5E5RB

Crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn3
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
192
structure length
187
Chain Sequence
KTRMRSTVSVREGQGVVLLCGPPELSYAWVFNEYPFVEEDSRRFVSQETGHLYIAKVEPSDVGNYTCVVTSTVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVRLECFALGNPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGKNVARGRLTYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Interactions Between Contactin Family Members and Protein-tyrosine Phosphatase Receptor Type G in Neural Tissues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
molecule keywords Receptor-type tyrosine-protein phosphatase gamma
total genus 39
structure length 187
sequence length 192
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5rB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e5rB02
1CLCA 2IPUG 4X9BA 4Z0BL 1GGUA 1ZT1A 4X98B 4ZOAA 3AMKA 4I3RL 3PHQB 5I16A 5J1AB 4RQQA 3WFEL 4LLAA 1H3PL 2W65B 3FQRB 3CLEL 5LQBH 3T65A 5BVPH 12E8H 3RWHB 3LKQB 1FNGA 3NA4A 3GJFB 2ZUXA 3MV7B 3SE8L 4FZ8H 3HZMA 5E5MB 4FFYL 2XN9B 5C0EB 1HXYB 4ZD3H 5BV7H 5D71H 4F57L 3HKFA 4Y4KC 4TUKH 5F6HJ 1FVCB 1Q9KB 1TZHB 3F58H 1QO3B 2ED7A 4KGJA 1R5IB 2DMBA 1C08B 4K9EC 4YK4B 2VSDA 5GSRB 4BQCA 1JRHI 5SWSE 3CGTA 5ALBL 5MEPA 3ZL4L 4NO5A 5FYKD 4NQDA 4GOSA 4IHOB 4PJDB 4QRPB 2NW2B 1LO2L 1A14H 3OKLA 1GPOL 4G8EA 4MD0B 4WO4B 3SDCB 2P8PA 2X70A 5KVDH 1S5IH 1FZJA 4X6DA 2AJYH 2HKFL 4TUJB 2X42A 3RDTA 5I17B 4QXGH 2FIRT 5FFLA 3ULSA 5ICXB 3QHTC 3VXMB 4PGZA 3KYKH 4PRDA 3CD4A 3RKPA 1WEJL 2O61A 5AEAA 2JB6A 4RSVA 1PDKA 2C3GA 3QXVA 3G6AB 4P23B 5F9WC 3SDAA 5JHDD 1AJ7L 5ESQA 2DM2A 4J1UA 1FO0H 1JNLL 2D31A 4WWKC 4LSTH 1HSAA 4JKLA 2FEEI 1FO0A 3WFHB 2VXQL 4JHZA 3T77A 5E8EA 5ACMA 1NH6A 5FEBA 1AR2A 1ZLVH 2X4UB 1MCRA 4PRAB 5CWSB 4JY5H 2HFFA 2ITDA 2CK2A 1J0HA 1AGDA 5BVJB 2ARJA 4Y5YC 1INQB 4DUVA 4HG4J 4WV1A 3L3IB 3HFMH 4DTGH 4TSBL 3KPRB 4LKCB 2E3VA 3QH3A 3F6LA 1U8OB 3MQIA 4Y4HD 4UB0H 1LVEA 5A1AA 4PJ5D 3RJQB 1WITA 5IHZB 3HZVB 4TUOB 4DZBB 3IFPA 4P4KC 5EORL 1GHFL 2ED8A 5KOMC 3OSKA 5HYSA 3ZL4H 4X8XA 3MRGB 3WE6A 4U6HA 1XGPA 2HLAA 3LQZA 4PJGB 3GI9L 3MLSL 1P4IL 4S1DD 4NO0B 3JUYA 4EDWL 4RIRB 2VLJE 3E6FA 3CC5B 5ISZB 1WT5C 1RVFH 1T22B 4KU1A 5TPWL 2CDGB 1C5BH 3SCMC 4U1GC 2D7NA 2XKSA 4TSCH 1SBBA 2W0FB 3AS2A 2C5DC 3RGVC 4XNQA 3O6ML 4O4YH 5GGTL 1WFTA 3ZTJH 4CVZB 1J05A 1TMCB 4Y16D 5K59E 1EXUA 3NCBB 3RKDC 3RY4A 2CGRL 4PJ8B 2NY3B 4U3HA 1R0AH 2XT1B 1KJMA 1OQOA 4GQ9L 4YQXL 2C4FU 3ARUA 3OAYK 3S37X 1T1WA 4LLVB 1NLBH 2MFNA 3GSVA 4ZXBC 4CVXB 5FOBB 1EBPA 2DD8L 1MQKH 5IEKA 3MFGB 3T3MF 4JLRB 1UZ8B 1CQKA 1R5WA 1R0AL 4JRXE 2CIIA 3RDTC 1MRDL 3T4YA 1JWSA 5KSVA 4YHNB 4PV9A 4S10A 1ND0A 2ADFH 1OP5H 5HHOB 4RGNB 3LD8B 2AQ1A 5CIPB 1T04A 2GQHA 3Q1SL 4D0BB 2L4OA 1YEHL 35C8L 4HC1H 2VDOL 3TBSA 2E7BA 3WJJC 2BSTB 3QUML 4GFTB 4HKZA 2PXYD 4HPOH 1XR9A 2EO9A 4M6OL 3V5HB 5E9DA 3CX5J 1C5CH 3T2OA 3U7WH 3C60C 1AP2B 2BRRH 4JO2L 3QIBB 1RZKH 2ZSWB 1CD9B 5GRUL 2P5WB 1DUZB 3Q48A 3I75B 5GS0L 2DQCL 3FB5A 1P7HL 4UNTA 3BGMA 1NUDA 4QXTA 1OF2B 2B1AH 5C08E 3LEVL 1ED3B 2FJFA 2ILLA 4WWKA 2CRIA 4BJLA 1LEIA 4L8SB 3VXTA 5FUOL 3U82B 4IS6B 3GMQB 2C3VA 3DGGA 1FYTA 1CLOL 3E1F1 1B0WA 1IGFL 3HTLX 5E56A 1ZLUH 4L4TD 1WIPA 4KTEH 5IB2A 1QTYT 2NY2C 3QG6B 1LNUA 4U1HA 4BQ8A 5ETUB 1MFBL 5CJOL 1L0QA 3LMJH 5EIQA 4JN1H 4PJFA 3MLTA 2OTUB 1XGQB 1U93B 3OGCA 4M7ZC 1TETH 3WHXA 3AU1A 4G3YH 3PIQA 2P24A 1A0QL 4X6CA 5J9PB 1RIVH 3MFFA 3HE6D 1VPOL 4WENB 5DA4A 2VERN 4KMTH 5KN5B 3GMLA 3QQ4B 4EN3B 4NHCH 3C5ZA 2EXYC 4BYHA 5J8OA 1CXLA 2HWZL 4PJ7B 3UAJC 1Q38A 3ILQD 1XAUA 5F7HA 3QWOA 3K80A 4KKCD 4K71B 1QR4A 1N2RA 1EHLH 5E2UH 1N7MH 4S0TD 1FSKC 2CUMA 2DI8A 3PJSA 1HDMA 5D5ME 4CNIA 4NO3A 1NFDB 4NHCL 1KV3A 4F80A 1FNLA 3HG1D 4N8VG 2Z93B 5EC1B 4WWKD 2P47B 1F90L 4G7VH 3TVMB 3LDBB 1IILE 4NM4L 4AMKL 4YBLC 4QNPF 1FFOB 3ALPA 4M6NH 2VDQH 4NZDA 4OGXL 2Z91A 4LARH 3OKDB 2G2RB 5JLZA 2C9AA 1RUMH 4ONHA 4YHYB 3O0RH 2UZIL 3T2NH 4Z76A 4Y88A 2CO6B 3DO7B 2ZUQC 5AZEL 4LU5H 1KIPB 4S1SL 3C5ZC 3S5LA 4HULB 1H5BA 1D9KB 5GIRA 2EDRA 4PJBE 4UILL 4JDZA 2QSCH 5JORA 1FZMB 3DURA 1DBKL 2KH2B 2VO5A 3GIVB 4JDVB 5JQ6H 4FZ8L 1A6VH 1UEYA 3BZ4B 5KTEH 3R0NA 5BS0D 2DL2A 2QSVA 1KGCD 4J6RH 2B0SL 1CLZL 5FYJL 2BNRE 1MCPH 4N90D 5J6GA 4EKXA 1KIQB 1KJVA 1J86A 1KXQE 2EC9T 3KLSA 4WGVB 3N1MC 5IESH 3BX7C 1UACL 1X5KA 1YDPB 4DEPB 1T20A 3PWNA 2OZ4A 3R8QA 5TFSL 3FO1B 3MODH 3W39B 5SX4I 1QSEE 4MA7L 2PW1B 3GSOB 1Q9LA 3MRRB 4Q9BA 4Y4FB 2Y23A 5CUSL 1AHWA 3O11A 4HUWA 4RX4D 4PGCA 4OCXL 4U1JA 2GI7A 2P46B 5DQ9B 5DUML 1IZJA 4N8CH 2P8LA 2Q8AL 2NLJA 3WS3A 4G7VL 3D3VA 3QDMA 3CFCL 4R9HA 4XNMB 1HWGB 2WUBL 3L7FA 2AJ3B 4LMQI 4BK5A 3VGGA 1JGVH 3MC0A 4FQJH 4GO6B 3ESVF 4YHLH 3WJLA 1KJ2L 3CX5K 4Y4HC 2QJDA 3FQNA 4KKNA 2GEEA 2D3VA 4G6MH 1NAKH 4X4YB 2E27L 3ALXA 5DHYA 3CSYB 1XF3B 1NCNA 2N7BA 3VFVB 4F9PA 5IB4B 2MOVA 3X13A 4TVPL 3EGSB 4HIIA 1A1MA 3U4BL 5I0DA 2EKJA 1DEEB 1YEEH 3NZHH 4ERSH 1X4YA 1MHEA 1MHCB 3VXOB 4O00A 4PV8A 1MIML 5FUCC 1YN7A 1PW3A 3GSNL 3H42H 4JY4A 3JV0A 2X2YA 4XP6H 1VESA 4NO5B 1CE6A 4ZO9A 1LD9B 3MJGX 4UIMB 4Z77A 5BZDA 3SGEI 3LKSB 1DQLL 4G5ZH 1R5VB 4JGMA 3L3HB 3VXUD 2X70B 1S9KC 