5E68A

High resolution crystal structure of luxs - quorum sensor molecular complex from salmonella typhi at 1.58 angstroms
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
166
Chain Sequence
LLDSFAVDHTRMQAPAVRTAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title High resolution crystal structure of LuxS - Quorum sensor molecular complex from Salmonella typhi at 1.58 Angstroms
rcsb
source organism Salmonella typhi
molecule tags Lyase
total genus 46
structure length 166
sequence length 167
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 5e68A00
1VH2A 1J6VA 1JQWA 4XCHA 1VJEA 1J6XA 1YCLA 2FQOA 1J6WA 1IE0A 1JVIA 1VGXA 2FQTA 5E68A 1J98A 1JOEA 1INNA
chains in the Genus database with same CATH superfamily
1VLOA 4KASA 5EGEA 3T01A 4XLPA 3GSIA 4A3BC 3JSTA 5IP9C 2YU9K 3K7AK 1BS2A 3I4NC 2Y0SL 1WOPA 1X31C 4JK1A 4DDQA 2JA6A 1TWCK 2E2HA 4GTAA 1TWAC 2A69A 5JFEA 3S2DC 3HOWC 2E2IC 5IYBK 3A8JA 3HOZK 4GTLA 4M1XA 1TWHC 4GTDA 4A3IC 4BLAA 3RZDC 3N3YA 4ZH4A 1F93A 1WCMA 3CQZC 4NOIA 4LK1A 3S0XA 2NVYA 3GTLA 3AD8C 1XZPA 2YU9C 3K7AC 4Y52K 1PJ6A 4G0VA 4BXXK 1L0WA 1EFWA 1WSVA 2EBBA 3LPXA 1J98A 3GTGK 1TWGA 4KB2A 1AB4A 4MQ9A 1TWCC 4GTBA 5M5YK 5M3MK 3H0GK 4A3MC 4FM9A 1XPPA 1YX2A 5IYBC 2GSUA 1KQ4A 3TFJA 3HOZC 3BUEA 5FJ8K 2P8TA 1B4BA 2WAQL 5C44K 4MEXA 4PAAA 3TTGA 1HI9A 4KN4A 1XZQA 2NVXK 4LOWA 4AH6A 4Y52C 3HOXK 1SFOA 3GTQK 3S17K 2VUMA 4BXXC 5IYCC 3HKZD 1Y1VK 3GTGC 2R92A 2P5MA 2NVQK 5IORA 1B4AA 3H0GC 3T02A 4AYBL 3WODA 2E2JK 4Q4ZA 2Y3PA 4C3JK 4YG2A 3OEPA 1IL2A 3GTMK 3SZYA 5C44C 1G51A 4OIPA 4Y7NK 1I6HK 1V5VA 2JA7A 1VJEA 1J6XA 2NVXC 4KATA 4C2MK 3ERED 4P5AA 4GFQA 4GT9A 2ZUFA 3GTQC 3S17C 1J6VA 1Y1VC 2PA8D 4A3DC 2NVQC 3GTOK 1ZXOA 3A8KA 3L4KA 3S16K 2E2JC 1JQWA 3S1MK 3S2DK 4GTFA 4C3JC 1K83K 1WORA 4YFNA 1TWFA 4C45A 3GTMC 1VGXA 1WQFA 4Y7NC 5C4XK 3LAPA 1I6HC 5M5WK 2E2IA 4C2MC 1WOSA 2R7ZK 2JA5K 4A93K 4KMHA 3Q3QA 1PJ5A 1TWHA 3AH5A 2PMZD 3H3VD 3GTOC 2ZFZA 3CQZA 5CJ9A 1BGWA 4A3LK 4YFKA 3TFHA 3S16C 3S1MC 3GIRA 4J3NA 3GEEA 1K83C 2YU9A 4A3MK 3HOUK 