5E5RB

Crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
192
structure length
187
Chain Sequence
b'KTRMRSTVSVREGQGVVLLCGPPELSYAWVFNEYPFVEEDSRRFVSQETGHLYIAKVEPSDVGNYTCVVTSTVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVRLECFALGNPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGKNVARGRLTYYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-type tyrosine-protein phosphatase gamma
publication title Structural Basis for Interactions Between Contactin Family Members and Protein-tyrosine Phosphatase Receptor Type G in Neural Tissues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
total genus 39
structure length 187
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5rB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5rB02
4JFFD 1A4KB 2EDYA 5CILH 2VL5B 4U6VL 1TLKA 4PJ8C 4FTVB 4P23D 4RSVA 5FYJU 3OZ9H 4Y2DD 2ZUXA 3WXVH 4XMLL 4QNPE 1DUZA 2HTLD 4L8CA 5HHXL 3HFMH 3LQAH 1MLBB 1AIFA 5CEYB 4GJTB 4ZSOB 5C0FA 3T0ED 5IB5A 1BD2A 1IBGL 15C8L 5E2VL 4MA7L 4R6UA 1P84J 1PSKL 4LPWA 4P3CH 5JPMB 3REWB 3FO0L 4JFZL 4NGHL 5CCKL 3CIQA 1ZT7B 2WW8A 2OJEA 4OIBA 3EBAA 5I1HL 4K23H 1JGVL 2C4FU 5D7JD 4H1LH 2G2RA 5BZDB 3KPNB 2BNRB 2WBKA 4OLWH 3MOAH 3GFUA 5DRWA 1B90A 2HT2D 1X5HA 3VFSB 4KZEL 3VXMD 4KROC 2DM3A 2XKUA 1E6OL 1BHGA 2EE6A 4LNRA 3MA7B 2EH7L 2J8UE 4PRIA 3ARWA 5GGTL 5FYKD 2GTWA 1CT8B 2VDMH 1C7SA 1VFAA 4Z7VF 4Y5YB 4YHML 1KTDB 4CADA 2VDPL 3JUYA 5C0ND 1H3XA 1XCQA 4RMUA 5TQ0H 3RVUC 3JTSB 4Y5VA 5IVZA 1OAUL 5FF6B 4R3SB 4GBXD 2QSQA 1P7QD 3G6DL 4L4VE 4I0KA 1T5WA 1EDQA 4G6KL 3BH9B 1CDGA 5DGRA 1TNNA 5HHVL 4M1CC 2XWBA 1P7KB 2E7MA 1OSPH 3C60A 3IDYC 1NANI 4QXWA 3UJIH 4O00A 1K8IA 1JIBA 2AKRB 2C26A 4LHQB 5GGVL 5F6HI 1IKNC 1IGTB 1R3KB 4NWUL 4TOYL 5HDLA 5DEGA 5E00A 1QFWI 3B9KD 4G6AC 4ZTPH 1F5WA 4NUGH 4RIRA 3VWJA 1KTLA 3G5ZA 3MLPA 1LEKA 1CWVA 1NEZA 3IJHB 2PETA 4JREC 5I1AB 5IBUB 3SE9L 2AJZB 3C2SA 5EU6A 5IG7A 2GYSA 5E70A 3GSWB 1X7QA 1G7IA 1T2JA 4I3GA 2AJXL 1BQHA 3FO2A 2Y5EA 1RK1B 2Q76B 1C08B 1Q72H 4ZFOB 3IGAA 4RZCB 3K2UH 2HRPH 3U0TB 4AYFA 2NXZC 1BIIA 4U31A 1U8IA 4HUUB 3S35L 4E41D 2AEPH 1X5AA 2R2EA 4R2GC 3OKKA 5GGSB 2FR4B 3PL6A 4X99B 1AP2A 4DW2H 2UWEA 3MRDA 3SOBH 4G6ML 5JUEL 3PABB 2BNQB 1F3JA 3QULA 3T0WA 2GUOA 3ULSB 1DJSA 5F7KC 5EU7E 3TCXA 4XNMB 1CTOA 4P46B 2MNUA 5IHLB 4NZUL 2IANA 4OCMC 5KOVC 4DKEL 1G7HB 1UXWB 2BC4A 3GMOA 5E8PA 1C1EH 4KTYA 1I7TB 2EDJA 2EICA 5BCAA 2LV4A 2OK0L 5HJ3A 4ZUSB 1DQLH 4ZPTB 2Y36H 1JI2A 4MNQD 1BAFH 2ZSVA 5GGSY 2F53A 2VH5L 3IDNA 1E4JA 1JGDB 4KKCC 1T2XA 1ZLWK 4BSJA 4XGZB 5JIKA 3B9EA 1CICB 2DQIL 1LEIB 2X5PA 5DD3H 3W5MA 3TO4C 3QZWB 5H2BB 3O4LD 1JPFB 3VXUE 1S78C 5CINH 5JW5A 1OB1A 3AVEA 5ITBL 2ARWA 2K7PA 2WIIB 3CU1A 5CGTA 2CDEB 5GS0C 5F3HB 1OF2B 3CMGA 1A1NA 3MUZ1 1DEEA 3D2UB 1FO0B 1QLFA 2JB5H 2PO6A 1YDPB 3M1BA 1MI5E 1KXTB 4X9IA 4HFUL 4OZ4B 5CP7B 1MAML 4JHBA 4FQXB 3EDKA 4MNHA 1CLCA 1CGWA 4XC1H 5CAYB 1W8OA 3BHBA 1DFBL 5EOCL 3RWHA 1SMOA 4U6TA 4ZPVB 3VWKA 4NQEA 3W81A 1G7PA 3HE7C 2YPLA 4XCCL 4N5ED 4XB8A 3UDWA 4HJ0D 4JRYA 1ACYH 5H35A 4U6XB 3OB8A 1XCTA 3ULUH 2VSDA 4X4XA 1HXYB 3EOBA 5MEPB 5MENA 3HC0B 1KJ3H 4DFIA 2HKFH 3MFFA 1YNTB 3CVIL 4QGYA 5AWNL 3ZHDA 2R1XB 3QDMA 2PXYA 1HKFA 2OR7A 4P2RD 3MBXL 4NQCA 4FZEH 1F42A 2V7NA 1PG7L 3C5ZA 1MQKH 3C5SA 1VGEH 2WBWB 4G3YL 4PJFE 2Z8WC 5F7EH 1YQVL 4U1IA 2R9HC 4YEEA 5IVNA 4MJIB 5IT2L 3OXRB 4MZ2A 3QHZH 2VJXA 1VFBA 2QQKH 3V0VB 3GSUA 5GIRB 3DSNA 1DN0A 5FYJD 2VLLB 5EG6C 5FM8A 3SKJH 2R15A 4NM8H 2VLME 2NNAB 5MEOB 3ARGC 1MF2L 3UTTD 4AMKH 4IOFD 4LCIH 3OKEA 1R3IL 4YHIA 3LRSB 4KK9D 4J3WA 5EIIB 1HYRC 3NMEA 3RWEB 1CYGA 3VRIA 2W0FA 5IBTH 3I50L 3MLWL 3B3IB 3BIKB 1NCAH 4JFYA 1MHPH 1OCWH 5J1AA 3SKUD 1HHJA 2W1NA 3T0XA 5F7DA 4OF8A 5MHSE 5BS0D 1KIPB 1ORSA 5D1XC 4LSUL 4B0MM 5DK3A 1KJMB 5BQ7A 1BFSA 3EYUL 2RCSL 4WRLA 1I85C 3TGXA 1WWAX 4OZHE 1A5FL 1T66C 2XI9A 2GSIB 3LS4L 4Y19D 4FQ1L 4PJGF 1FZJA 4ZS7L 3VI3F 1A7OH 5HPMA 2FJFA 1MOEA 2X4NA 2APBA 2FCBA 4XXCC 4DZ8B 3GSQA 5DJDA 4QYOA 3RVXD 3DV6B 4ZAKB 3K74B 1MSPA 1S7SA 1NC2A 3C2AH 3RBGA 1NDGA 35C8L 5TDOB 1K2DA 4Y4KD 1EEZA 1INQB 4U33A 4HUVA 4YDJB 4Y4FD 3T2QA 3BPOB 3QIUB 3WYRA 1A14H 2DAVA 4D0CA 3RU8L 3HI5H 3N9GH 1TZGH 3HI6L 4MVBD 4ONHB 3KS0H 3UBXA 3B4NA 4XP6H 1G1CA 4IM8A 1R3LA 5J6HA 4MAUH 4F9LA 3VA2C 5HYQA 1VKXB 4RWHA 3VXQA 2QV2A 1T1YA 2FIKA 1TTFA 5I1DA 3BEVB 4FFVD 1WCBB 1N5YL 3TJEL 1H5BC 5E0QA 2ZG2A 1XGUA 5T1DL 5AG9A 1KCVH 1T03L 3BGFC 4BQCA 4XPTL 3OGOE 5KVDL 2GJ6D 4U05A 5IMMA 2AEQL 4MNGB 4XNZB 4WDIB 5C08B 2H26A 3IXAB 1IARB 1B0WA 2Q3ZA 4R0LA 4JKKA 3QNYB 2MKLC 1NDMB 2ZKHH 4OV5B 5EFIA 3U30C 1CFTB 3CUPB 1HK6A 2NX5B 3MNZA 4DVBB 1A0QH 1A6ZA 4XPGL 2HT4D 2IQ9H 3D9AL 4JFHD 1U8LA 1NH6A 2FHBA 4W4NA 5FO7A 5IB1A 4LNVA 1Y0LA 1S9XB 5E6YA 4M1DL 5LGHH 3U79A 3VRLE 1PY9A 1Q9OA 3BZEA 1WFTA 5EIQA 1FFPB 3MRPB 5C3TA 2J8UA 5F1KC 5F96L 1SJXA 3A6CH 4GS7B 3MLVL 4QXUL 5E4IA 3CDFA 1G7JA 4Z7UB 1EAPB 4X98A 2W60B 4JQIH 4NIKB 2DYPB 1ZTXH 2BXZA 2M1KA 4OGAD 4BKLB 4YIQA 3H6JA 5HGHA 5GS1A 1IQDA 1A2YA 1K85A 1P5UA 3WBDA 4U6VH 4OFIA 1H8SA 4L4VA 1TVDA 3D6GA 4BQ8A 2A6KA 5DO2C 4EUPA 1VADA 1BD2D 1DE4A 4HXBL 1VFMA 3H9YA 1AGFB 5I73B 4FG6D 3RNQB 2WUBL 