5E6HA

A linked jumonji domain of the kdm5a lysine demethylase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
317
structure length
294
Chain Sequence
EFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Characterization of a Linked Jumonji Domain of the KDM5/JARID1 Family of Histone H3 Lysine 4 Demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 294
sequence length 317
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5e6hA00
2OX0A 5FZ3A 4D6RA 4CCLA 4EZ4A 2YU2A 4QXHA 5FZOA 4DIQA 4CCMA 3PUQA 3PTRB 4GJZA 2XUEA 5FZ0A 4D6SA 5FYTA 5FYBA 5IWFA 5FY8A 4UF0B 5F37A 4NUBA 5FY4A 2GP3A 5A7QA 5IVCA 5IVJA 4QX7A 5FXXA 5FV3A 5LWBA 5FZMA 1VRBA 3KV6A 2XDVA 5FZLA 3N9MA 2Q8CA 5FUNA 3DXUA 5FZBA 5IVYA 4D6QA 2P5BA 5LW9A 5FZAA 4QU1A 4QXBA 5FPUA 4DO0A 5IVFA 3U4SA 5IVEA 3KVAA 3N9NA 5F32A 2YPDA 5FZGA 5FY0A 4LIVA 2YBKA 5FYVA 2OQ7A 5IVBA 5FZIA 5FXWA 5FZ1A 5IW0A 2Q8DA 5F2WA 5FZEA 5A7WA 2XXZA 5FYUA 5FZFA 5A1FA 3UYJA 5FPVA 5FP8A 4AI9A 5CEHA 4Y33A 4V2WA 5KR7A 4LIUA 3KV5A 4BU2A 5FZOB 3RVHA 5FYSA 4C8DA 5IVVA 5FP9A 5FY7A 4LITA 2XMLA 4HOOA 5FZDA 3LD8A 5A3WA 3DXTA 4E4HA 5LY1A 3PUSA 5FJKA 4CUGA 4GJYA 4XDPA 3KV4A 5FP7A 4BXFA 4CSWA 5E6HA 5A7OA 5A80A 2GP5A 4QXCA 3OPTA 4Y4RA 5FZHA 3K3NA 4BISA 4TN7A 3AL6A 5LY2A 5FUPA 4CCJA 5F2SA 2PXJA 5FYZA 3PURA 5F3EA 3PU3A 5FZKA 5FXZA 2YBPA 5K4LA 3ZPOA 2YU1A 4V2VA 3ZLIA 5F5AA 4GAZA 4IGQA 5FY9A 4CCNA 3AVSA 5FP4A 3KVBA 5F39A 4IGOA 4LXLA 5A7WB 5FZ7A 5FYIA 5ANQA 2Q8EA 5FJHA 3PU8A 5FYYA 3N9PA 5FZ9A 3PUAA 4IGPA 2YBSA 5FY1A 3AVRA 5FZCA 2OT7A 5F3IA 4EZHA 5A3NA 4UF0A 3NJYA 5FY5A 5A7SA 2WWJA 4AAPA 5FYHA 5FWJA 2VD7A 5FZ6A 5FPLA 4ASKA 3N9LA 3OPWA 3LDBA 5F5IA 5A3PA 2OQ6A 3N9QA 5FYMA 5F5CA 5ISLA 5FPAA 4GD4A 2W2IA 3U78A 5FZ4A 5A7PA 4EYUA 5FBJA 3K2OA 5FP3A 3AL5A 5FPBA 4CCOA 5FZ8A 3N9OA 4Y3OA 5FYCA 4CCKA 5A1LA 5FWEA 5F3CA 5FXVA 2OS2A 5A7NA 3K3OA 3PDQA 4HONA 4XDOA 5F3GA 4URAA 5A3TA 2WWUA 4QX8A 3KV9A 4QWNA
chains in the Genus database with same CATH superfamily
1URXA 2WKKA 4FSJA 5K0UC 4D6RA 4Z2WA 3ROUA 1BMV1 1EUUA 1YYNA 2VY0A 5LRRA 4GWIA 2ZGMA 4OFGA 4QXHA 4YVSC 3S7IA 3PUQA 3QH6A 1HW5A 3PTYA 4GIQA 3SC7X 4QQ2A 3B00A 4PLNA 1RJ8A 5LA1A 4UF0B 2WL1A 2K0GA 4BQ5A 3VD7A 3ZIWA 5IVCA 3RI9A 5DMYA 4XW3A 3FLTA 1PHMA 3SKJE 2ORXA 4MADA 5I8SA 2WR9A 4RL7A 5IJRA 4UXAA 3KV6A 2RHPA 4MYEA 5LATA 1KJLA 2GNMA 2ZGTA 2JB8A 4QPIC 2CWSA 2EIDA 2YB7A 1LOCA 2JDHA 3IWZA 2WAAA 2WNUC 3FE5A 2J1EA 2B9UA 3JXSA 4TWTA 5D1IA 2XONA 1PX4A 2EIEA 2JDYA 3ME2A 4Z92B 2UY9A 3N9NA 2DCJA 1D2QA 3E97A 3NV1A 5F32A 4QX5A 2HWE1 4E9KA 2H0BA 4D7TA 3KD4A 1OUXA 2WNOA 4D69A 1RUD2 1V6JA 4ISRA 1Y3TA 5F2WA 5HPOA 1JU3A 4FPKA 4FPEA 4P9WA 3E1F1 4K20A 4IETA 4Q0PA 5FYUA 3JB8A 2PAKA 3GBWA 3ZYJB 4MG2A 1NZIA 3KGZA 1DGWA 4LHNA 5IK8A 1O4YA 1W6MA 2QQWA 5FAXA 5C9AB 1LGCA 1UX7A 2C26A 4IEQA 1JBCA 5L19A 1D2SA 1HJFA 2PFWA 2ZEXA 3P1IA 5E1RA 3ZN5A 4LO6B 2R1BA 1ASJ3 1RUG1 4XUTA 1PVC3 1BLZA 2Z5WA 3LD8A 2BQPA 3T1LA 1LOFC 1LHOA 1WUVA 2XVKA 1RUH1 5EZWA 3ZDVA 4WBBA 1XE8A 2R062 3ETQA 2PLV2 5HV4A 1UYYA 4L0PA 2Q1ZB 3IB3A 4U2AA 1WD4A 2XJTA 4Y4YA 4BXFA 1UXXX 3CU7A 4QXCA 2CU5A 4A7YA 4NROA 2Q30A 5LASA 1E5IA 2TNFA 5LY2A 5I91A 1NOVA 4Z2AA 4XEZA 3BVCA 1Q8QA 3J7LA 2C0ZA 4JHZA 2L9LA 3PURA 3VD9A 3ZO0B 1F5JA 2AUYA 1RIRA 3ACHA 5FXZA 3T0BA 5CFCB 3AFKA 2RMU1 4JCKA 2W95A 5DABA 1UZ0A 2G4IA 3ZM8A 3VDBA 3IMMA 2VOVA 3WNNA 2IZWA 4QPGC 2DVBA 3THPA 2PELA 4JGZC 4LULA 3GCXA 1F8VA 2BOIA 2VBDA 2Y6KA 4PQ9A 4ATEA 1UMIA 5BNOC 4CU9A 5KHJA 1Y9MA 2C9KA 1QJY1 4XXPA 1WCQA 3AZYA 4XYXA 1JHJA 3VBHC 1FOD2 2WS92 2XJUA 3LB9A 4CDUA 1H9PA 1RHI3 4LBNA 1ZZ7A 4IE4A 2MNGA 1PZ9A 4W6WA 2D6LX 1YFWA 2WJSA 3X29B 3H3LA 3SXWA 1GMMA 1YFXA 1W6OB 1AL22 2D5HA 2NQYA 4I0BA 1PO21 1G9DA 4O61A 4AXOA 3TAYA 3WNPA 4Q4W2 1SDWA 3EQEA 4Y3OA 3HT2A 1R082 3EO6A 1VP6A 4NN0A 5FWEA 3SISA 5LK7B 5J1XA 3K3OA 1OPOA 4IV1A 1G86A 3AP6A 1UYXA 2XBO2 3ZFEC 1C5HA 3LE0A 4BHPA 2BNMA 3O7OA 1W90A 4ZS3A 2PAEA 2YGLA 4HN1A 3VDDB 5FYTA 5DAPA 1VE0A 1G6NA 2VZTA 5IFTA 1FNZA 2PHUA 2WO2A 1AUYA 2JD4A 1ND3B 4A41A 3LEMA 1X9PA 2XJVA 2AREA 3M70A 2RS32 1REFA 1H6YA 1CWPA 1HJGA 5HCFA 4WVWA 4YW2A 2R061 2PLV1 2P5BA 2NYYA 4RQPA 1DGWX 1CJPA 1Q56A 1WA6X 4AEKA 5HV0A 1CESA 1C1LA 1AR73 4XFGA 4QB1A 4A44A 1RXGA 1QH6A 5L36A 5JSPA 4ARYA 3WQ7A 1CGPA 4D8MA 3TNPB 1W39A 1RXFA 3V0AB 5LA0A 2RS53 4AEMA 2WA4A 5FRAA 3VZLA 4ASLA 1KD7A 4V2WA 2Y6FA 4WVVA 1FX5A 4YW1A 2AGSA 4PLOA 4FTSA 5A6YA 1NZCA 1O5LA 1FYUA 2NLRA 2AACA 4Q4V2 1TME2 3S30A 1Q8PA 3OB8A 4OUEA 5F9TA 3GDBA 4AHXA 1GOGA 4YM3A 1YLLA 3AX4A 3ZVXA 2HYXA 1L3JA 3PIJA 1YIPA 3VBOB 4W4ZA 3UGGA 1CQ9A 3WSOA 3ZR6A 3UKTA 1VBA1 1O5UA 5JI9A 1SPPA 1JUIA 2EVXA 4Q2FA 2IVIB 4QKDA 4MLOA 2WS91 5GZDA 2O1QA 5EWSA 1CX1A 4EN6B 1MEC2 5E6HA 2FHRA 4JKKA 1JUHA 2WO3A 3CHXA 5D8AB 1OOPC 1VRH3 3RYPA 5CKQA 4IW3A 2HWD1 2W5FA 1RL3A 2YDEA 2ARAA 4GMP1 1OFSA 5FO7B 2VMCA 3J7HA 2JEMA 4Q4W1 3ZPOA 4ZZ8A 2WSVA 2ID4A 1NCRC 4QB6A 4XHXA 1R081 2I2SA 2YROA 1AR82 4N43A 1PO13 3SCGA 3ZXGA 4DFSA 3E6CC 5FYIA 4ES9A 4ET7A 1R64A 1JI6A 3I54A 2D93A 3WW4A 2Y6LA 5JR7B 3OBAA 5FY5A 1AYM2 2HEWF 5JDBA 3SHRA 3WNXA 3NAPB 5T55A 2WNUB 3AZWA 1ZBA3 1PIV2 5J48A 4JQRA 3W59A 5J96B 1AHSA 4AHZA 1VPHA 5F5CA 1LKNA 3ZMNA 2V72A 2RS31 4FPYA 4UWDA 5FZ4A 2CYFA 4NRMA 2Y6HA 4WM8A 5DDJ1 4EYUA 3RYRA 1OLMA 3AL5A 1NQDA 1JYXA 1YUDA 4QKNA 3BU0A 5F6LB 2Y64A 3A23A 4CUAA 5ACA2 1I3HA 3MFAA 2OS2A 4LKEA 2NMOA 1HRI1 2XOMA 1XYNA 4Q4X1 1FAYA 2ZGQA 4GB32 1ULPA 2WWUA 3J9SA 4MGKE 2G9FA 4FI9A 1NCQA 1KGYA 2B9VA 4G9SB 4Y1VA 1STMA 3PVOA 3HQRA 1VBB1 3VUOA 2FDJA 4A4AA 1H1MA 2XWBB 3NKTA 3UESA 5FZOA 4JDNA 3VKFC 3TOJA 4AI1A 2YMZA 2ES3A 5FYBA 3J8F1 4E8DA 1ZRRA 4JTOA 1AR92 5IAVA 2VMGA 5H9QA 5LZ6A 5A3UA 1UOJA 4JGYC 1OD3A 3ZYFA 1O4ZA 3RZGA 5K8SA 4B1MA 1S0DA 1W9SA 4AHWA 1NA1A 4Q4Y2 3IDBB 5BNQA 3KQ4B 4CEYC 4O7XA 2DUQA 1LODA 1MEC1 4MXWB 5C3OA 2HYKA 4Z82A 2E31A 1CAUB 2A6WA 4Y5SA 4AK3A 1GP6A 4JGZB 4Q1PA 4OI1A 2CDOA 2DU0A 3BIWE 4XVHA 2FCVA 4CDQA 5BNOB 4XFHA 4HVOA 1UYPA 1UOFA 2I74A 1HQNA 4NE9A 2F4PA 4PIXA 3VBHB 3HNBM 3C7GA 3OGGA 5JSRA 2ZHMA 1OD5A 4P9XA 5BYNA 2FDKA 3MYXA 3POJA 4CXXA 3LCPA 1OC1A 4OI0A 3MUY1 1QJX3 1F2NA 5GLUA 3SNMA 1UY0A 3M4FA 2DCTA 2VXRA 3DXTA 1XNBA 4E4HA 2Y33A 3OTFA 2TUNA 3P3NA 4J1XA 1AYM1 2QQLA 2VUCA 3VBSB 4YSFA 1ASJ2 3M3IA 3T2QA 1PVC2 3IDEA 4TN7A 2YFUA 1JYVA 4CDWA 4QD2A 5L7OC 1OF4A 2UWCA 2ARCA 1ACCA 1WLTA 3CZJA 3LPGA 1U12A 1I9RA 5LBCA 4JDMA 3LFIA 2F17A 1OLME 1POQA 1IGOA 3VBRA 4DXTA 5FJHA 5C6CA 2A3WA 4L92A 2R6QA 3LFMA 4MZUA 5FZ9A 3PUAA 2QUOA 3MW2A 3IM0A 4H7MA 3K4ZA 1GOFA 1KXGA 3MICA 2WT1A 4M4RA 4ES8A 5A3NA 3U1XA 4GULA 4LBJA 4LBMA 1AZDA 5CBLA 3AJYA 4JDOA 1GQHA 1RC6A 3NVCA 3DYMA 3BTXA 3L9JT 4FAGA 1AR91 1DYPA 2DDUA 4QKBA 2J42A 3KHBA 3WDUA 1RUG3 2D3RA 5H9RA 2ZGLA 2VW1A 2W2IA 2XJRA 4N90A 4IV3C 3WCSA 2PQSA 5FP3A 1O91A 5KHIA 1H2KA 2VUAA 2A1XA 1RHI2 1LOGA 1LTEA 1RUNA 2YC4A 1JZ7A 3LIGA 4E8CA 1SLAA 2BW8A 2C6SA 4XC9A 4HK9A 4KI5M 4YGEA 1F4AA 1KS4A 5CVRA 2BUKA 4NIIA 4BZ4A 4EZ4A 4WM7C 2B5HA 1QJZA 2J1AA 2CAVA 1S55A 2DYCA 2D6KA 2VUJA 2RDSA 3MHZA 4CP1A 1J59A 1W9TA 3IIIA 4EJRA 3AXEA 4XZPA 2YC0A 4RA0A 2GU9A 1OQ1A 3HQXA 3RZHA 4BH9A 1H2NA 5FY4A 1XXNA 3ZFGC 3NNMA 4H55A 5KHHA 1GZCA 3TRSB 1YQ6A 5FXXA 2AH2A 4ZY9A 5J09A 2QTWB 4M00A 3INAA 1Z78A 3I2GA 1UCXA 2Q8CA 2A71A 2VQUA 1IHMA 1S0EA 4L97A 4D6QA 3UK9A 2GN7A 4ZU7A 1SEFA 4YFWA 1FPN3 3WDYA 3LQCA 3T2PA 1IPSA 1VAVA 1SDDB 3FHIB 1VBC1 1NCRB 5B4NA 2W9XA 2WQ8A 4X8NA 1H4HA 2YPDA 4NPLA 1O4TA 2VCMA 1TQ5A 2QQUA 3IAQA 1PO23 4JX0A 1FT9A 3NV3A 2HWF3 1PGSA 2VGDA 1AX2A 1W2NA 1SQ4A 3D82A 2AYHA 3EHKA 3NW4A 5FUIA 3ZX7A 5FZFA 4P08A 3ACFA 4DXZA 2W92A 3J7MA 1AR72 1GFF2 4B4RA 3AYDA 4JZRA 3KWVA 3D4KA 1ENSA 4YZ4A 4KBBA 4FTBA 2WQZC 5F8PA 3L2HA 2GC3A 1C8NA 5IVVA 4YVWB 4JV4A 3ES4A 4JKLA 3WNKA 3VZNA 4E4SA 2JDAA 2RS52 5BNPB 1JYIA 2QZ3A 5I93A 4AHYA 4AQ6A 4EE2A 3O0WA 4KWLA 5ABJB 1UY2A 2Y0OA 1C57A 5KXDA 1W8NA 1XE0A 2P6CA 3OPTA 2ZHNA 5GJ6A 3RMYA 5I0RA 3OBTA 3KT7A 5LBFA 