5E68A

High resolution crystal structure of luxs - quorum sensor molecular complex from salmonella typhi at 1.58 angstroms
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
167
structure length
166
Chain Sequence
LLDSFAVDHTRMQAPAVRTAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of LuxS - Quorum sensor molecular complex from Salmonella typhi at 1.58 Angstroms
rcsb
source organism Salmonella typhi
molecule tags Lyase
molecule keywords S-ribosylhomocysteine lyase
total genus 46
structure length 166
sequence length 167
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 5e68A00
1J6WA 4XCHA 1VGXA 1IE0A 5E68A 1VH2A 1INNA 2FQOA 1VJEA 1YCLA 1JQWA 1J6XA 2FQTA 1J98A 1JOEA 1JVIA 1J6VA
chains in the Genus database with same CATH superfamily
1J6WA 1RU0A 2PPBA 4KATA 2JA5A 3N0CA 4BY7C 3RZOK 1DCHA 4BBRK 1WOPA 3CQZA 4GTLA 3HKZL 1USMA 4KMDA 4ILDA 4GZYA 2W7VA 4A3MC 2Y0SD 3BP3A 3GTKC 4WJ3M 4KM8A 2R93A 1DCOA 1O29A 1X31C 4YFXA 3L4JA 2RH6A 1TWCC 3EQLA 4G0VA 4MEXA 3CQZC 4A3KK 4FZBA 4RMFA 5IP9C 4A3FC 2NVYK 1BGWA 4A3EC 5IYCK 4ZH4A 1IS1A 1YNJA 4C3HC 4A3CK 4XCHA 3JSTA 5C4XC 1Y1VC 3T01A 4A3JC 4PAAA 4BKWA 4G7HA 2A6HA 2D6FC 5D4DA 1IBAA 5M5YK 1WIHA 1K83K 1WQHA 5IOSA 2VUMK 1ZBSA 3HOWC 1ZQ1C 4KMUA 2NVQK 3GTLA 1Y1VA 1I6VA 1VLOA 1HQMA 4Q5SA 1Y1WC 2PMZL 1EK8A 3AD7C 4C3IK 3WODA 2CW0A 2R7ZK 3M3YK 3OEPA 5JVOA 4C3JC 1I6HK 3T00A 1TWAC 3HOUC 3NUHA 3TFJA 5IYBK 1AB4A 2NVYA 4NOIA 3GTKA 3HOWK 3FKIC 2B63K 4LQYA 3PO3C 3S1QC 4GTEA 1TWFC 1F93A 3OPFA 4C2MC 4G7ZA 5EGEA 1ZXOA 2V6SA 2PHCB 1XZPB 4C3IC 1BJTA 4YG2A 5C3EC 5IP7K 3HOVK 3PO2C 4AYBL 2PA8L 4GTBA 5IORA 1R9TA 4A3BK 2GAGC 2R92K 2E2JK 2E2IK 2RGRA 3GTQC 1O2BA 5IYDK 4KB2A 4A3IK 1F7UA 4QIWL 2JA7C 3HOZC 3I4MK 1ISEA 3AH5A 1WCMC 1TWAA 1VJEA 3S1RC 1XZQB 2BE5A 1TWGC 2NVYC 3L4KA 2E2IA 1INNA 1JOEA 4A3BC 1WQGA 3TFHA 4A3CC 4M1XA 1WQFA 3TFIA 2A69A 2A68A 4MQ9A 2R93C 3HOXC 4A93K 1VGXA 1B4AA 2JA8C 4XLPA 3S1NK 1BS2A 1I3QK 4KAWX 2YU9A 2O5JA 1IL2A 1YX2A 2WB1D 3GTJC 4GTDA 4WILA 1XXCA 3GSIA 3H3VL 4C2MK 1I50C 2JA6K 1TWGK 