5E64A

Hemagglutinin-esterase-fusion protein structure of influenza d virus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
427
structure length
424
Chain Sequence
ELICIVQRVNESFSLHSGFGGNVYSMKTEPMTGFTNVTKGASVINQKDWIGFGDSRTDLTNDQFPASSDVPLAVAKKFRSLSGASLMLSAFGPPGKVDYLYQGCGKEKVFYEGVNWSPEAGIDCFGSNWTQTKKDFYSRIYEAARSSTCMTLVNSLDTKISSTTATAGTASSCSSSWMKSPLWYAESSVNPPQVCGTEQSATFTLPTSFGIYKCNKHVVQLCYFVYENKAKFNTFGCGDYYQNYYDGNGNLIGGMDNRVAAYRGIANAGVKIECPSKILNPGTYSIKSTPRFLLVPKRSYCFDTDGGYPIQVVQSEWSASRRSDNATEEACLQTEGCIFIKKTTPYVGEADDNHGDIEMRQLLSGLGNNDTVCVSQSGYTKGETPFVKDYLSPPKYGRCQLKTDSGRIPTLPSGLIIPQAGTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemagglutinin-esterase
publication title An Open Receptor-Binding Cavity of Hemagglutinin-Esterase-Fusion Glycoprotein from Newly-Identified Influenza D Virus: Basis for Its Broad Cell Tropism
pubmed doi rcsb
source organism Influenza d virus (d/swine/oklahoma/1334/2011)
molecule tags Hydrolase
total genus 121
structure length 424
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02710 Hema_HEFG Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein
A PF03996 Hema_esterase Hemagglutinin esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.20 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5e64A01
1FLCA 5E66A 5E64A 5E65A 5E62A 5E5WA
chains in the Genus database with same CATH superfamily
2XP3A 2F21A 1F8AB 3KAHA 1WR7A 2YSGA 2ZR6A 4QIBA 2YSHA 3M85A 4A0UA 2XPAA 2JX8A 3FSCA 2M8JA 2M3OW 2MDIA 3PQHA 2E45A 3KABA 2QRVA 2M8IA 3M7NA 2ZQVA 2JXWA 2YSBA 1JMQA 1ZCNA 2LAJA 1O6WA 2EZ5W 3LE4A 3TC5A 2DK1A 3LKXB 2DMVA 2XPBA 3MCBA 3FSBA 5E66A 2JV4A 2XP4A 2YSIA 1TK7A 3MQGA 5E5WA 3KAIA 2DK7A 2ZQTA 3ODKA 2XP8A 2OWOA 3CNGA 3TDBA 2BA1A 2XP6A 3WH0A 2JMFA 2ZAJA 3KAFA 2ZQUA 2WADA 3L4HA 2ZR4A 1WMVA 3FS8A 3MQHA 2XP7A 2Q5AA 3NTPA 1RP5A 3TCZA 1FLCA 5CQ2A 5U47A 1I5HW 5E65A 1EG3A 5E62A 2Y8NB 1NMVA 2ZQSA 4REXA 2ITKA 2YSFA 2XP5A 3KCEA 1K9QA 2DWVA 2YAJB 2XP9A 2L4JA 2WAEA 2KXQA 4E5RA 1EG4A 4U84A 2DJYA 1K9RA 4U86A 3KAGA 3OOBA 4GLXA 5AHTA 2ZR5A 3LKXA 4A0TA 3MCBB 4U85A 1TR8A 1PINA 2RE3A 5E64A 1YW5A 3KADA
chains in the Genus database with same CATH topology
2XP3A 2F21A 1F8AB 3KAHA 1WR7A 2YSGA 2ZR6A 4QIBA 2YSHA 3M85A 4A0UA 2XPAA 2JX8A 3FSCA 2M8JA 2M3OW 2MDIA 3PQHA 2E45A 3KABA 2QRVA 2M8IA 3M7NA 2ZQVA 2JXWA 2YSBA 1JMQA 1ZCNA 2LAJA 1O6WA 2EZ5W 3LE4A 3TC5A 2DK1A 3LKXB 2DMVA 2XPBA 3MCBA 3FSBA 5E66A 2JV4A 2XP4A 2YSIA 1TK7A 3MQGA 5E5WA 3KAIA 2DK7A 2ZQTA 3ODKA 2XP8A 2OWOA 3CNGA 3TDBA 2BA1A 2XP6A 3WH0A 2JMFA 2ZAJA 3KAFA 2ZQUA 2WADA 3L4HA 2ZR4A 1WMVA 3FS8A 3MQHA 2XP7A 2Q5AA 3NTPA 1RP5A 3TCZA 1FLCA 5CQ2A 5U47A 1I5HW 5E65A 1EG3A 5E62A 2Y8NB 1NMVA 2ZQSA 4REXA 2ITKA 2YSFA 2XP5A 3KCEA 1K9QA 2DWVA 2YAJB 2XP9A 2L4JA 2WAEA 2KXQA 4E5RA 1EG4A 4U84A 2DJYA 1K9RA 4U86A 3KAGA 3OOBA 4GLXA 5AHTA 2ZR5A 3LKXA 4A0TA 3MCBB 4U85A 1TR8A 1PINA 2RE3A 5E64A 1YW5A 3KADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FLC A;  5E66 A;  5E64 A;  5E65 A;  5E62 A;  5E5W A; 