5ILTH 4E0RB 4EI5C 1RU9L 1FL6B 1VFOA 4KJPC 4ODVL 1LEKB 5I1JH 3ARDB 4ISVA 1U8JB 1NC2A 2AI0L 2GAZB 4P57B 2A74B 3MUY1 3QYCA 1I3VA 1RULL 3SQOH 4JG0H 1TVBB 1OTTC 3QUYA 3CSBA 4OB5L 1WICA 2N7AA 2WSKA 4TSCL 2YSSA 1I9RH 4RRPG 5GGVL 5IFAL 3PHSA 3PL6A 3LQAC 3JWDH 4MYWB 1S7TA 4PJEB 2WBWB 4W4NA 4QRRA 3HR6A 3FB8B 3UCRA 4GG8A 1NSNL 4WUUD 3TZVB 4PTUA 4XC3H 1NGQH 3DVNB 1YPZA 2Q7YB 3MV8D 1ONQA 1CXIA 4P46B 1UVQA 1QEWB 3R1GH 1LE9A 4DAGL 1M1SA 3VI4E 1KB9K 5HDBE 4NC1C 1DL7L 4FNLH 1WBXA 2ATKA 4M61A 2F74B 3QRFM 5AZ2H 4PJXE 2I25N 4PJ7E 4OUUA 1AGFA 2DTML 2X4PB 4RA3A 2QEJA 5F21B 1F13A 5EZOH 4PS4H 2ADFL 5TE6L 4QCIA 4M9PA 1UB6B 3BYTA 4PJ8A 1KCLA 4TPRL 4F7EA 3TFKC 1LK2A 1JHTA 1FFPA 5FDWB 1QLFB 1UXSB 3RX5A 3K74B 3IXAB 4P5TC 2VTFA 1L9MA 4JPWL 2D7QA 3MRGA 3RVUD 1U8QA 4YUEL 9CGTA 3QNXA 5FGCE 3U83A 5I1HL 4GS7C 1NCWL 4GKSB 1FE8L 4KK8C 3KXFD 5EC2B 5D7SL 5ISZA 1TVDA 3KXFA 2D0GA 1M05A 1KENL 3D2UB 3OKYA 4E42B 3R06A 4R4BB 3VFUB 4GJTB 5SWSB 4I9WE 1RZJL 4HFUH 5EIVA 3M1BA 4XBPB 3RA7H 4MXQD 4QRSA 5DFWH 3MRIA 4XP1L 2OK0L 1WAAA 3QJHA 1XFPA 5I8EA 3MRKB 4DK3A 1JYVA 3GSXB 2EE9A 3LMJL 2VLRA 4L8SA 2V9QA 4WGWB 3S96A 3TPKA 5C6PB 5FKAA 4WV1B 4QRQA 5DMGC 4JFYA 3NAAL 3BT2H 2JJUA 2FX8L 4HIXL 5ALBH 3IT8D 1ZVHA 3KPSB 4XP1H 1T7ZA 4YGVA 4QHUB 5IGXH 2DYPA 1ND0B 2NXZB 1T66D 1LDSA 1D6EA 1A7NL 4H1LB 4K07A 3MJ6A 5TDNA 5IG7A 3L6FA 1SHMA 4G8FB 1VCAA 3JV6B 3RNQA 3V0VA 2D7TH 4OCYL 3PWJA 3ZHKA 1PX3A 3L3KB 4QRRD 4RGNE 4YPJA 4NNXA 3PL6D 4KDVA 4B7IA 4JCMA 4MNHB 4LCCC 4RGMB 3DX9B 2AJUL 1SM3H 5DK0B 1JZ6A 5DD0L 4Y4KA 3RWGB 1G7JB 6FABH 5GISH 4YHYC 1J18A 1CFNB 1MH5A 4RWHA 4OD1H 4XNQB 3RAJH 5I74C 2ARJB 4NM8L 4L3EA 5A2LH 1JGUH 4IRZL 5GJTH 2G75A 3MNZB 4AT6A 3V7AE 4AEIH 4HS3A 4UT7H 2QQNL 1IT9L 1U8KB 2XOTA 3HE7B 5FM4A 1NFDA 2GTWA 3FN0L 4OD2A 4KUZH 3OG6B 1DQDL 4KC3B 2EDEA 5HGHA 4TUOA 1PZUB 4KZEL 1AFVL 5ESAA 5FOBA 2XFXB 1O7SA 4AH2B 1RHHA 1IKNA 3ARBC 1JGUL 3OX8B 4P2QE 5HYSB 1ZHBA 2C26A 4PY7B 4TQEL 2X1QA 4KHTH 3HNTH 4OLXL 4ESKA 2AXGA 5M94B 3PGDA 3D85A 3GM8A 1JPFB 5FYKL 3QWQB 2K1MA 5I75C 4PGDB 2H8PA 1KNOA 1RIUH 1X5JA 1U58B 2JE8A 2FX7L 5D7LE 3VXUE 1WCBB 4XC1L 5B38B 1JUFA 1I1RA 3BWAB 1XIWD 1FGVL 4JDZB 1IL1A 1IGYB 1RUKL 3KPSD 3G6JE 1Q72L 4MA7H 4MJ2A 1FNSL 4P2QD 1BZ7A 1WIUA 1RUPL 1ZEAH 4Y89A 3BISA 3UTZB 4ONOA 1MY7A 4BH8B 4J8RB 4R2GC 2IFFH 4IRJC 3TVMD 1N0LA 4KXZI 4Z78A 1ERNA 5FYKE 5J6GB 4Q58C 3PWUA 3RWEB 2Z93A 4FQHB 3ZT6A 1CDGA 4Z9KB 5ID1B 5F9JA 2GSGA 4U1SB 5DJDB 5E8NA 2WWKO 5FYKU 4ZSOB 3B9EA 1CD1A 1LP9F 4NZRH 3P40A 2YZ1A 4N8CL 1B4JL 1MSPA 3D0VA 3OMZA 4HS6B 1FFOA 1MREH 5F9AC 2ZUTA 5DJYA 3V52H 3W0WD 3VG9C 1L7TL 3SDXA 3IB4A 3B2UC 5F7YC 4KROB 4OTXL 2ITCA 5JHLL 5HHOA 5F1NA 3U1SL 4AG4L 2G9HB 4HUWB 2ADGB 5ERWB 5F3HA 1Q94A 3OGCB 3S5LB 2Z92B 1D3CA 1Q0YL 5HDQH 4S1DC 4DTGL 1U41A 3S36X 4CJ0A 1OAUH 4NNYB 1ZXQA 5I1CL 2YPKB 5FYJU 4Y1AB 4KZEH 4IDJL 2DQGH 1G7HB 2VDKH 3FB6A 3B6SB 3WUWA 1JYWA 1N8ZB 1PJ9A 1YQ2A 5D7JB 3EYUH 3IDGB 1PYWB 3T0AA 5BZWA 3TBYB 1QKZH 4IOFD 4D9LL 3VFSB 3NFPB 4JFOA 4MAYC 2A6IB 2HG5A 4LCUA 3ARDD 1LEIB 1MCDA 2GK0A 5KVGH 3VWKA 3D0LA 1CDCA 2ERJC 4JPIB 3HI5H 3S4SA 3O6LH 1FZOB 1CG9A 3T0EE 1FL5B 4PG9A 3CVHB 4BUGA 1QHPA 3A6OA 4NKOA 3VXNA 2AK1H 2VE6B 1QRNE 4TSBH 2PTUA 1AD9B 3PDGA 1F45A 2YPVH 4KK5D 3WIIL 3D39E 3Q6GH 4N0YH 4GKNB 1YEIL 2F53D 1Z0MA 2C3HA 1MF2H 3BZDA 3QIWA 4H1LG 1I9IH 4WEMB 1OAQH 3ROOA 3SGEH 3RBGA 3CFEA 4HCRL 5EN2B 3MGAA 5DVOA 3WS3B 3HG1A 3NIDF 4UUJB 2PO6C 1RAMA 5CP7B 1PG7L 1MFBH 4P49A 1P7KA 5ITBL 1A3LL 1OP3H 1N5YL 5EBGA 1I8KB 1A3QA 4TOYH 5GRVL 1I9IL 1NSNH 2VWEE 1F3DH 2J88H 2A74A 3W0WB 1LO4L 1XF4A 3EYVB 3VJ6A 3FQNB 1WUNT 3ORJA 3HS0B 2YUWA 4L8DA 3DSFH 1G1CA 3F5WB 2VIRB 3OAYH 1S7XA 4LBEB 1YMMB 4YXKL 4CNIB 2FEEL 5KW9L 4ZG1A 4U6YA 4X99B 1NFIB 3NH7H 4FS0A 3H2WA 1F3RB 4ODBD 1MJ7L 3EO0B 5EUKA 5CFHA 3QEHA 1HQRB 4ONFL 1KCSH 4ONGL 2HLFD 1GGIH 5DEFA 4X9FA 4QTIH 1UM6H 3QXWA 4G42B 1D9KC 4XCYA 2ATKB 3VGBA 2VAAA 1NFDF 5CSZB 2Q76B 4E41D 3MREA 4H26A 2BCKA 1T7VA 3O2VL 4NQEA 2AKRA 1QRNB 1Z2KA 4QO1A 5CJ5A 3CSPA 4BZYA 4KKAC 2CLZB 3BH9A 1BJ1J 4JFPB 2XXMB 1KLUA 2YD4A 4YXHH 1IC1A 4AIXA 5E6ZA 1A3RL 2DBJA 2XA8L 4HK0A 4FTVE 5JHDB 4Y2DC 1R3IH 3AAZB 1B6UA 2F19H 2R8SL 2O26U 1M71B 3TVMC 5JPNA 2BRRL 3ES6B 4G8IB 2BVUA 5DHVH 2NXYB 4N0YL 1LK3L 4LSDA 3H9SA 4LIQH 5ANME 4MSWA 1CI5A 4TUKL 1KCRH 5TE4H 1CBVL 4F9LC 3VFOA 2X1WL 4G43B 3DX7A 3MRLA 4PJBA 1G9EA 3CVHH 2PXYA 4X4YA 5FM5O 1YPZB 4I13B 3BKJH 3W11C 2YD3A 4C57C 1ZT4B 4R97B 5K9KB 4K7PY 1HZHH 5I1EH 4ODHL 2NXYC 3KPRD 3MGOB 3U7YH 4MJ5A 1W0VB 1DBAH 5CLWA 4MLSA 3GSNB 2V2WA 3HUJB 4PJIB 2WMPA 4ZPVB 4XVUC 5L0QC 5HXMA 25C8L 2X4PA 3CFIC 1KB5L 4Y1AE 4U2ZA 3LEXA 5BRZA 5K9OB 4WW1B 1UB6A 2EYTB 3IU4H 1C1EH 5J12C 4HEPG 1MJUL 4MA8L 1N0XH 3P4OB 4S0SD 5E03A 4RAUB 4R26L 1EDQA 3GJFH 2DWEB 2FX7H 1T83A 3DX8A 3FCTB 2OX5A 1QFWM 4ZFFA 2IAMD 4Z6AT 4JO1L 4Z7WA 4R4ND 1KCSL 3BSZH 4ONGH 4MXVF 2DQJH 4YH6A 1XF5B 3DRTA 4WI4A 4MA8H 1PKQE 1FVDA 2J5LC 1WCQA 5JIPA 2YRZA 3K3QA 4G9FB 4HZAA 2P8MA 4Q9QH 4K23H 1AC0A 4FQXA 3GSUA 4PRPA 5FA4A 1A2YA 4LLYB 5I30H 1R6VA 1U8LB 4OGAD 2Y07H 3HI1A 2HT4C 2O5ZL 5EBLB 4JRYB 5C3LD 3OQ3B 3EGSA 2GW5A 5DC4B 3CUPB 4GG8B 4G6KL 3FL7A 4YWGH 