3AQPA 3GTGC 3DXJA 3S14C 3RZOC 3M4OK 4A3GC 4XSZA 1Y1VK 1UV7A 4GTFA 4BBRC 3GEIA 2JA6C 1SFOA 3AD8C 1O24A 3IPJA 1K83C 5C4JK 1J6XA 1I6HC 1F7VA 4G0UA 2JH3A 1JQWA 2R92C 1SFOK 1Y1WA 3LAJA 4C3JK 4BLBA 4OIQA 4P5BA 3GTMK 2Y0SL 3GDZA 3FKIA 2WB1L 1K83A 5C44C 3S0XA 4BY1C 1WCMK 5IOQA 5M5XK 1IE0A 2R7ZA 3HOXK 4A93C 2VUMC 3AD9C 3GTOK 1YCLA 4BY7K 3K7AK 3S1MC 1G51A 2GAHC 3S2DK 3S1NC 5IYDC 1WOOA 3SZZA 5JFEA 1F9NA 2VUMA 4KN7A 2P5MA 2R7ZC 1EFWA 3A8IA 1O28A 4LR2A 5FJ8K 3I4MC 5C3EK 3M3YC 5M3MK 4KMAA 4QIWD 3HXAA 3GEHA 1PJ5A 1TWCA 4A3KC 4A3EK 2PMZD 4QJVB 2GSUA 4A3FK 3I4NK 3S2DC 3GTPC 2O5IA 1XZQA 3K7AC 4QJVA 3FKIK 4MEYA 2E2HC 4A3DC 4G0WA 1SMYA 3GIRA 1EQRA 4AYBD 5CJ9A 1J6VA 4OIPA 3ADAC 2ZUFA 4KM9A 1XXBA 1B4BA 2V6TA 4P5AA 3GTPA 4KASA 5L46A 3QX3A 1XPPA 2B63C 1O25A 1WSRA 1TWFK 1I50A 3S17K 4A3LK 4JK1A 4AH6A 3CQZK 1EH1A 1YNNA 3S14K 3H0GA 4YFKA 1TWCK 4GT9A 4O2DA 1L0WA 2B63A 2YU9C 5E68A 1PJ6A 3T02A 3GEEA 3V4GA 4BLAA 4Q4ZA 2WAQD 3LPXA 5M3FK 2FQTA 5TMFA 2Y3PA 3HKZD 3S17C 4A3LC 2E2HA 4WJ4A 5EGHA 2XCRB 3FOEA 3LAPA 1USOA 5IYBC 1O27A 4LOWA 4FM9A 3S2HK 4BXXK 1ZYRA 5C4XK 2E2HK 4A3DK 3S15K 3HOYK 4DDQA 1XXAA 4LK1A 2XCOA 5HL8A 3S16K 2EBBA 3G4AA 1KQ4A 2JA7A 1I3QA 2FQOA 3GTMC 3VA7A 3Q3QA 2E2IC 1Y1WK 5FLMK 4YFNA 5C44K 5IP7C 1DCPA 4Y52C 4X6AC 3H0GK 1EI6A 2XCQA 1TWHC 4LK0A 5M5WK 1WSVA 3HOZK 4Y7NK 3GTLK 4LJZA 1PJ7A 4A3IC 3GTGK 3GTJA 4KB4A 3M4OC 4J3NA 3N0BA 4A3GK 1ZVUA 3PO3K 2NVXK 3S1QK 3RZDC 4GTCA 1VRQC 3BUEA 4G7OA 3HOVC 3SZYA 2NVXA 3GTKK 3CAGA 1R9TK 4BBSK 5TMCA 4OIRA 2JA8K 3GTGA 1V5VA 1I3QC 1SFOC 3GTMA 1I50K 1TWFA 4Y7NC 3GTLC 1IW7A 3MMLB 3N3YA 4PABA 3PO2K 2NVTK 2PA8D 4OIOA 3GTPK 3BP8C 4KARA 3OREA 3GTOA 2WAQL 2GSNA 3ERED 3HOYC 4C45A 1WORA 3S1RK 4KDDA 1WCMA 4BBSC 1BDFA 4LLGA 4A3JK 2P8TA 2V6UA 4X6AK 3FOFA 3S16C 4KN4A 3GTQA 3A8KA 4C3HK 5IP9K 1O26A 2JA6A 5IYCC 2JA5K 5FLMC 1O2AA 4GTAA 2KWAA 3H0GC 4KC6A 2ZUEA 2CFAB 3GTJK 1TWHK 1IQ0A 4XSXA 4BY1K 4GFQA 5TJ3A 1J98A 2E2JC 2A6EA 3AQOA 3H3VD 1C0AA 2NVQC 1XZPA 1R9TC 3RZDK 4BXXC 3S15C 3GTOC 1O2FB 4KMHA 1VH2A 2JA5C 3GTQK 1TWAK 2NVTC 2JA7K 1DD5A 3S2HC 4P9SA 3S1MK 3HOUK 2GSOA 2CFAA 1TWGA 5CHPA 4Y52K 2ZFZA 3FHZA 1WOSA 3G4CA 4OINA 2R92A 3I4NC 5C4JC 5IOTA 3A8JA 1JVIA 3TTGA 2YU9K 2R93K 4XLNA 1HI9A 1TWHA 1GE9A 4A3MK 2NVXC