5J6GA 1DUYA 5SX5K 1N0XL 4XMLH 5LAXA 3NGBC 5HHXH 4WO4B 3BFOA 4XXDA 1RJCA 5BV7C 3GUTA 1IBGH 1MJJA 15C8H 5E2VH 2E7LA 3E6FA 1AXTL 4MA7H 1PSKH 1Z3GL 2ARJA 2NW2B 3FO0H 4JFZH 4NGHH 5CCKH 4MCYB 3BD4A 4IRJB 4OCWL 5GZNC 1YEEL 3IS0X 1WZKA 5I1HH 1I7UA 1JGVH 3DWTA 4PRID 2HJKA 2HG5A 3REVB 3SGJA 5BRZB 4KK6D 2EE3A 2Z93A 1FSKB 2DQUL 4MQ7A 4ISVB 1MFCL 4PR5B 3D69A 5IWLC 2OSLA 2NY1D 2YWZA 4KZEH 1M7IB 1I7ZA 1E6OH 4GW1A 4Z7NF 2EH7H 4KVNL 2HH0L 1EUTA 5GGTH 3L5JA 5FYLE 3MUHL 2GITA 3WS3B 4Z76A 4YHMH 2FRGP 1I1FB 2VDPH 4PGBB 5SWZE 1T22A 1X4YA 1I8LC 4HS8L 1YC7A 5DJZA 3QSKB 2AVGA 4JVUA 4GG6B 1OAUH 3C60D 3WJJA 3ILQD 3RIAF 3OJDA 3WHXA 4M8QB 3G6DH 2XQBL 1ZA6B 1VERA 1BLNB 2K3TA 4G6KH 2K7QA 2JB6B 4PLKC 5HHVH 1Q9LB 1Q9KB 4NKDA 3VWJD 4EIZC 2X44D 4GSDL 5IB3A 1EXUB 5HGAA 4DGIL 4HWNA 5GGVH 4N0CD 4TOYH 4NWUH 3S3PA 1NCDL 2L7JA 5EU6D 3I9GL 1SY6L 2W0LA 2FNBA 4F7PA 2J12B 1UB6B 4PGCA 3D3VA 4FQQB 3EHBC 4XWOC 1NBVL 4H5SA 1MLCA 4WWKA 3SE9H 3VFVA 4OD2A 3C6LA 3VXUA 3D48R 4YBLB 5ADOL 2AJXH 2Z35B 1RK0B 3HAEA 3PL6D 5F9OL 1A7RL 1DP0A 4YDKL 5HVHC 2X41A 4PLOB 4NSKA 3S35H 3HPJA 1MI5A 4NNYA 2HRLA 2DD8L 4PTUA 4GRLA 2NY0D 1B0RA 2IAND 2FO4A 4G6MH 1NAML 4AEIL 5JUEH 4NQXA 3GB7A 3SE3A 3MGTB 2IWGA 1VEOA 2DKUA 2X1OA 1NL0L 3KPOB 1P1ZB 4NZUH 2F53D 4DKEH 4BQBA 4JN1L 5EU3B 2AV1B 1QSFB 3NIDE 2CDGA 3QYCA 2OK0H 5J3HD 1OP3H 1QYGL 2EDWA 5F3BA 2JCCB 2LABA 1ETZA 1A7NH 3X14B 5GRUL 2HJFA 2VH5H 5A2JH 5E2JA 3AUVA 3UMTA 5F21B 3EOYG 4OLYL 4QRQA 1J05A 5EWIL 3TEUA 4PJFA 2ATPB 4JY4B 3LB6D 2DQIH 3OR6A 4TUKL 4Z78B 4CL7A 4PP2B 1BOGB 3LHPL 3AM8C 1AGBA 2PO6D 1XIWB 1U58B 5E6IA 4JFQA 5ITBH 1TZIB 1KCUL 1R24A 3R06B 4M3JA 4JO3L 2EYTB 4NFCA 1UQSA 4HJJL 3LKSA 2VAJA 4M3KB 2Y1VA 3UTQA 1IJ9A 4HS6B 4MGXA 3KYMA 5B8CC 1FCGA 3VGGA 3VWKD 4HFUH 3DARA 4NQED 5KVEL 1MAMH 2YPLD 1IC5L 4JRYD 2JF1A 2HKHL 1AHWB 1YYLL 1J87A 1N59A 1DFBH 1JN6A 3KLAA 2GIYA 5I71C 5EOCH 5MEND 1S5IL 4MJ5B 3CFJA 3QDMD 3B5GA 1WC7A 4LLWA 4XCCH 4OZHA 3NA9L 4NQCD 3RUGF 3O9WB 1I8KB 3C5ZD 1U2CA 4ELMA 1E27A 1G9ML 4PJAE 1G9NL 3IDJA 5AWNH 4JN2B 5MEQB 1QVOB 1LE5B 3MBXH 2BVQB 3EJYD 2CKBL 5CD3B 2NXYC 2R0WL 5I1LB 1YEDA 3PXHA 1PG7H 3VD5A 1M71B 4G3YH 3ZE2E 4YGVB 1L9NA 1KLFA 1TIUA 1YQVH 3QXDA 3Q5OA 3A67L 4RQQB 4PB0L 4WU7A 5IT2H 1FG9C 2CJUL 4DOHE 2KPNA 1OWWA 5KSBB 1P4IL 1EHAA 4CMHC 3FB6A 4PV8A 1GPOL 1DBAL 5C2BL 3JBG7 5I74B 1IL1B 2A6DA 2LVCA 5CEYA 2B4CC 2IG2L 2AQ2A 5D1QC 3ARFA 1R3IH 2YPKA 3WDIA 4NPYB 4FP8L 2FX7L 4Y1AE 4L8BA 1BWWA 3MMEB 3KLHD 1N5AB 3I50H 3MLWH 4NZDA 1XGRA 3H3KA 4RAVA 4YR6A 5KZCB 3RY4A 3G5VB 1OWRM 2Z92A 1X6LA 1HSAB 2MQCA 3U2SB 1I1YA 4LAQL 1U3JA 4LSUH 3T3PF 3EYUH 2RCSH 1W0WB 3MOBL 1A5FH 1CZ8L 4HWBA 4OM0L 1JZ7A 3NH7L 1IEBB 2BVEA 4JQVC 3LS4H 5HYJE 3V7AE 4FQ1H 4ZS7H 1NC2D 1UJTA 2OI9C 3ZHLA 3F7YB 3NBNA 3VFWA 2R0ZL 3TBTA 2BCKA 3QUZB 3EYQD 3JTSA 1PLGL 2RQ8A 4WUUA 3IFPB 2H3NA 3O3AB 4A6YL 2PCPA 3UTZA 5F71A 3PIQB 35C8H 4JM2A 3STLB 3WMSA 1FBIL 2VC2L 3O8XA 1HE7A 5SX4I 4MXWL 1P7KA 3NPSC 2DWDB 3VMNA 2IAMB 4NO3B 4RDQG 3N1GC 3WKML 3RU8H 3HI6H 3AY4A 5JPNA 3KLDA 5A3ID 1KTRL 2FWOA 4D94A 3P77A 3ULVC 3QQ4B 5ID1A 4J1UB 1JP5A 3TH2T 4KRNA 1N5YH 3TJEH 2HFFA 1JTTA 5E7FA 1HILB 5E8NA 2AJZA 1EBPA 3G5XB 2EDTA 5T1DH 1T03H 4I0PC 3WFDL 4EI5C 3OB0K 3WFBL 2FJHA 3HS0B 4XPTH 5I8KL 5KVDH 1Q9WB 2Q76A 4PJDB 1FN4B 4U1HA 4BZ1L 1EGJA 2AEQH 1Z6JT 2XY2A 5JDJA 1NLBL 3LN4B 2MKWA 4Y5XA 4LLQA 2ZCLL 4MA3A 5IKCB 3WNKA 4GAFB 5GGSA 1TJIL 3AU1A 4Y16A 3CXDL 1BEYL 5EUKB 4HD9A 4WEBL 4X5XA 3ZKMC 4MDIB 4X7CC 3TYFB 3ULSA 2XZAL 4XPGH 5CBAB 3D9AH 1SJVA 2BRRL 1IGIL 4FMFA 4EXPX 3V5HA 2J6EA 1OT2A 4I5BB 5F72S 1UXWA 5FB8A 4JHAL 2BSTA 3CFBA 4M1DH 5F89A 5E5UB 3AXLB 3MYJA 2CQVA 3D87B 4Q0XL 1Z9OA 4ZPTA 5F96H 4QXUH 3MLVH 4E9LA 1SYSA 5DZOA 2NY4C 2D2OA 3MRNA 4L4VD 1JGDA 1Z9MA 4JKPL 5SWZA 3WS6A 1TCRB 1PEZA 3I84A 5MI0B 2P48B 1RI8A 4JB9L 5FIEA 1GOFA 3OAYH 4G9FA 3RL2B 4OAWB 4XH2A 1IGJA 3QZWA 1JMXA 1DVFA 3EOAB 2FH6A 5HGDB 3FJTA 3UPCA 4HXBH 3VCLA 2AV7B 1FNSL 1J7VR 1I1AC 4HHAA 4P3DA 2WUBH 2BNUA 2XN9B 4I48A 3QDGA 1N0XH 3KXFB 4FQ2L 5E5MA 4NO2A 5KSVB 5FKAB 4JLRB 2GQHA 3TVMA 5JA9A 3GSXB 3PWPA 1IAIL 3MODL 1AXTH 1WZ1L 3FRPA 1Z3GH 3FQWA 4BFIB 4OGYL 4ZO6A 3QO1A 5CIPB 2X4UB 1ZSDA 2QLVB 3HE6A 4XBPA 2BSRA 1LDPL 4OCWH 1WITA 1YEEH 2NTFB 2DI7A 3IVKB 3C8DA 2VYRE 3LMJL 1CN4A 5D5MB 5CGYC 3MLSL 3MNWB 2DQUH 2OTWB 1MFCH 3EKCA 3STZA 4XVUD 2BOBA 3K3QA 4KVNH 2HH0H 3VFNB 4AH2B 4N8VB 1GGYA 4NKOB 3NIFF 5JR1H 4PRAB 5CSZA 2R56L 5J57B 1KJ2B 4HS8H 5EBLA 1S9YA 1D6EB 1CD1B 1Q0XL 3L3DB 5CJOL 1HNGA 4X6FB 2XQBH 1RULL 3GJFH 3TBWA 4XBGB 3CDCA 4OFYA 2ICES 5CJXC 2BXYA 3QBTB 1KB5B 4GSDH 2VQ1A 3D3VD 2AXGB 1WUNT 4DGIH 5HI5C 3HRZA 2NY3D 4WWKD 4AM0A 2JCCF 3ZE0F 3C6LD 3I9GH 3VXUD 1SY6H 3SBWA 2J7LA 1V7NL 2FEDC 3UZQA 3EYVA 1LILA 1H3WM 2QHRL 3HR5B 2UWEF 5TE7L 4H0HB 4P49A 4NRYA 1NBVH 2HVJB 1FNGA 5HYSG 2MMXA 43C9B 1J0KA 1F00I 4ZUUB 4FXKA 2OMNA 5ADOH 1MI5D 4ZDHB 1HZHL 4LPVA 4GRLD 4JY5L 1G84A 3T77B 5F9OH 3EFDL 2QR0A 1A7RH 5BW7C 4YDKH 5FM5M 1IVLA 2XTLA 1J8HE 1BX2B 4OZIB 3PDGA 1QA9A 4EZMA 4GLRH 2DD8H 1CG9B 4KRLB 1S7RB 3DVIA 4O9HL 3S36L 3MV8B 1NAMH 1JHLL 4AEIH 2D9QB 4ZXBC 2VLRB 2J8OA 4U1LA 2IALB 1R5VA 1I4FA 3SPVA 2VITB 