;  2ADU A;  1BN5 A;  5CE6 A;  3TB5 A;  2BWV A;  2Q8K A;  2DFI A;  5CNX A;  4U1B A;  4FUK A;  3Q6D A;  4RGZ 1;  2GU5 A;  2BWX A;  5CDE A;  2IW2 A;  1WKM A;  1YW8 A;  2BHA A;  4U6C A;  4U73 A;  4HXX A;  2EA4 A;  1XGM A;  2ZSG A;  4RZZ A;  1WBQ A;  4FLL A;  5E5B A;  2BWS A;  3FMR A;  3PKA A;  1A16 A;  4FLJ A;  1KQ0 A;  3L7G A;  3IU7 A;  3I7M A;  4JUQ A;  5JHU A;  3ROR A;  2EA2 A;  5FCF A;  2V6C A;  3IG4 A;  3PKB A;  1XGS A;  2BHC A;  2GG5 A;  2GGB A;  2Q94 A;  2GG3 A;  2GZ5 A;  4U70 A;  1KQ9 A;  2EVO A;  2BWU A;  2GA2 A;  2GGC A;  2BWW A;  4U71 A;  3FM3 A;  3BIT A;  4KM3 A;  2EVM A;  2GU7 A;  2V3Y A;  3O5V A;  2P99 A;  1WL9 A;  2V3Z A;  1R58 A;  3L24 A;  5CIK A;  2Q93 A;  4QR8 A;  2P98 A;  2V3X A;  2NQ7 A;  3IU9 A;  4IPA A;  3MAT A;  1C23 A;  4U69 A;  3CB6 A;  4FKC A;  4ZNG A;  1B6A A;  1C21 A;  1KP0 A;  1WLR A;  4FLK A;  1O0X A;  2P9A A;  2BN7 A;  4A6W A;  3CTZ A;  2Q95 A;  4ZWO A;  4FO7 A;  4B28 A;  1PV9 A;  1YJ3 A;  2Q96 A;  4IEC A;  2B3H A;  2GG8 A;  5JFR A;  2GG2 A;  2BHB A;  3D27 A;  4OOK A;  4FO8 A;  4MAT A;  2BWT A;  3PEB A;  1YW7 A;  4U76 A;  3PKD A;  2MAT A;  3BIP A;  3TAV A;  1YW9 A;  2GTX A;  4S2T P;  4IU6 A;  4S00 A;  4R60 A;  1CHM A;  4PV4 A;  4IKT A;  5D6E A;  4Z7M A;  1QXW A;  4IKS A;  1WN1 A;  3BIQ A;  3QOC A;  4S01 A;  2B3K A;  2Q92 A;  4PNC A;  2HOW A;  4S2R P;  1QXZ A;  1YVM A;  3S6B A;  4A6V A;  2BH3 A;  5CDL A;  5CLS A;  2GU6 A;  4IKU A;  1M35 A;  1C24 A;  3PKE A;  2OKN A;  4U6E A;  4U6W A;  3IU8 A;  1N51 A;  1BOA A; 
#chains in the Genus database with same CATH homology
 1R5G A;  3OVK A;  3PKC A;  4IF7 A;  4RZY A;  3MX6 A;  2GG9 A;  1C27 A;  1XGN A;  3OOO A;  1WL6 A;  3IL0 A;  3FMQ A;  1B59 A;  5D6F A;  4ZWU A;  2OAZ A;  4ZWP A;  1XGO A;  1MAT A;  2GG7 A;  4FLI A;  4U6Z A;  2BWY A;  3RVA A;  1Y1N A;  3PN9 A;  5FCH A;  4EGE A;  2GG0 A;  3MR1 A;  1W7V A;  4IDY A;  5JI6 A;  5CDV A;  4U75 A;  3CB5 A;  1WY2 A;  2G6P A;  4U6J A;  4IKR A;  2B3L A;  2GU4 A;  1QXY A;  1XNZ A;  2BB7 A;  2NQ6 A;  2BHD A;  5E2C A;  1W2M A;  1C22 A;  1JAW A;  1R5H A;  1QZY A;  2EVC A;  2ADU A;  1BN5 A;  5CE6 A;  3TB5 A;  2BWV A;  2Q8K A;  2DFI A;  5CNX A;  4U1B A;  4FUK A;  3Q6D A;  4RGZ 1;  2GU5 A;  2BWX A;  5CDE A;  2IW2 A;  1WKM A;  1YW8 A;  2BHA A;  4U6C A;  4U73 A;  4HXX A;  2EA4 A;  1XGM A;  2ZSG A;  4RZZ A;  1WBQ A;  4FLL A;  5E5B A;  2BWS A;  3FMR A;  3PKA A;  1A16 A;  4FLJ A;  1KQ0 A;  3L7G A;  3IU7 A;  3I7M A;  4JUQ A;  5JHU A;  3ROR A;  2EA2 A;  5FCF A;  2V6C A;  3IG4 A;  3PKB A;  1XGS A;  2BHC A;  2GG5 A;  2GGB A;  2Q94 A;  2GG3 A;  2GZ5 A;  4U70 A;  1KQ9 A;  2EVO A;  2BWU A;  2GA2 A;  2GGC A;  2BWW A;  4U71 A;  3FM3 A;  3BIT A;  4KM3 A;  2EVM A;  2GU7 A;  2V3Y A;  3O5V A;  2P99 A;  1WL9 A;  2V3Z A;  1R58 A;  3L24 A;  5CIK A;  2Q93 A;  4QR8 A;  2P98 A;  2V3X A;  2NQ7 A;  3IU9 A;  4IPA A;  3MAT A;  1C23 A;  4U69 A;  3CB6 A;  4FKC A;  4ZNG A;  1B6A A;  1C21 A;  1KP0 A;  1WLR A;  4FLK A;  1O0X A;  2P9A A;  2BN7 A;  4A6W A;  3CTZ A;  2Q95 A;  4ZWO A;  4FO7 A;  4B28 A;  1PV9 A;  1YJ3 A;  2Q96 A;  4IEC A;  2B3H A;  2GG8 A;  5JFR A;  2GG2 A;  2BHB A;  3D27 A;  4OOK A;  4FO8 A;  4MAT A;  2BWT A;  3PEB A;  1YW7 A;  4U76 A;  3PKD A;  2MAT A;  3BIP A;  3TAV A;  1YW9 A;  2GTX A;  4S2T P;  4IU6 A;  4S00 A;  4R60 A;  1CHM A;  4PV4 A;  4IKT A;  5D6E A;  4Z7M A;  1QXW A;  4IKS A;  1WN1 A;  3BIQ A;  3QOC A;  4S01 A;  2B3K A;  2Q92 A;  4PNC A;  2HOW A;  4S2R P;  1QXZ A;  1YVM A;  3S6B A;  4A6V A;  2BH3 A;  5CDL A;  5CLS A;  2GU6 A;  4IKU A;  1M35 A;  1C24 A;  3PKE A;  2OKN A;  4U6E A;  4U6W A;  3IU8 A;  1N51 A;  1BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...