1F9NA 5TMCA 5C4JK 3S1NK 1WQHA 1ZQ1C 1XZPB 3HOVC 5HL8A 1TWCA 4KMAA 4P9SA 3IPJA 5C4XC 1ISEA 4KARA 3HOYK 2R7ZC 2Y0SD 3HXAA 2JA5C 5IOQA 4A93C 1O29A 2GSOA 3FHZA 5IYCK 2FQTA 2RH6A 1DCOA 4A3LC 3GTPK 1O25A 2B63K 2V6TA 4A3GK 3HOUC 4WJ3M 3S1NC 1I50K 1TWGK 4QJVB 5C4JC 3S15K 2CFAA 3GTGA 1EK8A 1XZQB 5TJ3A 2WB1D 3GEHA 3H0GA 3N0CA 4LR2A 3HOYC 2GAGC 4KDDA 5E68A 3HKZL 1R9TK 3M4OK 3S2HC 4XLNA 5IYDK 1O2BA 4WJ4A 4A3DK 2BE5A 4LK0A 3GTPC 4GZYA 4KMUA 2GSNA 3FOEA 3CAGA 5IOTA 1JOEA 2NVXA 3A8IA 2B63C 4BY1K 3GTQA 1O2FB 3TFIA 4A3GC 1SMYA 4PABA 1I50C 1TWGC 1XXCA 1WQGA 1Y1VA 3PO2K 3S15C 4G7ZA 1F7UA 2W7VA 3ADAC 4XSZA 4KN7A 1YNJA 2R93A 4GTCA 3NUHA 3PO3K 4QIWD 4A3FK 4C3HK 1R9TC 3GTMA 3M4OC 2PA8L 2O5JA 1WSRA 3FKIK 5IOSA 1Y1WK 1I3QK 5IYDC 4A3JK 1XXBA 3DXJA 3RZOK 4A3CK 1YCLA 4C3IK 4KAWX 4BY1C 1O24A 2FQOA 1C0AA 4KMDA 3PO2C 4OIRA 4G7OA 3VA7A 1ZYRA 2NVTK 3GTOA 1O28A 3GTJK 1J6WA 1IE0A 3OREA 3HOVK 4KM9A 4MEYA 2PHCB 3I4MK 1TWAA 1K83A 3PO3C 4BY7K 1IW7A 4A3FC 3GTKK 2A6HA 2PMZL 4C3HC 4Q5SA 1EI6A 3S1RK 2JA8K 3H3VL 4GTEA 3FKIC 1Y1WC 1I3QC 4A3JC 5EGHA 3FOFA 2ZUEA 3RZOC 4A3CC 3S1QK 1GE9A 1RU0A 1EH1A 4KC6A 4LLGA 4C3IC 4BKWA 2GAHC 2R7ZA 2JH3A 2JA5A 3L4JA 4XSXA 4FZBA 2JA6K 4G0WA 2NVTC 2D6FC 1BJTA 2E2HK 3GTJC 1YNNA 3M3YK 3I4MC 5M3FK 3EQLA 1TWFC 3AQPA 4BY7C 3S14K 3GTKC 1PJ7A 3OPFA 1ZBSA 3S1RC 2JA8C 5IP7K 4X6AK 1WCMK 3AD9C 3S2HK 3V4GA 2NVYK 3BP3A 1DCHA 3S1QC 3GTLK 4O2DA 2CFAB 5FLMK 1JVIA 3MMLB 2XCRB 3T00A 2WB1L 1USMA 4BLBA 1USOA 3SZZA 5C3EK 5D4DA 2JA6C 2E2HC 1O27A 3GTPA 4BBSK 3M3YC 2B63A 5L46A 2RGRA 3S14C 1I50A 5IP7C 4BBRK 4X6AC 1WCMC 5TMFA 2NVYC 1IBAA 3GTLC 3GEIA 5JVOA 5FLMC 1SFOK 2KWAA 2VUMK 2V6UA 1R9TA 1XXAA 1ZVUA 1O2AA 2R92K 5C3EC 1VRQC 2WAQD 2PPBA 4QJVA 5CHPA 3G4AA 2V6SA 4A3KK 1WOOA 3G4CA 2XCOA 4BBSC 4RMFA 3BP8C 1HQMA 4QIWL 4YFXA 1BDFA 2XCQA 2A68A 4KM8A 2A6EA 2O5IA 4BBRC 4LQYA 3N0BA 2R93K 2JA7K 3AQOA 4OIOA 4ILDA 4KB4A 1IS1A 4AYBD 1SFOC 2VUMC 1IQ0A 3QX3A 5M5XK 3LAJA 4P5BA 4OINA 3FKIA 2R92C 1Y1WA 1I3QA 4A3EK 4A3KC 3HOXC 4WILA 2CW0A 4G0UA 4A3BK 5IP9K 1DD5A 1O26A 4G7HA 3I4NK 1TWFK 1INNA 3AD7C 4OIQA 1TWAK 3GTJA 2R93C 2JA7C 3HOWK 1WIHA 2E2IK 1VH2A 4XCHA 4LJZA 3GTKA 1TWHK 1F7VA 1UV7A 1I6VA 3GDZA 4A3IK 3RZDK 3CQZK 1DCPA 1EQRA 4A3EC