1S9VB 2QSCL 3FQTB 2YD6A 5HDBF 2AGJH 3L7EA 4ELMB 1B88A 1MJ8L 4MZ3A 5SWSA 4JHAL 5IW1A 3SGDH 2F19L 4UT7L 1NANH 4XBGB 1F97A 5MEQB 2XZQH 1RK1A 2BNQD 1FNEB 3GSQB 3OB8A 3SKJH 5L9DL 4DN3L 5F8QC 2Y9RT 3QXUA 4GXVL 4M6ML 5FF6B 1ZHKA 2E6QA 5BO1H 3ZMRA 1A7PL 1I9JH 4S2SA 3G5XB 3LS4L 3JV4B 1LILA 4RGNC 1N64H 4P3WA 4BUHA 5TDPA 3CZJA 5HVFB 5DD5L 2ZNXA 4WHYH 3AC0A 4LLDA 2Q6WB 5LGJB 2QKIA 1U8JA 3QNYA 4YJZL 1ES0A 4KDWA 3BP5A 5KSBB 2BVPB 1KEGL 5IQ9B 3TJHC 3TN0C 1DE4B 4PUBL 1ZS8A 3D85D 1EX0A 4NPYA 4PJXA 2R39A 1IBGL 1UM4H 5IG7B 4P2CG 2ZUVA 4NQUA 4KXZH 4F7CA 8FABA 2J12B 3SDAD 4U1NB 1E27B 4I18A 3GIZH 2GJ6B 4LAQL 1JPST 4OLYH 4XBEL 1S5IL 4N0UA 4P46A 4I2XA 1MRCL 1OB1A 4JFXB 5GGUA 4C83B 5FUZH 1ZTXL 2MWCA 4QRTA 2YZ8A 1WK0A 4HEME 3D2UA 1YJDL 1F3JA 4KV5E 5CJ8A 2PYFB 2BSED 4OUUB 1E4KA 2P49B 3IJSB 2R9HC 3UTZA 2IG2H 4M00A 3IDNA 4K3EL 1AIFA 5CEXB 5L7XL 2HP4A 1PY4A 3MJ9L 4N0RA 2VABA 2Y07L 4JANA 3BKYH 3VWJC 2QHLA 4LHUG 5D1ZA 4F2MB 2KZWA 3EO1B 4ZO6A 4WW2A 3GSXA 3INUL 3ARDC 2O5XL 2GSGB 4Q74A 1T4KB 1UXSA 5I19H 4NQDD 2XYCA 3U9PH 3P0VH 3CFCH 3HC0A 4AH2A 1OAUL 2RCSL 3D0VB 1U8HA 2EKSA 3NA9H 5IVZA 3VFWA 1EEZB 2NY6B 4ZODA 4I1NB 1W72A 4BSWA 1G0YR 2J8UF 5GGSA 5CINH 1JPFA 1XIWB 3C08H 1YYML 2AV1B 2JLLA 2OQJB 4ELKB 3S6CA 1E4WH 1B2WH 3P11H 3EYUL 3ZE1F 3SBWC 1RJYB 2RFXA 1UWXK 3MA9L 4R2GB 3MRMB 4P59L 5TF1L 1FFRA 3A67H 1RHFA 2MCG1 1MHHB 4LLMA 3L3KA 1IE5A 5BJTB 4PJBF 4M7JH 4HWBH 3SBWA 2O93L 3O6LL 5FUOH 4U6VL 5I1HH 3THML 4J4PD 4QLRA 1OTTD 3FFCE 1QFWI 3RWGA 4LMQE 4GMTL 3S36H 2K7QA 3MO1B 2OL3A 4HDIA 4Z7VB 4MD5B 5TH2B 3OF6A 2J2ZA 2CDFB 3MNZA 5DJDA 1ZA6A 1BQLL 3QHZL 2FYYA 5F96H 4H1LH 3LSOA 3GMMA 4M8QA 1A3RH 4FNLL 1F4XL 4XP9H 1N5AB 1ZA3B 2BVEA 4F37F 1HHGB 2DAVA 4XVSL 3KWWA 4X7CC 4IOSD 1KTRL 5FKPB 4FXGB 4U1MA 2X4QA 4GAGL 1U3HC 2AAVA 3VE0B 1WZ1L 4AQOA 4NQSB 4P2RE 1IGML 4GQ9H 3FMGH 3MOQA 4JPVH 2XKNA 4K94C 3L3JA 1A9BA 5FDYA 2Q87A 1NFDE 2R4RH 1OW0A 2R0LL 4ZNEA 1A22B 3MJ9A 4WFED 5DRXB 4KKBD 1FGNH 3GMOB 4PJ8D 2UWEB 1HOCB 5TE7H 2DQIH 5D2NE 1K8IA 4M7KH 4TNWK 3SE9H 1OW0C 4IRSA 3NFPA 4JFOB 3BPNC 5CZXC 3C60A 4AIOA 4RZCB 1KB5H 2FH6A 4HD9A 4P2OC 4OI9A 5FGBC 1REIA 2ADJA 3QXAA 3ARPA 4QTIL 3VW3H 4RQQB 4NP4L 5LXGH 1AKJD 5BOZG 3HMWL 3PWLB 3C5JA 1UEMA 1J0ZA 3SJVB 4MNQD 3H9HA 5GISL 2V5SA 4YDJB 4GW5B 3PABA 2DQUH 2DLFH 4XPFL 5TJWK 3R4DA 1SJXA 3S3PA 2NY7L 3I6GA 2ZUQB 2EDJA 1Q9OB 2X4OB 4NUJA 4AEIL 3WXVL 4HWBA 2JK5B 4GLRH 4I4WA 1BQHB 4LNRA 4GUPB 3NBNA 5FCUH 1I8MA 2GT9B 4XAKD 4JFDE 3BQUA 2G9HA 1QLRA 5CKAA 2ATPB 3CFKA 1LK3H 4XB7A 5GGRA 5F89B 1NC2D 4GS7B 1L4IA 4WI8A 2QR0B 4LFHD 1MFDH 3CVHL 1K8DB 2Z8SA 4LCIL 2XWJA 4LCWD 1HH6A 1YY8B 4WJ5A 3WS6C 4OT1L 2HLFC 3K4DA 1V7MH 2V5RA 3KYNB 3HS0A 4YZFE 3MODL 2NW3B 2WQRA 3CSGA 3D1MC 4LHUA 1BX2A 4NQCB 5DGQA 2EH8L 5DD3L 1UZ6E 4Y5VA 2YBRB 1K2DA 3S7GA 3ARXA 4XZUB 3TV3H 1KYOJ 2UUDH 3VWKB 4YHZH 4HXAH 5E8DH 3MGTA 5DFTA 5IWLA 2PR4H 1CG9B 4KVNL 3VXSD 3QXDB 2DLHA 2WP3O 1H3XA 2NY3D 2ZZUT 2NCMA 3QIUD 5DEZA 5IF0A 3WFBL 5IB1B 4I0PC 1T0MA 1WWAX 3RX7A 3SDYH 3QQNA 4H26B 5EA0H 1DFBH 1XR8B 4OUOA 1DZBA 5D1XC 3O81A 2V2TB 4H88L 1UH3A 4HH8A 4MA3A 4XXCC 1S9YA 3OWEA 3G9VA 4BFEA 2BNQA 3BRGC 3OKLB 1EVTC 2HJLB 5K59F 4R7DA 3EJYD 3FKUS 1E6OH 2HT3D 3TO4B 3FO2B 5EUOB 2DICA 4OZFA 4UUJA 3SEPA 3V7MA 5FO9B 4P4KA 1JZ8A 4XCNB 1XMWA 3G6DH 5L2JA 4YPGB 4G6JL 5EB9A 2Q86A 5AWNH 2DDQL 4XVUD 1T2QL 2HJFA 4XWGH 1CGSL 4RX4A 5DJAB 5FO8A 2P4AB 3RIFK 1TTGA 5IWLC 4N90E 1A1OA 4PRPD 5IK3A 2RB8A 5DMIH 3ZKND 4GXVH 4YHKH 1KPVB 4K3JH 1KFAH 5AZEH 4LBEA 2YRPA 5AYUH 2F8VA 3G5ZB 2IBGA 3CVHA 5A3IC 5DWUH 4OQTA 5T1LB 4P23A 4TTDC 3CUPA 4PJGA 3QUXD 5BW7C 3D25A 3HUJA 3SDAB 4ELMA 2XWBB 4POZC 5ILTL 5IOPA 5LKNA 3MRHA 1EO7A 2X4TA 3HI5L 3QFJA 4BKLB 2IGFL 1O5DT 4RMTA 3GHEH 2IANE 3EUUA 4I5BA 3KLHD 2BCKB 5F9OL 5KSAD 4PRAA 5CWSA 3G5XA 4CVZA 2APBA 4E41E 5DYOA 1HKFA 3VMOA 1FZJB 4FTVB 5JHDE 5IQ7L 1INQA 4RMRA 1OT2A 3KPRA 1OCWL 1S7WB 1T1WB 1TJIH 2LABA 3IFOA 3I84A 1UB5A 2FH8A 3TN0B 1H3VA 3NCFB 1KG0A 5MEOB 4AG4H 3GSUB 1NEZG 4K8RL 3QFDA 1YMMA 2DJSA 5IT2H 1EHNA 5DK2A 2AK4E 4JN2A 2MTPA 3T4YB 5MHSD 3ILPB 4JG0L 1BFSA 4GRWF 3JWOL 3KAAA 1FLTX 3STLA 3UPRA 5C2BH 4PLKC 1OB1B 3P30H 1BD2D 1TTFA 4X6FA 2H32A 1K5NB 4MJ5B 5CZKA 1FPTH 5IMOB 4LKXA 2CLRA 5E4IA 1DLHB 3GMPA 1FBIH 1MCOH 3IJSA 3MACL 2BY1A 3LN4A 3SOBL 3JWOH 3DUHA 5C8JB 4XCEA 1TVHA 4XTRD 2R69L 1EXUB 3ECBB 2DQTH 3BKMH 3OKOB 3OJDB 5D1QD 1CGWA 5EFIB 2IMMA 3Q1SH 4PG2A 5LWYL 4XXDA 3QZWA 3BP5B 5AZ2L 1IGTA 2VLRE 2XQYG 4WW2B 2B1HH 3AAZA 2ZCHL 3U7AA 2H3NB 2Z0BA 3ARGA 3GSVB 2VDOH 1UCBH 3RZCA 4IS6A 3MUGB 4MQXD 4P9MH 2FLRT 2BHZA 5J7CC 1DVFB 5EU6D 3AGVA 4U6HB 2F58L 4YHNA 1DQJB 1FG2B 1DR9A 3PV6B 4QHLB 5FV2A 5GHWL 3GHBH 5C09E 1YZZA 4KJQD 2C1OB 4IIQC 1EFXA 5FB8B 5BS0B 3LY6A 5CIPA 1GL4B 2XN9A 3LRSB 1AE6H 4JQVA 5C0EA 1BP3B 1URLA 3MCLL 2BSTA 1JTOA 1VACA 4IJ3C 3S8WA 1U91B 2FBOJ 1UA6H 3MV7D 3SQOL 3O9WA 3OHXB 4P23C 3DHJA 1CLYH 2IH1A 1OWRM 2YWYA 4M5YL 2RHEA 4R0LB 2FBJH 1UJ3C 4XI5C 1NLBL 3GDBA 1UWGL 4Q97A 3FAXA 3C5ZB 1TPXB 5FCSH 2F53A 5SX4H 4RFEB 3D3VE 1E4XH 1Z9LA 2P8PB 3QWOB 1QPXA 1SEBA 2HFFB 1RIHH 2VXTL 3S3SA 1KJ2A 2OSLB 1T66C 1JRHL 5INCA 4KMQA 4LCYA 4L8CB 1WZ1H 1S3KH 