1JN2P 3LA3A 5F2SA 3MF6A 3DCQA 5JZGB 3UNPA 3HAGA 5F3EA 3EB7A 1WCDJ 2UY8A 4LOTA 1RHI1 4O65A 4QX1A 4CCNA 1ND2C 4RR3C 3VHNA 3T0AA 1N47A 3VBUB 4IGOA 1VRH2 3NWKA 4QMAA 1UZWA 4AL9A 4V1PA 2P17A 1POV1 1XC6A 2W1QA 4IEOA 4QDSA 2IXCA 2GZWA 4GQ7A 3LEIA 3MF9A 4HKLA 4YZ3A 2VZVA 1DZQA 4XPVA 3WY6A 1JYWA 2AEYA 2FMYA 1N3QA 1PO12 3LAGA 5FPLA 4ASKA 3MIDA 4OI2A 2P34A 3OY8A 1EUTA 1ZVFA 4HPKA 3ZXLA 4CEYB 5FYMA 1JZ3A 4KBZA 1QMJA 4R52A 3A7QA 4X6QB 1UY3A 3BGAA 2JE8A 5A7PA 3VHRA 4LA2A 4KGQA 3AB0A 1VBA3 4YG0A 3SH4A 4PIZA 1XYPA 1ZBA2 4FQZA 4YW3A 1DGRN 1VB4A 3R4SA 3KM5A 2JG8A 5EHDA 3WVJA 2WDBA 1TMF3 4XDOA 4PCRA 3WNLA 4AVSA 1W6PA 1IG0A 2BBVA 4ZHNA 3C7EA 1E5HA 5KXCA 1LHWA 4Q29A 1VBE3 2HWD3 1W04A 3W20A 1MS8A 4GMP3 1X8EA 3AP9A 5C9AC 3ZXDA 4CXWA 5G04L 4P9LA 1XRUA 5GZEA 2AR6A 4R9BA 1KQRA 3U07A 3T09A 1LU1A 1DQ0A 2WT0A 4C91A 3FJSA 3C7OA 4XF0A 1V6OA 5IVJA 1ZRDA 4ZZ5A 3CJIC 4YWAA 4QM9A 1QDCA 1YIFA 1DZRA 5C4WC 2RS51 4YW4A 3OUJA 3H3ZA 5L7OB 1YQ2A 1BYHA 4U36A 1RGSA 4YGDA 5TSWA 3ZSEA 1H1IA 4Y22B 1W9YA 5JXGA 1YCIA 3WF0A 1PMIA 3KB5A 5IVEA 4LA3A 1JYCA 4XIOA 4Q0QA 2E51A 2YBKA 3NMBA 3WNOA 1GWMA 1JZ5A 1HDKA 3M7AA 3KF3A 2BNNA 5DDJ3 4EN9B 4RS5A 4AQ2A 5LRSA 2PHXA 2ZCWA 1CN1A 1NYWA 2BGOA 3I4IA 1DZTA 1S2BA 2VQAA 4Q0SA 4BLJA 3ZYRA 3J7NA 2X05A 3VZKA 2BJSA 5T5OA 5B2GB 1HRI3 4XF4A 4Q4X3 2JDUA 3OEAA 2QKDA 3AKPA 1WMXA 4WVMA 3P3PA 3MUZ1 2F6BA 1JOBA 2WYSA 1CIYA 1VBB3 5T5PA 3AK0A 3WDXA 2WNEA 3BTZA 4AGGA 1MS0A 4ONUA 5L9RA 5LCWL 3K4DA 5JLVA 3J8F3 1PO11 2QJVA 2ZX2A 3GHNA 5FTTC 4JRAA 4NRQA 1NY72 2P3IA 3GHMA 4CA9A 5CA6A 1UX6A 1FNYA 1X7NA 1CPMA 1BMV2 1QJX2 4CP9A 5J36A 3K4AA 3WR0A 5DZEA 3LSDA 3U14A 4LBQD 3OGVA 1TNFA 2HWB1 3ILFA 3M3QA 4WM7B 2W3JA 3LSEA 4P9GA 4PT6A 1W8ZA 1ZBA1 4LBQB 4XAAA 5F5QA 2W91A 1S0GA 1R1A3 1X9TA 4CDWB 5IK7A 2QQIA 5FP4A 2DCKA 1IOAA 4NOTA 3LOIA 3WOGA 1ULFA 2WLPA 3ZFGB 4FT8A 4P5YA 4HSLA 5BNNA 1K5MA 1T2XA 5I8TA 3VDDC 2QQPA 2BEOA 4J25A 1RUJ3 3VBRB 3N36A 1OKQA 2EICA 2J1SA 1T6GC 2D43A 2WZ8A 1LGNA 4XILA 4AAPA 4COWA 2XUMA 3GBFA 3ILRA 3IN9A 3ABZA 3H7YA 2YV8A 1CR7A 1WZXA 4UFKA 1OURA 3AKSA 1GP4A 1MQTB 5A3PA 3BPSA 3BTYA 2I45A 2XLGA 1OF3A 2XWJB 1QXJA 4I0AA 2QBXA 3TN93 3U37A 2CNAA 5FOBB 2WFPA 3F95A 3POFA 2OPKA 1HKDA 2O14A 2JX9A 3SKVA 1QNWA 1CAXB 1CIWA 1V9U1 3FC0A 3WV6A 3N9OA 2FQPA 2W87A 4FP2A 3CJXA 2XLFA 5FREA 3VBFA 4WVZA 4YM0A 3L2YA 1RUG2 2B39A 2NMNA 3AC0A 4IERA 3FFZA 5JOWA 4C0HA 3APBA 2A6VA 4DXSA 1A6CA 1XB9A 2VNVA 3TEZA 4CU6A 4H7LA 2WSUA 1HX6A 2VMDA 1X36A 3MLJA 2D6MA 3VD3A 4CEWC 1LU2A 1SLBA 1Y4WA 3AP5A 1J83A 4GJZA 4FBFA 2WZPP 1ENRA 4D6SA 3ZSLA 2G9GA 1IKQA 2Q8OA 4MSVA 2SLIA 2KR2A 4H2AA 4RHV1 5KWRA 4XTPA 4Z8BA 5FMOL 1B35A 1CAWA 1W6NA 5DAWA 3ZOIA 2W1WA 3RQ0A 4LORA 5J3UA 4R9AA 2EXJA 4QPIA 2A6ZA 5DG1A 2RDQA 2VBBA 1YXWA 3SITA 5EQUA 4FFFA 1ZA4A 2OKXA 5JMCA 1Q3EA 3WG1A 5D8AC 3V0BB 2P4EA 1AJOA 5FPUA 1EP0A 3U75A 1NY71 4RR3B 4TSVA 3PMEA 2E26A 1QJX1 3WT3A 1W9WA 1D4M3 3R05A 3DPRC 4P14A 1QJY2 2ZGKA 1G9AA 3WCRA 4XOGA 4HETA 5FZEA 2BNOA 4DUVA 3EBRA 4OMCA 1DQ5A 3LGRA 3ORJA 3RJRA 1E5RA 5DUUA 1C1FA 4XTMA 4RFRB 2C4XA 4WZCA 2ADDA 3AJZA 2X53S 1MVEA 1LHUA 4OUSA 1LEMA 1PO22 5FY7A 3H0OA 1O3TA 2HWF2 2R043 3E5QA 3NAPC 2WN2A 4XCBA 1W0PA 4DMIA 5C71A 5HI0A 4ZXKA 4CU7A 5A6XA 3J26N 2QQKA 1QU0A 1HN1A 1ZX5A 2DCYA 3U4XA 4R8HA 5BY5A 4K9SA 2FDGA 3MLKA 1LRHA 5FZHA 4N8MA 4JVAA 2Y6GA 3UJQA 4FCAA 2RJKA 3ZXKA 5T5LA 1X33A 2VNOA 1H6XA 1Z0HA 3NO8A 4E2SA 4QX3A 4CCDA 4BE3A 1X82A 2HEVF 3USSA 2X5IA 2YU1A 5CG9A 3FMGA 4OHXA 5FY9A 3OYWA 1QKQA 1SACA 2VVFA 3OPZA 5GZCA 2JG9C 5I0TA 2WZR1 1VBC3 1C4RA 4BK5A 1HXS1 4TLGA 4QPGA 4GXLA 3D0JA 4IGPA 3CJIB 5FZCA 2QZ2A 1H9WA 4Q0VA 3VD4A 1OLRA 4EZHA 4UFIA 1M4WA 1ENQA 3K48A 3MBWA 5C4WB 4M01A 2DFCA 4L8QA 1QQP1 3LDBA 3ZYHA 4MH0E 5F5IA 3VN4A 1PK6A 5CZKA 4A3XA 3WW2A 4B4PA 2Y8KA 4D0QA 5FQ0B 2IUWA 1PZ7A 1XPWA 3OY8B 1ZRIA 4HG6B 4HPKB 2LUWA 4AVBA 5FPBA 3NV2A 3NJXA 1SFNA 1U0AA 3K46A 3RNSA 4CTEA 2XHKA 3NJVA 1OA3A 1REDA 1MZFA 3GZTB 3LEGA 5JIAA 5C8CA 4FOQA 5A3TA 4E2QA 4LOSA 5CKNA 2B4KA 4QWNA 3LZZA 4UW4A 3ZFEA 1YQCA 1R1ZA 1VBA2 3POGA 4GMP0 2BFUL 3KCYA 1WMDA 4TTGA 2PQQA 1FPN1 2QQMA 2Z79A 1UY4A 3S5QA 4Z1VA 4I2OA 1TMF2 5KC6A 4QB2A 2WNVA 2PTMA 4BWOA 1GKBA 5HXMA 1POV3 1VBE2 2ETEA 2HWD2 2VNGA 3P6BA 4B7KA 3OGRA 2UYBA 2HWF1 1ZZCA 3C7FA 4ISQA 1W0OA 3IDCB 4LE4A 4UBGA 5FZMA 5I8YA 3VBSC 2NZ9A 4CUCA 1JYTA 1TG7A 2OZ6A 4XJUA 4QU1A 2GH2A 4PF1A 1MR5A 1ODNA 2IFRA 2ZEYA 1PGW2 1HB2A 4LIVA 2OQ7A 4BQWA 3PL0A 4CP0A 3USUA 2VOXA 2EIBA 2J1TA 4Q26A 2SBAA 1YC61 4XZUG 4XF3A 4BJ0A 5F7UA 2Y38A 2P1BA 2VNRA 3DEMA 2ZGSA 2QQNA 3LWCA 2A70A 2JDMA 3O1VA 5A33B 3LF7A 3D3AA 3WF4A 4BQXA 1SG3A 4FOYA 3WZ1A 4IUGA 3VDCA 1K5JA 2XL9A 3GXUA 5BPXA 5DDJ2 3LA2A 3T3YA 4QHOA 4URTA 3T1MA 1M06G 2VM9A 2VAUA 1S4CA 3PUSA 2ZMKA 1S0JA 2QDNA 4H14A 4N53A 1HRI2 4Q27A 1LAJA 4Q4X2 3WHUA 4UAPA 4GKXA 4RN5A 3BOWA 4I30A 1OOPA 4TZDA 1VBB2 2VC9A 4AZZA 2HBUA 4IE6A 5FUPA 5SV5A 3G6JB 1OLQA 1UY1A 1V6NA 3J8F2 5FLHA 4FPOB 4UFMA 5K4LA 4CEWB 1YFYA 2IXIA 2ZXQA 3ZXFA 1SFPA 1QIQA 4GAZA 4YG6A 4E4ZA 1FV2A 4I01A 1UKRA 4IL7A 4CPBA 5A7WB 1WW4A 4LXLA 5A3LA 1OVPA 4P9YA 3A22A 1NQJA 1RUC3 3OCPA 1D0GA 3N9PA 2DBNA 5FOJB 2DCZA 1FV3A 1HB3A 2VMEA 3R0RA 5CISA 4Y26A 2VZOA 3IKWA 1BBT3 5A6ZA 4CE8A 3W21A 2WWJA 3I2IA 1ULGA 1O8PA 4QHBA 4OCTA 1JU4A 1TMF1 3OD4A 4YZ5A 4HXCA 3KLSA 3LPFA 3POWA 3JBG3 3PJQA 1VBE1 1RUJ2 4NRPA 3O1PA 2WO1A 2PN5A 5FKCA 1GNHA 4XUNA 5DPNA 2QE3A 3DPRB 5FBJA 2OIIA 4EROA 1IS6A 4KG8A 4CCOA 3I2KA 2ZGRA 1K45A 1W8OA 1PMJX 2ET1A 2V4VA 1D4VB 1PM4A 2JD9A 3MW4A 4A6SA 5A1LA 4RQPC 5CG8A 1VBD3 1AX1A 4HL0A 2XKOA 4L2NA 4Y20B 5A32B 3TN92 5CFDA 1RYYA 1PMHX 2XQXA 1PGW1 3OGSA 3ZYPA 1WWYA 2ZGUA 1ZRFA 1AF9A 4CUBA 1FI2A 2DVFA 2HWB3 1A8DA 3S6PA 3I59A 4CCMA 1W05A 1GSLA 3Q8EA 4BK4A 5FLIA 2VQ0A 5EIYB 4YVWC 4LKSA 3W5MA 1RINA 4QT6A 5A7QA 1UQXA 3B94A 4QX7A 5BNPC 5JIUA 1EAH3 3ITQA 3FL7A 1LULA 2R49A 5FZLA 4NHKA 1C8M1 5JOXA 5DUWA 2PAMA 3OUIA 1CAVA 4XMAA 5ABJC 4D7SA 1CAWB 5FZBA 2VZQA 4AI3A 1GP5A 1FMD3 5GM0A 1UPSA 2CAUA 2CHHA 1K12A 5D21A 5J7MA 3OD0A 2JG9B 4E4DX 5JZGC 3FZ3A 2AEZA 5FZIA 1H2MA 3QH7A 5FXWA 1BZWA 5CU1A 3ACIA 4MX3A 3VBUC 1V9U3 2B46X 1IPKA 1F4HA 2Q5TA 2RJLA 2RE9A 5FP8A 4CZSA 5HCAA 4AVTA 2GDFA 2X09A 4BU2A 1W2UA 1WW5A 3MLLA 3RVHA 5T5JA 1D4M2 4N43C 3R4UA 2O8QA 5FP9A 4YZ2A 2P6HA 2XQRA 1OH4A 2OXBA 4COZA 5A3MA 2VO5A 1I5ZA 5FZDA 4HVQA 3WDWA 4AEDA 2C5DA 4F83A 2WYFA 5KHGA 3THTA 1R1A1 3HNMA 5CKMA 1XOYA 4LQRA 3ZFFA 2D98A 4RHV3 4CSWA 1YI7A 1GNZA 2R042 2GC1A 2PHRA 2KXLA 4AGRA 5FIXA 1WMEA 5JCTA 1RUJ1 5T54A 2VZSA 3PUHA 3ZN4A 2ILMA 4YZ1A 1HRV1 4AE2A 2VZPA 4WM8C 2FBEA 2C1FA 3A4UA 4NHLA 4E2GA 4BPZA 3AYAA 1I1EA 1FATA 3TN91 1W6MB 2X5IB 4PDWA 1UKGA 3OYWB 1NCQC 4UYBA 3RZLA 1BK1A 2WA3A 1LENA 3BOPA 3IDAA 3M3CA 2VL4A 2DF7A 3NJYA 3AMNA 2FMDA 4QGLA 4RD7A 1OFNA 5HXVA 4PBPA 3ZMOA 4RGGA 2B7YA 5FZ6A 1VBC2 2EAKA 3URFA 3B9IA 1COV3 2VUDA 2J1UA 4UT5A 1IS3A 3NKGA 3V64A 1U5ZA 3C8XA 1NE4A 1BEV1 1QOOA 2YPJA 4NO4A 3PNAA 4FO9A 2ZGOA 4QDRA 5GLZA 2J1RA 1GQGA 1VMJA 2Z69A 4IV3A 4BM8A 3FX3A 4YGBA 5DZFA 1DCSA 4IEWA 4CDXA 4Y1UA 4K3UA 3TEWA 3MDPA 1AXZA 1NA1C 4HFSA 2R16A 2DVAA 4JC1A 4URAA 4B7EA 3MIFA 1QDOA 1BVVA 3JZVA 2OVUA 2Z42A 3HPNA 3IT8A 4QKFA 1K3IA 4XQWA 4MOAA 4LNVA 1C3HA 4XJZA 1GZ9A 3PTRB 4DY5A 4LR4A 4WZFA 2EA7A 4MHUA 3S7EA 3WW1A 2ZGNA 3WNMA 1ST8A 4XBQA 4CDQC 3IIAA 5C3SA 3Q8BA 3LIHA 2WZR3 3PVEA 4NUBA 2GP3A 3BUCA 3VGIA 2A7AA 1HXS3 2E53A 1QOSA 3OSDA 2VOTA 1D4M1 1POV0 4NHMA 3WINE 1W2AX 3FUOA 4CDUB 1O3SA 4P9JA 3JQXA 4HT1T 4XUOA 3ON7A 3K75B 3H50A 1NLRA 4AWDA 3POSA 3RZZA 2VMIA 1LGBA 2D7FA 4GZ9A 5FK7A 2BWAA 4J1WA 2JKBA 1H8TA 4XDQA 1QQP3 4S2DA 3ES1A 4GH4A 4QDQA 4ZU5A 3KVAA 2R041 2RR13 4LE3A 1ZBE3 3T08A 1IQAA 3PMSA 1R091 4P02B 2K2SA 2LRPA 5C3RA 1HQWA 4IV1B 4CDWC 4X6RB 2HH9A 1J84A 2VJXA 5EFUA 3I3BA 2BVBA 2ZX3A 4Y33A 3KV5A 2JE9A 3MIHA 2KA3A 3S0MA 3HBKA 1WGPA 3EXUA 5KXBA 3VBRC 1AVBA 1DGLA 1O7FA 4A7ZA 2IXJA 4C1XA 4NPMA 1BVP1 1V6IA 5H9SA 3DV8A 