chains in the Genus database with same CATH topology
1VH2A 1J6VA 1JQWA 4XCHA 1VJEA 1J6XA 1YCLA 2FQOA 1J6WA 1IE0A 1JVIA 1VGXA 2FQTA 5E68A 1J98A 1JOEA 1INNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH2 A;  1J6V A;  1JQW A;  4XCH A;  1VJE A;  1J6X A;  1YCL A;  2FQO A;  1J6W A;  1IE0 A;  1JVI A;  1VGX A;  2FQT A;  5E68 A;  1J98 A;  1JOE A;  1INN A; 
#chains in the Genus database with same CATH topology
 1VLO A;  4KAS A;  5EGE A;  3T01 A;  4XLP A;  3GSI A;  4A3B C;  3JST A;  5IP9 C;  2YU9 K;  3K7A K;  1BS2 A;  3I4N C;  2Y0S L;  1WOP A;  1X31 C;  4JK1 A;  4DDQ A;  2JA6 A;  1TWC K;  2E2H A;  4GTA A;  1TWA C;  2A69 A;  5JFE A;  3S2D C;  3HOW C;  2E2I C;  5IYB K;  3A8J A;  3HOZ K;  4GTL A;  4M1X A;  1TWH C;  4GTD A;  4A3I C;  4BLA A;  3RZD C;  3N3Y A;  4ZH4 A;  1F93 A;  1WCM A;  3CQZ C;  4NOI A;  4LK1 A;  3S0X A;  2NVY A;  3GTL A;  3AD8 C;  1XZP A;  2YU9 C;  3K7A C;  4Y52 K;  1PJ6 A;  4G0V A;  4BXX K;  1L0W A;  1EFW A;  1WSV A;  2EBB A;  3LPX A;  1J98 A;  3GTG K;  1TWG A;  4KB2 A;  1AB4 A;  4MQ9 A;  1TWC C;  4GTB A;  5M5Y K;  5M3M K;  3H0G K;  4A3M C;  4FM9 A;  1XPP A;  1YX2 A;  5IYB C;  2GSU A;  1KQ4 A;  3TFJ A;  3HOZ C;  3BUE A;  5FJ8 K;  2P8T A;  1B4B A;  2WAQ L;  5C44 K;  4MEX A;  4PAA A;  3TTG A;  1HI9 A;  4KN4 A;  1XZQ A;  2NVX K;  4LOW A;  4AH6 A;  4Y52 C;  3HOX K;  1SFO A;  3GTQ K;  3S17 K;  2VUM A;  4BXX C;  5IYC C;  3HKZ D;  1Y1V K;  3GTG C;  2R92 A;  2P5M A;  2NVQ K;  5IOR A;  1B4A A;  3H0G C;  3T02 A;  4AYB L;  3WOD A;  2E2J K;  4Q4Z A;  2Y3P A;  4C3J K;  4YG2 A;  3OEP A;  1IL2 A;  3GTM K;  3SZY A;  5C44 C;  1G51 A;  4OIP A;  4Y7N K;  1I6H K;  1V5V A;  2JA7 A;  1VJE A;  1J6X A;  2NVX C;  4KAT A;  4C2M K;  3ERE D;  4P5A A;  4GFQ A;  4GT9 A;  2ZUF A;  3GTQ C;  3S17 C;  1J6V A;  1Y1V C;  2PA8 D;  4A3D C;  2NVQ C;  3GTO K;  1ZXO A;  3A8K