3CMGA 3FOLB 5E9DD 5A2JH 2Q6WA 3HC0B 3P30L 5LGKA 1A7BA 1NMAH 4OV6F 3MZTA 3TT1H 1JHKH 1XCTB 2MPAH 5CD3A 3P77A 4ZUWB 1VEMA 1GJIA 3IKKA 4TSAH 3I9GL 5HI4C 2UWEE 1DE4A 1EGJA 4Y2DA 5JUEH 3BT2L 1U93A 1NQBA 2J8UE 2VR5A 2WIIB 5C07B 4JRYA 5E2UL 1XR9B 1E27A 1EV2E 4JDTH 5I1DB 4NN6C 1KGCE 1AP2A 3UJJL 5I6XC 1RI8A 4XBGA 4ZAKD 4LSPH 2P1YA 5JA8B 2Y72A 2V7NA 2X4RB 4WHCA 3PWPE 5GIRB 3T3PF 2UUDK 1OF2A 4DGYL 1K8IB 1FHGA 2WW8A 4HMDA 1GZPB 1BZQK 4LSVL 1C12A 3BH8B 3AM8A 3FT4A 2B2XL 4KTEL 5JW5A 3MLYH 1A6WL 1WFOA 5H37G 3MLUH 4PLNC 4FHBD 3GUTA 3W11D 5D2NC 1DLFH 1X5LA 2HTLD 3MLRL 1HQ4B 3IFPB 4LDEB 4OT1H 4KGLA 4P2OB 5HHQA 4ZMAT 2VLME 4D0CB 3W39A 3G04A 2GSIA 1G6RB 1AO7B 3MLZH 2E6PA 1XGTA 2VLJD 1IGJA 3Q5OA 4Z7VF 4RBPH 4JFEE 1GPOH 2YD7A 3IYLW 2LU4A 2JCCB 2VKXA 3F7PC 4Q9RH 2X1XR 2BSRB 1EEYA 3EOYG 4HGWB 2K7PA 4OZ4B 2ENYA 4K7PH 2AJYL 4JREB 4ZFOB 5E4EB 3DV6B 3V5HA 2IBZX 3GMLB 5E99H 1FVEA 3MRMA 4P3DA 2YD9A 3C09C 4PRID 1DSFL 3FRUA 1UXWB 1IQWH 1T2JA 4XHJD 3VXSA 3S5LG 5IBLD 5C9JB 1U42A 1U6AH 4F7MA 3RP1A 3NFSH 3HC4L 3MJ7B 1CDUA 3UZQA 5DR5L 32C2B 4YHIA 1KJVB 1KIQA 3HC3H 1NGWA 4YHPA 5HHME 1FIEA 4OGXH 4G6KH 4UZGA 4KDTC 5EU7C 4AJ0A 3TP4A 3U48A 2IQAA 1MFCH 1XF3A 4JLRA 3DVGB 4HGMA 3GMMB 4M8QB 1Q9OA 2AEWA 4JVUA 1LP9B 2HVJB 3IDMA 3QPXL 5LBSL 4DKEH 2NX5B 4A6YH 5FA3B 3FAWA 5CZVH 3WN5B 1ZA3A 3H0TA 4R6UA 1YY9C 3DRQA 4M1DL 4ELKA 1OTSD 2XZCH 3GGWB 1OP3K 4C4KO 1WSST 1G6RL 3WHXB 1D5MA 3V6BR 2QR0A 1KPUB 3GMNB 5D72L 2P8LB 4NO0D 4M1CD 3QPXH 5LBSH 2BNQB 3VGDA 1MCFA 5JORB 1FZMA 3L3JB 1MRDH 3DUUA 1MFAL 1WT5A 4P5TA 3ZDZF 3E6HA 4C58B 5L8LB 3O2DL 1P6AB 1V3LA 4U1GB 5ADOL 3MROB 4MCZA 2NR6D 5CZXD 4KZDL 1FBIL 3CH1B 3MRNB 2NY6C 4OLXH 1AKJA 4ERSL 2P5EA 2A73A 1NMBH 4K7PX 1RJLA 5DK3A 3NMEA 4X7FC 1A7RL 2UY6A 3MGTB 3ZSTA 3U4EB 1JWUB 3X11A 5F9OH 4FP8L 1A6UL 4L29A 1HDMB 1T0PB 3THMH 5D1XD 2C1PB 5IB4A 3RU8H 1JZ5A 1MCEA 4LLQB 4V1DE 1GOGA 1Q9LB 1LO5B 4NT6A 2W07A 3BYYA 3C2AL 5IB1A 5HHOE 1QRKA 4D2NA 5D2NA 5F72S 5CGMA 4PV8B 1A4KB 5I1LB 4FQCL 1E4KC 2R2BA 1DANU 2C7UB 3MLTB 1JFQL 2D7PA 2QQKL 4KRLB 3U4AA 3ZE2F 1S9YB 1HHKA 3NZ8B 1FH5L 3PIQB 1MLCB 4OCNC 1JGLH 3RWCA 4OCWH 5KSBF 3MRCA 4MJIB 3MNWA 3O4LB 4JE4B 4JRWA 3RWFB 1MWAA 5EH1A 1K6QH 3HHRB 2AEIT 2Q86B 3U9PL 1LEKA 1MRCH 1MI5A 4HBCL 5IROC 5BS0E 5HDLA 3QA3A 5FM5M 1X4ZA 4NJ9L 4YDKL 1MIEL 2FEDD 3IFOB 4FQLL 1D5IL 4FQ2H 1GXEA 2WWKT 4EI6A 5ITBH 1B2WL 1QACA 1TXKA 3DXAE 5DK2B 4ODTH 3MJ9H 1K2DB 4J3OC 4I77L 3C8KB 3Q2CA 4FABH 3GO1L 2VL5B 3B83A 5GGTA 3WLBB 4J4PA 4BFIA 2IALB 2XZZA 1IARB 4OZGF 2OCFD 5I0ZA 2SEBB 3QXDA 1YN7B 1LE9B 5I19L 1QR1B 3G08A 1K5NA 2G2RA 2MHAA 1G9NL 1PVHA 2VDNH 2ICCA 5C0ND 2HT3C 2Z35A 4Y16B 1NMBL 2DM7A 4PJDF 4UAOB 5ICYA 5GRZA 5DJ2B 3WV0A 2X05A 1A6UH 4FXKA 1FE8H 3QWRA 3SDDA 2BVQA 2XWJB 4OB5H 2XV6B 1AY1H 2P5ED 4JM2D 3V6OC 1S9WA 1SJHA 3GIVA 1KC5L 3UYOD 4UNUA 3JWDL 3IDJB 3LKRB 4UV7L 5T3XH 1Q0XL 4WUUA 4EDWH 3MRPB 3RX8A 4ZS6C 3BZFA 5DJAA 4R3SA 2W0LA 5F93C 4BA8A 4QF1A 1I1YA 1T20B 3PWNB 1D6EB 1K6QL 4X8JA 4XMLL 1E4XL 4MX7A 5DHYB 1T3FA 2FHBA 3TO2B 3HPLB 5EC2A 1P1ZB 1EAJA 5D7IB 4XNUH 1T6VN 3DX6B 4N9GA 1FGNL 4M6AA 5CBEB 3D2UD 4QT5A 1B9ZA 2JIXA 3CXDL 5J12B 5DHVA 2YXMA 3WIHH 2E7LA 1OHQA 3TBVB 4OFVA 1MCSA 5I8CB 4Z5RA 2XTLA 3QISA 3EYOB 5EULV 4X6EB 1H9VA 1EA9C 4XP4H 3KPNA 1PEWA 3G6JF 4YHMH 3RUGB 3GJEA 4L8BB 4XPGH 1AD0B 3FO2A 3BAEL 4UTBL 4OF7A 3QCTH 3CVIL 4P2RB 1WTGT 3ARGB 3FOLA 3G5YB 3EDDA 2VITA 4ISVB 1A7OL 1DDHA 1WF5A 1IC5H 1XCTA 3QULA 3AREB 4JJ5B 3C6LA 2XY1A 1LP9E 1M6OB 1TPXC 4PJAB 5FCUL 2DQIL 2DYPB 4LP4A 4QKXB 4HS8L 3ME0A 4JM2C 1VERA 4PJ9A 4GKSA 5C6TH 3V0WH 3S88H 4GG6F 2Z8VC 4JAMA 4GAYB 4EUPB 2RAMA 5CEYB 1S7TB 4CGTA 4DN3H 5JW4Q 2ZOLB 3VW3L 4PRIE 4HIIB 3FFDA 1JGVL 2J8HA 1LGVA 3G9AB 3VRJB 1SY6A 1I9JL 3KPRE 2VLJB 5FO7A 4RISL 2JELH 3LEYL 1ONQB 3CLEH 4Z0BH 5LQBL 1NCAH 4OGAC 2IH1B 1IAIL 4UI2A 2E9IA 1WZMA 4JG1H 4M5ZH 4BKLA 4JZJC 4YDVB 5IMOA 5C2UB 4CJ1A 1BVKA 4JCLA 5ITFA 4TVPD 1GVIA 1DEDA 4QYOB 3O6FD 3P4LA 4PRIB 5ESVA 1JV5A 1L7IL 4LPXA 1JYNA 3NVQA 4Z7WE 1TJGL 3JUZA 5C0AB 3TA3D 4FTVD 3H42L 4JFDB 1VFAA 3S37L 4P57A 3AY4A 5I1GH 4G8GD 1IGTB 4YGVB 4Q2ZA 2WZPD 5TQ0L 5I76A 5DQJA 1BECA 5FGCB 3VFMB 3VH8G 4KI1A 4M4PA 5DT1H 2XWTB 3QFDB 2YC1B 3FHAA 1DVFA 5FUCE 2DM3A 1LEGA 3E8UH 5DJXA 2W91A 5HYJE 3HI6L 3M17B 4HBQA 5IBUB 3UTTE 1WBYA 5IW6B 2MMXA 4AK1A 3BOVA 3OAUL 1I7ZB 1DN0B 1CXHA 1YC8A 2NNAB 1A9EA 3FTGA 4R4FH 5BS0A 3H9YA 1KNOB 1N4XH 4H25A 4WY7L 1BF2A 4Y7MA 3RTQB 3VGFA 5ID0A 3UBXG 1R3HB 3MSPA 4K8RC 1R24B 4MCYB 1KF9B 4YR6A 3H8NA 5ICZA 4Y8AA 2YD8A 2BP3A 4OLZL 5HHXL 3BKCL 1CE1H 1AGFB 2H45A 4H0IA 4NNYA 2C4XA 5C8JA 5KS9F 4AENA 2PNDA 1U0QA 4WCYH 5DMIL 3FB6B 1RPQA 3OKOA 3Q3GA 2APXA 4Y19A 1OP9A 4MMXC 4OCWL 2I9TB 32C2A 3DJ9A 3MR9B 1B0GA 3VXQB 5I8EB 5J89A 4X7TB 5C0RH 1JNHB 5D93C 1MHPH 1WJ3A 2MSPA 4X6DE 2YR3A 1CXEA 1QBMH 4L4TE 2R1YA 1EZVX 4AEFA 3S4SB 5C7XH 2BFVH 4HKJA 4P2OA 1JNLH 4UQ3A 3L3GA 3BKYL 1MCLA 2GJJA 3BE1L 1F6AA 4JR9L 1NGPL 5AWNL 4TNVK 1Y6MR 3O3DA 2EH7H 4JEGB 1MRFH 3MV9B 4X5LA 1JGEB 1YYLL 4O2CA 3LAFA 3BGFB 4I48A 1TZIA 3STZB 2R0ZH 1EEYB 1EFXD 1HNFA 4HGWA 4UINH 3HFML 5C07A 3WSQL 3GMRA 2NXYD 3P4NA 3ZDYE 4OZHA 4NIKB 3ZYOA 2A6DA 3P0GB 