1E5SA 4BXSV 1MQTC 5FJKA 3AZVA 5I0SA 2E6VA 2VTXA 1L7RA 4JKMA 5A7OA 5LEJA 2Y26A 2GP5A 5GZFA 3H3UA 5IATA 1W28A 4RQPB 5I0DA 2QQJA 4M3CA 2YYOA 1EV13 2EXKA 4MVTA 1XNTA 1XNDA 2J1VA 3CBNA 4IEZA 2E63A 2D3PA 5AFEA 3NNFA 2RV9A 1WW6A 2JICA 3H9AA 4UFLA 4YNIA 1XNAA 4D3WA 4DOUA 1GZWA 4IGQA 2CL2A 1XJAA 4OQ8A 1ND2A 3FHQA 3CF6E 3UV9A 3AVSA 4YRDA 2RS11 4CRQA 4EN7B 4GWMA 4AEJA 3KS7A 2LTNA 4COVA 2JWPA 3B9CA 4XCAA 3IZOA 4ZU4A 5BUVA 2DURA 1PNFA 3VKOA 4UF0A 3O1SA 1XSQA 4MUVA 1VLNA 5FWJA 3RJ2X 5FO9B 1WBLA 1RVF3 1VAKA 4HK8A 1RUC2 4I3PA 1DFQA 1SPPB 3ZPYA 3RZJA 4OYUA 3O0VA 3HR9A 5FO8B 1JZ6A 2QNKA 4GD4A 1SZBA 3DUIA 5C5UA 1N1VA 2GSYA 1BBT2 2X29A 3DKWA 1HB4A 4NR1A 1JXNA 4YYOA 4OMDA 4MV2A 3O1OA 5EJ3A 1Z7S3 1ZZ6A 3FUQA 2VCBA 1HIXA 4DB5A 1K42A 4RGKA 2A3XA 4XQDA 1GUIA 3JBG2 3BODA 4GA9A 5EYYA 4QX8A 3CO2A 3N7KA 1QXPA 4LJHA 2WAOA 3QLQA 4N43B 1REEA 4TXWA 5FZ3A 3RMXA 4CCLA 3ZSMA 1LECA 4META 2A5ZA 1DQ4A 5JXHA 1YJKA 3PHMA 3VZJA 3WF1A 1VR3A 1W8HA 1UU6A 1VBD2 5F1RA 4EV0A 2VOWA 3RZMA 2XKPA 4HANA 3GZUC 1O6UA 2QVSB 2JJ6A 4XJ9A 4Y1XA 1XU2A 2JIGA 4XFBA 4JTNA 3RGBA 4HN0A 2Q0AA 3UJOA 3WQ1A 2HWB2 4AG4A 2XPJA 2OYZA 1MS9A 4AOCA 4AW7A 2ZS6B 3QD6A 2V5YA 3HMYA 1XQNA 4DEQA 1KS5A 1Q8SA 3MIEA 3AMQA 1Y9QA 2HWC3 4DS0A 4PF5A 4LHKA 2PYTA 3WD5A 4WM8B 2WWSA 4LKFA 1TVGA 2GNTA 3FBMA 3VLBB 5DUVA 2MPFA 5IVFA 4OHYA 4AGVA 4QQLA 1U5IA 3WF2A 1H30A 1W03A 3TBDA 5C7GA 5IVBA 1F15A 2VECA 2FZ2A 5CFCA 4FVVA 1V6MA 2W47A 1YQ5A 5GZGA 5IW0A 1LB2A 5H9PA 1J3PA 4QHZA 4XE9A 1F5FA 1NCQB 3MPPG 4NAMA 4AI9A 2W39A 2Z4FA 1ONAA 1G9FA 1DDLA 3N7LA 5FZOB 3FN9A 2OPWA 2K9ZA 2B45X 3CEWA 4M3CF 1FOD3 3VZOA 5BXXA 4LITA 1JW6A 2W08A 3AP7A 4A7KA 2D3SA 1QGLA 1JYNA 1LJ7A 4LPLA 1V9U2 2ZX1A 5LY1A 5AC91 1SBFA 2HKXA 4YARA 2VE1A 3HJRA 4BQ2A 2VW2A 1UIJA 4GJYA 1C28A 1W6OA 1QH7A 1NX9A 1NA1B 1RUC1 3FFQA 3JD73 3OBRA 3I8TA 4GALA 4KWJA 1DQ2A 1KDKA 5GLTA 5C3QA 4UW5A 1QHDA 2UWBA 1J3QA 2GMMA 1C8M3 3HT1A 4CCJA 3SH3A 1SLTA 3KGLA 1BBT1 1QY4A 5FZKA 1AR61 4RYDA 4R4ZA 4RHV2 4M0NA 4V2VA 2V4AA 3V65A 5M0TA 4NIHA 1QJU1 2WFF3 4K1YA 3NRUA 2H0VA 2W68A 4CDQB 2BPA2 1RUI1 3JBG1 1S2EA 2ZTNA 3NNGA 2BBAA 1ALYA 2BGCA 3VDDA 3T0DA 1W3VA 2IVJA 1RUF3 3CIHA 4BMEA 4D7YA 4OULA 1Q5OA 4DINB 4L9BA 1ND3A 3Q9OA 2VD7A 1UZVA 1V70A 1VBD1 2VVEA 4KU8A 1U5XA 2VZUA 3OPWA 4KGGA 2G19A 4OHZA 3HOBA 4Y1ZA 3DYPA 2ARXA 1W06A 4N7UA 4UI9L 1RUOA 5LB6A 3WEZA 4HLTA 5HCHA 2B8MA 4MGTA 4EWAA 2RDRA 1UMHA 5FPZA 2IFWA 4B8EA 2DWRA 1COV2 4DQAA 5FDBA 2DU1A 4XETA 2X10A 1RJ7A 5F3GA 4DEVA 1EAH1 4PHZA 2BDRA 3V0AA 2WT2A 4FAHA 1W8TA 3HD8B 1UF2C 2OX0A 1GU3A 3VV1A 5GLWA 1JZ2A 3H8RA 1HRV3 4XBNA 4NMIA 1NAEA 2VG9A 1QXRA 4RS5C 1UMZA 2VU9A 1CZSA 1FMD1 1ZRCA 2ZBJA 1DP0A 4B1LA 1ZREA 5L9BA 2W0XA 5FFOC 3VBOA 3BTAA 1DF0A 4XMIA 4QGMA 3HN1A 5DZGA 4CYDA 3W58A 3MV11 5DAXA 1GV9A 2VOKA 4MGIE 3UGFA 1PNGA 5C3PA 2WZR2 2BU9A 3RYKA 2GC2A 1G7YA 1H4GA 1HXS2 1J58A 4DO0A 3RG0A 1J3RA 2W1UA 2WINB 5AVAA 5CAZA 5K0UA 5FZGA 1RMU1 1BEV3 3QBQA 2A6YA 2VH9A 4YVSA 2GNBA 2PHWA 1AXYA 2D97A 1JOJA 3H1MA 3JB4C 5GALA 3W5NA 3ELNA 4UW3A 3UETA 1QQP2 3U10A 2IXKA 5JOYA 2OA2A 1OA2A 2R32A 4JHTA 4QPYA 5E89A 3I2JA 2RR12 3KT4A 1ZBE2 3PJYA 1RUE3 2VZ3A 3CNAA 4GKYA 1XNKA 4LO4B 3DKQA 4ORFA 1V6KA 3H1YA 4HOOA 5A3WA 4FXKB 1ZZ9A 2YUEA 5BNNC 1C5IA 3NAPA 2WNUA 4EN8B 3NQHA 1GR3A 4KG0A 2D44A 4HKOA 1H8VA 3WP5A 1X8MA 4IQPA 3OGJA 3TWIA 3ZKYA 3M3EA 1F35A 3OBZA 2JECA 2YHJA 3H8XA 2EALA 1UZYA 3N7JA 4TLFA 2ZHKA 5T52A 3PIGA 1MS4A 3GGLA 1YI9A 1FPN2 3SCFA 5L73A 4NIGA 4MGQA 3QCWA 1MPXA 3OEBA 1COV1 3JQWA 2YGMA 1JS9A 1WCSA 2XJQA 4FPHA 4I02A 1GWKA 2DTWA 4S2HA 1EV12 3VBFC 3VB9A 3VD5A 3C3VA 3PU8A 4K21A 5ANNA 2LROA 5DQ0A 1LOFA 3HNYM 1R093 5C5TA 4AI8A 4I09A 2ORZA 3ZKUA 2H6CA 3WG3A 3TB0A 1BJQA 4QX0A 3CZUA 3MV01 4C0BA 5K9YA 5IUQA 2LW8A 2OQ6A 4Q4Y3 3BN6A 1YQ8A 2ZEZA 2P3YA 2UYAA 2DV9A 1W8WA 4JQTA 5KHKA 3M1HA 3OOXA 1YNAA 1B35C 1J1LA 5FPAA 2JIJA 3U78A 1O3QA 3HQUA 1Q8OA 4AFAA 1LOAA 3ETPA 3H1WA 3O1RA 1RB8G 1RITA 5T3NA 1RVF2 4MXWA 1O3RA 2VTFA 2R073 5FYCA 1MZ5A 1CAUA 2IC1A 2ZEWA 2DFBA 4FQ4A 1QJFA 4JGZA 1U5YA 2RVAA 2ZX4A 5FKBA 1DLCA 3I2OA 1APNA 2ZGPA 5EP9A 4AFBA 1UO9A 5EV7A 3POIA 3D0SA 1LHNA 5BNOA 2JXAA 4NJ4A 5LBEA 5KXEA 2CTVA 1XBFA 1SHWB 1Z7S2 1ULEA 1SMVA 3VBHA 5C33A 3GJBA 3ECQA 4FTEA 4S2FA 2Q4SA 3K77A 5IWFA 5FY8A 5JUVA 2RS13 3WX5A 1KITA 3SQOA 2XR4A 2RR11 1ZBE1 1EY2A 3BYWA 3HBZA 2NM1A 1CZVA 2AZ5A 1MS5A 4KQ7A 2XDVA 3D5OA 4PLMA 3HIFA 1NLSA 2JB4A 3VBSA 2WQ4A 3WUCA 2UU8A 3C2UA 4IEYA 1SCRA 5CB7A 4HMZA 3VHOA 3SMHA 1YJLA 4QQOA 4AFDA 2JG8B 5I0UA 3J4UH 1SCSA 1N1YA 1OI6A 3SEPA 4A3ZA 3TYJA 4WV8A 1W6PB 2HWC2 1WBFA 2WC2A 1BKZA 1UIKA 1AYN1 3NJZA 5GKAC 3WG2A 3MZHA 5LA2A 2QCSB 1MZEA 4AI0A 2ZAHA 4FFIA 5CEHA 1HV1A 1ZA7A 1UOGA 4UFJA 2X5IC 2VCCA 4LTAA 4LHSA 2NP0A 3AZXA 3O1UA 2CV6A 1V00A 3RPQA 5DG2A 1OXCA 1UOBA 1EV11 3LDRA 2BOJA 4BQ4A 3RI8A 1ENXA 4Y5TA 4BYYA 2H6BA 3MO4A 3VZMA 3MGUA 3VKLA 1YHFA 1PVXA 1A8MA 1DLLA 3T4HB 4BIOA 3ALQA 1UWWA 2WLQA 4EN0A 1S0IA 4BQ1A 3KV4A 4AAXA 3MW3A 4P5HA 5DN2A 3PVBB 1KFUL 2OUHA 3K3NA 1EPWA 1OBNA 2MEV3 1S1AA 1PK6C 3IMNA 4CP2A 4UBHA 4AR2A 4F8AA 1I5PA 4FPJA 2V5DA 4PQQA 4IESA 2ENRA 1W0NA 2BYVE 1VJ2A 3AZZA 3PU3A 3POBA 3QOPA 1OHFA 1RVF1 3GZAA 2NN8A 3ACGA 4G3YC 4XFCA 3CKHA 3O14A 4RS5B 2F4LA 5F5AA 2FDIA 3JD72 2CSGA 2FCUA 3KVBA 4MGSA 1LR5A 5EXOA 5C8CC 2E7AA 3KQRA 3CLPA 1C8M2 3DN7A 2VTXJ 1CD3G 5D2AA 4OVEA 1E57A 3N3HA 4MXVA 4ZS2A 3EJKA 4DZGA 4RGAA 1CONA 1Z7S1 4WVMB 4ZPIA 1RUD1 2OZJA 2WFF2 3LA7A 3ENRA 4OHVA 4NAOA 3VKNA 2P3KA 4CDUC 3N9LA 2ZACA 1A3KA 3E6BA 4OI4A 4X8PA 1BK0A 2VR4A 2WNVC 1RUF2 2GALA 2J7MA 2YC2A 5JPNB 4BQYA 2TEPA 4CP9B 3AMPA 5AC93 2Y0IA 4KWUA 1DQ1A 1NCRA 3ZN6A 3CDZB 2CGPA 3B93A 4XHBA 4CCKA 1UNBA 5A7NA 2X8KA 1S2KA 2Y60A 3CMGA 4XBLA 3ZSJA 3IBMA 4IV1C 3RDIA 3WDTA 4DXRA 1SLCA 4DUXA 5JPMB 1UZZA 3MEPA 3T2TA 3M2MA 1CVNA 1QEXA 1GBGA 1R1A2 2GAUA 2HWC1 4QU2A 1K5MB 1AR63 3MFCA 5HCBA 5BNNB 4RSUA 3O0XA 4FXGB 1SBEA 2Q1MA 4LBOA 4Q0UA 3ZYBA 1NLQA 1QJU3 1ZNPA 4YVWA 3I97A 3BIEA 1QWRA 3DGTA 3UL2A 1RUI3 3POEA 5BNPA 1VMHA 2DUPA 4DY3A 4MGYE 1WD3A 1EPZA 2YG0A 1JOPA 1PM7A 3MI8A 3LDKA 4NVPA 1GNYA 5FLJA 2ZKNA 5IK4A 1HRV2 3POYA 4C1WA 1KRIA 1W2TA 3B02A 1ZM1A 2RDNA 5ABJA 1N3OA 5LEKA 4AFMA 4W6XA 2KM2A 1OQEA 4QXBA 3RS6A 3LOBA 4DPNA 4N53C 3HN3A 1FOD1 2QDRA 1GOHA 1BHGA 3NNJA 3WQBA 5JZGA 5FYVA 4Q8KA 3VBFB 1NXMA 1O59A 3OUHA 4BB3A 4PI0A 1IKPA 1KFXL 3IAPA 2Q8DA 1AL21 3VBUA 1UAIA 4XF9A 5A1FA 5K0UB 3Q8CA 3EMRA 3HEIA 4FPGA 4YVSB 2ET7A 1HV0A 4QXKA 3JD71 4JGYA 5JOZA 1BEV2 2Y34A 1OMIA 2VZRA 1KEXA 4P00B 2Z2SB 4PJYA 4LK7A 1YFUA 1WKYA 4ITCA 4R4XA 1B35B 1W6NB 1W99A 5DAVA 2XBO1 4AYUA 2EF6A 3LEKA 5JR2A 2E7TA 5E16A 3R4DB 4XJAA 1IZ3A 4CEYA 3AKQA 2UURA 2WFF1 5E88A 4KMQA 1XYOA 4QPIB 1RUE2 3TEXA 3AXDA 1LEDA 5FMCA 5FPXA 4J6GA 2ARBA 1RUF1 3DYOA 4LKDA 4XJ8A 3ZYGA 3MPBA 5FMDA 5FYZA 3B7MA 3AYEA 4UOJA 2VBPA 2VQTA 5JXJA 3ASIA 1DHKB 4IE0A 2PHLA 4AI2A 5HBAA 2W46A 2D6OX 3THCA 3TEYA 1G9CA 5F39A 3E6DA 5FZ7A 3BKZA 5ANQA 2WBKA 1WW7A 4LMFA 1RMU3 4D94A 2ZAAA 2WO7A 1QF3A 1QOTA 4COUA 5CFDC 3AVRA 2HJIA 4COYA 3KSCA 3WW3A 4MHRA 5EPAA 5A7SA 2V73A 1WCKA 1SLLA 2E7QA 3N9QA 2PA7A 5FR3A 1R092 1ULOA 5DAQA 1F9KA 1GYKA 2VZ1A 3GALA 4Q4V1 3ZIXA 1H1AA 4LO8A 2GMEA 1TME1 5L7OA 5IK5A 4YGCA 1UYZA 2N7GA 2BRTA 4P9IA 2JDPA 2XH6A 4Y22A 1N1SA 3K2OA 3WLUA 1EYBA 4G4FA 4QX2A 4UW6A 4YLZA 3WHTA 3Q8AA 4PBOA 2JENA 3SCHA 5FXVA 3T4VA 5APAA 4C90A 3FLPA 5CIRA 3WG4A 2O0OA 4B3NA 5AFBA 4XUPA 3I3EA 3LKJA 3H8OA 2I07B 3UKNA 2P3JA 1IQDC 1IS5A 2RM23 4QPGB 4YG3A 1VIWB 2WZEA 1SFYA 2R072 2XUEA 1OT5A 3GBGA 3PUIA 4NWVA 2LM3A 3VL9A 4BLIA 1UL9A 2BV4A 4QQHA 3O1TA 2XGXA 5F37A 1OH3A 3U11A 4Q5OA 2ZHLA 5JAXA 1XNCA 2W52A 4IXLA 1AR81 5FV3A 4LLOA 5LWBA 1TNRA 2P2KA 2W1SA 3D6EA 1PK6B 5FMOS 5FK8A 2LS6A 1NT0A 3VDAA 4AEDC 3DXUA 2XB6C 3WQ0A 4Y5Z0 4OQ9A 2D6PA 1TZOA 2RS12 5FZAA 3NL1A 3AKTA 4FOWA 1RUE1 1S0CA 3ZFFC 3U4SA 4OZOA 1PIV1 4B4QA 5C8CB 4WM7A 3WF3A 3GF6A 5FCCA 5A70A 1OKOA 2ERFA 2IXHA 1HN0A 