#chains in the Genus database with same CATH topology
 2XP3 A;  2F21 A;  1F8A B;  3KAH A;  1WR7 A;  2YSG A;  2ZR6 A;  4QIB A;  2YSH A;  3M85 A;  4A0U A;  2XPA A;  2JX8 A;  3FSC A;  2M8J A;  2M3O W;  2MDI A;  3PQH A;  2E45 A;  3KAB A;  2QRV A;  2M8I A;  3M7N A;  2ZQV A;  2JXW A;  2YSB A;  1JMQ A;  1ZCN A;  2LAJ A;  1O6W A;  2EZ5 W;  3LE4 A;  3TC5 A;  2DK1 A;  3LKX B;  2DMV A;  2XPB A;  3MCB A;  3FSB A;  5E66 A;  2JV4 A;  2XP4 A;  2YSI A;  1TK7 A;  3MQG A;  5E5W A;  3KAI A;  2DK7 A;  2ZQT A;  3ODK A;  2XP8 A;  2OWO A;  3CNG A;  3TDB A;  2BA1 A;  2XP6 A;  3WH0 A;  2JMF A;  2ZAJ A;  3KAF A;  2ZQU A;  2WAD A;  3L4H A;  2ZR4 A;  1WMV A;  3FS8 A;  3MQH A;  2XP7 A;  2Q5A A;  3NTP A;  1RP5 A;  3TCZ A;  1FLC A;  5CQ2 A;  5U47 A;  1I5H W;  5E65 A;  1EG3 A;  5E62 A;  2Y8N B;  1NMV A;  2ZQS A;  4REX A;  2ITK A;  2YSF A;  2XP5 A;  3KCE A;  1K9Q A;  2DWV A;  2YAJ B;  2XP9 A;  2L4J A;  2WAE A;  2KXQ A;  4E5R A;  1EG4 A;  4U84 A;  2DJY A;  1K9R A;  4U86 A;  3KAG A;  3OOB A;  4GLX A;  5AHT A;  2ZR5 A;  3LKX A;  4A0T A;  3MCB B;  4U85 A;  1TR8 A;  1PIN A;  2RE3 A;  5E64 A;  1YW5 A;  3KAD A; 
#chains in the Genus database with same CATH homology
 2XP3 A;  2F21 A;  1F8A B;  3KAH A;  1WR7 A;  2YSG A;  2ZR6 A;  4QIB A;  2YSH A;  3M85 A;  4A0U A;  2XPA A;  2JX8 A;  3FSC A;  2M8J A;  2M3O W;  2MDI A;  3PQH A;  2E45 A;  3KAB A;  2QRV A;  2M8I A;  3M7N A;  2ZQV A;  2JXW A;  2YSB A;  1JMQ A;  1ZCN A;  2LAJ A;  1O6W A;  2EZ5 W;  3LE4 A;  3TC5 A;  2DK1 A;  3LKX B;  2DMV A;  2XPB A;  3MCB A;  3FSB A;  5E66 A;  2JV4 A;  2XP4 A;  2YSI A;  1TK7 A;  3MQG A;  5E5W A;  3KAI A;  2DK7 A;  2ZQT A;  3ODK A;  2XP8 A;  2OWO A;  3CNG A;  3TDB A;  2BA1 A;  2XP6 A;  3WH0 A;  2JMF A;  2ZAJ A;  3KAF A;  2ZQU A;  2WAD A;  3L4H A;  2ZR4 A;  1WMV A;  3FS8 A;  3MQH A;  2XP7 A;  2Q5A A;  3NTP A;  1RP5 A;  3TCZ A;  1FLC A;  5CQ2 A;  5U47 A;  1I5H W;  5E65 A;  1EG3 A;  5E62 A;  2Y8N B;  1NMV A;  2ZQS A;  4REX A;  2ITK A;  2YSF A;  2XP5 A;  3KCE A;  1K9Q A;  2DWV A;  2YAJ B;  2XP9 A;  2L4J A;  2WAE A;  2KXQ A;  4E5R A;  1EG4 A;  4U84 A;  2DJY A;  1K9R A;  4U86 A;  3KAG A;  3OOB A;  4GLX A;  5AHT A;  2ZR5 A;  3LKX A;  4A0T A;  3MCB B;  4U85 A;  1TR8 A;  1PIN A;  2RE3 A;  5E64 A;  1YW5 A;  3KAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...