A;  3L4K A;  3S16 K;  2E2J C;  1JQW A;  3S1M K;  3S2D K;  4GTF A;  4C3J C;  1K83 K;  1WOR A;  4YFN A;  1TWF A;  4C45 A;  3GTM C;  1VGX A;  1WQF A;  4Y7N C;  5C4X K;  3LAP A;  1I6H C;  5M5W K;  2E2I A;  4C2M C;  1WOS A;  2R7Z K;  2JA5 K;  4A93 K;  4KMH A;  3Q3Q A;  1PJ5 A;  1TWH A;  3AH5 A;  2PMZ D;  3H3V D;  3GTO C;  2ZFZ A;  3CQZ A;  5CJ9 A;  1BGW A;  4A3L K;  4YFK A;  3TFH A;  3S16 C;  3S1M C;  3GIR A;  4J3N A;  3GEE A;  1K83 C;  2YU9 A;  4A3M K;  3HOU K;  1F9N A;  5TMC A;  5C4J K;  3S1N K;  1WQH A;  1ZQ1 C;  1XZP B;  3HOV C;  5HL8 A;  1TWC A;  4KMA A;  4P9S A;  3IPJ A;  5C4X C;  1ISE A;  4KAR A;  3HOY K;  2R7Z C;  2Y0S D;  3HXA A;  2JA5 C;  5IOQ A;  4A93 C;  1O29 A;  2GSO A;  3FHZ A;  5IYC K;  2FQT A;  2RH6 A;  1DCO A;  4A3L C;  3GTP K;  1O25 A;  2B63 K;  2V6T A;  4A3G K;  3HOU C;  4WJ3 M;  3S1N C;  1I50 K;  1TWG K;  4QJV B;  5C4J C;  3S15 K;  2CFA A;  3GTG A;  1EK8 A;  1XZQ B;  5TJ3 A;  2WB1 D;  3GEH A;  3H0G A;  3N0C A;  4LR2 A;  3HOY C;  2GAG C;  4KDD A;  5E68 A;  3HKZ L;  1R9T K;  3M4O K;  3S2H C;  4XLN A;  5IYD K;  1O2B A;  4WJ4 A;  4A3D K;  2BE5 A;  4LK0 A;  3GTP C;  4GZY A;  4KMU A;  2GSN A;  3FOE A;  3CAG A;  5IOT A;  1JOE A;  2NVX A;  3A8I A;  2B63 C;  4BY1 K;  3GTQ A;  1O2F B;  3TFI A;  4A3G C;  1SMY A;  4PAB A;  1I50 C;  1TWG C;  1XXC A;  1WQG A;  1Y1V A;  3PO2 K;  3S15 C;  4G7Z A;  1F7U A;  2W7V A;  3ADA C;  4XSZ A;  4KN7 A;  1YNJ A;  2R93 A;  4GTC A;  3NUH A;  3PO3 K;  4QIW D;  4A3F K;  4C3H K;  1R9T C;  3GTM A;  3M4O C;  2PA8 L;  2O5J A;  1WSR A;  3FKI K;  5IOS A;  1Y1W K;  1I3Q K;  5IYD C;  4A3J K;  1XXB A;  3DXJ A;  3RZO K;  4A3C K;  1YCL A;  4C3I K;  4KAW X;  4BY1 C;  1O24 A;  2FQO A;  1C0A A;  4KMD A;  3PO2 C;  4OIR A;  4G7O A;  3VA7 A;  1ZYR A;  2NVT K;  3GTO A;  1O28 A;  3GTJ K;  1J6W A;  1IE0 A;  3ORE A;  3HOV K;  4KM9 A;  4MEY A;  2PHC B;  3I4M K;  1TWA A;  1K83 A;  3PO3 C;  4BY7 K;  1IW7 A;  4A3F C;  3GTK K;  2A6H A;  2PMZ L;  4C3H C;  4Q5S A;  1EI6 A;  3S1R K;  2JA8 K;  3H3V L;  4GTE