4EWEA 1JZ8A 4LBQA 4S2GA 1TEIA 2WN3A 4SBVA 4FPLA 2PHDA 2XXZA 4L99A 4K40A 3UYJA 3KMHA 4NHYA 3FBYA 3ZFEB 3A0KA 4AQTA 5KR7A 3ZFGA 4HZFA 4QQPA 4CU8A 4OHWA 3N35A 5CYYA 3SH5A 5ACA1 1HLCA 1X50A 1LNSA 1CJDA 1DBNA 4IEXA 3ZYIB 4LT5A 2HWE3 2OW4A 2WNVB 1UN1A 2CWMA 4GB31 3N7MA 4PDWC 3WP6A 5J37A 4I0WB 3S5AA 4LLFA 3AFGA 1MQTA 4O9GA 4BOWA 4L11A 5JVVA 4XABA 5FP7A 3H42B 3N4MA 4HBNA 1LHVA 2ZMLA 4JAAA 4FP3A 3NNLA 2CGNA 2ZOEB 1KJRA 2EIGA 2ZZQA 3HWJA 2K46A 1CAXA 3AL6A 4AF9A 5A1AA 4HVRA 5A6QA 4A42A 1AJKA 1D0HA 3GZEA 3USUB 2YBPA 1WLDA 1RUH3 1OQDA 3RFRA 1S0BA 4OLLA 5EJ1B 4CDXC 4Q4Y1 5DXDA 4ZKTB 2D6NA 2MEV2 2Q8EA 1F31A 3IPVA 4EWDA 2JDZA 4IE7A 1MS3A 2WIIB 2YBSA 2OT7A 4Q1RA 1AYN3 2C24A 1MZ6A 2R071 4LBKA 3B3QE 1S0FA 3ZR5A 2WRAA 3KCXA 4XFIA 4DRVA 1B09A 3KZ4C 1W6QA 2RMU3 1GANA 4A45A 2FDHA 2FDFA 1PZ8A 1GICA 4N53B 4OZXA 2A3YA 4R9DA 5GLVA 1GLHA 1LCLA 1BQPA 2XVGA 4HKWA 4F3JA 4H3WA 4A2UA 3V0BA 1OOPB 2XLAA 2AC1A 1PGL2 2GN3A 4RR3A 1QJY3 2FCTA 2V09A 4KL1A 1JODA 2GMPA 2R0FA 3PVNA 2ATFA 4GWJA 4LHLA 2YY1A 4CPBD 4AVAA 4INDA 3BALA 2PHFA 1H8TC 3H7JA 2Y6JA 1P8JA 4HONA 2VMHA 3EYPA 2CDPA 4KNCA 4GH4C 1ASJ1 2D5FA 3G7DA 3ZN6B 1H2LA 4CVUA 3ST7A 4F7ZA 1PVC1 5AC92 3THDA 2YU2A 3ACLA 3WXPA 2JDNA 3KF5A 2A75A 4AFCA 4DIQA 3GCWA 4E27A 4LUMA 1G9BA 3I49A 5FZ0A 1US3A 4XACA 4K7JA 2BFUS 2JKXA 5JXIA 4XXAA 1Y9GA 2A73B 4YPJA 5IFPA 4BMBA 4JRLA 4NPRA 3VKMA 4W6YA 3GM8A 1VRBA 3K51A 4ASMB 4YW7A 3KHCA 1AR62 3AM2A 4QPWA 3UKVA 1NUKA 1RUD3 2HEYF 3I3QA 2BERA 1QJU2 1V0AA 3JUUA 5LK5A 3ATGA 1UU5A 1XU1A 4NIAA 3T2OA 5KC5A 4HSJA 1RUI2 1NG0A 3P5BA 3RRDA 1UPIA 1W2OA 5C8WA 4KU7A 1L7QA 1WA4A 5SV8A 5FY0A 1GWLA 4PI2A 1LOBA 3H8UA 4Z07A 4IEUA 1Q43A 3KCCA 5F6KA 5C9AA 4XFFA 5C70A 3BCWA 5CFDB 4OUMA 2IWGB 3SEEA 1I6XA 2BZDA 5CNAA 1SBDA 5FPVA 4NWWA 1ULDA 2ZPXA 1H0BA 2PMWB 1CZTA 3UT0A 2EXHA 1ZZ8A 2R063 2PLV3 4LIUA 1L7LA 1QNYA 3I59B 4FFHA 1AL0G 1IG3A 1JHNA 3CJIA 4KH9A 2MEV1 4I3GA 4LEJA 3I2DA 3QACA 5FYSA 1DIWA 1ULCA 5C4WA 2KD7A 3U0ZA 2XMLA 1W9FA 4XJWA 4XUQA 4JGYB 1DYKA 3CL1A 5DUXA 1N3PA 3A21A 3Q8FA 4TYSA 3BPZA 1NKGA 2GH8A 1WMFA 1D7PM 3UGHA 1BCXA 1EAH2 1MS1A 1CAVB 1TE1B 2DVDA 2QFEA 4Y1YA 1W8FA 2XHNA 4AQSA 4EQVA 5FQ0A 2DVGA 1WLCA 3AKRA 1HB1A 3D8CA 4Y4RA 4YM2A 4BISA 5BV6A 1HQLA 3VHPA 1NXD1 4N9HA 4M3CE 5IYYA 1YRZA 1ZYBA 4M0HA 1FMD2 1JTZX 2B42B 1DYOA 2XL7A 4W8JA 4BDVB 2J22A 1PGL1 1G8WA 4XAEA 1RTVA 4CXYA 1PX3A 2ZABA 1VAMA 4YFZA 2WS93 3DF0A 2VULA 4YM1A 4ZONA 3O1MA 2MHFA 3A0NA 1IS4A 5F3IA 3RWKX 1AL23 1GQPA 2XG3A 3F2ZA 1CPNA 2VCAA 2BTVC 2CGOA 1DQ6A 5FYHA 5LBBA 5T50A 3RSJA 4AEDB 2VMFA 4LBLA 3FLRA 4Q4W3 2YXSA 1RMU2 1VB2A 1AR71 1JH5A 1R083 2AENA 3WDVA 3ZXEA 4IEPA 5JSOA 4XF1A 3ZFFB 4W65A 4XIKA 2QQOA 4FPFA 1V6LA 1MACA 3CQOA 4BIFA 2QQVA 2VW0A 3O12A 2XBO3 4QM8A 1WLWA 3GNEA 2RG4A 1UW8A 1W8UA 3BI3A 5L9VA 1ZZBA 3R6SA 2ZZJA 4BCUA 5F3CA 2JG8C 2A6XA 3PDQA 2DBIA 4YW6A 1DGRA 5K7PA 4AVVA 1QJEA 3GYDA 4IEVA 3KV9A 4UFHA 4Y24A 4LO7A 2ZMNA 3BB6A 4KWKA 5CFCC 2DTYA 2RS33 5A33A 2ZX0A 4FFGA 4PDWB 1CX4A 1A78A 2Q1FA 4IDZA 2R30A 2TBVA 4BQ3A 4K8FA 4NHXA 2WUHA 3E5XA 5A3OA 1OUSA 4CCEA 5ERLA 1W3XA 2OUJA 3B5LB 1VRH1 2RM22 2VVDA 2E32A 1OPMA 4SLIA 4DRRA 3VL8A 3WUDA 4CCCA 3N9MA 3WP4A 5FUNA 1YWKA 4W50A 2ZKLA 2UWAA 5EJZB 4ZXEA 5IVYA 5IT6A 2LALA 5E8AA 5EYXA 5LW9A 3C7HA 4IV3B 3JU9A 4A6OA 2O8OA 4NIDA 1MVQA 2EAAA 4CDXB 2EXIA 2R0HA 1JMUB 1GZTA 5FBZA 3GJAA 2RJ2A 4Q4V3 2C9AA 2HLEA 3AP4A 5FMBA 1TME3 4IE5A 4DUWA 1N1TA 3SLIA 4CEWA 5FZ1A 1OVSA 5IHRA 3I2FA 2GNDA 2VXJA 3MIBA 2FD8A 1KDMA 3DECA 5A7WA 3B01A 4Q8LA 3NV4A 3M8LA 3ZDSA 1US2A 4XFAA 1UU4A 3V56A 2GC0A 4B29A 1WCUA 1LESA 1SLIA 2XJSA 3B69A 2E9QA 4FOVA 2ZA9A 3O5SA 1Y43B 4GWNA 4LO5B 2E33A 5AVPA 1UXZA 4K1ZA 1MEC3 4M4PA 4C8DA 3T30A 3ZSKA 4ARXA 4LUKA 3S57A 5LA9A 2WABA 1YEWA 1AXKA 2VPVA 2FZ1A 3JCIA 4PIYA 5JI7A 5CADA 4QAWA 4FPCA 5D8AA 1FXZA 1O8SA 4XURA 3M3OA 3FHAA 4CUGA 1ND3C 4K8RB 4XDPA 3TNQA 4MGZE 2JE7A 5A80A 2CY6A 2YFZA 1DG6A 4N9IA 1UD1A 2DUOA 1AR83 2HWE2 5JWPA 1H8TB 3BU7A 3AYCA 3DPRA 3WP3A 1A34A 1XSRA 4GH4B 1Y7BA 1ODMA 2PXJA 3NSTA 3PLQA 2R1DA 3OJBA 2D40A 1VMFA 4Y20A 5A32A 1BXHA 3ZLIA 2R7EB 2YZ4A 3OF1A 4MO3M 5KBFA 1AYM3 2PHTA 1OA4A 4YW5A 1J1TA 3I3DA 1AX0A 1LOEA 1DU3D 3RWNA 1PIV3 4RFT0 3ZXJA 5FYYA 2BWCA 1K5MC 3OG2A 4R9CA 2G1MA 5FY1A 2P37A 2BVVA 1RUH2 1OSGA 3RZKA 3IPVB 3FWEA 3MIGA 5B4XA 5IAXA 2HBTA 5G05L 2ADEA 5J98B 2XJPA 4BA6A 2ZJCA 4O9EA 4AVCA 4K6BA 2W94A 5ACA3 3I7DA 3I2HA 3KT1A 2XVLA 4LK6A 2IXLA 5ISLA 1XE7A 3VBOC 1AYN2 1IPJA 1YO8A 2G9ZA 1NE6A 2RM21 3HVDA 4GB33 1T6BX 1W6QB 2BGPA 2BP6A 4XQ4A 4DNYA 2JDKA 4ATFA 3I3MA 3E5UA 1Q8VA 4M3CB 3ILNA 4QGNA 5FZ8A 2RMU2 2JG9A 4N7IA 1JZ4A 3AMMA 5JMOA 1VALA 2NPIA 3DL3A 3W9AA 3ZXAC 1GZWB 1AR93 1ND2B 3AMHA
chains in the Genus database with same CATH topology
2OX0A 5FZ3A 4D6RA 4CCLA 4EZ4A 2YU2A 4QXHA 5FZOA 4DIQA 4CCMA 3PUQA 3PTRB 4GJZA 2XUEA 5FZ0A 4D6SA 5FYTA 5FYBA 5IWFA 5FY8A 4UF0B 5F37A 4NUBA 5FY4A 2GP3A 5A7QA 5IVCA 5IVJA 4QX7A 5FXXA 5FV3A 5LWBA 5FZMA 1VRBA 3KV6A 2XDVA 5FZLA 3N9MA 2Q8CA 5FUNA 3DXUA 5FZBA 5IVYA 4D6QA 2P5BA 5LW9A 5FZAA 4QU1A 4QXBA 5FPUA 4DO0A 5IVFA 3U4SA 5IVEA 3KVAA 3N9NA 5F32A 2YPDA 5FZGA 5FY0A 4LIVA 2YBKA 5FYVA 2OQ7A 5IVBA 5FZIA 5FXWA 5FZ1A 5IW0A 2Q8DA 5F2WA 5FZEA 5A7WA 2XXZA 5FYUA 5FZFA 5A1FA 3UYJA 5FPVA 5FP8A 4AI9A 5CEHA 4Y33A 4V2WA 5KR7A 4LIUA 3KV5A 4BU2A 5FZOB 3RVHA 5FYSA 4C8DA 5IVVA 5FP9A 5FY7A 4LITA 2XMLA 4HOOA 5FZDA 3LD8A 5A3WA 3DXTA 4E4HA 5LY1A 3PUSA 5FJKA 4CUGA 4GJYA 4XDPA 3KV4A 5FP7A 4BXFA 4CSWA 5E6HA 5A7OA 5A80A 2GP5A 4QXCA 3OPTA 4Y4RA 5FZHA 3K3NA 4BISA 4TN7A 3AL6A 5LY2A 5FUPA 4CCJA 5F2SA 2PXJA 5FYZA 3PURA 5F3EA 3PU3A 5FZKA 5FXZA 2YBPA 5K4LA 3ZPOA 2YU1A 4V2VA 3ZLIA 5F5AA 4GAZA 4IGQA 5FY9A 4CCNA 3AVSA 5FP4A 3KVBA 5F39A 4IGOA 4LXLA 5A7WB 5FZ7A 5FYIA 5ANQA 2Q8EA 5FJHA 3PU8A 5FYYA 3N9PA 5FZ9A 3PUAA 4IGPA 2YBSA 5FY1A 3AVRA 5FZCA 2OT7A 5F3IA 4EZHA 5A3NA 4UF0A 3NJYA 5FY5A 5A7SA 2WWJA 4AAPA 5FYHA 5FWJA 2VD7A 5FZ6A 5FPLA 4ASKA 3N9LA 3OPWA 3LDBA 5F5IA 5A3PA 2OQ6A 3N9QA 5FYMA 5F5CA 5ISLA 5FPAA 4GD4A 2W2IA 3U78A 5FZ4A 5A7PA 4EYUA 5FBJA 3K2OA 5FP3A 3AL5A 5FPBA 4CCOA 5FZ8A 3N9OA 4Y3OA 5FYCA 4CCKA 5A1LA 5FWEA 5F3CA 5FXVA 2OS2A 5A7NA 3K3OA 3PDQA 4HONA 4XDOA 5F3GA 4URAA 5A3TA 2WWUA 4QX8A 3KV9A 4QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OX0 A;  5FZ3 A;  4D6R A;  4CCL A;  4EZ4 A;  2YU2 A;  4QXH A;  5FZO A;  4DIQ A;  4CCM A;  3PUQ A;  3PTR B;  4GJZ A;  2XUE A;  5FZ0 A;  4D6S A;  5FYT A;  5FYB A;  5IWF A;  5FY8 A;  4UF0 B;  5F37 A;  4NUB A;  5FY4 A;  2GP3 A;  5A7Q A;  5IVC A;  5IVJ A;  4QX7 A;  5FXX A;  5FV3 A;  5LWB A;  5FZM A;  1VRB A;  3KV6 A;  2XDV A;  5FZL A;  3N9M A;  2Q8C A;  5FUN A;  3DXU A;  5FZB A;  5IVY A;  4D6Q A;  2P5B A;  5LW9 A;  5FZA A;  4QU1 A;  4QXB A;  5FPU A;  4DO0 A;  5IVF A;  3U4S A;  5IVE A;  3KVA A;  3N9N A;  5F32 A;  2YPD A;  5FZG A;  5FY0 A;  4LIV A;  2YBK A;  5FYV A;  2OQ7 A;  5IVB A;  5FZI A;  5FXW A;  5FZ1 A;  5IW0 A;  2Q8D A;  5F2W A;  5FZE A;  5A7W A;  2XXZ A;  5FYU A;  5FZF A;  5A1F A;  3UYJ A;  5FPV A;  5FP8 A;  4AI9 A;  5CEH A;  4Y33 A;  4V2W A;  5KR7 A;  4LIU A;  3KV5 A;  4BU2 A;  5FZO B;  3RVH A;  5FYS A;  4C8D A;  5IVV A;  5FP9 A;  5FY7 A;  4LIT A;  2XML A;  4HOO A;  5FZD A;  3LD8 A;  5A3W A;  3DXT A;  4E4H A;  5LY1 A;  3PUS A;  5FJK A;  4CUG A;  4GJY A;  4XDP A;  3KV4 A;  5FP7 A;  4BXF A;  4CSW A;  5E6H A;  5A7O A;  5A80 A;  2GP5 A;  4QXC A;  3OPT A;  4Y4R A;  5FZH A;  3K3N A;  4BIS A;  4TN7 A;  3AL6 A;  5LY2 A;  5FUP A;  4CCJ A;  5F2S A;  2PXJ A;  5FYZ A;  3PUR A;  5F3E A;  3PU3 A;  5FZK A;  5FXZ A;  2YBP A;  5K4L A;  3ZPO A;  2YU1 A;  4V2V A;  3ZLI A;  5F5A A;  4GAZ A;  4IGQ A;  5FY9 A;  4CCN A;  3AVS A;  5FP4 A;  3KVB A;  5F39 A;  4IGO A;  4LXL A;  5A7W B;  5FZ7 A;  5FYI A;  5ANQ A;  2Q8E A;  5FJH A;  3PU8 A;  5FYY A;  3N9P A;  5FZ9 A;  3PUA A;  4IGP A;  2YBS A;  5FY1 A;  3AVR A;  5FZC A;  2OT7 A;  5F3I A;  4EZH A;  5A3N A;  4UF0 A;  3NJY A;  5FY5 A;  5A7S A;  2WWJ A;  4AAP A;  5FYH A;  5FWJ A;  2VD7 A;  5FZ6 A;  5FPL A;  4ASK A;  3N9L A;  3OPW A;  3LDB A;  5F5I A;  5A3P A;  2OQ6 A;  3N9Q A;  5FYM A;  5F5C A;  5ISL A;  5FPA A;  4GD4 A;  2W2I A;  3U78 A;  5FZ4 A;  5A7P A;  4EYU A;  5FBJ A;  3K2O A;  5FP3 A;  3AL5 A;  5FPB A;  4CCO A;  5FZ8 A;  3N9O A;  4Y3O A;  5FYC A;  4CCK A;  5A1L A;  5FWE A;  5F3C A;  5FXV A;  2OS2 A;  5A7N A;  3K3O A;  3PDQ A;  4HON A;  4XDO A;  5F3G A;  4URA A;  5A3T A;  2WWU A;  4QX8 A;  3KV9 A;  4QWN A; 