chains in the Genus database with same CATH topology
1J6WA 4XCHA 1VGXA 1IE0A 5E68A 1VH2A 1INNA 2FQOA 1VJEA 1YCLA 1JQWA 1J6XA 2FQTA 1J98A 1JOEA 1JVIA 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6W A;  4XCH A;  1VGX A;  1IE0 A;  5E68 A;  1VH2 A;  1INN A;  2FQO A;  1VJE A;  1YCL A;  1JQW A;  1J6X A;  2FQT A;  1J98 A;  1JOE A;  1JVI A;  1J6V A; 
#chains in the Genus database with same CATH topology
 1J6W A;  1RU0 A;  2PPB A;  4KAT A;  2JA5 A;  3N0C A;  4BY7 C;  3RZO K;  1DCH A;  4BBR K;  1WOP A;  3CQZ A;  4GTL A;  3HKZ L;  1USM A;  4KMD A;  4ILD A;  4GZY A;  2W7V A;  4A3M C;  2Y0S D;  3BP3 A;  3GTK C;  4WJ3 M;  4KM8 A;  2R93 A;  1DCO A;  1O29 A;  1X31 C;  4YFX A;  3L4J A;  2RH6 A;  1TWC C;  3EQL A;  4G0V A;  4MEX A;  3CQZ C;  4A3K K;  4FZB A;  4RMF A;  5IP9 C;  4A3F C;  2NVY K;  1BGW A;  4A3E C;  5IYC K;  4ZH4 A;  1IS1 A;  1YNJ A;  4C3H C;  4A3C K;  4XCH A;  3JST A;  5C4X C;  1Y1V C;  3T01 A;  4A3J C;  4PAA A;  4BKW A;  4G7H A;  2A6H A;  2D6F C;  5D4D A;  1IBA A;  5M5Y K;  1WIH A;  1K83 K;  1WQH A;  5IOS A;  2VUM K;  1ZBS A;  3HOW C;  1ZQ1 C;  4KMU A;  2NVQ K;  3GTL A;  1Y1V A;  1I6V A;  1VLO A;  1HQM A;  4Q5S A;  1Y1W C;  2PMZ L;  1EK8 A;  3AD7 C;  4C3I K;  3WOD A;  2CW0 A;  2R7Z K;  3M3Y K;  3OEP A;  5JVO A;  4C3J C;  1I6H K;  3T00 A;  1TWA C;  3HOU C;  3NUH A;  3TFJ A;  5IYB K;  1AB4 A;  2NVY A;  4NOI A;  3GTK A;  3HOW K;  3FKI C;  2B63 K;  4LQY A;  3PO3 C;  3S1Q C;  4GTE A;  1TWF C;  1F93 A;  3OPF A;  4C2M C;  4G7Z A;  5EGE A;  1ZXO A;  2V6S A;  2PHC B;  1XZP B;  4C3I C;  1BJT A;  4YG2 A;  5C3E C;  5IP7 K;  3HOV K;  3PO2 C;  4AYB L;  2PA8 L;  4GTB A;  5IOR A;  1R9T A;  4A3B K;  2GAG C;  2R92 K;  2E2J K;  2E2I K;  2RGR A;  3GTQ C;  1O2B A;  5IYD K;  4KB2 A;  4A3I K;  1F7U A;  4QIW L;  2JA7 C;  3HOZ C;  3I4M K;  1ISE A;  