5E64A

Hemagglutinin-esterase-fusion protein structure of influenza d virus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
427
structure length
424
Chain Sequence
ELICIVQRVNESFSLHSGFGGNVYSMKTEPMTGFTNVTKGASVINQKDWIGFGDSRTDLTNDQFPASSDVPLAVAKKFRSLSGASLMLSAFGPPGKVDYLYQGCGKEKVFYEGVNWSPEAGIDCFGSNWTQTKKDFYSRIYEAARSSTCMTLVNSLDTKISSTTATAGTASSCSSSWMKSPLWYAESSVNPPQVCGTEQSATFTLPTSFGIYKCNKHVVQLCYFVYENKAKFNTFGCGDYYQNYYDGNGNLIGGMDNRVAAYRGIANAGVKIECPSKILNPGTYSIKSTPRFLLVPKRSYCFDTDGGYPIQVVQSEWSASRRSDNATEEACLQTEGCIFIKKTTPYVGEADDNHGDIEMRQLLSGLGNNDTVCVSQSGYTKGETPFVKDYLSPPKYGRCQLKTDSGRIPTLPSGLIIPQAGTDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemagglutinin-esterase
publication title An Open Receptor-Binding Cavity of Hemagglutinin-Esterase-Fusion Glycoprotein from Newly-Identified Influenza D Virus: Basis for Its Broad Cell Tropism
pubmed doi rcsb
source organism Influenza d virus (d/swine/oklahoma/1334/2011)
molecule tags Hydrolase
total genus 121
structure length 424
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02710 Hema_HEFG Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein
A PF03996 Hema_esterase Hemagglutinin esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.20 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 5e64A01
5E66A 5E5WA 5E65A 1FLCA 5E64A 5E62A
chains in the Genus database with same CATH superfamily
3KAIA 2YSFA 4A0UA 2L4JA 2Y8NB 2E45A 2XP8A 5U47A 2YAJB 1O6WA 2M8JA 3WH0A 3LKXB 4QIBA 3LKXA 2OWOA 4U86A 1WMVA 2XP3A 3KABA 2JMFA 2WAEA 5E5WA 3MCBB 1K9QA 2ITKA 1ZCNA 2F21A 2DK7A 2MDIA 2ZR5A 1EG4A 2DK1A 3TC5A 2M8IA 1JMQA 3FS8A 2XP4A 3TCZA 2YSBA 2ZQTA 1WR7A 3FSCA 4U85A 2XP6A 2ZR4A 2EZ5W 1TR8A 2YSHA 3KCEA 2XP7A 5E64A 3MQGA 3NTPA 3MQHA 2YSIA 2RE3A 3KAGA 2BA1A 2DWVA 2QRVA 2DJYA 2JXWA 2ZAJA 3ODKA 1NMVA 2ZQUA 4GLXA 5E66A 1I5HW 1PINA 2M3OW 3CNGA 1K9RA 3M85A 2LAJA 1RP5A 1F8AB 1EG3A 5CQ2A 4U84A 2Q5AA 2ZQSA 2YSGA 4A0TA 1TK7A 5AHTA 2ZR6A 3LE4A 3OOBA 2JV4A 3KAFA 2XPAA 3FSBA 3KADA 5E62A 3KAHA 2ZQVA 2DMVA 3L4HA 3TDBA 2JX8A 2KXQA 5E65A 2XP9A 4E5RA 3PQHA 4REXA 3MCBA 2WADA 1FLCA 3M7NA 2XP5A 1YW5A 2XPBA
chains in the Genus database with same CATH topology
3KAIA 2YSFA 4A0UA 2L4JA 2Y8NB 2E45A 2XP8A 5U47A 2YAJB 1O6WA 2M8JA 3WH0A 3LKXB 4QIBA 3LKXA 2OWOA 4U86A 1WMVA 2XP3A 3KABA 2JMFA 2WAEA 5E5WA 3MCBB 1K9QA 2ITKA 1ZCNA 2F21A 2DK7A 2MDIA 2ZR5A 1EG4A 2DK1A 3TC5A 2M8IA 1JMQA 3FS8A 2XP4A 3TCZA 2YSBA 2ZQTA 1WR7A 3FSCA 4U85A 2XP6A 2ZR4A 2EZ5W 1TR8A 2YSHA 3KCEA 2XP7A 5E64A 3MQGA 3NTPA 3MQHA 2YSIA 2RE3A 3KAGA 2BA1A 2DWVA 2QRVA 2DJYA 2JXWA 2ZAJA 3ODKA 1NMVA 2ZQUA 4GLXA 5E66A 1I5HW 1PINA 2M3OW 3CNGA 1K9RA 3M85A 2LAJA 1RP5A 1F8AB 1EG3A 5CQ2A 4U84A 2Q5AA 2ZQSA 2YSGA 4A0TA 1TK7A 5AHTA 2ZR6A 3LE4A 3OOBA 2JV4A 3KAFA 2XPAA 3FSBA 3KADA 5E62A 3KAHA 2ZQVA 2DMVA 3L4HA 3TDBA 2JX8A 2KXQA 5E65A 2XP9A 4E5RA 3PQHA 4REXA 3MCBA 2WADA 1FLCA 3M7NA 2XP5A 1YW5A 2XPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E66 A;  5E5W A;  5E65 A;  1FLC A;  5E64 A;  5E62 A; 