#chains in the Genus database with same CATH topology
 1URX A;  2WKK A;  4FSJ A;  5K0U C;  4D6R A;  4Z2W A;  3ROU A;  1BMV 1;  1EUU A;  1YYN A;  2VY0 A;  5LRR A;  4GWI A;  2ZGM A;  4OFG A;  4QXH A;  4YVS C;  3S7I A;  3PUQ A;  3QH6 A;  1HW5 A;  3PTY A;  4GIQ A;  3SC7 X;  4QQ2 A;  3B00 A;  4PLN A;  1RJ8 A;  5LA1 A;  4UF0 B;  2WL1 A;  2K0G A;  4BQ5 A;  3VD7 A;  3ZIW A;  5IVC A;  3RI9 A;  5DMY A;  4XW3 A;  3FLT A;  1PHM A;  3SKJ E;  2ORX A;  4MAD A;  5I8S A;  2WR9 A;  4RL7 A;  5IJR A;  4UXA A;  3KV6 A;  2RHP A;  4MYE A;  5LAT A;  1KJL A;  2GNM A;  2ZGT A;  2JB8 A;  4QPI C;  2CWS A;  2EID A;  2YB7 A;  1LOC A;  2JDH A;  3IWZ A;  2WAA A;  2WNU C;  3FE5 A;  2J1E A;  2B9U A;  3JXS A;  4TWT A;  5D1I A;  2XON A;  1PX4 A;  2EIE A;  2JDY A;  3ME2 A;  4Z92 B;  2UY9 A;  3N9N A;  2DCJ A;  1D2Q A;  3E97 A;  3NV1 A;  5F32 A;  4QX5 A;  2HWE 1;  4E9K A;  2H0B A;  4D7T A;  3KD4 A;  1OUX A;  2WNO A;  4D69 A;  1RUD 2;  1V6J A;  4ISR A;  1Y3T A;  5F2W A;  5HPO A;  1JU3 A;  4FPK A;  4FPE A;  4P9W A;  3E1F 1;  4K20 A;  4IET A;  4Q0P A;  5FYU A;  3JB8 A;  2PAK A;  3GBW A;  3ZYJ B;  4MG2 A;  1NZI A;  3KGZ A;  1DGW A;  4LHN A;  5IK8 A;  1O4Y A;  1W6M A;  2QQW A;  5FAX A;  5C9A B;  1LGC A;  1UX7 A;  2C26 A;  4IEQ A;  1JBC A;  5L19 A;  1D2S A;  1HJF A;  2PFW A;  2ZEX A;  3P1I A;  5E1R A;  3ZN5 A;  4LO6 B;  2R1B A;  1ASJ 3;  1RUG 1;  4XUT A;  1PVC 3;  1BLZ A;  2Z5W A;  3LD8 A;  2BQP A;  3T1L A;  1LOF C;  1LHO A;  1WUV A;  2XVK A;  1RUH 1;  5EZW A;  3ZDV A;  4WBB A;  1XE8 A;  2R06 2;  3ETQ A;  2PLV 2;  5HV4 A;  1UYY A;  4L0P A;  2Q1Z B;  3IB3 A;  4U2A A;  1WD4 A;  2XJT A;  4Y4Y A;  4BXF A;  1UXX X;  3CU7 A;  4QXC A;  2CU5 A;  4A7Y A;  4NRO A;  2Q30 A;  5LAS A;  1E5I A;  2TNF A;  5LY2 A;  5I91 A;  1NOV A;  4Z2A A;  4XEZ A;  3BVC A;  1Q8Q A;  3J7L A;  2C0Z A;  4JHZ A;  2L9L A;  3PUR A;  3VD9 A;  3ZO0 B;  1F5J A;  2AUY A;  1RIR A;  3ACH A;  5FXZ A;  3T0B A;  5CFC B;  3AFK A;  2RMU 1;  4JCK A;  2W95 A;  5DAB A;  1UZ0 A;  2G4I A;  3ZM8 A;  3VDB A;  3IMM A;  2VOV A;  3WNN A;  2IZW A;  4QPG C;  2DVB A;  3THP A;  2PEL A;  4JGZ C;  4LUL A;  3GCX A;  1F8V A;  2BOI A;  2VBD A;  2Y6K A;  4PQ9 A;  4ATE A;  1UMI A;  5BNO C;  4CU9 A;  5KHJ A;  1Y9M A;  2C9K A;  1QJY 1;  4XXP A;  1WCQ A;  3AZY A;  4XYX A;  1JHJ A;  3VBH C;  1FOD 2;  2WS9 2;  2XJU A;  3LB9 A;  4CDU A;  1H9P A;  1RHI 3;  4LBN A;  1ZZ7 A;  4IE4 A;  2MNG A;  1PZ9 A;  4W6W A;  2D6L X;  1YFW A;  2WJS A;  3X29 B;  3H3L A;  3SXW A;  1GMM A;  1YFX A;  1W6O B;  1AL2 2;  2D5H A;  2NQY A;  4I0B A;  1PO2 1;  1G9D A;  4O61 A;  4AXO A;  3TAY A;  3WNP A;  4Q4W 2;  1SDW A;  3EQE A;  4Y3O A;  3HT2 A;  1R08 2;  3EO6 A;  1VP6 A;  4NN0 A;  5FWE A;  3SIS A;  5LK7 B;  5J1X A;  3K3O A;  1OPO A;  4IV1 A;  1G86 A;  3AP6 A;  1UYX A;  2XBO 2;  3ZFE C;  1C5H A;  3LE0 A;  4BHP A;  2BNM A;  3O7O A;  1W90 A;  4ZS3 A;  2PAE A;  2YGL A;  4HN1 A;  3VDD B;  5FYT A;  5DAP A;  1VE0 A;  1G6N A;  2VZT A;  5IFT A;  1FNZ A;  2PHU A;  2WO2 A;  1AUY A;  2JD4 A;  1ND3 B;  4A41 A;  3LEM A;  1X9P A;  2XJV A;  2ARE A;  3M70 A;  2RS3 2;  1REF A;  1H6Y A;  1CWP A;  1HJG A;  5HCF A;  4WVW A;  4YW2 A;  2R06 1;  2PLV 1;  2P5B A;  2NYY A;  4RQP A;  1DGW X;  1CJP A;  1Q56 A;  1WA6 X;  4AEK A;  5HV0 A;  1CES A;  1C1L A;  1AR7 3;  4XFG A;  4QB1 A;  4A44 A;  1RXG A;  1QH6 A;  5L36 A;  5JSP A;  4ARY A;  3WQ7 A;  1CGP A;  4D8M A;  3TNP B;  1W39 A;  1RXF A;  3V0A B;  5LA0 A;  2RS5 3;  4AEM A;  2WA4 A;  5FRA A;  3VZL A;  4ASL A;  1KD7 A;  4V2W A;  2Y6F A;  4WVV A;  1FX5 A;  4YW1 A;  2AGS A;  4PLO A;  4FTS A;  5A6Y A;  1NZC A;  1O5L A;  1FYU A;  2NLR A;  2AAC A;  4Q4V 2;  1TME 2;  3S30 A;  1Q8P A;  3OB8 A;  4OUE A;  5F9T A;  3GDB A;  4AHX A;  1GOG A;  4YM3 A;  1YLL A;  3AX4 A;  3ZVX A;  2HYX A;  1L3J A;  3PIJ A;  1YIP A;  3VBO B;  4W4Z A;  3UGG A;  1CQ9 A;  3WSO A;  3ZR6 A;  3UKT A;  1VBA 1;  1O5U A;  5JI9 A;  1SPP A;  1JUI A;  2EVX A;  4Q2F A;  2IVI B;  4QKD A;  4MLO A;  2WS9 1;  5GZD A;  2O1Q A;  5EWS A;  1CX1 A;  4EN6 B;  1MEC 2;  5E6H A;  2FHR A;  4JKK A;  1JUH A;  2WO3 A;  3CHX A;  5D8A B;  1OOP C;  1VRH 3;  3RYP A;  5CKQ A;  4IW3 A;  2HWD 1;  2W5F A;  1RL3 A;  2YDE A;  2ARA A;  4GMP 1;  1OFS A;  5FO7 B;  2VMC A;  3J7H A;  2JEM A;  4Q4W 1;  3ZPO A;  4ZZ8 A;  2WSV A;  2ID4 A;  1NCR C;  4QB6 A;  4XHX A;  1R08 1;  2I2S A;  2YRO A;  1AR8 2;  4N43 A;  1PO1 3;  3SCG A;  3ZXG A;  4DFS A;  3E6C C;  5FYI A;  4ES9 A;  4ET7 A;  1R64 A;  1JI6 A;  3I54 A;  2D93 A;  3WW4 A;  2Y6L A;  5JR7 B;  3OBA A;  5FY5 A;  1AYM 2;  2HEW F;  5JDB A;  3SHR A;  3WNX A;  3NAP B;  5T55 A;  2WNU B;  3AZW A;  1ZBA 3;  1PIV 2;  5J48 A;  4JQR A;  3W59 A;  5J96 B;  1AHS A;  4AHZ A;  1VPH A;  5F5C A;  1LKN A;  3ZMN A;  2V72 A;  2RS3 1;  4FPY A;  4UWD A;  5FZ4 A;  2CYF A;  4NRM A;  2Y6H A;  4WM8 A;  5DDJ 1;  4EYU A;  3RYR A;  1OLM A;  3AL5 A;  1NQD A;  1JYX A;  1YUD A;  4QKN A;  3BU0 A;  5F6L B;  2Y64 A;  3A23 A;  4CUA A;  5ACA 2;  1I3H A;  3MFA A;  2OS2 A;  4LKE A;  2NMO A;  1HRI 1;  2XOM A;  1XYN A;  4Q4X 1;  1FAY A;  2ZGQ A;  4GB3 2;  1ULP A;  2WWU A;  3J9S A;  4MGK E;  2G9F A;  4FI9 A;  1NCQ A;  1KGY A;  2B9V A;  4G9S B;  4Y1V A;  1STM A;  3PVO A;  3HQR A;  1VBB 1;  3VUO A;  2FDJ A;  4A4A A;  1H1M A;  2XWB B;  3NKT A;  3UES A;  5FZO A;  4JDN A;  3VKF C;  3TOJ A;  4AI1 A;  2YMZ A;  2ES3 A;  5FYB A;  3J8F 1;  4E8D A;  1ZRR A;  4JTO A;  1AR9 2;  5IAV A;  2VMG A;  5H9Q A;  5LZ6 A;  5A3U A;  1UOJ A;  4JGY C;  1OD3 A;  3ZYF A;  1O4Z A;  3RZG A;  5K8S A;  4B1M A;  1S0D A;  1W9S A;  4AHW A;  1NA1 A;  4Q4Y 2;  3IDB B;  5BNQ A;  3KQ4 B;  4CEY C;  4O7X A;  2DUQ A;  1LOD A;  1MEC 1;  4MXW B;  5C3O A;  2HYK A;  4Z82 A;  2E31 A;  1CAU B;  2A6W A;  4Y5S A;  4AK3 A;  1GP6 A;  4JGZ B;  4Q1P A;  4OI1 A;  2CDO A;  2DU0 A;  3BIW E;  4XVH A;  2FCV A;  4CDQ A;  5BNO B;  4XFH A;  4HVO A;  1UYP A;  1UOF A;  2I74 A;  1HQN A;  4NE9 A;  2F4P A;  4PIX A;  3VBH B;  3HNB M;  3C7G A;  3OGG A;  5JSR A;  2ZHM A;  1OD5 A;  4P9X A;  5BYN A;  2FDK A;  3MYX A;  3POJ A;  4CXX A;  3LCP A;  1OC1 A;  4OI0 A;  3MUY 1;  1QJX 3;  1F2N A;  5GLU A;  3SNM A;  1UY0 A;  3M4F A;  2DCT A;  2VXR A;  3DXT A;  1XNB A;  4E4H A;  2Y33 A;  3OTF A;  2TUN A;  3P3N A;  4J1X A;  1AYM 1;  2QQL A;  2VUC A;  3VBS B;  4YSF A;  1ASJ 2;  3M3I A;  3T2Q A;  1PVC 2;  3IDE A;  4TN7 A;  2YFU A;  1JYV A;  4CDW A;  4QD2 A;  5L7O C;  1OF4 A;  2UWC A;  2ARC A;  1ACC A;  1WLT A;  3CZJ A;  3LPG A;  1U12 A;  1I9R A;  5LBC A;  4JDM A;  3LFI A;  2F17 A;  1OLM E;  1POQ A;  1IGO A;  3VBR A;  4DXT A;  5FJH A;  5C6C A;  2A3W A;  4L92 A;  2R6Q A;  3LFM A;  4MZU A;  5FZ9 A;  3PUA A;  2QUO A;  3MW2 A;  3IM0 A;  4H7M A;  3K4Z A;  1GOF A;  1KXG A;  3MIC A;  2WT1 A;  4M4R A;  4ES8 A;  5A3N A;  3U1X A;  4GUL A;  4LBJ A;  4LBM A;  1AZD A;  5CBL A;  3AJY A;  4JDO A;  1GQH A;  1RC6 A;  3NVC A;  3DYM A;  3BTX A;  3L9J T;  4FAG A;  1AR9 1;  1DYP A;  2DDU A;  4QKB A;  2J42 A;  3KHB A;  3WDU A;  1RUG 3;  2D3R A;  5H9R A;  2ZGL A;  2VW1 A;  2W2I A;  2XJR A;  4N90 A;  4IV3 C;  3WCS A;  2PQS A;  5FP3 A;  1O91 A;  5KHI A;  1H2K A;  2VUA A;  2A1X A;  1RHI 2;  1LOG A;  1LTE A;  1RUN A;  2YC4 A;  1JZ7 A;  3LIG A;  4E8C A;  1SLA A;  2BW8 