5E0QA 1SEQL 4PRNB 1P6FA 1EJOL 4OIBA 3KPLB 4E42A 3P0YL 1T80A 1JZ3A 2MCPH 3T3PE 3RTQC 2WINA 3GSRA 3MYZA 4AEEA 3DVIA 4MHHI 3SE4A 3QO1A 5T5NF 1HILA 1FIGH 5ENWA 1ZGLB 3Q0HA 3Q6GL 4Z78B 4MAUH 3U0TB 3VFSA 4JM4L 1BBJB 2PXYC 3NCMA 1C12B 1J5OL 5DJCA 4L8CA 1J9CT 3ARZA 2DQCH 3GBNL 4D9QD 3QUZB 2FBJL 3SPVB 2Y1VA 1U9KA 2HVJA 3IDMB 1NLDL 2Y6SC 4QHUA 4EOWL 5JW4N 1PG7H 4IRJB 4DW2L 3UTPE 2XTJD 5D2NB 3VXSE 5EBWA 4M7LT 2IPKA 4WNQA 3W9EB 3VXRE 2CR3A 3MLWL 4K8RH 1NMAL 3GMNA 3EFFB 2DKUA 4N68A 3ZTNH 4TULL 4YFLF 4TPRH 1AGEA 4FQLH 3LOWA 2DM4A 3GFUA 4XVSH 5DEGA 1BM3H 4RNRA 1WCBA 4XMKH 4Y19D 4J3XA 3RBSA 3REVB 5D7JA 4PJ5B 3EJZC 3ETBF 2VZTA 3GK8L 4MCZB 1WFUA 4RMVA 1G7IA 1CFNA 1MH5B 4XVJH 2JF1A 3ZDZE 4Z7QF 1BLNA 7FABL 5D1XB 2P5EB 4JFHD 4LASH 5IMKB 1CGVA 2BERA 1VKXB 3MJ7A 4OD3H 1UC6A 4D8PB 2GCYB 5HHMD 1U8KA 4URTB 4UIKH 5KG9B 2DQTL 4KJWD 3VD5A 3P4MB 4NOFA 3VD4A 5DO2C 4ZQKB 3TO4D 3IXTB 1KENH 2BXZA 5L8JB 5JOPE 5GS0D 1ZLUK 5SV4A 1S5HB 2CUHA 3GB7B 5I1IH 2FD6H 1ZT4A 2GSIB 4LCIH 3CDFA 4RMWA 3HAEG 4YHOH 3PGDB 3K81A 2J6EL 5GSVA 2ITCB 2GJ6E 4Y16A 4G8GA 4AL8H 4ALAH 2YHGA 3E2HC 4KAQH 3UPAA 3VFNA 2MNUA 3TA3A 4NCC1 1P7KB 4B41A 3EIFA 1IL1B 3M8OH 5KJRL 1ZSDA 4I0PD 1IFHL 3W0WA 3DUUB 4GW1A 4WTXA 1HINH 3WHE1 4LNVA 3DX8B 2DQDL 4JG1L 4M5ZL 1QSFA 4WUUB 3ULUF 1RQ5A 1HHIA 3HAEA 5F97E 5B3NA 5KJRH 1I4FA 1K4DB 1M7IB 3O2DA 2HG5B 1NFIA 3W9DA 4HK3N 2A73B 3RIAK 3KYOA 3VXMA 3DARA 5HYQB 4G9FA 1IQWL 5BRZE 4R96B 5KS9A 3HZMB 2VISB 1BM3L 2PXYB 1N3NB 3SKMA 4R26H 2APWA 1UT9A 1U8LA 1T1YA 2BXYA 4PG9B 3WJLC 4GRWE 3MRJA 3DXAB 5E00A 3V6FB 5FECB 4JB9L 3SDXB 2NX5A 3FQUA 1ZMYA 2V2WB 4PJIA 1EHAA 4YEFA 4OFKA 5C0CE 2F8XC 5DF0A 2X1OA 5HGAB 5IJKA 5HBBA 3EYOA 4OCRL 3BHBB 2V17H 1NANI 4IRZH 1YEGL 5GJTL 3RFZC 3V9FA 4QWWC 5DXWA 2LQRA 2YD1A 4AMKH 2YKLH 4EUPH 1CL7L 1AXSB 1DANT 3L9RB 3UDWC 5F7DA 4ZYKB 4N9OB 3RL2B 3UBXB 3LD8C 4LCWE 5JHDA 1CBVH 4K3JL 4L1DA 3IDJA 3LKRA 3VFRA 5A2FA 1JVKA 4XVTL 3JZ7A 1QP1A 3RDTB 4KVCL 3RWJA 1AGCA 2FDBP 4NOBA 2DRUA 1P5UA 2FECL 3ARVA 3BKJL 1B0RA 5C71A 4XCFL 4POZD 3WD5L 2WLZA 3BEVA 3LN9A 3L3DA 4L3ED 3HMXL 4L29B 5CGTA 2IGFH 2VUYA 2NY3C 1RD6A 4M62L 1HEZA 3KVQA 4WTZG 3OKKB 3F62A 5HVHB 4Q6YA 4JZOA 2MJWA 1D5ZA 2V9RA 2BFVL 3E6FB 3HPJB 1VFBB 4I2XB 4LSSH 5DEFB 1XF2B 3CFJA 1I1AA 3DROB 3BXNB 3ELAT 5F6IC 5B4MD 5E2WL 2XZAH 4PJ5E 3HMXA 3DETD 1OWWA 4QTHB 4TNVF 5EWIH 2AK1L 1LDPL 4X4ZA 5EO1B 1Z5LA 5CSGA 5FAAA 4CADA 1J05B 1LE5A 5F88B 5FGRA 2D2OA 4OAWA 2DYPD 2M1KA 1GC1C 1YQVL 1WEJH 4NBYB 1BIIA 1B4JH 1NDGB 2F54D 1JTPA 1U8OA 3IFLH 5C70A 2ENSA 1I1FB 2GK2A 3OKNB 4NKMA 2P5EE 4EVNB 3OAZK 5EPMB 3T8XA 4QGTA 1T4KA 3QIUC 5I16B 5E24E 4B53A 1UZ8A 4X9IA 3WDHA 4YBHA 1CF8L 1I7RB 3AMLA 3RUGF 2EYRB 3MA7A 2XZQL 1QFWH 1EH9A 3FT2A 1KTDB 4GG6E 4WI7A 1CDIA 2I07A 2VXQH 3QEHB 3FOMA 5D6DC 5JW3H 1S9XB 1MNUH 4YNYA 5D7IA 1HH9A 4WI5A 4LL9A 3VRLF 2N4IA 5T3ZL 1ZLWH 4QT5B 1FNEA 3GSQA 43CAA 2DD8H 1F3JB 3WEXA 4ODTL 4XCFH 1IAMA 4RMQA 4ZPVA 5D6DA 3TYFB 3O3EA 3TIDB 3AVEA 1MI5D 3MV01 4V1DB 2BJML 3SDDB 3OF6D 3SO3B 5LGJA 4W4OC 4XCCH 4X7TA 5FYLE 4MD0A 1IBGH 1UM4L 4N8PA 4APQB 3N50A 4JM2B 1QBLH 5L88H 1ZS8B 5IEKB 2DQFA 1YMME 1UM5L 2C3VB 4K3DH 4PJAF 4X4ME 3BZFB 2G60L 3OR7B 5I1KH 1AC6A 1EEZA 3H3BC 1LO0H 5JOEA 4K3GA 1FH5H 4WEUD 3VWKC 1WFNA 1WIOA 2FIKB 1QKZL 3ZZ1A 2E8YA 2OZ4H 2X5PA 3JWDC 3KWWB 3HRZB 4RIRA 4Z7NF 4DVRH 4D0BA 1DP0A 4GRWB 3SGJA 3VE0A 5L8KB 3G6AA 3FT3A 5EBLA 5IBTL 5GGUB 4HKZB 4HKXB 3C09B 5I1KL 1Q9KA 5HHPB 2XKNB 3ULUL 4M9OA 3LS5L 4EIGB 2I5YH 5I8CA 2J4WL 2ICWJ 3BI9X 4XP9L 1NCCH 2CKBH 3VG0L 3WFZA 1VADB 4YAQB 3QT2A 4K7FB 2I9TA 1ZKAA 4YXKH 3B9AA 3PQYB 4NBZB 3LKOA 3S34L 1VEPA 4WFFE 1GRWA 1JNHA 2R2HA 1BAFH 4N0UE 2R2EA 4XP5H 4JY6B 4XC3L 1XGRA 3WIHL 4ZPTA 4TUJA 4DEPC 1IC4H 3KPPA 4J4PC 5EZJB 2QKIB 4W6YB 1YC7A 3SPVA 3UEZA 2F15A 4TULH 3VGAC 3P11L 2VXUL 2VZ1A 2P8MB 4OLVH 4NPYB 3PWPB 1E4XI 1PLGL 1MEXL 5C0NC 5JO5B 3HE6C 4LASL 3KJ6H 4OIIH 5C09D 4I4WB 4XCCL 1KN4H 4LVHC 5IW6A 4PJHA 2QADC 3WIFB 4CVWA 3HR5A 3IKCA 3QIBA 4LEXL 2J1KA 5BJTA 5CGYD 2XA8H 2E7HA 4F9PC 1KIPA 4UV7H 1J88A 1NBZB 4RWYH 4G7YH 3WFHA 1QUNA 3K8LA 1GGIL 5D8JH 4MQTB 2CKBB 1OARL 5T1LD 1TCMA 2QHRL 4JRXA 1EUUA 1CGTA 4PRIA 3MLRH 3HUJF 1EO5A 4P4RA 5C1MB 1G6VK 1QYGL 3LDBC 2WM0A 4NKDA 3WKML 2J6EH 5DC9B 3BP4B 3WL9A 3F7VA 4R97C 1ORQB 2CRYA 2AXFA 3I85A 3MNVA 5BO1L 4YXHL 2VSCA 4IRJA 5EU6E 4Q9RL 4LVOB 4F15C 1S5HA 1T89C 4U1MB 1FFNA 1PEZA 3L3GB 5EBWB 3W0WE 3DI3B 3QCUL 5E5RB 3A6CL 5E94A 2Q20A 3FRPA 2VLKD 4MVBC 1T21B 1KBGL 3L95B 3MXWL 3SHSA 5F3BA 3D69B 1S7SB 4HMCA 3IDIB 4R0LC 1LO4H 4OZHF 2NYYD 3CC5A 4HIXH 3UC0H 2V2TA 2Y5TA 3FONA 3PG2A 4LRNH 1RJYA 4J2XA 1YNKL 2JCCF 2Y06L 1KLGB 3UTQA 1G7MA 4LVEA 2CLVA 1HOCA 2CJUH 4KVNH 4IJ3B 1IC5L 5ALCL 5DSCB 1A4JB 4LSSL 3GKZA 4LPVA 1EMTL 3MBEB 4XCNA 1AIFB 3UC0L 3BO8B 4OLEA 4WRLA 4WDIA 5C0BB 1F42A 2NW3A 2AJ3A 2OMNA 5E2WH 5F1SA 1AI1L 4ZAKA 1BQHG 2CJUL 3NPSC 2V17L 1CIDA 1DVFC 3W9DB 4JDTL 1UQSA 2L7UA 4FQXC 3O45A 4X6CE 4BQ6A 1RUPH 3IDYB 2DL9A 2HWZH 4YIQA 3KJ4C 1H15B 5KS9B 3U0WL 4U1IA 2H26A 1CIUA 3MRJB 5B3JF 1FYTB 2VN4A 2BDNH 1QD0A 4Y2DD 4ZTPH 5L9DH 5C0BE 4ZFZA 4G6AD 4IOFC 4LSVH 2DQHH 4JKPL 1N26A 1J8HB 4FQQA 4L1HA 