3AH5 A;  1WCM C;  1TWA A;  1VJE A;  3S1R C;  1XZQ B;  2BE5 A;  1TWG C;  2NVY C;  3L4K A;  2E2I A;  1INN A;  1JOE A;  4A3B C;  1WQG A;  3TFH A;  4A3C C;  4M1X A;  1WQF A;  3TFI A;  2A69 A;  2A68 A;  4MQ9 A;  2R93 C;  3HOX C;  4A93 K;  1VGX A;  1B4A A;  2JA8 C;  4XLP A;  3S1N K;  1BS2 A;  1I3Q K;  4KAW X;  2YU9 A;  2O5J A;  1IL2 A;  1YX2 A;  2WB1 D;  3GTJ C;  4GTD A;  4WIL A;  1XXC A;  3GSI A;  3H3V L;  4C2M K;  1I50 C;  2JA6 K;  1TWG K;  3AQP A;  3GTG C;  3DXJ A;  3S14 C;  3RZO C;  3M4O K;  4A3G C;  4XSZ A;  1Y1V K;  1UV7 A;  4GTF A;  4BBR C;  3GEI A;  2JA6 C;  1SFO A;  3AD8 C;  1O24 A;  3IPJ A;  1K83 C;  5C4J K;  1J6X A;  1I6H C;  1F7V A;  4G0U A;  2JH3 A;  1JQW A;  2R92 C;  1SFO K;  1Y1W A;  3LAJ A;  4C3J K;  4BLB A;  4OIQ A;  4P5B A;  3GTM K;  2Y0S L;  3GDZ A;  3FKI A;  2WB1 L;  1K83 A;  5C44 C;  3S0X A;  4BY1 C;  1WCM K;  5IOQ A;  5M5X K;  1IE0 A;  2R7Z A;  3HOX K;  4A93 C;  2VUM C;  3AD9 C;  3GTO K;  1YCL A;  4BY7 K;  3K7A K;  3S1M C;  1G51 A;  2GAH C;  3S2D K;  3S1N C;  5IYD C;  1WOO A;  3SZZ A;  5JFE A;  1F9N A;  2VUM A;  4KN7 A;  2P5M A;  2R7Z C;  1EFW A;  3A8I A;  1O28 A;  4LR2 A;  5FJ8 K;  3I4M C;  5C3E K;  3M3Y C;  5M3M K;  4KMA A;  4QIW D;  3HXA A;  3GEH A;  1PJ5 A;  1TWC A;  4A3K C;  4A3E K;  2PMZ D;  4QJV B;  2GSU A;  4A3F K;  3I4N K;  3S2D C;  3GTP C;  2O5I A;  1XZQ A;  3K7A C;  4QJV A;  3FKI K;  4MEY A;  2E2H C;  4A3D C;  4G0W A;  1SMY A;  3GIR A;  1EQR A;  4AYB D;  5CJ9 A;  1J6V A;  4OIP A;  3ADA C;  2ZUF A;  4KM9 A;  1XXB A;  1B4B A;  2V6T A;  4P5A A;  3GTP A;  4KAS A;  5L46 A;  3QX3 A;  1XPP A;  2B63 C;  1O25 A;  1WSR A;  1TWF K;  1I50 A;  3S17 K;  4A3L K;  4JK1 A;  4AH6 A;  3CQZ K;  1EH1 A;  1YNN A;  3S14 K;  3H0G A;  4YFK A;  1TWC K;  4GT9 A;  4O2D A;  1L0W A;  2B63 A;  2YU9 C;  5E68 A;  1PJ6 A;  3T02 A;  3GEE A;  3V4G A;  4BLA A;  4Q4Z A;  2WAQ D;  3LPX A;  5M3F K;  2FQT A;  5TMF A;  2Y3P A;  3HKZ D;  3S17 C;  4A3L C;  2E2H A;  4WJ4 A;  5EGH A;  2XCR B;  3FOE A;  3LAP A;  1USO A;  5IYB C;  1O27 