A;  2C6S A;  4XC9 A;  4HK9 A;  4KI5 M;  4YGE A;  1F4A A;  1KS4 A;  5CVR A;  2BUK A;  4NII A;  4BZ4 A;  4EZ4 A;  4WM7 C;  2B5H A;  1QJZ A;  2J1A A;  2CAV A;  1S55 A;  2DYC A;  2D6K A;  2VUJ A;  2RDS A;  3MHZ A;  4CP1 A;  1J59 A;  1W9T A;  3III A;  4EJR A;  3AXE A;  4XZP A;  2YC0 A;  4RA0 A;  2GU9 A;  1OQ1 A;  3HQX A;  3RZH A;  4BH9 A;  1H2N A;  5FY4 A;  1XXN A;  3ZFG C;  3NNM A;  4H55 A;  5KHH A;  1GZC A;  3TRS B;  1YQ6 A;  5FXX A;  2AH2 A;  4ZY9 A;  5J09 A;  2QTW B;  4M00 A;  3INA A;  1Z78 A;  3I2G A;  1UCX A;  2Q8C A;  2A71 A;  2VQU A;  1IHM A;  1S0E A;  4L97 A;  4D6Q A;  3UK9 A;  2GN7 A;  4ZU7 A;  1SEF A;  4YFW A;  1FPN 3;  3WDY A;  3LQC A;  3T2P A;  1IPS A;  1VAV A;  1SDD B;  3FHI B;  1VBC 1;  1NCR B;  5B4N A;  2W9X A;  2WQ8 A;  4X8N A;  1H4H A;  2YPD A;  4NPL A;  1O4T A;  2VCM A;  1TQ5 A;  2QQU A;  3IAQ A;  1PO2 3;  4JX0 A;  1FT9 A;  3NV3 A;  2HWF 3;  1PGS A;  2VGD A;  1AX2 A;  1W2N A;  1SQ4 A;  3D82 A;  2AYH A;  3EHK A;  3NW4 A;  5FUI A;  3ZX7 A;  5FZF A;  4P08 A;  3ACF A;  4DXZ A;  2W92 A;  3J7M A;  1AR7 2;  1GFF 2;  4B4R A;  3AYD A;  4JZR A;  3KWV A;  3D4K A;  1ENS A;  4YZ4 A;  4KBB A;  4FTB A;  2WQZ C;  5F8P A;  3L2H A;  2GC3 A;  1C8N A;  5IVV A;  4YVW B;  4JV4 A;  3ES4 A;  4JKL A;  3WNK A;  3VZN A;  4E4S A;  2JDA A;  2RS5 2;  5BNP B;  1JYI A;  2QZ3 A;  5I93 A;  4AHY A;  4AQ6 A;  4EE2 A;  3O0W A;  4KWL A;  5ABJ B;  1UY2 A;  2Y0O A;  1C57 A;  5KXD A;  1W8N A;  1XE0 A;  2P6C A;  3OPT A;  2ZHN A;  5GJ6 A;  3RMY A;  5I0R A;  3OBT A;  3KT7 A;  5LBF A;  1JN2 P;  3LA3 A;  5F2S A;  3MF6 A;  3DCQ A;  5JZG B;  3UNP A;  3HAG A;  5F3E A;  3EB7 A;  1WCD J;  2UY8 A;  4LOT A;  1RHI 1;  4O65 A;  4QX1 A;  4CCN A;  1ND2 C;  4RR3 C;  3VHN A;  3T0A A;  1N47 A;  3VBU B;  4IGO A;  1VRH 2;  3NWK A;  4QMA A;  1UZW A;  4AL9 A;  4V1P A;  2P17 A;  1POV 1;  1XC6 A;  2W1Q A;  4IEO A;  4QDS A;  2IXC A;  2GZW A;  4GQ7 A;  3LEI A;  3MF9 A;  4HKL A;  4YZ3 A;  2VZV A;  1DZQ A;  4XPV A;  3WY6 A;  1JYW A;  2AEY A;  2FMY A;  1N3Q A;  1PO1 2;  3LAG A;  5FPL A;  4ASK A;  3MID A;  4OI2 A;  2P34 A;  3OY8 A;  1EUT A;  1ZVF A;  4HPK A;  3ZXL A;  4CEY B;  5FYM A;  1JZ3 A;  4KBZ A;  1QMJ A;  4R52 A;  3A7Q A;  4X6Q B;  1UY3 A;  3BGA A;  2JE8 A;  5A7P A;  3VHR A;  4LA2 A;  4KGQ A;  3AB0 A;  1VBA 3;  4YG0 A;  3SH4 A;  4PIZ A;  1XYP A;  1ZBA 2;  4FQZ A;  4YW3 A;  1DGR N;  1VB4 A;  3R4S A;  3KM5 A;  2JG8 A;  5EHD A;  3WVJ A;  2WDB A;  1TMF 3;  4XDO A;  4PCR A;  3WNL A;  4AVS A;  1W6P A;  1IG0 A;  2BBV A;  4ZHN A;  3C7E A;  1E5H A;  5KXC A;  1LHW A;  4Q29 A;  1VBE 3;  2HWD 3;  1W04 A;  3W20 A;  1MS8 A;  4GMP 3;  1X8E A;  3AP9 A;  5C9A C;  3ZXD A;  4CXW A;  5G04 L;  4P9L A;  1XRU A;  5GZE A;  2AR6 A;  4R9B A;  1KQR A;  3U07 A;  3T09 A;  1LU1 A;  1DQ0 A;  2WT0 A;  4C91 A;  3FJS A;  3C7O A;  4XF0 A;  1V6O A;  5IVJ A;  1ZRD A;  4ZZ5 A;  3CJI C;  4YWA A;  4QM9 A;  1QDC A;  1YIF A;  1DZR A;  5C4W C;  2RS5 1;  4YW4 A;  3OUJ A;  3H3Z A;  5L7O B;  1YQ2 A;  1BYH A;  4U36 A;  1RGS A;  4YGD A;  5TSW A;  3ZSE A;  1H1I A;  4Y22 B;  1W9Y A;  5JXG A;  1YCI A;  3WF0 A;  1PMI A;  3KB5 A;  5IVE A;  4LA3 A;  1JYC A;  4XIO A;  4Q0Q A;  2E51 A;  2YBK A;  3NMB A;  3WNO A;  1GWM A;  1JZ5 A;  1HDK A;  3M7A A;  3KF3 A;  2BNN A;  5DDJ 3;  4EN9 B;  4RS5 A;  4AQ2 A;  5LRS A;  2PHX A;  2ZCW A;  1CN1 A;  1NYW A;  2BGO A;  3I4I A;  1DZT A;  1S2B A;  2VQA A;  4Q0S A;  4BLJ A;  3ZYR A;  3J7N A;  2X05 A;  3VZK A;  2BJS A;  5T5O A;  5B2G B;  1HRI 3;  4XF4 A;  4Q4X 3;  2JDU A;  3OEA A;  2QKD A;  3AKP A;  1WMX A;  4WVM A;  3P3P A;  3MUZ 1;  2F6B A;  1JOB A;  2WYS A;  1CIY A;  1VBB 3;  5T5P A;  3AK0 A;  3WDX A;  2WNE A;  3BTZ A;  4AGG A;  1MS0 A;  4ONU A;  5L9R A;  5LCW L;  3K4D A;  5JLV A;  3J8F 3;  1PO1 1;  2QJV A;  2ZX2 A;  3GHN A;  5FTT C;  4JRA A;  4NRQ A;  1NY7 2;  2P3I A;  3GHM A;  4CA9 A;  5CA6 A;  1UX6 A;  1FNY A;  1X7N A;  1CPM A;  1BMV 2;  1QJX 2;  4CP9 A;  5J36 A;  3K4A A;  3WR0 A;  5DZE A;  3LSD A;  3U14 A;  4LBQ D;  3OGV A;  1TNF A;  2HWB 1;  3ILF A;  3M3Q A;  4WM7 B;  2W3J A;  3LSE A;  4P9G A;  4PT6 A;  1W8Z A;  1ZBA 1;  4LBQ B;  4XAA A;  5F5Q A;  2W91 A;  1S0G A;  1R1A 3;  1X9T A;  4CDW B;  5IK7 A;  2QQI A;  5FP4 A;  2DCK A;  1IOA A;  4NOT A;  3LOI A;  3WOG A;  1ULF A;  2WLP A;  3ZFG B;  4FT8 A;  4P5Y A;  4HSL A;  5BNN A;  1K5M A;  1T2X A;  5I8T A;  3VDD C;  2QQP A;  2BEO A;  4J25 A;  1RUJ 3;  3VBR B;  3N36 A;  1OKQ A;  2EIC A;  2J1S A;  1T6G C;  2D43 A;  2WZ8 A;  1LGN A;  4XIL A;  4AAP A;  4COW A;  2XUM A;  3GBF A;  3ILR A;  3IN9 A;  3ABZ A;  3H7Y A;  2YV8 A;  1CR7 A;  1WZX A;  4UFK A;  1OUR A;  3AKS A;  1GP4 A;  1MQT B;  5A3P A;  3BPS A;  3BTY A;  2I45 A;  2XLG A;  1OF3 A;  2XWJ B;  1QXJ A;  4I0A A;  2QBX A;  3TN9 3;  3U37 A;  2CNA A;  5FOB B;  2WFP A;  3F95 A;  3POF A;  2OPK A;  1HKD A;  2O14 A;  2JX9 A;  3SKV A;  1QNW A;  1CAX B;  1CIW A;  1V9U 1;  3FC0 A;  3WV6 A;  3N9O A;  2FQP A;  2W87 A;  4FP2 A;  3CJX A;  2XLF A;  5FRE A;  3VBF A;  4WVZ A;  4YM0 A;  3L2Y A;  1RUG 2;  2B39 A;  2NMN A;  3AC0 A;  4IER A;  3FFZ A;  5JOW A;  4C0H A;  3APB A;  2A6V A;  4DXS A;  1A6C A;  1XB9 A;  2VNV A;  3TEZ A;  4CU6 A;  4H7L A;  2WSU A;  1HX6 A;  2VMD A;  1X36 A;  3MLJ A;  2D6M A;  3VD3 A;  4CEW C;  1LU2 A;  1SLB A;  1Y4W A;  3AP5 A;  1J83 A;  4GJZ A;  4FBF A;  2WZP P;  1ENR A;  4D6S A;  3ZSL A;  2G9G A;  1IKQ A;  2Q8O A;  4MSV A;  2SLI A;  2KR2 A;  4H2A A;  4RHV 1;  5KWR A;  4XTP A;  4Z8B A;  5FMO L;  1B35 A;  1CAW A;  1W6N A;  5DAW A;  3ZOI A;  2W1W A;  3RQ0 A;  4LOR A;  5J3U A;  4R9A A;  2EXJ A;  4QPI A;  2A6Z A;  5DG1 A;  2RDQ A;  2VBB A;  1YXW A;  3SIT A;  5EQU A;  4FFF A;  1ZA4 A;  2OKX A;  5JMC A;  1Q3E A;  3WG1 A;  5D8A C;  3V0B B;  2P4E A;  1AJO A;  5FPU A;  1EP0 A;  3U75 A;  1NY7 1;  4RR3 B;  4TSV A;  3PME A;  2E26 A;  1QJX 1;  3WT3 A;  1W9W A;  1D4M 3;  3R05 A;  3DPR C;  4P14 A;  1QJY 2;  2ZGK A;  1G9A A;  3WCR A;  4XOG A;  4HET A;  5FZE A;  2BNO A;  4DUV A;  3EBR A;  4OMC A;  1DQ5 A;  3LGR A;  3ORJ A;  3RJR A;  1E5R A;  5DUU A;  1C1F A;  4XTM A;  4RFR B;  2C4X A;  4WZC A;  2ADD A;  3AJZ A;  2X53 S;  1MVE A;  1LHU A;  4OUS A;  1LEM A;  1PO2 2;  5FY7 A;  3H0O A;  1O3T A;  2HWF 2;  2R04 3;  3E5Q A;  3NAP C;  2WN2 A;  4XCB A;  1W0P A;  4DMI A;  5C71 A;  5HI0 A;  4ZXK A;  4CU7 A;  5A6X A;  3J26 N;  2QQK A;  1QU0 A;  1HN1 A;  1ZX5 A;  2DCY A;  3U4X A;  4R8H A;  5BY5 A;  4K9S A;  2FDG A;  3MLK A;  1LRH A;  5FZH A;  4N8M A;  4JVA A;  2Y6G A;  3UJQ A;  4FCA A;  2RJK A;  3ZXK A;  5T5L A;  1X33 A;  2VNO A;  1H6X A;  1Z0H A;  3NO8 A;  4E2S A;  4QX3 A;  4CCD A;  4BE3 A;  1X82 A;  2HEV F;  3USS A;  2X5I A;  2YU1 A;  5CG9 A;  3FMG A;  4OHX A;  5FY9 A;  3OYW A;  1QKQ A;  1SAC A;  2VVF A;  3OPZ A;  5GZC A;  2JG9 C;  5I0T A;  2WZR 1;  1VBC 3;  1C4R A;  4BK5 A;  1HXS 1;  4TLG A;  4QPG A;  4GXL A;  3D0J A;  4IGP A;  3CJI B;  5FZC A;  2QZ2 A;  1H9W A;  4Q0V A;  3VD4 A;  1OLR A;  4EZH A;  4UFI A;  1M4W A;  1ENQ A;  3K48 A;  3MBW A;  5C4W B;  4M01 A;  2DFC A;  4L8Q A;  1QQP 1;  3LDB A;  3ZYH A;  4MH0 E;  5F5I A;  3VN4 A;  1PK6 A;  5CZK A;  4A3X A;  3WW2 A;  4B4P A;  2Y8K A;  4D0Q A;  5FQ0 B;  2IUW A;  1PZ7 A;  1XPW A;  3OY8 B;  1ZRI A;  4HG6 B;  4HPK B;  2LUW A;  4AVB A;  5FPB A;  3NV2 A;  3NJX A;  1SFN A;  1U0A A;  3K46 A;  3RNS A;  4CTE A;  2XHK A;  3NJV A;  1OA3 A;  1RED A;  1MZF A;  3GZT B;  3LEG A;  5JIA A;  5C8C A;  4FOQ A;  5A3T A;  4E2Q A;  4LOS A;  5CKN A;  2B4K A;  4QWN A;  3LZZ A;  4UW4 A;  3ZFE A;  1YQC A;  1R1Z A;  1VBA 2;  3POG A;  4GMP 0;  2BFU L;  3KCY A;  1WMD A;  4TTG A;  2PQQ A;  1FPN 1;  2QQM A;  2Z79 A;  1UY4 A;  3S5Q A;  4Z1V A;  4I2O A;  1TMF 2;  5KC6 A;  4QB2 A;  2WNV A;  2PTM A;  4BWO A;  1GKB A;  5HXM A;  1POV 3;  1VBE 2;  2ETE A;  2HWD 2;  2VNG A;  