1BQUA 3WD5H 3ULVF 1ADQL 5FIEA 2FJHB 1OL0A 3P4NB 1CT8A 2ZUUA 2NLJB 1JCKA 4RMUA 5E2JA 2HTKC 3BE1H 4JR9H 3MFFB 4NQEE 5CEZL 4LQ1A 2VLMD 3VDAA 5J11C 2BMKA 2P5WA 4HK3J 3H9SD 3RPKA 1U8PB 4XMPH 5IVOA 3TV3L 1HIMH 2R56H 4GH7B 1OM3L 5CCKH 3JTSB 1U8NA 2HYMA 3UTTB 4FFYH 4EN3A 1HHJB 3UP1A 3MA9H 2DIBA 1DBML 5J3HC 1NBVL 5T3XD 4FA8A 1A1OB 5IK3B 3VXTB 5JDJA 3O41A 2YN5A 3QUYB 1KG0B 2ZPKH 5MEOA 2GCYA 1DQLH 1HIML 2R56L 4MNQE 1RUKH 4NQED 3UO1L 1T5WA 2KQNA 2XN9D 4LPCA 3V5DA 1DTUA 4DOHB 3DXAA 4WFHD 3QUZD 4QRRB 4E41A 3C5ZD 4H20L 3SY0B 3SJVE 4G80A 2XRAH 2GYSA 4EBQL 5JZ7C 1T5XB 3TT3L 4OM0H 2ERJB 4OKVB 5MENB 5IHUL 3QG6A 2W38A 3STLB 1AHWB 3GBMH 3O11B 5TQ0H 4MB4A 3REWB 3MRHB 1QEWA 3VXPA 2GFBA 1G7LB 4KQ4H 5JNYB 4AEHH 3BIAX 2HKFH 3ARGD 4JGJA 2Z31A 5D7JC 5FYLL 1ODAA 3OAZH 3VRLE 1Y6NR 2APTA 2ZJSH 4R7DB 5IT2L 4LSQH 1KELH 2L7JA 3KPOB 2R23B 5EO1A 1F4XH 3O3BB 4Z7UE 3ULVC 5FO9A 1L7TH 1VFUA 5DO2D 3G5VA 2Z31C 1D9KA 3TNNB 2FX9H 3ZO0A 5CAYB 2ZCKL 4NQXA 4M03A 5C07D 1MCQA 1FYTD 2E27H 1FYHB 4OZIE 5HSFA 5T3ZE 1FPTL 5EO0B 1CU4H 1QSFB 1M7XA 4LF3B 4HWZB 4LFHG 3IXAA 3EOTH 3ZDXF 1TQBB 1AXTL 1HHIB 5JR1L 3PL6B 3V4UL 2V2XA 1P53A 4K94L 4J7RA 1I7RA 3IU3A 5DJZA 1IGCH 3HNSH 1J0KA 4XPBH 3A67L 3RWIA 5I15H 5JDSA 1KJ2H 2XPGB 1D5ZB 3ARFC 1JHLH 5E8PA 3NPSB 1QBLL 1MCJA 1OM3H 2X4TB 1IJ9A 1I1AB 3CFJB 3TO4C 4P5MB 5HJ3B 1BQHA 3MRRA 4LNRB 1MELA 1KC5H 3QDGA 2E9JA 2B5IC 1OLZA 2VQ1B 3MBEC 4G8GB 3RWDB 3ZSSA 4KJWC 5CINL 4XCEB 3I6KA 4NN6B 1Q0XH 5ELIA 5C08D 4GLRI 5T1KB 3IJHA 2B4CH 5CIPH 2NY4C 3WJJA 4HC1L 1IMHC 3ARDA 3IFNH 2R1XA 3B2VL 3WSQH 1QSEA 4YHOL 1NEZB 5F44A 3TYGH 1SEBB 1SEQH 4JQXA 4ORGB 4XNMA 1S7UA 4HT1H 4Q0XL 5DRNA 2DWDA 3VA2C 1FORL 4OV5B 3T8XB 2WBKA 3OG4B 5HGBA 5GQBA 2Q1EA 5IV2A 1DVFD 2FL5B 2OXGA 2DS4A 5I1AB 1SYVA 2X10A 4Q6IB 3ARBB 4UBDC 1WGOA 5CJQH 3AS3A 1CFQA 4F3FB 3DNKA 3QUXA 4OQTH 5IMLB 3QO0A 4F7TB 4HV8B 5T3XL 4GRLA 1T1YB 1UENA 3MTRA 4O51A 1HWHB 1INEH 1OQXA 4G8FA 2PW2B 3M07A 4ELMF 3IGAA 3D18B 1FDLL 1I3GL 2CXGA 2GY5A 3GK8H 1U92B 5KVEH 4GAJH 4WU5A 5EBMB 3INUH 3IF1A 5E70A 2BY0A 4V2BA 4FQ2L 4YHZL 4X5WB 2J8OA 3QFJB 4QRSB 3T2QA 4DWHA 1P9MC 4HAGA 4C56D 1F8TL 4MDJB 4LCCB 4I77H 4U4BA 4CMMB 3MLWH 3L3HA 5JUEL 4HHAB 4JPWH 1FAIH 4XAWH 5L2JB 1CR9L 4OZIF 4WEBL 4QRQB 3RZCB 3WNOA 4NQCE 2DQFB 4LPYA 3ARBD 4W68A 4ZOCA 1JPSL 1MUJA 2GITA 3U9UB 4IRSC 5IFJA 2NY0C 1SYSA 3KPSA 4IDLA 1F8TH 3WXVH 5DI8B 1V8HA 4PJ9D 2F5AH 3QNXB 3O0RL 3VGEA 1NC4B 1SVCP 5ESAB 2PCPA 4J23A 3LRSA 3VFVA 4KAQL 1FRGL 3VGAB 4HZLB 3KXFB 3X12B 4PTUB 4JFED 4OLUL 5D7IF 3FO9B 2AJZB 1P5VA 2AXHA 1R3IL 1X6LA 3UZVB 1CS6A 2QL1A 3UROR 2VZOA 1ZVYA 4LHUD 1PKQB 3DV6A 2WBJD 3S37H 1MY5A 3OV6A 1F58H 1PX4A 4K7FA 1UGNA 5BZDB 1IGYA 3FRUB 5KAQG 1KCKA 1EO8H 1RUML 3TYFA 3O3EB 2R2HB 2AEQL 4BH7B 4LCWA 3V4VL 2JIXD 3QJFB 5EU7E 1FV1B 4ZPTB 1YNTA 4RGOL 3ARSA 3PP3K 2Y25A 3BDYL 3T1FB 5JIHA 3SKJL 3QCVL 3MV8B 3RY5A 5E08L 1HHHA 3UJIL 3BQUD 3FQWA 3OKNA 4F7PA 2OR8A 2DKMA 3LB6D 2DIAA 1QLFA 1G9NC 4HS6A 4RGOH 4KJYA 1LWRA 4TNWF 4KUCF 5EZLA 3D5OF 5F7EH 4K2UL 4MLIA 2D0FA 4OF5A 5F7UA 5K9JH 3DRQB 3H3KA 3QDAA 4QHKJ 1CFVL 1OAXL 1J1PH 4OF3A 1OAZL 1D5MB 5C07E 5IEHB 3BRDA 5KVFL 5IJVB 3OKMB 3BWAA 3T0BA 5DVKA 2DQJL 4NWTL 1FVEB 2I9LB 1A7NH 3SDDC 5CSBA 3TZVC 5ANMB 5T3XE 3O9WB 3C60D 3OHXA 4HAFA 3CDCA 2BC4B 4L4JA 2RR3A 3SDAC 2EO1A 1KT2B 5BV7B 4G6ML 4WY7H 4QCIB 5E6ID 1NAKL 1YPZE 2VLRD 4JKPH 1GZQA 5ISZE 3CH1A 3MRNA 3O6FC 4FQHA 1ORQA 2MQCA 2XZCL 5BQ7B 3MLZL 3V5KB 1UYWL 2BNQE 1EJ6A 1QQDA 5HD8C 1VB9A 4ZSOA 1R3JA 1W0WB 3ZKSD 4CU8A 1MFAH 5D72H 2AJVH 1BFTA 1A5FH 3N9GH 4D0CA 3HLAB 4ZFGL 4UBDD 2R29L 3GI8L 1Q1JH 4FQPA 1IGJB 4N1EA 3WN5A 5JOPD 5C0JB 2AQ2A 5E99L 3VDBA 4OFYD 1DBMH 2HFTA 4YDIL 2KQMA 1J0IA 1G7QA 3GGWA 5EUOE 3H9ZA 1J8HA 4L3EE 1NKRA 4KUCD 3V6OA 4KZDH 5LAXB 4HW6A 4LDOB 1CT8B 3WNNA 1KOAA 3KR3L 4H8WH 1U2HA 1NBVH 1AGBA 4MA1B 2R1WA 4Z0XB 3UJIH 4LEOB 4M62H 1FQ9C 2X4NB 3C08L 2JCCE 5KVMC 4I3SH 2Y7QB 2DI7A 2HT4D 3M45A 4R0LA 4BH8A 5I9QB 1NDMB 4S1QH 4YX2L 3QA3B 1L9NA 2DQEL 3C87A 3GZKA 4ZUUB 2QQKH 1YEIH 4M7LL 4Y4HB 4KQ4L 5H94B 2W1NA 1NL0H 3RVXC 4GKZA 3F5WA 5DMKB 4HS3B 1RVFL 5D5MB 2CIKA 3CH8A 3KNBB 4F33B 4P2YA 1VDGA 2GUOB 1T5WB 3R1GL 3S36L 4OCXH 1IEBB 2DB8A 3BW9A 3ZYJA 4HBCH 3K4AA 1HQ4A 3I3BA 3FO0L 5K33A 1KTKE 3QNZB 4L9LC 4PD4J 2LTQC 5JO5A 1PY9A 1OGTA 3WO4C 3LKPA 3RL1B 5EIIB 1VGKA 3WDJA 3L95A 3ZLQC 5ADPH 4P5TD 2FATL 5J1SC 4XWGL 2X4SA 3IKCB 4L3CB 4JHBA 5DFVD 1Y0LB 5GRVK 3HG1B 5C0FB 3L3OB 1RUQL 4QHMA 5D70H 3O2WH 1G7HA 4PJDE 4QRPE 4TTGA 2M2DA 3QUYD 3DMMA 2BVQB 1TQCB 1I1AC 3PE9A 1UKTA 3IDGA 3NA9L 4P3DB 1Y18B 1S78D 1WAAE 1QRND 2Q7NA 1BOYA 2ZUYA 5EORH 5C0DA 1RZGA 3FN3A 4O5LL 3BP7A 4P3CH 1ZT1B 4X98A 3UMTA 4F58H 5GHWH 5F7NC 3QSKB 2NTFB 3PDOB 2VMFA 1S7XB 5DUPL 5FXCH 2ED9A 2QADD 4MSWB 2J5LB 3VXUA 4PS4L 4KY1H 1U36A 4IMKA 2NY0B 2DQGL 2XG4A 4BK4A 1FNGB 2GTWB 5GGRY 2D7OA 4PRHD 3GHEL 5D8JL 5ID1A 3CMOL 3D9AH 3TBWA 3RZCC 5GRUH 2VAJA 1EFQA 2B4CL 3DSNA 4HCRH 2ZOKA 2J8UB 3REWA 4PJFE 4P2QB 3V8CA 4JHWL 1QNZH 3EBAA 3L5IA 4XCYB 2Z31B 3MLYL 4QOKD 3GSNA 4X83A 3MV11 4ELME 1EEUA 1S7SA 3S35H 3CFEB 4N5UA 5L2KB 3KPOA 5GSRA 3OJ2C 2H8PB 3MOAL 4MWFB 3P9MB 5ERWA 5F3HB 3FONB 