5E68A

High resolution crystal structure of luxs - quorum sensor molecular complex from salmonella typhi at 1.58 angstroms
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
166
Chain Sequence
b'LLDSFAVDHTRMQAPAVRTAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title High resolution crystal structure of LuxS - Quorum sensor molecular complex from Salmonella typhi at 1.58 Angstroms
rcsb
source organism Salmonella typhi
molecule tags Lyase
total genus 46
structure length 166
sequence length 167
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 5e68A00
1VH2A 1J98A 1J6XA 2FQTA 5E68A 1VJEA 1JQWA 2FQOA 1JOEA 1JVIA 1J6WA 1YCLA 1IE0A 1INNA 1VGXA 1J6VA 4XCHA
chains in the Genus database with same CATH superfamily
4BY1C 3AD7C 3S1NC 1WQFA 3OPFA 4LR2A 3G4AA 3H3VD 3CAGA 1ZVUA 1BJTA 3H0GA 4BBRC 3H0GK 4BKWA 5JVOA 4GT9A 3HOVK 5M5XK 3IPJA 4A3JC 2NVTK 4P5BA 1ZBSA 4GTFA 4FM9A 4XLPA 3HKZD 4A3EC 2JA5A 1PJ5A 2JA5K 1BGWA 3FHZA 3GEIA 2JA6A 2JA6K 4A3CK 4QIWD 1O28A 3JSTA 4GFQA 3S1QC 3M3YC 3S16K 3HOZK 4ILDA 2GAGC 3OEPA 4KB4A 4C3HK 4KMAA 1XXAA 2E2IA 2WAQL 3I4NC 2NVQC 2A6HA 1WOOA 4BBSC 4A3KK 3T00A 3SZYA 1I6VA 4OIPA 3GTPC 1XXBA 4PABA 3TFHA 4GTDA 2P5MA 5FJ8K 1K83C 4C2MK 3S14C 4WJ3M 3DXJA 2R92A 1XZQB 1YCLA 2R92K 1O25A 1VH2A 2GSOA 3S1MC 2A69A 2A68A 1F9NA 2FQTA 3K7AK 4OIOA 3S2HK 4MQ9A 1I6HK 1AB4A 1EK8A 4LK0A 3HXAA 2YU9C 3S2DK 2ZFZA 1I3QA 3BUEA 1I3QK 1B4AA 1Y1VC 3AH5A 4C3IK 3GTJA 3GTJK 4XCHA 2P8TA 1TWAC 4A3GK 4Y7NC 5C44K 2Y0SD 5E68A 3H3VL 5C3EK 3CQZK 3HOWC 3AQOA 4A3MK 1BDFA 4KAWX 3AD8C 4GTAA 2BE5A 4OIRA 4Y52C 3V4GA 4A3IK 2JA8C 3TFIA 5TJ3A 3HKZL 1O24A 3MMLB 5TMCA 1WOPA 4XLNA 1L0WA 4G7HA 1I50C 4P9SA 5CJ9A 4QIWL 4C3JK 4Q5SA 5FLMC 2V6TA 1USOA 4KMUA 1O27A 1TWFA 2E2JC 3HOYC 1Y1VA 1TWFK 3HOUK 3GTKA 3GTKK 3GSIA 5IYDC 1TWCK 2NVXC 4WJ4A 1TWAA 4XSZA 4X6AK 2PPBA 1XZPB 1KQ4A 4BY7K 3FKIA 1PJ6A 5EGEA 3A8IA 4A3FK 3AQPA 3BP3A 4LQYA 4LK1A 4A3BK 4A3LC 5IYCK 2E2HC 3T01A 3RZDK 3GTGC 1DD5A 1TWGA 1TWGK 4G7OA 1VJEA 4KM9A 4A3DK 4BXXK 4LOWA 3S0XA 5C4XK 1Y1WC 