A;  3FKI C;  1Y1W C;  1I3Q C;  4A3J C;  5EGH A;  3FOF A;  2ZUE A;  3RZO C;  4A3C C;  3S1Q K;  1GE9 A;  1RU0 A;  1EH1 A;  4KC6 A;  4LLG A;  4C3I C;  4BKW A;  2GAH C;  2R7Z A;  2JH3 A;  2JA5 A;  3L4J A;  4XSX A;  4FZB A;  2JA6 K;  4G0W A;  2NVT C;  2D6F C;  1BJT A;  2E2H K;  3GTJ C;  1YNN A;  3M3Y K;  3I4M C;  5M3F K;  3EQL A;  1TWF C;  3AQP A;  4BY7 C;  3S14 K;  3GTK C;  1PJ7 A;  3OPF A;  1ZBS A;  3S1R C;  2JA8 C;  5IP7 K;  4X6A K;  1WCM K;  3AD9 C;  3S2H K;  3V4G A;  2NVY K;  3BP3 A;  1DCH A;  3S1Q C;  3GTL K;  4O2D A;  2CFA B;  5FLM K;  1JVI A;  3MML B;  2XCR B;  3T00 A;  2WB1 L;  1USM A;  4BLB A;  1USO A;  3SZZ A;  5C3E K;  5D4D A;  2JA6 C;  2E2H C;  1O27 A;  3GTP A;  4BBS K;  3M3Y C;  2B63 A;  5L46 A;  2RGR A;  3S14 C;  1I50 A;  5IP7 C;  4BBR K;  4X6A C;  1WCM C;  5TMF A;  2NVY C;  1IBA A;  3GTL C;  3GEI A;  5JVO A;  5FLM C;  1SFO K;  2KWA A;  2VUM K;  2V6U A;  1R9T A;  1XXA A;  1ZVU A;  1O2A A;  2R92 K;  5C3E C;  1VRQ C;  2WAQ D;  2PPB A;  4QJV A;  5CHP A;  3G4A A;  2V6S A;  4A3K K;  1WOO A;  3G4C A;  2XCO A;  4BBS C;  4RMF A;  3BP8 C;  1HQM A;  4QIW L;  4YFX A;  1BDF A;  2XCQ A;  2A68 A;  4KM8 A;  2A6E A;  2O5I A;  4BBR C;  4LQY A;  3N0B A;  2R93 K;  2JA7 K;  3AQO A;  4OIO A;  4ILD A;  4KB4 A;  1IS1 A;  4AYB D;  1SFO C;  2VUM C;  1IQ0 A;  3QX3 A;  5M5X K;  3LAJ A;  4P5B A;  4OIN A;  3FKI A;  2R92 C;  1Y1W A;  1I3Q A;  4A3E K;  4A3K C;  3HOX C;  4WIL A;  2CW0 A;  4G0U A;  4A3B K;  5IP9 K;  1DD5 A;  1O26 A;  4G7H A;  3I4N K;  1TWF K;  1INN A;  3AD7 C;  4OIQ A;  1TWA K;  3GTJ A;  2R93 C;  2JA7 C;  3HOW K;  1WIH A;  2E2I K;  1VH2 A;  4XCH A;  4LJZ A;  3GTK A;  1TWH K;  1F7V A;  1UV7 A;  1I6V A;  3GDZ A;  4A3I K;  3RZD K;  3CQZ K;  1DCP A;  1EQR A;  4A3E C; 
#chains in the Genus database with same CATH homology
 1VH2 A;  1J6V A;  1JQW A;  4XCH A;  1VJE A;  1J6X A;  1YCL A;  2FQO A;  1J6W A;  1IE0 A;  1JVI A;  1VGX A;  2FQT A;  5E68 A;  1J98 A;  1JOE A;  1INN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...