4CRPA 4PGEB 5SX5K 1JRHH 2E9WA 1C7SA 4FG6C 1I9RL 1DBBH 3P4OA 2R1XB 1UXWA 3TT1L 3EYVA 4NYLA 3VJ6B 1XH3A 3MXWH 2X89D 2X9YA 1I3GH 4L8DB 4PGBB 3DV4B 3X14B 4JPVL 5D6CB 3ULVL 3O8XA 2Y5EA 4DAGH 1TIUA 4JJ5A 3C6LB 1UQSB 2JB5H 1E6JH 2HRPL 5IKCB 3MRLB 4OI8A 4U1SA 3QAZB 4L4TB 4U1KA 1LO2H 3MYJA 4DVBA 4PJ9B 3U4EA 2A1WL 3SKNB 2HT2D 2AEPL 2AK4B 1JWMA 3RNKB 3EFDH 4AM0A 3ZYIA 4FQXD 4HUMB 1P7QD 2HH0H 4ZFZB 4GG6B 1FSKB 2HKHL 3SE3C 4JPKH 1BGXH 5LXGL 5DGRA 2UVEA 2OMBA 2B1AL 1J0YA 1NBYA 2YPLD 3J8F7 4Z7UF 4JGUA 4NRZA 4NQDB 2EYTA 5T1MA 4M48H 1CTOA 3ROLA 5IVXE 1ZLSL 3CLFH 2HKHH 3JV4A 3CPLA 3MPCA 2DLFL 1BVZA 4XX1E 4ZDHA 5HDOA 4YWGL 3SQBA 5BRZD 1CICD 2XG5A 1KCUH 2OL3H 4LKCA 1U3HD 2NPLX 5F1KC 1H0DB 4R3SB 1Z6JT 2EC8A 2X40A 3QBTB 5IQ9A 2FHFA 1I1YB 1OT1A 4FQXB 5JIIA 3B3IA 4JQXC 1DQTA 4HV8A 3UX9B 3NN8B 1X7QB 2P5WE 2V2XB 3RHWK 4O51B 3VWJB 5HYJA 2ZOLA 3VXNB 1Z3GH 3X12A 4FMKA 3RHWF 3SY0A 3I50L 2W59A 4R8WL 3LV3A 1S9VA 2AEQH 4L5FH 3TLRA 2IQ9L 2BK8A 4LLWB 2YPLB 1I7ZA 4YLQT 5ALCH 1T03L 5HGDA 1BWMA 1KFAL 5T3ZD 1G7LA 3G08B 4UTBH 2C4FT 2GJ6D 2KBGA 5HJ3A 4CMHC 1W72H 1C5DA 1BOGA 2VAAB 3NAAH 4NO2A 4X0KA 4G9DB 1EHLL 4OGYH 3HC3L 5EZIH 3HZKB 5EU3A 1MWAB 4UDTA 5DT1L 3O9WD 3CK0H 4XRCB 1AHWC 3QIBC 3MLSH 4JFFA 4JJHA 4ODUA 5MI0C 1U95A 3GBML 3PWPD 1O0VA 5HD8D 1ITBB 1JGDA 5AG9A 2B20A 3BIKB 2FO4B 3WFCL 5F1IB 4DZ8A 3DRTB 1SJHB 2Y36H 3UPCA 3I6LE 4R7NA 4LLVA 3SDYL 5DQJB 5F71A 4ZTOL 3ESUF 3BJ91 5EU6A 2LU3A 4LLYA 1MOEA 4CW1A 2ICEB 1R5WB 3RWHA 1F6AB 3PQYD 3ULVD 1SM3L 1XGPB 5L7XH 4KDTA 5E7BA 5GGSB 5IM7A 3VFTB 2EE6A 4PLJD 3FHQA 1NFKA 3RTQD 4I48B 5E8PB 1T22A 5B39A 1YEDA 2ICES 5D1QA 3QEQE 4G42A 4H5SB 4O9HH 2OL3L 2MHAB 5IJVA 2A6KA 2JIXB 1MHPL 4PJ8C 1BVKB 3P0VL 4U6XA 4WTZA 2B0SH 1IGCL 3HNSL 4ZTPL 1D6VH 2X7LB 4C59B 4HQQL 3GI8H 3TPUA 3G6JA 1T0NB 4FQIH 2AJVL 4NDMB 1V3JA 1KEGH 2LVCA 3LB6C 1YNTB 5T5FL 3BH9B 3LIZH 1ZGLA 4LCCA 3VG9B 1KCVL 1X6NA 3OXSB 3UTPD 3W81A 1K3IA 5JPNB 5E1AA 3WKNA 4KMLB 4Z7WB 3X17A 3O3AB 3HZYA 4PJXB 3GIZL 4XHJC 5KSUA 2B39A 2COQA 3NIFE 1CFSA 4P9HH 2FYYB 1W0YT 2DBLH 3QULB 4MB5A 5I1AA 4UT9H 2XQBH 2VH5H 3OR6B 3EDFA 1RUAL 4F3FA 4I18B 4PREB 4OGYL 5EZIL 3NCJL 3LCYA 1JGEA 2DQEH 2IJ0C 1KELL 5D7IE 4GAYA 1FORH 5EU4A 4EUPA 2YEZA 3VXRA 4NC2B 3KPQA 4N9GB 4CDHA 5J1TC 1I85C 4WCYL 2NY2D 4ZO7A 2R1WB 4Z0XA 4NJ9H 4Y5YB 3IETB 2LTQB 4OF8A 2WINB 3ILQC 3B2UD 3TT3H 3SE3A 5IROA 1AE6L 2KL6A 2FCBA 1JPGB 1QBML 5GGVH 1DUYB 3BUYB 4HIHB 3QFJD 3OXRB 5DMYA 1GZQB 2X9XA 3RGVD 4KTDH 4OLVL 4GXUM 1IM9B 1YPZF 4B7LA 3ABZA 4F8TA 5IHLB 1MEXH 2HTLC 3CDGB 5F7LB 3LQAL 4DKFH 3TBTB 1JL8A 1X5HA 4P23D 1W0WA 1CGUA 1NCCL 2CKBL 4OCSH 3HAEH 2H1PL 2VR4A 1TDQA 4OIAA 3KS0H 3NIGE 3LN5B 4WO4C 5SWQA 3QQ9C 3SDCC 5IMMB 2KUTA 1FVDB 3TJEL 2BVPA 3ALWA 3U30C 1Q0YH 1B6DA 4KI5D 1MIMH 5HDQL 4RFOH 4XH2A 4ZAKC 5I76B 4XPGL 5B3JE 3L1OL 1N5AA 4PRDB 3AM8C 2DLIA 2GIYA 4KJQC 2AV1A 4NN5C 4HH9B 2XWTA 1G7QB 1X5ZA 3AY4C 4U3CA 1DQQA 3DYOA 5CEYA 5AUMA 4HZLA 2BJMH 4F7CB 8FABB 4PP2B 4XNYL 5LAXA 4H0HB 4MQ7A 3PGFH 4M1CC 1C16A 1MQKL 2YA1A 4KK9C 1EHXA 5J9PA 1CFBA 1DN2A 5AAWA 4LEOA 4RGMC 2BZDA 5IW1B 1BJ8A 2HA1A 5MERB 2RBLA 4N0UB 4JZNB 4KQ3H 1AQKL 5D7KD 1OGAA 4PJCA 2HJKB 2FLBT 3T4AB 3V6ZA 4QRTB 5JXED 3GKWH 5C86A 4PJ5A 1HCVA 1IM9D 4JKKA 3QIWC 3MRDB 1BQLH 1XZ0B 4Y4HA 1LMKA 3KYNA 1RZGB 3MCLH 5ESVB 1RZKC 4LCWB 5JA9A 7CGTA 1PKOA 4GAFB 4OCMC 4XNXL 3QIUA 1F6LL 2NXZC 5TF1H 3U7WL 43C9A 5C0AA 3QG7L 1ZA6B 4HWUA 2HAZA 1BREA 4JQVC 4RFNB 4ODHH 3P9WB 4ZUTB 1P84J 3SGKC 1CYGA 1DBAL 1S7VB 3LKNB 1KTLA 5SX5H 1JTTA 1J1XL 1YNKH 3WNMA 1U8HB 1OP5K 1DBBL 4WNQB 4NUJB 3O4OC 1VGKB 2NX5E 4KHXH 1JWSB 1NGYA 1QFOA 4W6XB 4BSWB 4Z76B 1I8MB 1QVOB 5TE4L 3RGHA 1DN0A 3L5HA 4O2CB 2J6EA 1IVLA 4PGEA 3QCTL 1AI1H 4P48A 3A6CH 2ZCLH 1HZHL 2AEPH 1G7IB 4MD4B 4TSAL 1CN4A 1NJ9B 5J06A 1QSVA 4AENB 1GGTA 3C60B 5IVXF 4BZ1H 1FNFA 4Y4KD 4F37K 4YPGA 2VKWA 3FB5B 5I66A 2DN7A 4AIZA 3T0VA 2UZXB 1WLHA 5EA0L 3HNVL 1YEFL 5FYJE 5I1IL 4U0RC 2OL3B 2YUVA 1BBJA 4WHYG 2YBRA 5D5MF 5LCVH 1D5BA 2VDQL 1C1EL 4OBRA 3AS1A 1BVLA 5C0AD 1V3MA 4LVNC 4MNQA 4CVXA 3EJYC 1NCUA 3EYQD 2FR4B 1EEQA 3FO1A 3OB0H 2GUOA 4APQC 5IVZB 1CR9H 4G7YL 4LU5L 4CVUA 5LVEA 5ECJE 3D25B 5C0RL 2B2XH 4WIQA 2GTZB 3QB7C 1AO7D 1T04B 4EZMA 4Z18A 1TZIB 3ZDYF 4NKQB 5GGRB 1QSZA 4B50A 2P24B 5A43C 2PETA 2WBJB 4M8VA 1ZHLA 3MLUL 4KK8D 2OYPA 1O7VA 2NY1B 1PG7X 2NY5H 1DUZA 3Q5TA 1AFVH 5DZLA 5HI4D 4HXAL 2GJZA 4KRNA 1BIIB 1NDGA 2HN7B 3N85L 2IPTL 4LHJB 1A47A 5TFSH 5EOQH 4Z7VA 4OZIA 1H0DA 1RFDH 3TFKD 2FJGA 3CFBA 1ZWIB 1NGZB 2X09A 4BQ9A 1YNLH 3SKMB 3SO5A 3KHOA 1D7FA 4AEHL 2A6JB 2HFEA 3C5JB 1FGVH 2ZCLL 1PFCA 4KRPD 5FECA 1HEZB 1X9QA 5F1OB 3F7QA 4GW5A 4BFGA 2CQVA 1A14L 4M7LH 4NN7B 5D9SA 1CE1L 4EI5B 2Y36L 1OAYH 3RZWA 2VDLL 2YKLL 2PO6A 3BZEA 3T0EC 4HJJH 2IPUK 3WMSA 2H32B 4XB8A 3C8DA 3OKDA 5JLZB 4HWNA 1H5BC 1P4LB 3BSZL 2ZG3A 4A2LA 1DLHA 3GMPB 4EBQH 3KYKL 3QDGE 1OSZA 5JW4R 4ZTOH 3BEWB 3AFLA 5F89A 1DCLA 3TA3B 1G0XA 3PGCA 5KN5A 2UWEA 2JJSC 4Q6IC 4WFEE 4OM1L 3F6IA 1OAKL 3QZWB 1QHOA 5FUZL 4JDVA 4APQA 1K4CB 5CBAB 3CXHJ 3QUMB 1ZOXA 4JFEB 1ACYH 1NCDL 2VZSA 1KPVA 2YSSB 1YEEL 3PJSB 2F5BL 2HTKD 4CW1B 1ADQH 4TN9A 5FYKH 2VWEC 3VWJA 1MVUB 3SJVA 