3P6B A;  4B7K A;  3OGR A;  2UYB A;  2HWF 1;  1ZZC A;  3C7F A;  4ISQ A;  1W0O A;  3IDC B;  4LE4 A;  4UBG A;  5FZM A;  5I8Y A;  3VBS C;  2NZ9 A;  4CUC A;  1JYT A;  1TG7 A;  2OZ6 A;  4XJU A;  4QU1 A;  2GH2 A;  4PF1 A;  1MR5 A;  1ODN A;  2IFR A;  2ZEY A;  1PGW 2;  1HB2 A;  4LIV A;  2OQ7 A;  4BQW A;  3PL0 A;  4CP0 A;  3USU A;  2VOX A;  2EIB A;  2J1T A;  4Q26 A;  2SBA A;  1YC6 1;  4XZU G;  4XF3 A;  4BJ0 A;  5F7U A;  2Y38 A;  2P1B A;  2VNR A;  3DEM A;  2ZGS A;  2QQN A;  3LWC A;  2A70 A;  2JDM A;  3O1V A;  5A33 B;  3LF7 A;  3D3A A;  3WF4 A;  4BQX A;  1SG3 A;  4FOY A;  3WZ1 A;  4IUG A;  3VDC A;  1K5J A;  2XL9 A;  3GXU A;  5BPX A;  5DDJ 2;  3LA2 A;  3T3Y A;  4QHO A;  4URT A;  3T1M A;  1M06 G;  2VM9 A;  2VAU A;  1S4C A;  3PUS A;  2ZMK A;  1S0J A;  2QDN A;  4H14 A;  4N53 A;  1HRI 2;  4Q27 A;  1LAJ A;  4Q4X 2;  3WHU A;  4UAP A;  4GKX A;  4RN5 A;  3BOW A;  4I30 A;  1OOP A;  4TZD A;  1VBB 2;  2VC9 A;  4AZZ A;  2HBU A;  4IE6 A;  5FUP A;  5SV5 A;  3G6J B;  1OLQ A;  1UY1 A;  1V6N A;  3J8F 2;  5FLH A;  4FPO B;  4UFM A;  5K4L A;  4CEW B;  1YFY A;  2IXI A;  2ZXQ A;  3ZXF A;  1SFP A;  1QIQ A;  4GAZ A;  4YG6 A;  4E4Z A;  1FV2 A;  4I01 A;  1UKR A;  4IL7 A;  4CPB A;  5A7W B;  1WW4 A;  4LXL A;  5A3L A;  1OVP A;  4P9Y A;  3A22 A;  1NQJ A;  1RUC 3;  3OCP A;  1D0G A;  3N9P A;  2DBN A;  5FOJ B;  2DCZ A;  1FV3 A;  1HB3 A;  2VME A;  3R0R A;  5CIS A;  4Y26 A;  2VZO A;  3IKW A;  1BBT 3;  5A6Z A;  4CE8 A;  3W21 A;  2WWJ A;  3I2I A;  1ULG A;  1O8P A;  4QHB A;  4OCT A;  1JU4 A;  1TMF 1;  3OD4 A;  4YZ5 A;  4HXC A;  3KLS A;  3LPF A;  3POW A;  3JBG 3;  3PJQ A;  1VBE 1;  1RUJ 2;  4NRP A;  3O1P A;  2WO1 A;  2PN5 A;  5FKC A;  1GNH A;  4XUN A;  5DPN A;  2QE3 A;  3DPR B;  5FBJ A;  2OII A;  4ERO A;  1IS6 A;  4KG8 A;  4CCO A;  3I2K A;  2ZGR A;  1K45 A;  1W8O A;  1PMJ X;  2ET1 A;  2V4V A;  1D4V B;  1PM4 A;  2JD9 A;  3MW4 A;  4A6S A;  5A1L A;  4RQP C;  5CG8 A;  1VBD 3;  1AX1 A;  4HL0 A;  2XKO A;  4L2N A;  4Y20 B;  5A32 B;  3TN9 2;  5CFD A;  1RYY A;  1PMH X;  2XQX A;  1PGW 1;  3OGS A;  3ZYP A;  1WWY A;  2ZGU A;  1ZRF A;  1AF9 A;  4CUB A;  1FI2 A;  2DVF A;  2HWB 3;  1A8D A;  3S6P A;  3I59 A;  4CCM A;  1W05 A;  1GSL A;  3Q8E A;  4BK4 A;  5FLI A;  2VQ0 A;  5EIY B;  4YVW C;  4LKS A;  3W5M A;  1RIN A;  4QT6 A;  5A7Q A;  1UQX A;  3B94 A;  4QX7 A;  5BNP C;  5JIU A;  1EAH 3;  3ITQ A;  3FL7 A;  1LUL A;  2R49 A;  5FZL A;  4NHK A;  1C8M 1;  5JOX A;  5DUW A;  2PAM A;  3OUI A;  1CAV A;  4XMA A;  5ABJ C;  4D7S A;  1CAW B;  5FZB A;  2VZQ A;  4AI3 A;  1GP5 A;  1FMD 3;  5GM0 A;  1UPS A;  2CAU A;  2CHH A;  1K12 A;  5D21 A;  5J7M A;  3OD0 A;  2JG9 B;  4E4D X;  5JZG C;  3FZ3 A;  2AEZ A;  5FZI A;  1H2M A;  3QH7 A;  5FXW A;  1BZW A;  5CU1 A;  3ACI A;  4MX3 A;  3VBU C;  1V9U 3;  2B46 X;  1IPK A;  1F4H A;  2Q5T A;  2RJL A;  2RE9 A;  5FP8 A;  4CZS A;  5HCA A;  4AVT A;  2GDF A;  2X09 A;  4BU2 A;  1W2U A;  1WW5 A;  3MLL A;  3RVH A;  5T5J A;  1D4M 2;  4N43 C;  3R4U A;  2O8Q A;  5FP9 A;  4YZ2 A;  2P6H A;  2XQR A;  1OH4 A;  2OXB A;  4COZ A;  5A3M A;  2VO5 A;  1I5Z A;  5FZD A;  4HVQ A;  3WDW A;  4AED A;  2C5D A;  4F83 A;  2WYF A;  5KHG A;  3THT A;  1R1A 1;  3HNM A;  5CKM A;  1XOY A;  4LQR A;  3ZFF A;  2D98 A;  4RHV 3;  4CSW A;  1YI7 A;  1GNZ A;  2R04 2;  2GC1 A;  2PHR A;  2KXL A;  4AGR A;  5FIX A;  1WME A;  5JCT A;  1RUJ 1;  5T54 A;  2VZS A;  3PUH A;  3ZN4 A;  2ILM A;  4YZ1 A;  1HRV 1;  4AE2 A;  2VZP A;  4WM8 C;  2FBE A;  2C1F A;  3A4U A;  4NHL A;  4E2G A;  4BPZ A;  3AYA A;  1I1E A;  1FAT A;  3TN9 1;  1W6M B;  2X5I B;  4PDW A;  1UKG A;  3OYW B;  1NCQ C;  4UYB A;  3RZL A;  1BK1 A;  2WA3 A;  1LEN A;  3BOP A;  3IDA A;  3M3C A;  2VL4 A;  2DF7 A;  3NJY A;  3AMN A;  2FMD A;  4QGL A;  4RD7 A;  1OFN A;  5HXV A;  4PBP A;  3ZMO A;  4RGG A;  2B7Y A;  5FZ6 A;  1VBC 2;  2EAK A;  3URF A;  3B9I A;  1COV 3;  2VUD A;  2J1U A;  4UT5 A;  1IS3 A;  3NKG A;  3V64 A;  1U5Z A;  3C8X A;  1NE4 A;  1BEV 1;  1QOO A;  2YPJ A;  4NO4 A;  3PNA A;  4FO9 A;  2ZGO A;  4QDR A;  5GLZ A;  2J1R A;  1GQG A;  1VMJ A;  2Z69 A;  4IV3 A;  4BM8 A;  3FX3 A;  4YGB A;  5DZF A;  1DCS A;  4IEW A;  4CDX A;  4Y1U A;  4K3U A;  3TEW A;  3MDP A;  1AXZ A;  1NA1 C;  4HFS A;  2R16 A;  2DVA A;  4JC1 A;  4URA A;  4B7E A;  3MIF A;  1QDO A;  1BVV A;  3JZV A;  2OVU A;  2Z42 A;  3HPN A;  3IT8 A;  4QKF A;  1K3I A;  4XQW A;  4MOA A;  4LNV A;  1C3H A;  4XJZ A;  1GZ9 A;  3PTR B;  4DY5 A;  4LR4 A;  4WZF A;  2EA7 A;  4MHU A;  3S7E A;  3WW1 A;  2ZGN A;  3WNM A;  1ST8 A;  4XBQ A;  4CDQ C;  3IIA A;  5C3S A;  3Q8B A;  3LIH A;  2WZR 3;  3PVE A;  4NUB A;  2GP3 A;  3BUC A;  3VGI A;  2A7A A;  1HXS 3;  2E53 A;  1QOS A;  3OSD A;  2VOT A;  1D4M 1;  1POV 0;  4NHM A;  3WIN E;  1W2A X;  3FUO A;  4CDU B;  1O3S A;  4P9J A;  3JQX A;  4HT1 T;  4XUO A;  3ON7 A;  3K75 B;  3H50 A;  1NLR A;  4AWD A;  3POS A;  3RZZ A;  2VMI A;  1LGB A;  2D7F A;  4GZ9 A;  5FK7 A;  2BWA A;  4J1W A;  2JKB A;  1H8T A;  4XDQ A;  1QQP 3;  4S2D A;  3ES1 A;  4GH4 A;  4QDQ A;  4ZU5 A;  3KVA A;  2R04 1;  2RR1 3;  4LE3 A;  1ZBE 3;  3T08 A;  1IQA A;  3PMS A;  1R09 1;  4P02 B;  2K2S A;  2LRP A;  5C3R A;  1HQW A;  4IV1 B;  4CDW C;  4X6R B;  2HH9 A;  1J84 A;  2VJX A;  5EFU A;  3I3B A;  2BVB A;  2ZX3 A;  4Y33 A;  3KV5 A;  2JE9 A;  3MIH A;  2KA3 A;  3S0M A;  3HBK A;  1WGP A;  3EXU A;  5KXB A;  3VBR C;  1AVB A;  1DGL A;  1O7F A;  4A7Z A;  2IXJ A;  4C1X A;  4NPM A;  1BVP 1;  1V6I A;  5H9S A;  3DV8 A;  1E5S A;  4BXS V;  1MQT C;  5FJK A;  3AZV A;  5I0S A;  2E6V A;  2VTX A;  1L7R A;  4JKM A;  5A7O A;  5LEJ A;  2Y26 A;  2GP5 A;  5GZF A;  3H3U A;  5IAT A;  1W28 A;  4RQP B;  5I0D A;  2QQJ A;  4M3C A;  2YYO A;  1EV1 3;  2EXK A;  4MVT A;  1XNT A;  1XND A;  2J1V A;  3CBN A;  4IEZ A;  2E63 A;  2D3P A;  5AFE A;  3NNF A;  2RV9 A;  1WW6 A;  2JIC A;  3H9A A;  4UFL A;  4YNI A;  1XNA A;  4D3W A;  4DOU A;  1GZW A;  4IGQ A;  2CL2 A;  1XJA A;  4OQ8 A;  1ND2 A;  3FHQ A;  3CF6 E;  3UV9 A;  3AVS A;  4YRD A;  2RS1 1;  4CRQ A;  4EN7 B;  4GWM A;  4AEJ A;  3KS7 A;  2LTN A;  4COV A;  2JWP A;  3B9C A;  4XCA A;  3IZO A;  4ZU4 A;  5BUV A;  2DUR A;  1PNF A;  3VKO A;  4UF0 A;  3O1S A;  1XSQ A;  4MUV A;  1VLN A;  5FWJ A;  3RJ2 X;  5FO9 B;  1WBL A;  1RVF 3;  1VAK A;  4HK8 A;  1RUC 2;  4I3P A;  1DFQ A;  1SPP B;  3ZPY A;  3RZJ A;  4OYU A;  3O0V A;  3HR9 A;  5FO8 B;  1JZ6 A;  2QNK A;  4GD4 A;  1SZB A;  3DUI A;  5C5U A;  1N1V A;  2GSY A;  1BBT 2;  2X29 A;  3DKW A;  1HB4 A;  4NR1 A;  1JXN A;  4YYO A;  4OMD A;  4MV2 A;  3O1O A;  5EJ3 A;  1Z7S 3;  1ZZ6 A;  3FUQ A;  2VCB A;  1HIX A;  4DB5 A;  1K42 A;  4RGK A;  2A3X A;  4XQD A;  1GUI A;  3JBG 2;  3BOD A;  4GA9 A;  5EYY A;  4QX8 A;  3CO2 A;  3N7K A;  1QXP A;  4LJH A;  2WAO A;  3QLQ A;  4N43 B;  1REE A;  4TXW A;  5FZ3 A;  3RMX A;  4CCL A;  3ZSM A;  1LEC A;  4MET A;  2A5Z A;  1DQ4 A;  5JXH A;  1YJK A;  3PHM A;  3VZJ A;  3WF1 A;  1VR3 A;  1W8H A;  1UU6 A;  1VBD 2;  5F1R A;  4EV0 A;  2VOW A;  3RZM A;  2XKP A;  4HAN A;  3GZU C;  1O6U A;  2QVS B;  2JJ6 A;  4XJ9 A;  4Y1X A;  1XU2 A;  2JIG A;  4XFB A;  4JTN A;  3RGB A;  4HN0 A;  2Q0A A;  3UJO A;  3WQ1 A;  2HWB 2;  4AG4 A;  2XPJ A;  2OYZ A;  1MS9 A;  4AOC A;  4AW7 A;  2ZS6 B;  3QD6 A;  2V5Y A;  3HMY A;  1XQN A;  4DEQ A;  1KS5 A;  1Q8S A;  3MIE A;  3AMQ A;  1Y9Q A;  2HWC 3;  4DS0 A;  4PF5 A;  4LHK A;  2PYT A;  3WD5 A;  4WM8 B;  2WWS A;  4LKF A;  1TVG A;  2GNT A;  3FBM A;  3VLB B;  5DUV A;  2MPF A;  5IVF A;  4OHY A;  4AGV A;  4QQL A;  1U5I A;  3WF2 A;  1H30 A;  1W03 A;  3TBD A;  5C7G A;  5IVB A;  1F15 A;  2VEC A;  2FZ2 A;  5CFC A;  4FVV A;  1V6M A;  2W47 A;  1YQ5 A;  5GZG A;  5IW0 A;  1LB2 A;  5H9P A;  1J3P A;  4QHZ A;  4XE9 A;  1F5F A;  1NCQ B;  3MPP G;  4NAM A;  4AI9 A;  2W39 A;  2Z4F A;  1ONA A;  1G9F A;  1DDL A;  3N7L A;  5FZO B;  3FN9 A;  