4KMDA 1IL2A 1SFOA 5IP7C 5IOTA 1SFOK 2WB1D 2ZUEA 1DCPA 3RZOK 3GTOC 1EQRA 1IQ0A 2V6SA 2VUMC 3OREA 2R93A 3S17K 4BLAA 1R9TC 2R93K 4P5AA 3N0CA 4GTLA 2JH3A 2JA7A 2JA7K 1WIHA 1EI6A 4LJZA 5TMFA 2B63C 3GTMC 4GTCA 5M3FK 1DCHA 3PO3C 2E2IK 3I4MK 3M4OK 4BY1K 3S1NK 1WCMC 4MEYA 2A6EA 3PO2C 1USMA 5IYBC 2NVYC 3L4KA 5L46A 3A8KA 1JOEA 1TWHC 2GAHC 2Y3PA 4GTBA 4A3JK 3EQLA 1WSRA 1F7VA 3S1RC 4A3EK 4GTEA 1HQMA 5M3MK 5C4JC 2O5IA 3G4CA 5M5YK 2VUMA 1XZQA 3N3YA 4QJVB 2RGRA 4A93C 1O29A 3S1QK 1DCOA 2XCRB 3M3YK 1VLOA 3S15C 2R7ZC 3GTQC 5IP9C 3FOFA 1VRQC 4G0UA 1ZQ1C 3I4NK 1F7UA 1RU0A 1G51A 3GTLC 4BBSK 2O5JA 3QX3A 4BY7C 1WCMA 1O2AA 2WB1L 3GTPA 3ERED 3GTPK 1ISEA 3GEEA 2PMZD 1K83A 1IS1A 1K83K 3S14K 4KATA 1EFWA 1TWHA 3H0GC 4YFXA 4FZBA 5EGHA 1WSVA 2ZUFA 4JK1A 4KB2A 3HOVC 4BXXC 4OINA 4A3DC 1C0AA 2WAQD 2YU9A 2NVTC 3LAPA 2YU9K 3L4JA 3NUHA 3BP8C 3GDZA 1Y1VK 5CHPA 3TFJA 4O2DA 1SMYA 1PJ7A 2CW0A 4AYBD 2JA5C 3RZOC 1TWAK 5HL8A 2CFAB 1WQGA 3FKIK 4YFNA 4Y7NK 1VGXA 2JA6C 4KN7A 4M1XA 4A3CC 3HOWK 4KMHA 3S16C 4KASA 3HOZC 4G0VA 1YNJA 4C3HC 2PHCB 4Q4ZA 1J6VA 4KN4A 4Y52K 1XZPA 2JA8K 4GZYA 1WOSA 1F93A 4A3KC 1ZYRA 3N0BA 4XSXA 1GE9A 2KWAA 3VA7A 3HOXK 3FOEA 1YNNA 4C2MC 1WORA 1I50A 1I50K 2RH6A 2Y0SL 2R92C 3LPXA 5FLMK 3K7AC 3T02A 1I6HC 3S2HC 3Q3QA 2W7VA 1B4BA 2E2JK 3HOYK 3S2DC 5IOQA 1I3QC 3WODA 4C3IC 2NVXA 2PA8D 5IYDK 2NVXK 1X31C 3TTGA 3GTJC 1J98A 4A3GC 4KARA 4OIQA 5C44C 2E2HA 4A3LK 2E2HK 1V5VA 3GTGA 5C3EC 2PMZL 3CQZC 4BBRK 3GTGK 4A3MC 4G7ZA 1UV7A 1Y1WA 1Y1WK 1INNA 1O2FB 4MEXA 3GIRA 4AH6A 5IP7K 4A3IC 2V6UA 1J6WA 1XXCA 4C45A 2GSNA 5D4DA 1ZXOA 3GTOA 3GTOK 1JQWA 4AYBL 2FQOA 2GSUA 5IOSA 2VUMK 1R9TA 1EH1A 1R9TK 3A8JA 4ZH4A 4C3JC 4LLGA 2XCQA 2B63A 3GTMA 2B63K 3GTMK 2EBBA 5IORA 4RMFA 1TWFC 3HOUC 3PO3K 3GTKC 2NVQK 1TWCC 1O26A 5JFEA 1O2BA 4X6AC 3ADAC 4QJVA 4J3NA 1WCMK 3FKIC 3PO2K 1WQHA 4A3FC 1XPPA 3CQZA 5IYBK 2NVYA 4A3BC 1J6XA 2NVYK 5IYCC 3RZDC 1JVIA 1TWHK 1IE0A 1TWGC 4WILA 3S1MK 5C4XC 4PAAA 1IBAA 4KM8A 4BLBA 1SFOC 3S1RK 2XCOA 1BS2A 1HI9A 2PA8L 5C4JK 3AD9C 3LAJA 3HOXC 4YFKA 4A93K 4G0WA 3S17C 2R93C 4NOIA 4YG2A 3SZZA 2D6FC 2R7ZA 1YX2A 3S15K 3GTQA 2R7ZK 4KDDA 3GTQK 5IP9K 2JA7C 3GEHA 4DDQA 4KC6A 3GTLA 1TWCA 3GTLK 2E2IC 5M5WK 3I4MC 3M4OC 2CFAA 1IW7A