1NL0H 3MJ9L 5FKPB 2Y06L 4U0RC 4YDJA 5D6DA 1FVEA 1JZ6A 3LD8C 4JN1H 1U3ZA 4K3EL 5CSBA 1SHMA 2PW2A 4PJAA 1WGOA 4P5KB 1QYGH 5JLZA 3QCVH 3W5NA 4YPGB 1MUJA 3L7EB 3MUGB 2OL3A 3HN3A 4OLYH 1CD8A 3ZKND 3BEVA 5EWIH 3UPRA 5E6ID 1QHPA 4HG4K 2LTQC 4TUOB 4JFEB 3S37L 4TUKH 4X7FC 4XI5D 5IBLD 5JNYB 3LHPH 2IF7A 4HBQA 3IKCB 2IQAA 2QEJA 3L3OA 2FZ3B 3MGOB 1LK3L 3QNXA 2ZOLA 1KCUH 5CS7A 4NBZB 2DS4A 4JO3H 1FAIL 2LAAA 4HJJH 4TTDC 3CX5J 1AI1L 3KPLB 5MHSD 2YEZA 3EO0B 1A3QA 1A4JA 4K9EC 4LLDB 4P2OC 3R1GL 5KVEH 4PG2C 1IC5H 2HKHH 4BK4A 4P59L 1YYLH 4P2QE 3MJ7B 4JDZB 3KYNA 1S5IH 1CGVA 4K3DL 4B53A 4NN5C 2DM4A 5IGXL 1JI1A 1DQML 4WNQB 3MLXL 4MJ6B 5J9PB 4K71B 4J8RA 3NA9H 1FYHB 1WICA 1XR9B 3WFHB 1JNNL 1G9MH 4Z7UA 2MSPA 1G9NH 4H26B 1DLHB 2W60A 1VDGA 1U3HB 1P84K 2V17L 1L9MA 2CKBH 1WBYA 1CVRA 2R0WH 2UYLB 4JZOA 3PHQB 4HWBL 4P4RB 2IADA 1PX3A 4L3AA 5FA4B 5GSVA 5DRXA 2CUIA 4UT7L 4UQ2A 4RGNC 3ARFD 4PB0H 1O7VA 2CJUH 3FTGA 4PRPB 1P4IH 4Z7WA 2EEBA 1GPOH 5C0DA 1DBAH 5C2BH 1TFHA 2P24B 3MBEB 3T8XB 4S1DD 4YO0A 2A74A 2IG2H 4MB3A 5BOPA 2OZ4A 1IAMA 5D93B 2LFGA 1ZVSB 5JW4Q 4PBWD 1JWMA 1H3GA 4FP8H 2FX7H 1R3JB 5IFJB 2H32H 3KPSE 3V5KA 2MJWA 3GIVA 1D6VL 2CR3A 3PNWA 4GW5B 2WAHA 5F7FA 1ZHNB 2HFEB 1V3JA 1HHGA 4LAQH 4XX1G 2EDLA 4CN4A 2IPKB 3MOBH 3VXRA 1CZ8H 4HULB 5H37H 3UTPE 4OM0H 3K0WA 3BKJL 3NH7H 3PGCA 4WUUD 4YAQB 4PJDF 5H37G 4PREA 1WAAE 3O4OB 5L0QB 5L7XL 1BQSA 4QHNB 1EHLL 2R0ZH 1RMFL 1D9KA 4G8EB 3O8XD 5DJ6B 1GIGL 1PLGH 3MRJA 4XPBL 4GG6A 4ZFOL 4EDXB 4LEXL 1FNLA 1KACB 4A6YH 3ILPB 2CR6A 3BN3B 1U2HA 1ZA6A 4KU1A 3MLUL 5HY9B 3TZVA 1LK2A 4D3CL 2JB6A 4PRBB 1FBIH 1GVIA 2VC2H 3HLAA 4R7DA 3VXSE 4MXWH 2AEIT 4QNPF 2DIJA 1DN2A 3WKMH 5I1GL 3VW3L 4QRUB 2XY1A 1XZ0B 4OGXL 2AS5M 1XAUA 4JRXE 3SE8L 2J6EL 4RRPG 1LWRA 3QO0A 4FQQA 4PJ9A 4OFVA 5IVXA 4XP4L 1MFDL 4Z5RA 1F4AA 1TVBB 4PV9B 4GKSB 3WFDH 5IQ9B 4Y16D 3WFBH 2YUWA 2X7LA 2R39A 2VWEE 2WUCL 5I8KH 4GQ9L 4BZ1H 5ACZA 4UI2A 2EDKA 1AH1A 5D8JL 1NLBH 2H1PL 2RJMA 1KF9B 3PHOB 2J8UF 2ZCLH 4Q7DA 1TJIH 4P5TB 3AROA 1NC4B 3CXDH 3HCVB 3LV3A 1BEYH 3OWEA 2BJML 3IJYB 4WEBH 4RMRA 1KB9J 3DJ9A 1X5GA 4EN3C 3BN9D 4MAYA 3V95A 3NCEB 1XF2B 2XZAH 1FO0L 4OZFA 4S10A 2BRRH 1IGIH 2OS7A 1OVZA 2C3VB 4R96B 4JHAH 4LQFL 5SWZD 2AV1A 3KWWB 3VFMA 3OGCB 3QI9A 1N0LA 4M6AA 1AC6A 1QACA 4Q0XH 3TH3T 4G9FD 4YX2L 4NQVB 3TF7C 3A6BL 1IILE 1PJ9A 3PWJA 1CLZL 3BQUC 2B7DT 1L0XA 1DVFD 5J12C 1S7TB 1G7QA 4RMVA 4JKPH 4G6JL 3OAYK 2H6PA 1INDL 4P5MA 2ATPA 1CGSL 4JB9H 4Z78A 4F3FA 3QDGD 1FZOA 1FVCA 1YMHA 3P0VL 4JPVL 3E6HA 1G0XA 3CSBA 3TVMD 5C0BA 4YHZL 4G80A 1FNSH 1NKRA 2DIBA 2LE9A 4PJCB 1FNFA 1GOHA 3PWPD 5C09E 1RZKL 3RGHA 5I18L 4LVHC 1OW0C 2GJZB 1UM4L 2X4PA 1SEQH 3H3BC 3AREA 3FONB 1UEYA 3HE6D 4FQ2H 3RP1A 4JY6B 5EUOB 2VZOA 4HCRA 3UTSE 4MWFB 1IAIH 3MODH 1WZ1H 1S7QA 6FABL 4H8WL 1IM9B 3F65A 4OGYH 4U1NA 5HHOA 1I8IB 2Q8AL 1ZLUH 1LDPH 4K3GA 2YPVL 4K7PX 3RKDC 1IC4L 1T3FB 4NKMB 4JCMA 4P48A 4W68A 3G6JE 2CLZA 3MLSH 5BMFL 5HI3D 3O2WL 1T1WB 4KROB 5C07A 2OX5A 5JDSA 4J2XA 5DJXA 1QRNA 1CFNA 4FNLL 4MLIA 4I9WE 3V6ZA 3BJ91 3S34L 4PLJD 1UH4A 1QR4A 3FB7A 2R56H 3QP3A 3PP3K 4LASL 3FHQA 4YGVA 4OQTA 4JPWL 4OFYD 4JJ5B 1B4JL 2YD2A 3MROA 3E8UL 3C8HA 3JWDL 5ESQB 1Q0XH 3CXHK 5D72L 5CJOH 1VPOL 1RULH 1LEGA 3F7VB 1KCLA 3HTLX 3IDYB 4WU5A 2DKSA 3NN8A 3WL9B 5K9KA 3HUJE 3FO1A 3VFUB 4DGYL 4X6BA 3RWIA 1JZ4A 1VGKB 2Q1EA 2Y4SA 1IMHC 2UV3A 1WBXB 1Q8MA 4XPAL 3BESR 1FJ1B 2GT9A 1V7NH 2DM7A 5EN2A 2OMBA 2QHRH 3IFOB 2APTA 4JREB 2A9NL 3U0PB 5TE7H 2K9UA 3EJJX 1RZJL 4XNXL 1GOGA 2ITCB 5EZLA 1A6UL 1QPPA 4DQOL 1HZHH 3TT1L 4Y2OA 4DZBB 4XBEL 1R5IA 3EFDH 2V5MA 1J0HA 1S7UA 2NXZB 1RJYB 2NCMA 2YXMA 4R2GB 4XCYA 4NUJB 2YUVA 2YA0A 2CKNA 3O41A 5TE4L 3SDDC 4ODSL 1PBYA 1KPVB 7FABL 2V5SA 4P2QA 4EI6A 4O9HH 3S36H 2WZPD 3QIUD 1JHLH 4PJIB 1RY7B 4KY1L 4PJFF 4QEGA 4FABL 2XG4A 3QUXB 5CUSL 5IB2B 3LZFL 2F8VA 1AGDA 3MJ9H 5C0CE 2Y06H 3MTRA 2DWDA 1KLUB 5HHME 3IDMB 3PF2A 5GGRB 4CGTA 4K3EH 1UZ8A 3NCMA 3EDFA 3LQZB 1QEWB 2ZOKA 4HW6A 2W91A 4KJQD 4IOIB 3ZT5A 1OARL 5M94B 3U83A 3EZJB 3DX7B 3DX6A 3GMPB 3S37H 3RWGA 3TO4B 5DJAA 2CLRB 3MLTB 4HUXA 1KC5L 4LU5L 1W0VA 3UXFA 4DFHA 1LK3H 2BERA 1HHHA 5GGRY 4NCC1 2H41A 4OZHF 4XVJL 5DD0L 2NY6D 1CVSC 5CFHA 1JV5A 1FAIH 4J7RA 1AI1H 5E8OA 3TCLB 1DQJA 2WWMC 2CDFB 3VFRB 2GCYB 3B5HA 2Z4QA 3TA3A 3SEPA 4WGVB 3R1GH 5KSAB 2AXFB 2FATL 4N0RA 2NY2C 4P59H 5F97E 2ATKB 4ORGB 2DQGL 3OX8A 4EQ2A 5AD0A 4LEOA 4F9PC 1N3NB 4ELKB 4KTEH 3HE7B 3PWVA 1XF4A 4K3DH 3H7BA 2EXWD 1SYVA 4Y89A 5IGXH 1DQMH 1XFPA 5ENWA 3MLXH 5C86A 4UNVA 3D39E 3CZFB 5T3ZE 2EKSA 3WFEL 1FZKA 1PYWA 1ND0B 3L9RA 1T5XA 5I16A 1JNNH 3C8KA 5GGUA 5ACMA 2Z31A 4NQSB 5KS9E 4U6HB 4Y1AB 2MOVA 3Q5TA 4QWWD 3LKNB 3WLWD 5DMKA 2V17H 5FXCH 1XGTA 1N26A 1WT5C 2X4SB 4HWBH 3CSPA 5DD5L 3TV3L 5JXEC 3VGFA 4NQTA 3MRLB 4M02A 4UT7H 1XGQB 4WFHD 1JBJA 3VXSA 3N1FC 2D31A 2XPGB 1MCDA 5IHZB 4LHUA 3K4DA 4HH8A 43CAA 3ARGB 3TIDB 1U8JB 1EX0A 1CXEA 1O5DT 4WI4A 5HYJB 3MX0A 5B39A 2MCG1 5HDBE 3GSRA 3LVEA 5ISZA 3SJVA 1AXSB 4JRXA 3OSKA 3SDAC 2UVFA 3KYKL 3ZKSD 4NFBA 5EC1A 3MV7E 5CIPA 2X4UA 1F11A 3FFCB 2C4XA 1KIRB 3GMLA 4URTB 3QT2A 1D6VH 1EJ6A 5FV1L 4FFZL 3FFDB 2NTFA 2QBWA 3VXRD 3TT3L 5D1XB 