#chains in the Genus database with same CATH topology
 3KAI A;  2YSF A;  4A0U A;  2L4J A;  2Y8N B;  2E45 A;  2XP8 A;  5U47 A;  2YAJ B;  1O6W A;  2M8J A;  3WH0 A;  3LKX B;  4QIB A;  3LKX A;  2OWO A;  4U86 A;  1WMV A;  2XP3 A;  3KAB A;  2JMF A;  2WAE A;  5E5W A;  3MCB B;  1K9Q A;  2ITK A;  1ZCN A;  2F21 A;  2DK7 A;  2MDI A;  2ZR5 A;  1EG4 A;  2DK1 A;  3TC5 A;  2M8I A;  1JMQ A;  3FS8 A;  2XP4 A;  3TCZ A;  2YSB A;  2ZQT A;  1WR7 A;  3FSC A;  4U85 A;  2XP6 A;  2ZR4 A;  2EZ5 W;  1TR8 A;  2YSH A;  3KCE A;  2XP7 A;  5E64 A;  3MQG A;  3NTP A;  3MQH A;  2YSI A;  2RE3 A;  3KAG A;  2BA1 A;  2DWV A;  2QRV A;  2DJY A;  2JXW A;  2ZAJ A;  3ODK A;  1NMV A;  2ZQU A;  4GLX A;  5E66 A;  1I5H W;  1PIN A;  2M3O W;  3CNG A;  1K9R A;  3M85 A;  2LAJ A;  1RP5 A;  1F8A B;  1EG3 A;  5CQ2 A;  4U84 A;  2Q5A A;  2ZQS A;  2YSG A;  4A0T A;  1TK7 A;  5AHT A;  2ZR6 A;  3LE4 A;  3OOB A;  2JV4 A;  3KAF A;  2XPA A;  3FSB A;  3KAD A;  5E62 A;  3KAH A;  2ZQV A;  2DMV A;  3L4H A;  3TDB A;  2JX8 A;  2KXQ A;  5E65 A;  2XP9 A;  4E5R A;  3PQH A;  4REX A;  3MCB A;  2WAD A;  1FLC A;  3M7N A;  2XP5 A;  1YW5 A;  2XPB A; 
#chains in the Genus database with same CATH homology
 3KAI A;  2YSF A;  4A0U A;  2L4J A;  2Y8N B;  2E45 A;  2XP8 A;  5U47 A;  2YAJ B;  1O6W A;  2M8J A;  3WH0 A;  3LKX B;  4QIB A;  3LKX A;  2OWO A;  4U86 A;  1WMV A;  2XP3 A;  3KAB A;  2JMF A;  2WAE A;  5E5W A;  3MCB B;  1K9Q A;  2ITK A;  1ZCN A;  2F21 A;  2DK7 A;  2MDI A;  2ZR5 A;  1EG4 A;  2DK1 A;  3TC5 A;  2M8I A;  1JMQ A;  3FS8 A;  2XP4 A;  3TCZ A;  2YSB A;  2ZQT A;  1WR7 A;  3FSC A;  4U85 A;  2XP6 A;  2ZR4 A;  2EZ5 W;  1TR8 A;  2YSH A;  3KCE A;  2XP7 A;  5E64 A;  3MQG A;  3NTP A;  3MQH A;  2YSI A;  2RE3 A;  3KAG A;  2BA1 A;  2DWV A;  2QRV A;  2DJY A;  2JXW A;  2ZAJ A;  3ODK A;  1NMV A;  2ZQU A;  4GLX A;  5E66 A;  1I5H W;  1PIN A;  2M3O W;  3CNG A;  1K9R A;  3M85 A;  2LAJ A;  1RP5 A;  1F8A B;  1EG3 A;  5CQ2 A;  4U84 A;  2Q5A A;  2ZQS A;  2YSG A;  4A0T A;  1TK7 A;  5AHT A;  2ZR6 A;  3LE4 A;  3OOB A;  2JV4 A;  3KAF A;  2XPA A;  3FSB A;  3KAD A;  5E62 A;  3KAH A;  2ZQV A;  2DMV A;  3L4H A;  3TDB A;  2JX8 A;  2KXQ A;  5E65 A;  2XP9 A;  4E5R A;  3PQH A;  4REX A;  3MCB A;  2WAD A;  1FLC A;  3M7N A;  2XP5 A;  1YW5 A;  2XPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...