chains in the Genus database with same CATH topology
1VH2A 1J98A 1J6XA 2FQTA 5E68A 1VJEA 1JQWA 2FQOA 1JOEA 1JVIA 1J6WA 1YCLA 1IE0A 1INNA 1VGXA 1J6VA 4XCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH2 A;  1J98 A;  1J6X A;  2FQT A;  5E68 A;  1VJE A;  1JQW A;  2FQO A;  1JOE A;  1JVI A;  1J6W A;  1YCL A;  1IE0 A;  1INN A;  1VGX A;  1J6V A;  4XCH A; 
#chains in the Genus database with same CATH topology
 4BY1 C;  3AD7 C;  3S1N C;  1WQF A;  3OPF A;  4LR2 A;  3G4A A;  3H3V D;  3CAG A;  1ZVU A;  1BJT A;  3H0G A;  4BBR C;  3H0G K;  4BKW A;  5JVO A;  4GT9 A;  3HOV K;  5M5X K;  3IPJ A;  4A3J C;  2NVT K;  4P5B A;  1ZBS A;  4GTF A;  4FM9 A;  4XLP A;  3HKZ D;  4A3E C;  2JA5 A;  1PJ5 A;  2JA5 K;  1BGW A;  3FHZ A;  3GEI A;  2JA6 A;  2JA6 K;  4A3C K;  4QIW D;  1O28 A;  3JST A;  4GFQ A;  3S1Q C;  3M3Y C;  3S16 K;  3HOZ K;  4ILD A;  2GAG C;  3OEP A;  4KB4 A;  4C3H K;  4KMA A;  1XXA A;  2E2I A;  2WAQ L;  3I4N C;  2NVQ C;  2A6H A;  1WOO A;  4BBS C;  4A3K K;  3T00 A;  3SZY A;  1I6V A;  4OIP A;  3GTP C;  1XXB A;  4PAB A;  3TFH A;  4GTD A;  2P5M A;  5FJ8 K;  1K83 C;  4C2M K;  3S14 C;  4WJ3 M;  3DXJ A;  2R92 A;  1XZQ B;  1YCL A;  2R92 K;  1O25 A;  1VH2 A;  2GSO A;  3S1M C;  2A69 A;  2A68 A;  1F9N A;  2FQT A;  3K7A K;  4OIO A;  3S2H K;  4MQ9 A;  1I6H K;  1AB4 A;  1EK8 A;  4LK0 A;  3HXA A;  2YU9 C;  3S2D K;  2ZFZ A;  1I3Q A;  3BUE A;  1I3Q K;  1B4A A;  1Y1V C;  3AH5 A;  4C3I K;  3GTJ A;  3GTJ K;  4XCH A;  2P8T A;  1TWA C;  4A3G K;  4Y7N C;  5C44 K;  2Y0S D;  5E68 A;  3H3V L;  5C3E K;  3CQZ K;  3HOW C;  3AQO A;  4A3M K;  1BDF A;  4KAW X;  3AD8 C;  4GTA A;  2BE5 A;  4OIR A;  4Y52 C;  3V4G A;  4A3I K;  2JA8 C;  3TFI A;  5TJ3 A;  3HKZ L;  1O24 A;  3MML B;  5TMC A;  1WOP A;  4XLN A;  1L0W A;  4G7H A;  1I50 C;  4P9S A;  5CJ9 A;  4QIW L;  4C3J K;  4Q5S A;  5FLM C;  2V6T