5IROC 3QG7L 1W2KT 1VB9A 4HDIB 1F4YL 3DGGB 4JM2F 3RWJA 4K55A 3VRLF 5FAAA 4K94L 4PY7B 5ANMB 1D9KD 1OAZL 3BKJH 1QFHA 1MCQA 3MR9B 1LQSR 4N8VA 4FQHB 5IBUG 5L7XH 3VXPB 1EHLH 3OKDB 4NKOA 3VXTB 1FHGA 3ARDA 3EDDA 8FABA 2QADC 3TZVD 1RMFH 2E3VA 4JFOA 2YD7A 4V1DE 3HZKB 3W11C 1GIGH 4XPBH 4JRWA 1TQBC 4LEXH 3RFZC 4OLUL 5DJCB 3EYSL 2WMPA 4R4BA 1RZ7L 5FGBC 4W81A 2KH2B 4IIQC 3MLUH 5DA4A 4D3CH 5CMAB 4CNIA 1D5MB 4HGKC 3SGDH 4EJ1C 4L9LC 2XTJC 4X6DE 2KKQA 1QP1A 1OAYL 4PJ9D 1S7XA 1JPTL 5I1GH 3GEWB 5IEKA 3VW3H 1V3MA 2YZ1A 3HZYB 2A6JA 4JDVB 4OGXH 3SE8H 4EDWL 2J6EH 4U1JB 3L3IB 5DJ8A 3W0WB 1B6DA 1BREA 2NZ9D 1H5BB 4LDEB 3JV6A 5CZVL 4UNTA 3JUZA 3L7FB 3DYPA 3EDEA 4XP4H 43C9A 3BGFB 1MFDH 1EMTL 5CZXD 3IRZA 3PWUB 3SGKC 5C09A 4GMSL 5CZKA 5KAQF 4E0RB 3BH8B 1GC1L 4LF3A 2WUCH 5DVNA 1DBML 3BXNB 2X09A 4GQ9H 3VE0A 1NGWB 4U6YB 5F1NA 4MAYD 5D8JH 4LCCA 2H1PH 5I1KL 5C0GB 4EKXA 1G0DA 2D7QA 3E3QC 3U30B 4P23C 1RZIA 2BJMH 5EBMA 4JO4L 4PG9A 4PGEA 1QUNA 1HKLL 5ABDE 5J56B 4ZNEE 3P4MA 1OP9A 3QI9D 1UXSB 2HTLC 2N4IA 1BBDL 4WUKL 1FO0H 3T0EC 3G6JA 5DMGC 2ITDB 5IM7A 1BBJB 4G8FA 2X1QA 4LQFH 2YC1B 4L5FL 5C92A 1JNHA 2HVKB 4HIHA 1OPGL 2V6HA 4HK3J 3ES6B 4KPHL 4YX2H 3DX9A 4JFXB 2Q86B 3A6BH 5FOBB 2G75B 5D7JC 1CLZH 3BZ4A 3LKRB 2ZP0T 5C0BD 4G6JH 4DVRL 2EDQA 1INDH 1E4XL 4C57C 5FA3B 1CGSH 3H9HB 1T0PB 4PB9L 3P0VH 3ARED 2V5TA 2FZ3A 3GSNB 5HHQB 2GTZA 1CDUA 4ZUTB 4YHZH 2Q8BL 4O2EB 5EOQL 2IJ0C 4LCYB 1CXFA 3NGBB 5KVMC 1RZKH 5I18H 1MCJA 5DHVA 3MRHA 2DQJL 1UM4H 4F15C 1HQ4B 5C0IB 4Y4HC 1NFIA 5HHOD 5I6XB 5BV7B 4U2ZA 5C0NC 5ESAB 2XICA 3B9VA 4L29A 4O4YL 5E9DB 4HIIB 1FNHA 2NLJA 5I19L 1CQYA 4KDVA 1RUKL 1ZLUK 4H8WH 6FABH 5C07D 4U1MB 5DJYB 4XC3L 5FO9B 4ORZC 1C5DA 2Q8AH 4BH7B 4GG8B 1ZT4B 2V7HB 2X70B 1S5HB 1VACA 2YPVH 3IAQA 2X4TB 1IC4H 5DQJB 4GW4B 3K4ZA 3UAJC 3UJTL 1QRND 1BJ1J 4HK0B 5LG1A 4OI9A 2W9DL 5BMFH 3GGWB 3O2WH 3B9KC 2ADIB 4MD0B 4WHYG 5A40E 4G6FB 5ICXB 3NIDF 1XF3A 3L6FB 1F3DJ 3EYFA 3ISWA 5FM4A 2WBJA 4UB0L 4FNLH 3HG1A 3S34H 3Q0HA 4BSVB 4BYHA 4N0FB 2X40A 1HOCA 1JGUL 1RD6A 3BD5A 5ERWA 4P4RA 2VDOL 2H9GA 3FQNA 2BY0A 4JPWH 4ZS6C 1B4JH 5F1IB 1FP5A 3E8UH 3JWDH 3P4OB 3TNMA 5D72H 1MREL 1P4LB 3QPXL 5IP4A 4NHUB 4HH9A 2BK8A 2C3XA 2PKDA 1RJLB 1OGAE 3V2AR 1J8HB 4LCUB 1AE6L 4DGYH 2P5EB 5KZCD 3L5WB 3OKLB 3EJZD 4XPAH 3TO2A 4NOFA 3MNVB 3BZFB 3BP5B 3VGEA 1UKTA 2HN7B 3I6KB 2L7UA 3GM8A 2A9NH 4JR9L 2EE9A 4J3UA 2F54E 1TVHB 3U1SH 1RZJH 4XNXH 2OBGA 3ARBA 1T83C 3Q6FA 3TBYA 1JF5A 1A6UH 4X7SL 4DQOH 1Z9LA 5HVHB 3KDMA 5CKGA 3TT1H 2HMID 1LHZA 4O5LH 4XBEH 1ORQB 3EYOB 4XCEB 2UZXB 2B39A 3BISA 3MCG1 4X5WB 3AAZB 1KCSL 3K2MC 4PJAF 4XTRC 2BSSB 4QHNA 2WWKO 1BP3B 1HI6A 3QUMA 2GSGB 1F45A 2AXJA 4HF5L 5TE4H 1UFUA 5EO9B 3DMMC 2DLHA 7FABH 4KI1A 5CD5C 5IK3A 3ZE2F 4KY1H 1S9VA 3RTQB 4L3EE 4FABH 2BMKA 1HYSD 4RISL 3LZFH 3HMXA 1ADQL 5FK9A 1UC6A 3CCHA 4PJ7A 2JLLA 2G9HA 1YEHL 2P7TB 1GH7A 1IGFL 2HLFD 4AQOA 1A1MB 4IS6A 5KS9A 1W72B 4MD5A 1WIOA 4LRIC 4NT6A 5C6TL 4H88L 1SBBA 1OARH 1FL3B 1S8DA 4N5EC 3O3BA 4HJ0C 1ITBB 4LK4A 4RFEB 5I1JL 1MIML 4WEUD 1KC5H 2BY3A 3ARUA 4LU5H 4WHDA 1E28A 4NQDA 3TA3D 1MFBL 1OGTB 2FBOJ 4XVJH 5DD0H 4M5ZH 1AD0B 1LD9B 4BH8A 5TDPB 3SN6N 5B8CB 4NBXB 3HI1B 4CVWA 1KJVB 2FEEL 1SM3L 5AZ2L 3O3DB 4QO1A 1AGEA 2FATH 1CR9L 5I71B 2A6IA 4YBHA 3R4DA 3UTPD 1T1XA 2DQGH 4IMLB 1U8OA 5C0AB 4WEMB 2DJ4A 4PJHE 3V5DB 3UTOA 1U8NA 1WWCA 4IOFC 4L4JA 5EU4B 2Z31D 4UDUA 4R96A 4KK9C 3TWCL 1ACZA 1U8QB 4XNUL 3X13A 4HV8A 3WFEH 5FGSA 1KPUA 5DR5L 1CFVL 2D7TL 4NWTL 3IT8D 2NXYB 1S7TA 1HH6A 3KPSB 1RJZB 4QHUA 3BPLC 2J88L 5D1ZB 5IMKA 1FLRL 3VXSD 3LEXA 4LHUD 3MO1B 4PJ8A 5AUMB 2CRMA 3ULUE 2ZUUA 4UV7L 5DD5H 3TV3H 3O11B 4UNUA 5ICZA 3L1OL 4K7PY 3MREA 4CMHB 4ZFGL 2PNDA 3SJVD 5ISZD 4JRXD 5IOPA 4JPIB 1TTUA 1NFDB 2ZUSA 4OF6A 4X8JA 5D1QB 1GZQB 3FONA 4QF1B 1RHFA 4LDLB 4EEEA 3NFPB 2ZSWA 2A2QT 3NFNA 4XNZC 3WD5L 3I3BA 4ZFFB 3KYKH 3KPPA 4Y4KC 4HBCL 1SJEA 5HGBB 4Y4FC 5JOFB 1KB5L 1UWEL 3IETA 4FFZH 3FQUA 3TT3H 4X6CE 4CVZB 4MVBC 1JHKL 3QG7H 3RX7A 1PD6A 3WO4C 2EO1A 2FYYA 3WNNA 2XFXA 3RWCA 1F4YH 1UENA 3BVNB 5DJ0A 4C55A 2I9LB 5DHYA 3QXAB 3L5HA 4E5XB 3DSFL 4K94H 2RFXB 1OAZH 3DV4B 1IEHA 4ODVL 1I3RA 5CHNB 4FFVC 2F74B 2OI9B 4Q9RL 3GSVB 3L5XL 1XEDA 2XA3A 2BHZA 4GS7C 1G7MB 2DLEA 5DD6A 4ZNEA 3IYLW 2Z9TA 5GQBA 4M61A 4OLUH 1RZ7H 1RHHB 1TPXB 2A0LD 4HC1L 3NPSB 1K4DB 5C1MB 3BWUC 3UYRL 1FQ9C 1BVKA 3TBSA 5BVPL 2YD9A 5D7IE 3MXWH 4MCZA 1Z5LA 2ORBL 1OAYH 1NEZG 1JPTH 4M6OL 2ZUVA 2VR5A 4NJAL 5GZOD 2VIRB 2HT4C 4PGJA 2DQCL 4EDWH 3FB5B 5FUCC 5C09D 2D3VA 3NVQA 1BQHG 3GJEA 1T89C 1WZLA 1YMME 1JK8B 2A1WL 3QDJA 4I13B 4R90L 4RFNC 3VFOA 1N64L 5CZVH 3SKMA 5GSRB 1FL5B 3QAZC 3HB3D 4I0PB 3HC4L 4EI5B 3DIFB 1EMTH 4XNQA 5TH2B 3QJHB 3BAEL 4GMSH 1GC1H 4TNWF 1DBMH 4OGAC 4DKFL 2CLVA 2OQJB 3ESUF 2PYEE 4GKZB 4FN0A 3BWAA 4P3WA 5EDXA 5TDNB 5I1KH 5E5RB 5TJWK 1EO8L 4ZUVB 4HKJA 4JO4H 4YXKL 3L3JA 4FG6C 2FO1A 5HHPB 3MV9A 1HKLH 5DZLA 1EFXA 5L6YL 3QJFB 4N0UA 4ZQKB 5JIHA 4JANB 1BBDH 4WUKH 3H0TA 4WFED 5JW3L 5EBWB 4I9WD 2XXMB 3MRCB 1KLUA 4L5FH 3AFLA 1OPGH 4JFED 5ESVB 4YDVB 2NY4B 3MLRL 3VFPB 2VDNL 4R4NC 4KPHH 3O3EB 1QEWA 2DJUA 3O81A 4WI7A 4C54A 4DVRH 2IH3A 1E4XH 5D2NC 3L3GB 