A;  4LOW A;  4FM9 A;  3S2H K;  4BXX K;  1ZYR A;  5C4X K;  2E2H K;  4A3D K;  3S15 K;  3HOY K;  4DDQ A;  1XXA A;  4LK1 A;  2XCO A;  5HL8 A;  3S16 K;  2EBB A;  3G4A A;  1KQ4 A;  2JA7 A;  1I3Q A;  2FQO A;  3GTM C;  3VA7 A;  3Q3Q A;  2E2I C;  1Y1W K;  5FLM K;  4YFN A;  5C44 K;  5IP7 C;  1DCP A;  4Y52 C;  4X6A C;  3H0G K;  1EI6 A;  2XCQ A;  1TWH C;  4LK0 A;  5M5W K;  1WSV A;  3HOZ K;  4Y7N K;  3GTL K;  4LJZ A;  1PJ7 A;  4A3I C;  3GTG K;  3GTJ A;  4KB4 A;  3M4O C;  4J3N A;  3N0B A;  4A3G K;  1ZVU A;  3PO3 K;  2NVX K;  3S1Q K;  3RZD C;  4GTC A;  1VRQ C;  3BUE A;  4G7O A;  3HOV C;  3SZY A;  2NVX A;  3GTK K;  3CAG A;  1R9T K;  4BBS K;  5TMC A;  4OIR A;  2JA8 K;  3GTG A;  1V5V A;  1I3Q C;  1SFO C;  3GTM A;  1I50 K;  1TWF A;  4Y7N C;  3GTL C;  1IW7 A;  3MML B;  3N3Y A;  4PAB A;  3PO2 K;  2NVT K;  2PA8 D;  4OIO A;  3GTP K;  3BP8 C;  4KAR A;  3ORE A;  3GTO A;  2WAQ L;  2GSN A;  3ERE D;  3HOY C;  4C45 A;  1WOR A;  3S1R K;  4KDD A;  1WCM A;  4BBS C;  1BDF A;  4LLG A;  4A3J K;  2P8T A;  2V6U A;  4X6A K;  3FOF A;  3S16 C;  4KN4 A;  3GTQ A;  3A8K A;  4C3H K;  5IP9 K;  1O26 A;  2JA6 A;  5IYC C;  2JA5 K;  5FLM C;  1O2A A;  4GTA A;  2KWA A;  3H0G C;  4KC6 A;  2ZUE A;  2CFA B;  3GTJ K;  1TWH K;  1IQ0 A;  4XSX A;  4BY1 K;  4GFQ A;  5TJ3 A;  1J98 A;  2E2J C;  2A6E A;  3AQO A;  3H3V D;  1C0A A;  2NVQ C;  1XZP A;  1R9T C;  3RZD K;  4BXX C;  3S15 C;  3GTO C;  1O2F B;  4KMH A;  1VH2 A;  2JA5 C;  3GTQ K;  1TWA K;  2NVT C;  2JA7 K;  1DD5 A;  3S2H C;  4P9S A;  3S1M K;  3HOU K;  2GSO A;  2CFA A;  1TWG A;  5CHP A;  4Y52 K;  2ZFZ A;  3FHZ A;  1WOS A;  3G4C A;  4OIN A;  2R92 A;  3I4N C;  5C4J C;  5IOT A;  3A8J A;  1JVI A;  3TTG A;  2YU9 K;  2R93 K;  4XLN A;  1HI9 A;  1TWH A;  1GE9 A;  4A3M K;  2NVX C; 
#chains in the Genus database with same CATH homology
 1J6W A;  4XCH A;  1VGX A;  1IE0 A;  5E68 A;  1VH2 A;  1INN A;  2FQO A;  1VJE A;  1YCL A;  1JQW A;  1J6X A;  2FQT A;  1J98 A;  1JOE A;  1JVI A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...