A;  1USO A;  4KMU A;  1O27 A;  1TWF A;  2E2J C;  3HOY C;  1Y1V A;  1TWF K;  3HOU K;  3GTK A;  3GTK K;  3GSI A;  5IYD C;  1TWC K;  2NVX C;  4WJ4 A;  1TWA A;  4XSZ A;  4X6A K;  2PPB A;  1XZP B;  1KQ4 A;  4BY7 K;  3FKI A;  1PJ6 A;  5EGE A;  3A8I A;  4A3F K;  3AQP A;  3BP3 A;  4LQY A;  4LK1 A;  4A3B K;  4A3L C;  5IYC K;  2E2H C;  3T01 A;  3RZD K;  3GTG C;  1DD5 A;  1TWG A;  1TWG K;  4G7O A;  1VJE A;  4KM9 A;  4A3D K;  4BXX K;  4LOW A;  3S0X A;  5C4X K;  1Y1W C;  4KMD A;  1IL2 A;  1SFO A;  5IP7 C;  5IOT A;  1SFO K;  2WB1 D;  2ZUE A;  1DCP A;  3RZO K;  3GTO C;  1EQR A;  1IQ0 A;  2V6S A;  2VUM C;  3ORE A;  2R93 A;  3S17 K;  4BLA A;  1R9T C;  2R93 K;  4P5A A;  3N0C A;  4GTL A;  2JH3 A;  2JA7 A;  2JA7 K;  1WIH A;  1EI6 A;  4LJZ A;  5TMF A;  2B63 C;  3GTM C;  4GTC A;  5M3F K;  1DCH A;  3PO3 C;  2E2I K;  3I4M K;  3M4O K;  4BY1 K;  3S1N K;  1WCM C;  4MEY A;  2A6E A;  3PO2 C;  1USM A;  5IYB C;  2NVY C;  3L4K A;  5L46 A;  3A8K A;  1JOE A;  1TWH C;  2GAH C;  2Y3P A;  4GTB A;  4A3J K;  3EQL A;  1WSR A;  1F7V A;  3S1R C;  4A3E K;  4GTE A;  1HQM A;  5M3M K;  5C4J C;  2O5I A;  3G4C A;  5M5Y K;  2VUM A;  1XZQ A;  3N3Y A;  4QJV B;  2RGR A;  4A93 C;  1O29 A;  3S1Q K;  1DCO A;  2XCR B;  3M3Y K;  1VLO A;  3S15 C;  2R7Z C;  3GTQ C;  5IP9 C;  3FOF A;  1VRQ C;  4G0U A;  1ZQ1 C;  3I4N K;  1F7U A;  1RU0 A;  1G51 A;  3GTL C;  4BBS K;  2O5J A;  3QX3 A;  4BY7 C;  1WCM A;  1O2A A;  2WB1 L;  3GTP A;  3ERE D;  3GTP K;  1ISE A;  3GEE A;  2PMZ D;  1K83 A;  1IS1 A;  1K83 K;  3S14 K;  4KAT A;  1EFW A;  1TWH A;  3H0G C;  4YFX A;  4FZB A;  5EGH A;  1WSV A;  2ZUF A;  4JK1 A;  4KB2 A;  3HOV C;  4BXX C;  4OIN A;  4A3D C;  1C0A A;  2WAQ D;  2YU9 A;  2NVT C;  3LAP A;  2YU9 K;  3L4J A;  3NUH A;  3BP8 C;  3GDZ A;  1Y1V K;  5CHP A;  3TFJ A;  4O2D A;  1SMY A;  1PJ7 A;  2CW0 A;  4AYB D;  2JA5 C;  3RZO C;  1TWA K;  5HL8 A;  2CFA B;  1WQG A;  3FKI K;  4YFN A;  4Y7N K;  1VGX A;  2JA6 C;  4KN7 A;  4M1X A;  4A3C C;  3HOW K;  4KMH A;  3S16 C;  4KAS A;  3HOZ C;  4G0V