3GMPA 2OXGA 2RR3A 2NY1C 1S7VB 4PB9H 4ETQB 4YK4C 1G6RB 1HXMA 4DJMA 4Y5VC 3CDGA 3H9SE 5EH1A 4HKXB 5EOQH 2Q8BH 2DL9A 1OGAA 1T7XA 3SCMA 4CMMA 5JO5A 2DQJH 1FORL 1G0YR 4P57A 2CDFA 1Q0YL 5CKAA 5I75C 3C60C 3ILQC 4I3RL 5L9DL 4O4YH 2VRAA 5I19H 3STBA 1KNOB 5K9JL 1RUKH 1R0AL 2GFBB 2F54A 2ZUTA 1CGTA 5I2IB 2X4RA 4XC3H 5T1KB 3BGMB 3S4SA 5ILTL 3VWJC 3V6OE 3VXME 3M8OL 1CL7L 5GJTL 4CU7A 3IJSA 2WBJD 3UJTH 4N0CC 1HQRB 2DQFB 4G8GA 3S3JA 2W9DH 3HUJB 3HG1D 3ZTJH 1U8HB 1T4KA 3PDOA 1N7ML 3ZTJG 5FM5O 3WNOA 1LNUB 4JVPA 3EIFA 1HN1A 2ZWLT 2R29L 4UB0H 5I76B 4OM1L 2DI8A 3OV6A 3QQ9D 4JAMB 1JGUH 3PL6C 4JHWL 4M4RA 5EC2A 3M17B 1MVUB 4FRWA 4L3EA 4CN1A 1G6VK 3DUSA 3CNKA 1MREH 1MJ8L 1CD0A 2EKJA 4KGLA 4M03A 3QPXH 4M7ZC 4O58L 1MEXL 4HUWA 4I2XE 3UBXI 5JHDA 3QIWC 1AE6H 1ED3A 1QSVA 3IKKA 1HHIA 1NUGA 3ARBD 3HMXL 2CRYA 1U0QA 4YPJA 2R4SL 4JR9H 2EYSA 4NRZB 4Z0BL 3TBVA 1MY7A 2M26A 1FVDB 5F9WC 5J3HC 5C0CB 5DI8B 1GXEA 4PJBE 1I85A 4XZUB 1ZGLP 4E41E 3RZCA 1MCEA 4X7SH 5HHMB 3THML 1ONQA 4OUOA 3KLSA 2VABB 2BVOB 5ANMA 3ZKXB 3LN9A 1AKJB 1D5BB 3BEWA 5SWQA 3LB6C 4N1EA 2G60L 1KCSH 3CFKA 1YPZB 3VXPA 5E03A 3OJ2C 2YKLL 5GRWA 4R7NA 4HF5H 5F9AC 4ZXBB 4LLMA 4LLUB 4GH7B 2UUDH 4WW1B 3GSOA 3RPIB 4LBEA 1UM5L 4J3SA 3QQ3B 1U8KA 2FEEI 3U4EB 3UBXG 1YEKL 4U0RB 2E9JA 4MNQE 3BP7A 4RISH 3FO9A 3LD8B 1TJHL 4JO1L 4D0DB 1D5MA 1L7TL 3RDTA 1ADQH 2VAAA 4UTAL 3VWKC 3GMRA 4UBDC 4WWID 1YEHH 3UDWC 3VI4E 4HEME 1IGFH 1BJMA 5J89A 3IXTA 1CCZA 1U8MB 2Z0BA 4JDVA 4PP1D 4M1GL 3R0NA 5C6TH 2LTQB 4H88H 2PXYC 3QUKA 4NQDD 1KB9K 1J88A 1BVZA 1T20B 3MCKA 1H15A 3T0BA 5EORL 5I1JH 2XNAB 1MIMH 3BI9X 1IC7L 2O5YL 2BZDA 1H3TA 4M9PA 2Q6WA 3RGVA 1KYOK 1NC4D 4PPTA 3D39B 4ZO9A 4QRPB 1MFBH 1RIUL 2YSSA 1VHPA 3EJYC 2Y23A 1LO2L 3FB8B 1FV1B 3QEUA 2VNCA 1NFDF 1WAAF 4P2OB 5J13C 1SM3H 1D5XA 5AZ2H 1ITCA 3SQOL 4APQA 5FHBL 2V2XA 3MLYL 4MDJA 4QOKA 5DEFB 1CR9H 4BUGA 3EZ8A 3PGDB 4X6CA 5KSUA 3ARPA 4NN5B 1ZGLB 1P9MA 3QUZC 4PGDA 4QRSA 3V7MA 2VXSH 4XHJD 1U9KA 3TWCH 1MHEB 1I7RB 2LU4A 4XNUH 5KG9B 5CIPH 3QUYA 4JZJA 3SKOB 4OCXL 3KLHC 4WJ5A 1M05A 1A9BA 5F9JB 4PJ8D 4GRWB 5DR5H 1CFVH 2D7TH 5HYSB 4NWTH 4EUPG 1AO7B 3H3PL 3MV7B 4FQJL 1X3DA 2SEBB 2A83A 2J88H 3GHEL 3FOLB 1A6WL 3H9HA 1KOAA 1YUHB 5FYJE 3VGBA 4F2MB 3KPRA 3KPQB 4RGNB 4UV7H 1MCSA 3UTTE 1F6AB 3L1OH 4ZFGH 3VRJB 1K5NA 1ZV5A 4HGWB 4LCYA 1LDSA 3A6OA 1FIGL 3Q3GB 4WV1A 3S5LB 2C1PB 1M6OB 1BJ1H 2OJZL 4KJWC 5D7IA 3PWNB 4ACPA 2FJGA 5EO0A 1OT1A 4GUPB 5IIEB 3P0GB 5T5FL 3LEVL 1F3DH 3PV6A 3DXAE 3EFFA 3WD5H 3ZDXE 3VH8A 3ULVF 1IGYB 4V1DB 2MQ0A 1NGXA 4HJGA 4D2NA 5BZWA 4HBCH 4F9LC 1L0QA 1CFBA 4XCNB 4R9HA 4HX1A 2MQ3A 2AABL 1KB5H 1ZT4A 4AEFA 3D18B 4I4WA 4QT5B 1OAXL 3P4NA 1JHKH 1A1OB 4LCWB 3O6FA 5IWLA 1BVLA 4RA0C 3EDJA 4G9DB 4X6DB 1U92B 3OKMA 2PYEA 1A6VL 4XRCA 3DSFH 5BJTA 2JTDA 4J3OC 4ODVH 4WENB 1JMZA 4Q9RH 4HMDA 3L5XH 4GRMB 2R23A 4N8CL 2CUMA 3X12B 5HPOA 1MCCA 2DLGA 4I3SL 4B7LA 5B4MD 4N90D 3P40A 5DURD 2I5YL 3GI9L 5F1IA 3LSOA 1X44A 4HC1H 1OTSC 4MS8D 4NHUA 2KUTA 1SBSL 1NPUA 4U1SA 4J4PA 3T65B 3UYRH 5HBBA 4F37F 3S96B 4KH2A 5BVPH 1H9VA 3QDJD 3NZ8B 2P5EA 1JHTA 3UPAA 1QBAA 2ORBH 2J5LC 3K80A 4M6OH 4NJAH 2VZ3A 3FT2B 4L3CB 5TGBA 4X7DC 4KUCF 1KBGL 3BUYA 2DQCH 5ID0A 4Z0XB 4KHXL 4RBPH 4Y2DA 1LMKA 1FNAA 4RA3A 3V6FB 3HAEG 2ILLA 3ROOA 4R90H 2A1WH 2XWTB 3FHAA 4X7EC 1JPST 4NDMA 1N64H 4IMKA 3S35X 2NXZD 3N50A 5GS1C 4MJ4A 2QL1A 4X9FA 3PJSA 3HC4H 4LMQE 3H9SA 1CK0L 4WY7L 1QTYT 3BAEH 4X4YB 2NY5C 4JQXA 3MOAL 2VISB 4YNYB 5L2JA 4DKFH 3W39A 3FQTB 3MV9D 1EFXD 5C0RL 5A2LH 2QQQA 4JFHE 4ZODA 1EO8H 3ORJA 5GS0L 5DTFB 4EN3B 2V5YA 4L8DB 4OSUL 1M7DA 4YXKH 3VXMA 3HZVA 2CMRL 4MA1C 3V6OA 1EO5A 4KJPD 1JGEA 1IE5A 3BT2L 1ZS8A 4QTIL 5SWSB 4P99A 4KWUA 5JW3H 2P5WA 5A43C 3F6LA 4G42A 3C09C 1TXKA 4KJYA 4OBSA 3SGJC 4PRHA 3HUJF 5I8EA 3MLRH 3BE1L 4OFDA 2VDNH 4C4KO 1N8ZA 3PGFL 25C8L 5J12B 3VXOA 5H94B 4YFLF 4V2BA 1QSEA 2P43B 3PQYB 4NNXA 4ZTPL 1NUFA 2A73B 5GS0D 5D9SB 2BOCB 1OGAD 3G04B 3SCMD 3Q5YA 1CFQB 4RFEA 1EHXA 1A7QL 2MHAA 4O51A 3QCUL 3WEXB 3RHWF 3QB7C 5GGTA 4KVCL 1LVEA 2MTPA 5E4EC 5EU7C 5BXFB 4LVHB 1FCCA 3QH3B 3M07A 1OY3B 4I2XA 5DF0A 3U4BL 1FORH 4ZYKB 2F54D 3LKQA 5T1MB 4HKZB 1A6TA 5EPMA 1Q0YH 2HRPL 2FSEB 4Z7VB 5JORB 4H1LB 2DKMA 4I3RH 5L9DH 2HJLA 2XZQL 5K9JH 3BRDA 5HDQL 4G8GD 4WHCA 2XOTA 1R0AH 1FFNB 4DWHA 5ILTH 3M8OH 1P2CB 1J11A 2K1MA 4GXUN 3G5YB 4PJBA 5GJTH 3RBSA 4P9HC 4LPYA 2NY3C 1RZFL 1RURL 1QFWL 2A9ML 3C6LC 3DVFA 3DO7B 1N7MH 4CU6A 3FN3A 3GBML 1J1PL 2FIRT 2X6MA 4L3ED 2EDNA 2AAVA 3DURB 3G08A 4P4KA 2R29H 5IW6A 4OM1H 2YK1L 5INCA 4CVXA 3NABL 1MRFL 3ARGD 4GRLC 4JHWH 3IDGB 4H25A 5JHDD 5D2LE 5A1AA 2XXCB 4D9QD 5JOPD 3SE3C 2CIIB 1LE9A 1MJ8H 3ZT7A 3TPUA 4O58H 2R1WB 4QF1A 1MEXH 4YXHL 4NZTL 3QIBA 3IDUA 3CFDB 5IMLB 4HWZA 3OKNA 3WKNA 4Z77A 1HH9A 3QEGL 2JJVA 5C9JA 2X4OA 1UH3A 2VLKB 3RZCD 1T66D 2IEPA 3V8OA 1CLOL 32C2B 4OJFL 2R4SH 4Z0BH 3LKOA 3EUUA 1YN6A 1QR1B 4U2YA 2EIEA 3TNNB 4OI8A 3THMH 2I9LA 3QXAA 1BZ7A 2IANE 1OTTC 4BM7A 4O2FA 4NO5B 3ZKNC 5E6IC 2ESVA 1MRCL 2I07B 4K71C 2G60H 5IBLC 3I02B 3SDDB 3C9NB 5KS9F 5CBEB 2YKLH 4LLVB 4YDLB 1AQKL 2GK0B 2F53E 1NCTA 3RDTD 5B21A 1MQKL 1ZT1B 4EVNB 1UM5H 3DVGB 2DIAA 4L4TE 5MERB 