1HYSD 4Y2OA 4Y19E 4U1KB 4XC1H 5I2IB 4PRHB 3IAQA 2Q7YA 5D1ZD 4HIJA 1YMHA 4M02A 1X3DA 2EECA 4P9ML 1CD0A 5I1JL 1ZE3C 2X7LA 5HPOA 2BSSB 5KSBE 3U4BH 3V2AR 4UT9L 5T1MB 2WAHA 3MV9E 2DLGA 4NGHH 2VXVH 3TWCH 4JREC 3K1KC 3PQYA 3BN3B 2A83A 5FGSA 3ULUD 3TNMB 4FMFA 1KSRA 1AQKH 4P5KA 5J6HB 2Y4SA 3TN0A 3VD7A 2H3NA 4FG6D 5DD6A 2WUCH 3GRWL 3B9KD 5EO9B 4G5ZL 3E3QE 1N4XL 3KPSE 2P48B 3CCHB 4ZNEE 5CD3B 4Y5VB 2OBGA 1TNMA 4YBQD 2I5YL 3FMGL 2FIKA 4Z7OE 2APFA 4LSQL 1CWVA 3PWPA 4JM4H 1FLRH 4NFCA 4DKDC 3U0PB 4TRPH 5IVXA 1EFXB 4U1LA 1YEJH 1IGIL 2DQDH 2EDKA 4LGSB 1JNNH 5HYJB 1VACB 3GSOA 5KANI 4DKFL 1RZFH 1TTUA 5JPMB 2JJSA 3WEXB 5FK9A 1RK0B 4Y4FA 1T0MB 4Y5YA 3VXOA 3M1BB 1VFBA 1A1NA 3P73A 3WIHA 3TJEH 3RVXD 15C8H 4MA3B 3WBDA 2EDTA 4L9LA 3BXNA 1JP5A 3WXWH 3K1DA 3SGDI 5K9QG 3VRIA 3L1OH 1G9MH 3NH7L 3D3VD 3QDMD 3HZKA 5EU3B 5FYJD 4DUXA 5SWSD 4MJ4A 5I6XB 2OTWA 3RPIB 4UT6L 3QUYC 1YYMH 2PYED 2CSPA 1ITCA 1S78C 3DI2B 5EU5A 2HJFB 1X5FA 1CVSC 3BP4A 3H7BB 3EOBA 1I1FA 1U3HA 5D7SH 2EZ0C 4K3HA 4LEXH 4R90L 3K7UA 1TVBA 3MNVB 1BFOB 1EJOH 4W81A 5I71C 2VC2L 1RHHB 2IAMB 5FGBA 4HCRA 2JJWA 1X7QA 4YDLC 1MCIA 1HYSC 4X80H 1N6QH 2VDMH 3MA7B 2VQTA 5HHPA 5EUOF 3U2SB 5IM7B 4GMTH 5H35B 2YPLA 4M1GL 3TA3C 1OGAB 1TZGH 1UVQB 3CJJA 2J88L 1UFUA 2VXTH 3L5XH 3GHBL 1G7JA 1P7QA 2VXSH 2Z8WC 4QXWA 1CK0H 2FX8H 1GC1L 3BH8A 3KJ4B 2AJXH 3PP3H 5F88A 4TRPL 1U95B 3OJDA 2PYEA 5IGXL 3QCUH 4LCYB 4YFEA 5GGSY 2HRLA 4XNUL 5L2KE 1RZJH 1A0QH 2QBWA 4XNZC 4XXDB 1IAOA 1N59A 5IMMA 1TETL 2FGWL 3W82A 3NIFF 4NQCD 1MAML 1LK2B 3CAFA 4KKCC 4RGND 4ONFH 4IIQB 4LLUA 2ICWB 1VPOH 4TYUA 1GC1H 2LU7A 4N1CA 2LAGB 3W5NA 4L8SC 5HHQB 4M4RA 5DVNA 3HE7D 4Z95H 4BFBD 1BFVL 3QRGL 4NSKB 2OJEA 1CLZH 5FYJH 4JFZL 4KMTL 3DBXB 4GT7A 4L4VD 5EZOL 5TE6H 4XI5D 5DD3H 4JFHE 4JO1H 3WIFA 5DHXB 3ZE2E 4B5EA 1YA5A 1RZIA 2AJSL 5DD1L 3VXRB 4WI3A 4WEBH 5J13C 3VD9A 1IRAY 1I1CA 1J87A 2A6KB 2IANA 4QOKA 2F74A 1EZVY 2FO1A 3KPMB 1KPRA 2QSTA 1IKFL 2V5TA 3E6HB 5GZND 2BVTA 5BVPL 2XKUA 4NC0B 4WDIB 5C0BA 3U1SH 5E6IB 4AIZB 5F70A 1HHJA 5JW5B 4M6NL 2JELL 4HUNB 4YDLB 2YS4A 1V5JA 2VZUA 2IAMC 4NQTA 4JY6A 3UJTH 1X5AA 4NFDA 1CL7H 2NXZD 1X44A 1R3KB 2ZKHH 5GS1A 1YY9D 3OR7A 4RBPK 1FZKB 3F7YB 2EC9U 3G04B 5E94B 1LP9A 4H8WL 4MNGB 4OZGE 3STBA 3ARYA 1W72L 3B5TA 3M8OL 1QVOA 3H0TB 3AB0C 3QPQD 2IWGA 4HKBB 4PIRF 1L7IH 5FYLD 1DQQB 4GKNA 4HWEL 1FNSH 3FT3B 3C6SB 2ZUWA 2IPTH 1DQDH 4ZFOA 3CXHK 1U6AL 1KPUA 1M05B 5C0AE 1RMFH 1OSPL 4KJPD 3C8HA 1ZHLB 1OTUD 4U2YA 5I1DA 1XT5A 4Z7UA 1FNAA 5C9JA 3MV7E 4Y4FC 4L5FL 3NCCB 3BQUC 1TNNA 3UO1H 1WQVT 1VADA 4YAQA 3TNNA 1DUYA 5JMRA 1U8IB 3ZKMC 2F53B 3PV7A 4UDUA 4RFEA 4JFZH 3LKOB 4HX1A 4F9LA 1D5BB 1OVZA 2VDLH 4L3EB 1ZT7A 2DJUA 5JOFA 4HC1A 1KACB 5C2BL 1Q72H 1F4YH 5TGBB 4EXKA 4M1DH 5JQHC 2R0WL 2C1PA 1K3ZA 1JI1A 4U6YB 4X99A 4KI5F 2CXKA 5DJZB 1FL3A 3SKUD 2OP4H 4OKVA 3RWIB 3TGXA 4MXWL 5TQ2H 5I1LA 1HQRA 5H8DA 4K3EH 2SEBA 3TH4T 2ORBH 1ZHBB 4U7SA 1G6RA 3TCXA 5BMFH 1IC4L 2BNRD 1F11A 4K8RD 4YHLL 3JV6A 3RNQB 4X7EC 4PJIE 3AXLA 5IB3B 5HHVL 2F5BH 3JV5A 3MRCB 3KHQA 4MJIA 1IM3B 1T1XA 1ACYL 1NCDH 5E95B 1OSZB 3RWDA 2JCCA 3ARED 4RFOL 4JZNA 2BMKB 2QQLH 3BD5A 2AKRB 2P7TB 4PJEE 3BPLB 5HYSG 2EDYA 3IJHB 2E7MA 3V6ZB 4I0KA 3JTSA 3RVTD 1MNUL 1MRFL 3HB3D 4NRXA 4ZFGH 1I85A 3FFCA 5C6WH 4ZUVA 2EDDA 5HYIA 2UYLA 4HLZG 1G6RH 4TTDD 1EUTA 5A2IH 1KLFA 1G9NH 2VDNL 3MBEA 1CQYA 3O41B 1AR1D 2G75B 5CILL 4AT6B 3MRFB 4HWZA 4XPAL 3X11B 5E1HB 4ZAKB 3UAJD 3FQRA 3EJZD 3O2VH 2A6JA 1SYVB 1NGWB 4YHPB 4LLQA 5T5FH 1XGUA 2IH3B 4OD2B 7FABH 1IAKA 5DMJB 3P0YH 5GS0H 3QEUB 4O5LH 5T33L 2VQUA 4PBVC 5D9SB 2XXCB 3B2VH 2XPGA 3MOBH 2XY2A 4MX7B 3SDXF 3T08A 4XPTH 3DVGA 4MAUL 4NCC2 2R9HD 3E0GA 4EDXB 3B5HA 4GW4B 1FIGL 1AO7A 3IGAB 5DS8A 1SJVA 4X5XB 3X3GL 4XWOC 1JPTL 4R2GD 5B39G 1NC4D 5DVLA 2QSQA 2IFFL 2EXWC 2XTJC 3IDIA 3ZKMD 1NL0L 3ARFA 2R23A 5D96B 2BSRA 1Q94B 5GGQH 4D94A 5I73C 5CJQL 1J8KA 2FJHA 5B4MC 1G7MB 2OLDA 4QRUB 1XCQA 1PG7W 4KHXL 1NGXB 4EOWH 1U3YA 1FFQA 5DSCA 4PTTB 3H3PL 1MREL 3V52L 1CFTB 3VH8B 5FV1L 3I9GH 5CBAA 4S11A 1MQ8A 3MROA 1U8NB 3UTTA 4NQVB 4OKDA 4OTXH 2GJZB 1MPAL 3VI3E 5JW3L 2VXSL 2P42B 2J3SA 4OZIB 3IAGC 1MVUA 4Q6IA 1T1ZA 1DL7H 5HHMB 3O45B 1Q9WB 1RJLB 4QRPD 2HMIC 1OY3B 5IR1A 1MJUH 1ZWIA 1FCGA 1BBDH 3QO0B 5HY9B 4F7TA 4LSUL 5D70L 5I8OH 5IVXB 2PCPB 3U0PA 4YDKH 5GRXG 2HFGH 1MFEH 1P1ZA 1C5CL 3E3QC 5I1CH 1JMXA 5A2KH 5FHBH 5LGHH 5F6IB 2FSEA 5CD5C 1I3RA 1FAIL 3B4NA 3FO9A 1R5IA 2DF3A 2Z35B 4EI5A 1A8JH 3BPNB 3PDDA 5CMAB 2D31B 2Z92A 1B3JA 3PWVB 4FFVD 1F90H 1MLCA 4YUEH 5E8EB 3GJEB 1EGJL 3VRIB 3RWFA 5KSAC 2O5ZH 2VC2H 1KCRL 4P5KB 4HHAA 3K0WA 5KZCD 3DTXB 1U8PA 1GH7A 3RVTC 3GSWB 2D7MA 4U6TA 5DD6B 2HN7A 4X6DF 1KIUA 2W9EH 2VDPH 1IAIH 1AKJB 1U3HB 4MMZC 3CLFL 4PG2C 1IKNC 1KBGH 3ARBA 2GK0B 1NC4A 2VIRA 3PHQA 5J1AA 2BVOB 3K46A 1A2YB 4X8JB 3LPGA 2BNUA 4NKIH 4U0RB 5EOCL 3V5DB 2HFEB 2OR7A 1FG9C 3WE6B 4JRYE 4G80B 1ZVSB 1NCTA 2IF7A 2Z4QA 3ZKNC 2PYEE 1Z9MA 4YHML 2NNAA 5I1GL 1I8IB 1VA9A 3RGVB 3BGAA 3BN9D 1GGCL 1RIHL 5C9KA 5IEHA 1U3JA 1R3LB 1T83C 4PJCF 4KRMB 1C08A 4L8BA 1AD0A 4ZUSB 3QR2A 2HT2C 4IBLT 2RGSA 2YA0A 5BVJA 5JIKA 1FV1A 4CN6A 2FECI 1RMFL 4PY8J 1MJ7H 3O4OB 1CFVH 1OAXH