A;  1YNJ A;  4C3H C;  2PHC B;  4Q4Z A;  1J6V A;  4KN4 A;  4Y52 K;  1XZP A;  2JA8 K;  4GZY A;  1WOS A;  1F93 A;  4A3K C;  1ZYR A;  3N0B A;  4XSX A;  1GE9 A;  2KWA A;  3VA7 A;  3HOX K;  3FOE A;  1YNN A;  4C2M C;  1WOR A;  1I50 A;  1I50 K;  2RH6 A;  2Y0S L;  2R92 C;  3LPX A;  5FLM K;  3K7A C;  3T02 A;  1I6H C;  3S2H C;  3Q3Q A;  2W7V A;  1B4B A;  2E2J K;  3HOY K;  3S2D C;  5IOQ A;  1I3Q C;  3WOD A;  4C3I C;  2NVX A;  2PA8 D;  5IYD K;  2NVX K;  1X31 C;  3TTG A;  3GTJ C;  1J98 A;  4A3G C;  4KAR A;  4OIQ A;  5C44 C;  2E2H A;  4A3L K;  2E2H K;  1V5V A;  3GTG A;  5C3E C;  2PMZ L;  3CQZ C;  4BBR K;  3GTG K;  4A3M C;  4G7Z A;  1UV7 A;  1Y1W A;  1Y1W K;  1INN A;  1O2F B;  4MEX A;  3GIR A;  4AH6 A;  5IP7 K;  4A3I C;  2V6U A;  1J6W A;  1XXC A;  4C45 A;  2GSN A;  5D4D A;  1ZXO A;  3GTO A;  3GTO K;  1JQW A;  4AYB L;  2FQO A;  2GSU A;  5IOS A;  2VUM K;  1R9T A;  1EH1 A;  1R9T K;  3A8J A;  4ZH4 A;  4C3J C;  4LLG A;  2XCQ A;  2B63 A;  3GTM A;  2B63 K;  3GTM K;  2EBB A;  5IOR A;  4RMF A;  1TWF C;  3HOU C;  3PO3 K;  3GTK C;  2NVQ K;  1TWC C;  1O26 A;  5JFE A;  1O2B A;  4X6A C;  3ADA C;  4QJV A;  4J3N A;  1WCM K;  3FKI C;  3PO2 K;  1WQH A;  4A3F C;  1XPP A;  3CQZ A;  5IYB K;  2NVY A;  4A3B C;  1J6X A;  2NVY K;  5IYC C;  3RZD C;  1JVI A;  1TWH K;  1IE0 A;  1TWG C;  4WIL A;  3S1M K;  5C4X C;  4PAA A;  1IBA A;  4KM8 A;  4BLB A;  1SFO C;  3S1R K;  2XCO A;  1BS2 A;  1HI9 A;  2PA8 L;  5C4J K;  3AD9 C;  3LAJ A;  3HOX C;  4YFK A;  4A93 K;  4G0W A;  3S17 C;  2R93 C;  4NOI A;  4YG2 A;  3SZZ A;  2D6F C;  2R7Z A;  1YX2 A;  3S15 K;  3GTQ A;  2R7Z K;  4KDD A;  3GTQ K;  5IP9 K;  2JA7 C;  3GEH A;  4DDQ A;  4KC6 A;  3GTL A;  1TWC A;  3GTL K;  2E2I C;  5M5W K;  3I4M C;  3M4O C;  2CFA A;  1IW7 A; 
#chains in the Genus database with same CATH homology
 1VH2 A;  1J98 A;  1J6X A;  2FQT A;  5E68 A;  1VJE A;  1JQW A;  2FQO A;  1JOE A;  1JVI A;  1J6W A;  1YCL A;  1IE0 A;  1INN A;  1VGX A;  1J6V A;  4XCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...