1J1XL 3WFCL 1YEKH 3MRKB 4Z9KB 3WUWG 4ODXB 3T4AB 3MRGA 2AK4B 1TJHH 1A6AA 4JO1H 1T0MA 1L7TH 1UVQA 2Y7QB 4PBXA 4UTAH 3W0WD 1J86A 3K8LA 3MRBA 2P8LB 1QFOA 3DLQR 1A22B 3SDCA 5HDBF 5SV3A 2I9TA 1QZ1A 4XMPL 1QBML 5IV2A 4M1GH 1NCUA 1NAKL 3KPTA 5D93C 3RGVD 4AT6B 4UDTA 3W9DA 1X5IA 2W07A 3MRIB 1FL5A 4JKLA 4PJHB 4UZGA 4X6EB 2NY7L 4I0PA 4EI5A 4O2CB 3OG6B 5EO1B 5EORH 4ERSL 3GIZH 3L3HA 2AJ3B 4MQSB 4AL8L 4OT1L 1IC7H 2O5YH 2OCFD 3NCFB 3QA3B 4APQD 4NQEE 1RIUH 5FECA 2YPLE 2G5BA 5DUML 3UCRA 4JRYE 4WHTA 1LO2H 4QOKD 4C56E 1XH3A 5TDNA 1XGYL 1IM3A 1DBJL 3MRRB 3DXAA 3GSNL 5KAQG 2EIZA 2V2WA 3QNZA 3TIEB 3SQOH 3ARFC 5FHBH 2NY2B 3DUUB 4PJXA 1RUQL 3MLYH 1JPGA 2C3WA 4ZOEA 2AW2A 2BDNL 4NO0A 1FL6B 3QUYD 5BV7L 2ZZUT 4NQCE 5DVKA 2C3GA 2P8PA 3FZUC 1LO4L 3RL1B 1S9WA 3IAPA 1E4WL 3F12B 1U95B 2EYRB 3ZDZE 4QTHA 4OV6F 3N85L 2E7CA 2Y5TA 4KKBC 1JZ3A 2O61B 4X6DF 2Q7YA 4QHKJ 4OCXH 3OAZH 5JZ7D 4JFPB 3WN5B 1TZGL 3KPRD 4HIEB 3P73A 1NGYA 4AEHL 4AG4L 3H3PH 3JV4B 3BGAA 4KK8D 4FQJH 1F58L 1ZHBB 3GHEH 3SDXA 1WBZB 4TN9A 3L3GA 1A6WH 5T1LA 5J11C 4YXLL 1MHCB 3OL2A 1MH5A 4X4ZA 2X4QA 2XACC 1JZ8A 1I1AA 4LIQL 1JF1A 3D0VA 3KVQA 5E9DD 3INUH 5IW1B 1CGYA 1FIGH 3MJ8A 1T1ZA 1P6FA 1BZQK 2OJZH 4JM2C 4PRDA 5GZND 4J23A 1FE8L 1R5WA 1Q94A 3O8XC 4F7TA 1T04B 3SDAB 4PJGB 4F7CB 1DEDA 1TMCB 3TFKD 5T5FH 4O02L 2C1OA 5IEHB 3DOSA 3LEVH 3AY4C 2XZCL 3O6FD 4N9GB 3OHXB 3T04D 4PJEE 2PYED 3MYZA 4QY8B 2AABH 4WI8A 1XGPB 3F8UB 3K81A 3O2DL 3ZYOA 4XP9L 1OAXH 1WFOA 4OFPA 1OQOA 3LRHA 1N4XL 2ZPKL 4ZUWA 3QHFL 4X80L 4XPHL 3RVWD 1BFOB 5A2IH 5ICYB 1A6VH 2WQRA 2IPTL 1HWGB 4ENED 3C6SB 1ULVA 2QADB 3B83A 4Y5XC 4F37K 4N8CH 1YMMB 4I3SH 3GMNA 4LOUD 1TQBB 4J4PD 4W6YB 4Y16C 5C8JB 4P0DA 2I5YH 3GI9H 3CH1B 2VO5A 3Q6GL 1B0GB 2P5ED 4IIQB 4POUB 4RMSA 2O26U 2DL2A 4L9LB 1SBSH 2XTJB 2WP3O 2PYFA 2R4RL 5LKNA 3QFJE 4FQCL 3UC0H 2JJTA 2OR9L 3T1FA 4ODWB 3BN9C 3NCBB 1LP9A 4LLYB 1I8MB 1U6AL 3JTTA 5CEZL 1KBGH 3H9SD 3IS1X 4KHXH 3U46B 1QKZL 1W8NA 3WS6C 2V9RA 3DVNA 4IEFB 4PBVC 3KYOA 1KG0A 1W72L 2HLAB 3DRQB 3F5WA 4UQ3B 1MWAB 2MFNA 1UM6L 2JK5B 1CK0H 4WY7H 4BSWA 4KDTA 4U1KB 1DVFC 2EDBA 1D5ZB 2FL5B 2W65A 3CC5A 4JFFB 3FCTB 1YN7B 3CPLA 5DSCB 5DVOA 5IW3A 4F7EA 3U7WL 2GI7A 2YBRB 5C0RH 5IJVB 4F7MA 5LGKA 4LSQL 4W6WB 4IRZL 4P23B 1P7HL 5CEZD 5C9KA 4YZFE 2P5WD 3TVMC 4LPUA 5GS0H 3ESVF 3LPGA 4OD1L 4RX4D 4OSUH 2CMRH 2BRQA 4PRHD 1U41A 1E6JL 2BFVL 3T0EB 3CDYA 3BT2H 2AK1L 4QTIH 5AG8A 3MLZL 4HFWB 1C7TA 1EEYB 4KI5D 4LKXB 3BD3A 1JUFB 3EO1A 1T0NB 3GHBL 3HA0A 5GS2D 1QSED 2I24N 3RHWK 3KNBB 1R3HB 4C83B 4JZNA 4HZLA 2OXHA 4Q9BA 3BE1H 3N1PC 5D7JB 5D7LA 3PGFH 25C8H 3X11A 5F6IB 3JZ7A 4OB5L 1JWUB 3DTXB 3B5TA 1UZ6E 2J3SA 4CU8A 4ZFZB 4NRXB 2NR6C 5HI3C 1RZGB 5D96B 5D2LA 1A7QH 3QCUH 5FGCE 5AAWA 4KVCH 1PQZA 1JWSB 5K93A 4OUUA 2JELL 5JHLL 3I6GB 4F15B 4Y4HB 1ZWIB 3RWDA 3SHSA 3U4BH 2Z91B 5C0AD 3B6SB 3FQXB 3D25A 4AIZB 1P7QB 3CFEA 4DEPC 2ADJA 3GJFA 4QHLB 1AGCB 2XKNA 4UIMA 2XZQH 5HDQH 4QRTB 2B4CL 5DJ2B 3SBWC 2OTUB 3W9EA 3WE6A 4OZGA 1NANH 1TZHB 4OTXH 3B9KB 4P4KD 1N6QL 2NXYD 1RZFH 1RURH 3FT4B 1KPRA 1SY6A 3QUXC 5DYOB 5IFAL 1QFWH 2A9MH 3QEQE 2EIDA 3G9VA 3BPCB 3P9WB 3DBXA 1J1PH 3GBMH 5E8DL 4CAGA 5K9OA 1U93B 5DS8A 1U8PA 2MWCA 1HSBB 1A7NL 2YK1H 1IGCL 1ES0A 3NABH 5T3XL 2GAZB 3BP6A 1FLTX 1MRFH 4WFFE 2X89A 3SKNA 4B41A 3QXTA 4L4TA 4TNVK 4HLZG 4Q58C 5CEXB 3QIBD 3D3VE 4YHPB 3VRJA 3U48A 2B8OT 2R69L 3L3KB 3CD4A 2ICCA 3PWNA 3U6RB 4YXHH 5D6DC 1NAMA 2HTKD 4I18B 4NZTH 3D0LA 5I8CA 2FBJL 3O45A 4UV4L 1H8NA 1IEAA 4M43L 2V2TB 2QKIB 3QEGH 5DDHA 3LDBC 3FRUB 5IHBA 2EZ0D 4OD3L 1VCAA 4XCNA 1NGZA 1CLOH 1MHHA 1YYML 1F4WL 4OJFH 5T3XD 4X7TB 1BFTA 3GDBA 1ZHKA 5KSAC 4MNQB 5ETUA 2VDKL 3OKOB 1HEZB 2ESVD 4PJHF 5LGJB 3ULVL 3K1DA 3QWOB 5IB4A 4L8SA 5TPWL 5D70L 5CWSA 4C56A 3ZTNL 5FO8A 1HHKB 5IHUL 4GAYB 2EECA 5HHNB 1MRCH 1NCNA 1FRGL 1JPSL 1S7WB 3O4LB 1F3RB 2IH1B 1CIDA 1BJ8A 3DMMB 4RAHA 3F58L 5H8DA 1AQKH 1QO3A 1JZ5A 2YOCA 2NY6C 3CSYA 3ULUF 1CDBA 2ZUWA 3SDCD 1J1XH 1NBYB 3WFCH 1LO5A 1TDQA 4Y88A 5E94A 2VXTL 2ZCHL 2B1HH 3NZHL 2CIKB 5B38B 5I1IL 4AIOA 3IFLL 4LVEA 1QBBA 4JGUA 4RNRB 4I0PD 4L3CA 4EI5D 5GS3A 4JFDE 1NUNB 4XMPH 1QBMH 2VLJE 4HIJA 5GRVL 5I66A 1NAKH 4DTGL 5DK0A 2KZ1B 4LL9A 4K2UL 4AENB 1PKQA 4L9DA 4K7FB 1FG2A 2NY7H 1J1OL 1U91B 4X6CF 3DX8A 4ERSH 5DRNB 4Z95L 4FFYL 3MUY1 4P2RB 3DXAD 2XWJA 4QRRA 4AL8H 4OT1H 3OPZL 2P46B 4QWWC 3WLWC 2CKBA 3RUGB 3P9MA 5DUMH 3OR7B 4NO0D 3QXWA 1G6RL 1XGYH 1DBJH 3ZDYE 4ELME 3GSNH 4QHMA 3TH4T 4UAOC 4TQEL 3BSZL 3D85A 4KHTL 4PJEA 3S7GA 4E42A 1RUQH 4BFEA 4OKVA 4YE4L 1H0DB 2BDNH 4MX7B 3U82B 5TF0A 5BV7H 4OQ1A 2EEDA 1LO4H 1E4WH 3H7LA 1AQDB 2APXA 4FTVE 3N85H 1ZANL 4C58B 2H32A 5D7IF 5T1LD 4PJ5A 1Y18A 3ZSTA 1IAIM 3LN5B 3BQUA 4D8PA 3ARZA 4I8DA 4N5UA 5BS0B 1ZK9A 3BPLB 5SV4A 1FYTA 2EDEA 1I1AD 4AG4H 2F5BL 4AEHH 3GMQA 1HINL 4LRNL 1F58H 1G7LB 1EA9C 4WI3A 4DGVL 2DMKA 2W38A 4Y19B 4YXLH 1A6PA 2VZ1A 4LGRB 1GZPB 3R0MA 3H9ZA 4LIQH 5L8KB 1ZA3B 2PW1B 3SY0B 5IR1A 5ALCL 4DKAA 3JWOC 4POZD 3QFJA 1CFSA 4LP5A 1FE8H 1XF5A 4ZYKA 1MFNA 4TUJB 5T1KD 4A6YA 3BO8A 3BW9A 4O02H 4Y4KB 4PS4H 5IMOA 5CP3H 2EDXA 5DMJB 2IPUK 2XZCH 4Y4FB 4MSWA 3SE4A 5I9QC 3NFSL 4MD4A 2V9QA 4JCLA 3WO4B 3O2DH 4WUUE 2M8XA 4PJ9C 4XP9H 2H8PB 2PTTA 2DWEB 3DO3A 4KXZI 1RZ8B 1KLGA 1N4XH 2ZPKH 4RRPA 3QHFH 3LKPB 4X80H 1C16B 4XPHH 2NZ9C 1TITA 1K4CB 4GMTL 1YEFL 3L95A 2IPTH 3WJLC 3PWLA 3BMWA 5EZJA 1B4RA 3BMVA 3HPLA 4KFZC 1DDHA 3KPMB 5CZXC 2EO9A 1BF8A 2DM2A 2GJ6B 2ADGB 2I60L 1F8TL 3LY6A 3Q6GH 1O7SA 1DQQB 5FDWB 3FN9A 4MAYC 2ED9A 3MACL 1BECA 1FFOA 1UB5B 2HFGL 5C70A 2R1YA 3VFTB 3G6AB 3RWFA 4L1HA 2R4RH 4TSBL 4FQCH 3EGSB 5EU5A 2OR9H 1QQDA 4G43B 1ROWA 1NEUA 3QI9C 2CO7B 1C12B 5DVMA 3UJJL 5ALBL 5I6XC 1U6AH 5CEZH 2VLKA 4F80A 1S9KC 3CZJA 4RFNB 3DGCR 1ZHLB 1QKZH 3QAZB 3FOMA 1EH9A 1W72H 1UM6H 3K8MA 1Z9SA 5GS2H 1QHOA 3UO1L 5I17A 3AS0A 1DUZB 1MJUL 4XHQA 5E8EA 4L8CB 5KANI 2J8HA 3U7WH 1AIFB 5C0FB 5HD8C 3SDDA 1KIQA 4N0YL 1NKOA 4LSQH 3AREC 1BD2B 1CU4L 5I8OL 4IRZH 3QFDA 4UINL 5JR1L 3HNSL 2CK0H 4OD1H 3VA6A 1YA5A 1ZT1A 5A16A 2NW3A 2OJEB 1E6JH 2BFVH 4K9EL 4QHKI 3C5JA 4MJ2A 2AK1H 3FQRB 4RCAA 2PUQT 3MLZH 4G9FE 3N0PB 4RMWA 4MQXC 3F62A 3RA7L 4G8IA 5D7LD 1FNEA 4DCQA 1Z0NA 2G2RB 2P8MA 3GHBH 3QEQA 4MXVE 5DRWB 4LKCA 3JXAA 2V9TA 3QDGE 4LNRB 4PRIB 2GTWB 2PN5A 3DRTA 1F4HA 1NBZA 4OB5H 1ZLVH 1MCRA 4CADB 1UJ3A 5D2NB 2NY1B 3PWPE 3Q2CA 2BHUA 1M1SA 2VE6A 4YK4B 1XCQB 3MV01 1OP5H 4Y5VB 5IVZB 2N7BA 5C0JA 5F7HA 2R2HA 5KANG 1QLRA 2E5EA 4PJBF 2P47B 4NYLA 1T5WB 3WIIL 1FC2D 3FT3A 2JELH 5JHLH 4I77L 2XWBB 5I75B 3C60B 1K8IB 4X9HA 4WW2A 2YUXA 1NMBL 4ZD3L 4NBYB 2VZSA 4P2YA 4Q6IA 5DEGB 5E00B 4RIRB 3IF1A 3VWJB 1KTLB 3G5ZB 2B4CH 5DRZA 1LEKB 3ZYIA 3TN0A 5INDA 4GKNA 1NEZB 4HIXL 2C7UA 3JWNC 3DROA 5EU6B 5IG7B 1N6QH 4MJIE 3RTQC 1X7QB 3EJZC 1G7IB 5IFAH 1BQHB 5EOTA 1RV6X 3IRPX 4BELD 3RY6A 3FO2B 3ZYJA 3VI4F 4CVUA 2X89D 1T21A 3MQIA 4FQIL 4NFDA 5GRZA 4L4TD 2AJUL 5E8DH 1V5JA 4HIEA 1NSNL 1BIIB 1U8IB 5T5NF 2R2EB 3QCVL 1WT5A 3OKKB 1IGCH 3PL6B 1WBZA 4LHUG 5T3XH 1AP2B 2UWEB 3ZLQC 3MRDB 5FUZL 1HIML 2ICWI 3B8SA 5B39G 1F3JB 4PTTA 3QULB 4M7ZB 1T2QL 1NCCL 4JPKL 2J4WL 5L2KB 2IANB 2R69H 3CVHA 2BC4B 3GMMA 3GMOB 5E8PB 3QIWB 4A2MA 2R2BA 3ECBA 4PD4K 2RHEA 4LSVL 1T04A 1GRWA 1NLDL 5F88A 5HJ3B 2FLRT 4PJGA 4WTWA 3U36A 3IU3A 4JFDA 2VLJA 2FBJH 4NOBA 4ODBD 5IEHA 2ZSVB 4UV4H 1NBQA 2QSCH 4M43H 3BYTA 3IDNB 3MRQA 3MJ9A 1HYSC 1KXQE 2P49B 4PRNA 5HI4D 2J1KA 3QDHA 2VB5A 1OL0A 4OD3H 1YYMH 1F4WH 1TQCC 4S2SA 5F9WB 2CXGA 2GHWB 4C56D 2VDKH 4LVNC 5C0EA 3ULVH 5DUBA 1IAKB 5TPWH 5JW5B 1OB1B 3D5OF 5D70H 5ICYA 2IMNA 3T09A 4ODUA 3ZTNH 5IHUH 4TVPL 1MJ7L 3S88L 3F7QA 1AR1D 1A1NB 1FRGH 3WIFA 4FXGA 1DEEB 1JPSH 1QLFB 2DJSA 2PO6B 3M1BB 3F58H 5IFHL 1BWMA 5D6CA 3TA3C 3VJ6B 1A4KA 1X5YA 2HT3C 5D1ZC 4BFBD 2VL5A 3QR2A 1AY1L 5LBSL 4FTVA 3VWKB 4NQEB 1G7PB 2VXTH 2YPLB 2ZCHH 4JRYB 3NZHH 5H35B 4EOWL 1XCTB 3U0WL 2EXYD 5GJSL 1KEML 5I1IH 4X4XB 5MENB 1MLBA 3EOBB 4TVPD 4ZSOA 3IFLH 3MFFB 3RIFF 3QDMB 2PXYB 4GXVL 3ZDXF 4N1CA 2Z31C 4QRRD 4PIRF 4DTGH 5JPMA 3REWA 4NQCB 3IAGC 2D9CA 2V7NB 4K2UH 1ZT7A 4MXQD 2Y9RT 1Q38A 4U1IB 3ETBF 1J1OH 4AY0A 1ERNA 4Z95H 4FFYH 5BZDA 2DQEL 3KPNA 2BNRA 1VFBB 3OPZH 3I3DA 4XPFL 3GSUB 3D85D 1DN0B 4IHOB 3VFSA 3QXUA 4YFLI 5J13B 3MA7A 1G6RH 3EOTL 3OKEB 1L6ZA 1CT8A 2IFFL 4WCYL 4YHIB 4M4PA 4Z7UE 4Y5YA 4NP4L 1I9IL 1KTDA 3BSZH 4TQEH 4KHTH 3VRIB 2W0FB 2B2XL 2IMMA 4YE4H 4JFYB 1J0ZA 5JMRA 5J1AB 1HHJB 1GGTA 2DQTL 5DXWA 4OCSL 5FF6A 4PJ5D 2AQ1A 4R3SA 5F7DB 3BQUD 3ZO0A 4LSDA 5EA0L 5TF1L 1ORSB 1OD9A 1FYTD 1KUMA 3BH9A 4NC1E 5BQ7B 1TPXC 1ZANH 5KW9L 4Z7WE 1MFEL 2VWEC 1F6LL 4LHJB 4I1NB 3V4UL 2AKRA 2JKXA 1R3KA 1IGTA 4X0KB 1FZJB 5DQDL 3DTXA 2QTEA 2F5BH 2IBBA 1HINH 5HPMB 2FJFB 4LRNH 2X4NB 4WFHE 1AXIB 3GSQB 3ARDC 4JKWA 3QFJD 5DJDB 4QYOB 4DGVH 3DETD 4QLRA 4XVTH 3IJHA 5I1AA 1EFQA 1NC2B 5L88L 1K2DB 2CRZA 3GSWA 2DICA 5ALCH 1EEZB 4HUVB 4FMKA 1J0YA 1RK1A 1C08A 3RKDD 4D0CB 4ZFOA 2NQCA 4RZCA 3U0TA 3VXRE 2YA1A 1TCMA 3UBXB 2EC8A 4HUUA 1F90L 4TULL 5GRXG 2A0LC 5HYQB 2FR4A 4X99A 3NFSH 4M8VA 3VXQB 1T1YB 2FIKB 5I1DB 3PABA 5SX4H 2BNQA 4HAFA 3OF6A 1XGUB 4GG6E 4XNMA 5F1OB 2EDRA 5GZOC 4P46A 4YWGL 3FT4A 3SO3B 1G7HA 1I7TA 5IMMB 2NMSA 4ZUSA 2H26B 4GMTH 3P3YA 1YEFH 3RVTD 3RVVD 4M5YL 2WLYA 3HB3C 3NA4A 4LCCC 4R0LB 2ZCKL 4XGZA 1VFUA 5EFIB 2I60H 3LPFA 4M93C 1F8TH 1CICA 1LEIA 3MNZB 5CEXA 1A6ZB 4LFHG 3MACH 5IVXE 5H2BA 1U8LB 5FO7B 5IB1B 1JPFA 2HFGH 2VLKD 8CGTA 2IC2A 1Y0LB 2YD6A 3BIAX 2FX9L 3U6RA 2WIIA 4TSBH 1Q9OB 1II4E 2CDEA 2J5LB 3BZEB 5F3HA 2X05A 1SEQL 3ALPA 2J8UB 2H2SD 1OF2A 1YY8B 4POYA 1P6AB 1G7JB 3D2UA 1FO0A 2PTUA 4X98B 5ALBH 3UJJH 3NIFE 1YDPA 1KGCD 4OZ4A 5CP7A 1CI5A 4FQXA 1LO3L 5F8RC 4YIQB 5HGHB 5GS1B 1IQDB 2JJSA 2EEAA 1A2YB 5DZNA 3VDCA 4KRMB 4L4VB 3SDDD 4ZPVA 1MRDL 4EUPB 4ETYA 1VADB 5ITFB 1DE4B 3S3SA 4XAKD 3ET9F 4U6XA 3UO1H 1MJUH 5LAXB 2W59A 3MV11 4QXTB 3KGRA 1HXYA 5MEPA 3HC0A 3FN0L 1YNTA 4N0YH 3AB0C 2R1XA 3MRMB 3DMMA 1CU4H 5DWUL 5I8OH 1MJJB 2JCCE 3GUTB 3ALWA 3DHJA 5HVFB 3E6FB 4MA1B 4UINH 3HNSH 2ARJB 3QEQD 4R97C 1BM3L 5FGCB 4K9EH 3C09B 4FFWD 3RA7H 1C5BL 2HJKB 2HG5B 4MJIA 2X42A 3OXRA 4DK3A 4DKDC 4S1QL 5LVEA 2Z93B 3V0VA 5GIRA 4OLEA 4PFEA 5C0BE 3UYOD 2VLLA 4WFFD 2OSLB 2IBGA 4PYHA 5FYKU 4GW1B 2NNAA 4LRIA 5MEOA 3WFZA 3LRSA 5EIIA 3RWEA 2WBJC 4Z76B 2ED7A 1VEMA 3VGAC 3RAJL 4C59B 5E7BA 1T22B 1SQ2N 3B3IA 3BIKA 3PE9A 1A3RL 5DJZB 4DK6A 5E4EB 2DMBA 2Z8SA 4GRWH 5HHOE 3DI3B 3UYPA 1U91A 3ZSSA 1U42A 2E27L 3OJDB 3WHXB 1KIPA 3WIIH 3P2TA 4GAGL 1KJMA 4I77H 2YMXL 5EULV 3AC0A 5C07E 2GSIA 4HXAL 5IB3B 4LGSB 3TN0D 3ZKXC 1NMBH 1IFHL 4ZD3H 4LSSL 1QRNE 5F70A 3ZKQD 3CVHL 4DZ8A 3S5LG 4UT9L 2NTSP 4F7PB 4PGCB 2E9IA 3D3VB 3DV6A 4H5SB 1MLCB 4ZAKA 2NY3B 4HIXH 1JRHI 3VFVB 3C6LB 4N68A 5TDOA 1MNUL 3VXUB 3MRFB 3PP4L 5KSBE 1INQA 1ZAGA 3HAEB 1RFDL 1OP3K 3QIUA 3E1F1 3QXVA 4FQIH 4NSKB 2AJUH 1AJ7L 4ONHA 3E2HC 1NSNH 4KQ4L 3HPJB 1KV3A 1MI5B 4NNYB 5K59E 4NC2B 1VKXA 4PTUB 4GRLB 3WNLA 1B0RB 2EH8L 2FO4B 5FUZH 1HIMH 1PEWA 4F8QA 2PR4L 1WCBA 4NQXB 3GB7B 3LS5L 1I3UA 1WZMA 3SDAD 3K8KA 4KRPD 4JFDD 2VLJD 1T2QH 1NCCH 3HC3L 4JPKH 2J4WH 1L7IH 4LDOB 2AJYL 2Q87A 1GYAA 1EEUA 1INEL 2WIMA 4MNGA 4YHLL 4LSVH 4WDIA 2CDGB 1NLDH 3JV5A 5C08A 5B3JE 3IXAA 2Q3AA 1ETZB 1YJDC 2X9YA 2ENSA 2HJFB 4D0BB 3QNYA 1NDMA 4OV5A 5DK2B 4QRQB 1J05B 1CFTA 3CUPA 4PJFB 2NX5A 1RIHL 3OR6B 4DVBA 2AEWA 1MAJA 3LAFA 2BVYA 4CBPA 3BKCL 4KTEL 2QADD 1AGBB 2ZNWA 3ZDZF 2UVEA 1ZMYA 2CK2A 3KHQA 1H3UA 1C16A 2Y72A 4M6ML 1S9XA 4JFQB 5E6IB 1R24B 1FFPA 3MRPA 1UQSB 4TVPH 1MJ7H 3S88H 3LKSB 1I1CA 2ARJQ 1MWAL 1EAPA 4JGJA 3UTQB 3KPMA 2YHGA 3KYMB 2DYPA 4FTVD 4RGOL 2XTJD 5AYUL 5IFHH 4BKLA 1PY4A 4U1GB 3KJ4B 4HG4J 2IPUG 2WNGA 3RIFK 4KK5C 1MCWW 4JM4L 4JE4B 4GT7A 2BSED 3RJQB 1N59B 1JN6B 3KLAB 4FOMA 2VN4A 3U7YL 1AY1H 3CFJB 5LBSH 1KULA 1EJOL 1AGFA 1WC7B 4LLWB 4OZHB 3RNQA 4EOWH 3U0WH 4WO4A 3MXVL 1KEMH 5GJSH 5GRVK 4ELMB 1GGCL 1E27B 3IDJB 1T89A 3OTTA 5DC4B 4GXVH 4XHJC 2BNRD 2NW2A 1KCKA 1YEDB 4PJEF 4MCYA 5I0DA 4IRJA 2KDGA 4M62L 2VDLL 3QXDB 3REVA 4WU7B 5BRZA 2DQEH 1RU9L 3FB6B 3K4AA 4PV8B 4ISVA 3T0DA 4PR5A 4XPFH 2A6DB 3V0AC 1BGXL 1M7IA 5SX5H 4YBQD 5FYKL 5DMGD 5HYFA 3EOTH 3ARFB 2EDDA 5EBGA 2IFFH 4IRSC 4WCYH 2YPKB 3WS3A 4NP4H 4NCDA 1I9IH 1I1FA 4L8BB 4PGBA 2B2XH 2VKWA 4JJHA 2DQTH 1XGRB 3FQRA 4RAVB 4OCSH 4YR6B 5B3NA 2Z92B 1REIA 4M8QA 1I1YB 5EA0H 5TF1H 4H1LG 4KAQL 1BLNA 5FDYA 1Q9LA 1Q9KA 3ABZA 5KW9H 1MFEH 2XN9E 4QGTA 3ELAT 2FECL 1EXUA 3KXFE 3V4UH 5E56A 4HMCA 3T2NH 4N9OB 5DQDH 1CQKA 4MYWB 3SJVE 5ISZE 3VFWB 5D2NA 4YDIL 5J11B 4EBQL 1JE6A 4Y4HD 1CXKA 3TBTB 4RMTA 1UB6A 2BCKB 1FZMB 4TVSa 4WUUB 4QXGL 2H3NB 3RNKB 1GGBL 2PCPB 3UTZB 2FD6L 5L88H 3LQMA 4JM2B 5J1TC 5D5ME 2YD1A 2Z35A 1RK0A 3O8XB 3TESA 5B4MC 1PFCA 1GGIL 3QG6B 3S4SG 5F8QC 5DMIL 2BNQD 3UAJD 5JPNB 3OF6D 1S3KL 4PY8I 3WUWB 1F90H 4TULH 2FWOB 2DTSA 5GRJL 1FGVL 1UKQA 4YZFF 4P46D 3BKML 5EZOL 3LH2L 3P77B 4MS8C 1D5IL 5IESL 5ID1B 2VQUA 4K8RC 4KUZL 2DMCA 3QCTL 2ZG3A 2HFFB 3MGTA 5E8NB 4FZ8L 3KPOA 1P1ZA 4YWGH 1CIUA 4HLJA 5BOZG 2FJHB 1SMAA 5EU3A 1QSFA 3VDBA 2BP3A 4U1HB 1H8OA 4ZS6D 1TNMA 1CICD 4Y5XB 2HWZL 4LLQB 2JCCA 4MA3B 4M5YH 3X14A 5C6WH 3AU1B 4Y16B 3VG9C 1UZ6F 1MVFA 2ZCKH 1V7ML 4X5XB 2C5DC 4JY4A 4KKAC 1I75A 3VD4A 4PP2A 1BOGA 1X5LA 2IGFL 5L2KA 3O0RL 3LQAC 4XT1C 3D2UD 1FDLL 4KDWA 3LRGA 1XIWA 2F58L 3V5HB 5FB8B 2BSTB 3CFBB 1U58A 3QIWA 1TZIA 2FX9H 2LAGB 4FQXD 5F89B 3R06A 2EYTA 1A02N 3MYJB 2YWYA 2VN7A 4KJPC 2I26N 1IKFL 1SYSB 4UOW1 4HS6A 4OZIE 3MRNB 2DRUA 5SWZB 5ADPL 1E4KC 1LO3H 1AHWA 1Y6NR 5DLML 4G9FB 4XTRD 4KKLC 3MV8E 1H3PL 4XH2B 4YHKL 4Z8FL 1IGJB 2VLRE 4MJ5A 1IAKA 1DVFB 3I6LD 1MRDH 1T6VN 3J7HA 3DMMD 3VCLB 1JYXA 5GGQL 5CD5D 1OTUD 3CK0L 4HHAB 4P3DB 2BNUB 4I48B 3QDGB 3O9WA 3SCMC 1I8KA 5E5MB 4NO2B 3FN0H 3VMOA 3TVMB 4JN2A 5MEQA 4WFEE 1KELL 1QVOA 5DWUH 1LE5A 4UOJA 4MJID 3PWPB 4LQ1A 2BVQA 5CD3A 5D7SL 3FQWB 5I1LA 3QO1B 3VJ6A 3GZKA 1ZSDB 1BM3H 3HE6B 1M71A 1KIUA 2BSRB 4XBPB 5LWYL 4JFEE 3WDHA 4AJ0A 2V5RA 3GJFK 4PGZA 4RQQA 1C5BH 5KSBA 1YEIL 4S1QH 3ARTA 3CMOL 5FYJL 2BVUA 2H45A 3BDXA 1IGML 3V8CA 1IL1A 5F7YC 3STZB 3DYMA 1RVFL 3CAFA 2BOBB 2UY7A 4W4OA 4DAGL 4WW2F 4LSRL 4NPYA 4JO2L 1ZEAL 5CSZB 3RAJH 3MMEA 1N5AA 1A3RH 5EBLB 4M6NL 1S9YB 5DC0A 4ZO7A 3BPNC 1ZVHA 3G5VA 4K3JL 2FHCA 3U1SL 5T33L 2E27H 4HQQL 1HSAA 3U2SA 4F33B 4XWGL 2QSTA 1MIEL 4GAGH 2XG5A 3TBWB 4IHOA 2YMXH 1W0WA 4O5LL 5IF0B 2VSCA 1VEPA 1IEBA 4DEPB 4HXAH 5BO1L 2VQ1B 3HRZB 4ZAKD 1T6WA 2DQDL 1PZ5B 1IFHH 4AM0B 3F7YA 3ME0A 4LSSH 1J0JA 4GXUM 1RUAL 3CVHH 2DLFL 3EYVB 5DD1L 3HG1E 4UT9H 4IOSD 1DBBL 3QUZA 4YDLC 3IFPA 2ADFL 4NRYB 2OLDA 1VENA 3O3AA 1EBAA 4GOSA 1FNGB 3CXHJ 3OQ3B 4NJ9L 1FPTH 1C5CL 3PIQA 1RIVH 4OKDA 4FXKB 1MNUH 3STLA 3PP4H 2DDQH 4PRPE 5CLTA 1UWXH 3RZCC 4IDLA 4WFGE 1BQLL 1RFDH 2BVPB 2QR0B 2IAMA 4NO3A 4YHOL 2D0HA 1AJ7H 4X0KA 4KQ4H 1QA9B 3BKYL 4JVWA 3BDBA 4F8TA 3QQ4A 2EH8H 4J1UA 1CDCA 2E9WA 2PR4H 4QCIB 3LS5H 1HILA 4CW1B 5C08D 4U1LB 3G5XA 1R5VB 3HC3H 1I4FB 3SPVB 3VH8G 5JW4M 3RKPA 2P1YA 3G9AB 2AJYH 1FVEB 3HS0A 2D03L 1Q9WA 1INEH 4PJDA 1FN4A 3RDTC 2ZG1A 4YHLH 4M5ZL 2PW2B 4PJAB 3LN4A 4GQPH 2NX5D 5JLZB 3LDBB 5IKCA 3ZDYF 4ELMF 1MUJB 2H2PC 2OL3B 3HZMB 1ADQA 5EUKA 3UPRB 5F7UA 4MDIA 2RGSA 1RIHH 3TYFA 3ULUC 5CBAA 3BKCH 4DOHB 1EVTC 4FHBD 2IQAB 1B3JA 3L3OB 4I5BA 3SO5A 3QNXB 3SQBA 2DYPD 2AI0L 4M6MH 3OB0H 2ZOLB 3RGVC 2VXVL 3AXLA 3TC9A 2BVTA 4PJ7E 3KR3L 3M45A 1MWAH 2HAZA 2YEZB 1A4JB 3WN5C 4ODTL 4RGOH 1TCRA 5AYUH 3CLFH 4APQC 2NY6B 1DR9A 4X5LA 4JM4H 3RL2A 2B1AL 4OAWA 1HWHB 2CD0A 3KYNB 3DYOA 4WO4D 3RQ3A 3X3FL 3U7YH 3EOAA 2ZUQC 3ARQ