2OPW A;  2K9Z A;  2B45 X;  3CEW A;  4M3C F;  1FOD 3;  3VZO A;  5BXX A;  4LIT A;  1JW6 A;  2W08 A;  3AP7 A;  4A7K A;  2D3S A;  1QGL A;  1JYN A;  1LJ7 A;  4LPL A;  1V9U 2;  2ZX1 A;  5LY1 A;  5AC9 1;  1SBF A;  2HKX A;  4YAR A;  2VE1 A;  3HJR A;  4BQ2 A;  2VW2 A;  1UIJ A;  4GJY A;  1C28 A;  1W6O A;  1QH7 A;  1NX9 A;  1NA1 B;  1RUC 1;  3FFQ A;  3JD7 3;  3OBR A;  3I8T A;  4GAL A;  4KWJ A;  1DQ2 A;  1KDK A;  5GLT A;  5C3Q A;  4UW5 A;  1QHD A;  2UWB A;  1J3Q A;  2GMM A;  1C8M 3;  3HT1 A;  4CCJ A;  3SH3 A;  1SLT A;  3KGL A;  1BBT 1;  1QY4 A;  5FZK A;  1AR6 1;  4RYD A;  4R4Z A;  4RHV 2;  4M0N A;  4V2V A;  2V4A A;  3V65 A;  5M0T A;  4NIH A;  1QJU 1;  2WFF 3;  4K1Y A;  3NRU A;  2H0V A;  2W68 A;  4CDQ B;  2BPA 2;  1RUI 1;  3JBG 1;  1S2E A;  2ZTN A;  3NNG A;  2BBA A;  1ALY A;  2BGC A;  3VDD A;  3T0D A;  1W3V A;  2IVJ A;  1RUF 3;  3CIH A;  4BME A;  4D7Y A;  4OUL A;  1Q5O A;  4DIN B;  4L9B A;  1ND3 A;  3Q9O A;  2VD7 A;  1UZV A;  1V70 A;  1VBD 1;  2VVE A;  4KU8 A;  1U5X A;  2VZU A;  3OPW A;  4KGG A;  2G19 A;  4OHZ A;  3HOB A;  4Y1Z A;  3DYP A;  2ARX A;  1W06 A;  4N7U A;  4UI9 L;  1RUO A;  5LB6 A;  3WEZ A;  4HLT A;  5HCH A;  2B8M A;  4MGT A;  4EWA A;  2RDR A;  1UMH A;  5FPZ A;  2IFW A;  4B8E A;  2DWR A;  1COV 2;  4DQA A;  5FDB A;  2DU1 A;  4XET A;  2X10 A;  1RJ7 A;  5F3G A;  4DEV A;  1EAH 1;  4PHZ A;  2BDR A;  3V0A A;  2WT2 A;  4FAH A;  1W8T A;  3HD8 B;  1UF2 C;  2OX0 A;  1GU3 A;  3VV1 A;  5GLW A;  1JZ2 A;  3H8R A;  1HRV 3;  4XBN A;  4NMI A;  1NAE A;  2VG9 A;  1QXR A;  4RS5 C;  1UMZ A;  2VU9 A;  1CZS A;  1FMD 1;  1ZRC A;  2ZBJ A;  1DP0 A;  4B1L A;  1ZRE A;  5L9B A;  2W0X A;  5FFO C;  3VBO A;  3BTA A;  1DF0 A;  4XMI A;  4QGM A;  3HN1 A;  5DZG A;  4CYD A;  3W58 A;  3MV1 1;  5DAX A;  1GV9 A;  2VOK A;  4MGI E;  3UGF A;  1PNG A;  5C3P A;  2WZR 2;  2BU9 A;  3RYK A;  2GC2 A;  1G7Y A;  1H4G A;  1HXS 2;  1J58 A;  4DO0 A;  3RG0 A;  1J3R A;  2W1U A;  2WIN B;  5AVA A;  5CAZ A;  5K0U A;  5FZG A;  1RMU 1;  1BEV 3;  3QBQ A;  2A6Y A;  2VH9 A;  4YVS A;  2GNB A;  2PHW A;  1AXY A;  2D97 A;  1JOJ A;  3H1M A;  3JB4 C;  5GAL A;  3W5N A;  3ELN A;  4UW3 A;  3UET A;  1QQP 2;  3U10 A;  2IXK A;  5JOY A;  2OA2 A;  1OA2 A;  2R32 A;  4JHT A;  4QPY A;  5E89 A;  3I2J A;  2RR1 2;  3KT4 A;  1ZBE 2;  3PJY A;  1RUE 3;  2VZ3 A;  3CNA A;  4GKY A;  1XNK A;  4LO4 B;  3DKQ A;  4ORF A;  1V6K A;  3H1Y A;  4HOO A;  5A3W A;  4FXK B;  1ZZ9 A;  2YUE A;  5BNN C;  1C5I A;  3NAP A;  2WNU A;  4EN8 B;  3NQH A;  1GR3 A;  4KG0 A;  2D44 A;  4HKO A;  1H8V A;  3WP5 A;  1X8M A;  4IQP A;  3OGJ A;  3TWI A;  3ZKY A;  3M3E A;  1F35 A;  3OBZ A;  2JEC A;  2YHJ A;  3H8X A;  2EAL A;  1UZY A;  3N7J A;  4TLF A;  2ZHK A;  5T52 A;  3PIG A;  1MS4 A;  3GGL A;  1YI9 A;  1FPN 2;  3SCF A;  5L73 A;  4NIG A;  4MGQ A;  3QCW A;  1MPX A;  3OEB A;  1COV 1;  3JQW A;  2YGM A;  1JS9 A;  1WCS A;  2XJQ A;  4FPH A;  4I02 A;  1GWK A;  2DTW A;  4S2H A;  1EV1 2;  3VBF C;  3VB9 A;  3VD5 A;  3C3V A;  3PU8 A;  4K21 A;  5ANN A;  2LRO A;  5DQ0 A;  1LOF A;  3HNY M;  1R09 3;  5C5T A;  4AI8 A;  4I09 A;  2ORZ A;  3ZKU A;  2H6C A;  3WG3 A;  3TB0 A;  1BJQ A;  4QX0 A;  3CZU A;  3MV0 1;  4C0B A;  5K9Y A;  5IUQ A;  2LW8 A;  2OQ6 A;  4Q4Y 3;  3BN6 A;  1YQ8 A;  2ZEZ A;  2P3Y A;  2UYA A;  2DV9 A;  1W8W A;  4JQT A;  5KHK A;  3M1H A;  3OOX A;  1YNA A;  1B35 C;  1J1L A;  5FPA A;  2JIJ A;  3U78 A;  1O3Q A;  3HQU A;  1Q8O A;  4AFA A;  1LOA A;  3ETP A;  3H1W A;  3O1R A;  1RB8 G;  1RIT A;  5T3N A;  1RVF 2;  4MXW A;  1O3R A;  2VTF A;  2R07 3;  5FYC A;  1MZ5 A;  1CAU A;  2IC1 A;  2ZEW A;  2DFB A;  4FQ4 A;  1QJF A;  4JGZ A;  1U5Y A;  2RVA A;  2ZX4 A;  5FKB A;  1DLC A;  3I2O A;  1APN A;  2ZGP A;  5EP9 A;  4AFB A;  1UO9 A;  5EV7 A;  3POI A;  3D0S A;  1LHN A;  5BNO A;  2JXA A;  4NJ4 A;  5LBE A;  5KXE A;  2CTV A;  1XBF A;  1SHW B;  1Z7S 2;  1ULE A;  1SMV A;  3VBH A;  5C33 A;  3GJB A;  3ECQ A;  4FTE A;  4S2F A;  2Q4S A;  3K77 A;  5IWF A;  5FY8 A;  5JUV A;  2RS1 3;  3WX5 A;  1KIT A;  3SQO A;  2XR4 A;  2RR1 1;  1ZBE 1;  1EY2 A;  3BYW A;  3HBZ A;  2NM1 A;  1CZV A;  2AZ5 A;  1MS5 A;  4KQ7 A;  2XDV A;  3D5O A;  4PLM A;  3HIF A;  1NLS A;  2JB4 A;  3VBS A;  2WQ4 A;  3WUC A;  2UU8 A;  3C2U A;  4IEY A;  1SCR A;  5CB7 A;  4HMZ A;  3VHO A;  3SMH A;  1YJL A;  4QQO A;  4AFD A;  2JG8 B;  5I0U A;  3J4U H;  1SCS A;  1N1Y A;  1OI6 A;  3SEP A;  4A3Z A;  3TYJ A;  4WV8 A;  1W6P B;  2HWC 2;  1WBF A;  2WC2 A;  1BKZ A;  1UIK A;  1AYN 1;  3NJZ A;  5GKA C;  3WG2 A;  3MZH A;  5LA2 A;  2QCS B;  1MZE A;  4AI0 A;  2ZAH A;  4FFI A;  5CEH A;  1HV1 A;  1ZA7 A;  1UOG A;  4UFJ A;  2X5I C;  2VCC A;  4LTA A;  4LHS A;  2NP0 A;  3AZX A;  3O1U A;  2CV6 A;  1V00 A;  3RPQ A;  5DG2 A;  1OXC A;  1UOB A;  1EV1 1;  3LDR A;  2BOJ A;  4BQ4 A;  3RI8 A;  1ENX A;  4Y5T A;  4BYY A;  2H6B A;  3MO4 A;  3VZM A;  3MGU A;  3VKL A;  1YHF A;  1PVX A;  1A8M A;  1DLL A;  3T4H B;  4BIO A;  3ALQ A;  1UWW A;  2WLQ A;  4EN0 A;  1S0I A;  4BQ1 A;  3KV4 A;  4AAX A;  3MW3 A;  4P5H A;  5DN2 A;  3PVB B;  1KFU L;  2OUH A;  3K3N A;  1EPW A;  1OBN A;  2MEV 3;  1S1A A;  1PK6 C;  3IMN A;  4CP2 A;  4UBH A;  4AR2 A;  4F8A A;  1I5P A;  4FPJ A;  2V5D A;  4PQQ A;  4IES A;  2ENR A;  1W0N A;  2BYV E;  1VJ2 A;  3AZZ A;  3PU3 A;  3POB A;  3QOP A;  1OHF A;  1RVF 1;  3GZA A;  2NN8 A;  3ACG A;  4G3Y C;  4XFC A;  3CKH A;  3O14 A;  4RS5 B;  2F4L A;  5F5A A;  2FDI A;  3JD7 2;  2CSG A;  2FCU A;  3KVB A;  4MGS A;  1LR5 A;  5EXO A;  5C8C C;  2E7A A;  3KQR A;  3CLP A;  1C8M 2;  3DN7 A;  2VTX J;  1CD3 G;  5D2A A;  4OVE A;  1E57 A;  3N3H A;  4MXV A;  4ZS2 A;  3EJK A;  4DZG A;  4RGA A;  1CON A;  1Z7S 1;  4WVM B;  4ZPI A;  1RUD 1;  2OZJ A;  2WFF 2;  3LA7 A;  3ENR A;  4OHV A;  4NAO A;  3VKN A;  2P3K A;  4CDU C;  3N9L A;  2ZAC A;  1A3K A;  3E6B A;  4OI4 A;  4X8P A;  1BK0 A;  2VR4 A;  2WNV C;  1RUF 2;  2GAL A;  2J7M A;  2YC2 A;  5JPN B;  4BQY A;  2TEP A;  4CP9 B;  3AMP A;  5AC9 3;  2Y0I A;  4KWU A;  1DQ1 A;  1NCR A;  3ZN6 A;  3CDZ B;  2CGP A;  3B93 A;  4XHB A;  4CCK A;  1UNB A;  5A7N A;  2X8K A;  1S2K A;  2Y60 A;  3CMG A;  4XBL A;  3ZSJ A;  3IBM A;  4IV1 C;  3RDI A;  3WDT A;  4DXR A;  1SLC A;  4DUX A;  5JPM B;  1UZZ A;  3MEP A;  3T2T A;  3M2M A;  1CVN A;  1QEX A;  1GBG A;  1R1A 2;  2GAU A;  2HWC 1;  4QU2 A;  1K5M B;  1AR6 3;  3MFC A;  5HCB A;  5BNN B;  4RSU A;  3O0X A;  4FXG B;  1SBE A;  2Q1M A;  4LBO A;  4Q0U A;  3ZYB A;  1NLQ A;  1QJU 3;  1ZNP A;  4YVW A;  3I97 A;  3BIE A;  1QWR A;  3DGT A;  3UL2 A;  1RUI 3;  3POE A;  5BNP A;  1VMH A;  2DUP A;  4DY3 A;  4MGY E;  1WD3 A;  1EPZ A;  2YG0 A;  1JOP A;  1PM7 A;  3MI8 A;  3LDK A;  4NVP A;  1GNY A;  5FLJ A;  2ZKN A;  5IK4 A;  1HRV 2;  3POY A;  4C1W A;  1KRI A;  1W2T A;  3B02 A;  1ZM1 A;  2RDN A;  5ABJ A;  1N3O A;  5LEK A;  4AFM A;  4W6X A;  2KM2 A;  1OQE A;  4QXB A;  3RS6 A;  3LOB A;  4DPN A;  4N53 C;  3HN3 A;  1FOD 1;  2QDR A;  1GOH A;  1BHG A;  3NNJ A;  3WQB A;  5JZG A;  5FYV A;  4Q8K A;  3VBF B;  1NXM A;  1O59 A;  3OUH A;  4BB3 A;  4PI0 A;  1IKP A;  1KFX L;  3IAP A;  2Q8D A;  1AL2 1;  3VBU A;  1UAI A;  4XF9 A;  5A1F A;  5K0U B;  3Q8C A;  3EMR A;  3HEI A;  4FPG A;  4YVS B;  2ET7 A;  1HV0 A;  4QXK A;  3JD7 1;  4JGY A;  5JOZ A;  1BEV 2;  2Y34 A;  1OMI A;  2VZR A;  1KEX A;  4P00 B;  2Z2S B;  4PJY A;  4LK7 A;  1YFU A;  1WKY A;  4ITC A;  4R4X A;  1B35 B;  1W6N B;  1W99 A;  5DAV A;  2XBO 1;  4AYU A;  2EF6 A;  3LEK A;  5JR2 A;  2E7T A;  5E16 A;  3R4D B;  4XJA A;  1IZ3 A;  4CEY A;  3AKQ A;  2UUR A;  2WFF 1;  5E88 A;  4KMQ A;  1XYO A;  4QPI B;  1RUE 2;  3TEX A;  3AXD A;  1LED A;  5FMC A;  5FPX A;  4J6G A;  2ARB A;  1RUF 1;  3DYO A;  4LKD A;  4XJ8 A;  3ZYG A;  3MPB A;  5FMD A;  5FYZ A;  3B7M A;  3AYE A;  4UOJ A;  2VBP A;  2VQT A;  5JXJ A;  3ASI A;  1DHK B;  4IE0 A;  2PHL A;  4AI2 A;  5HBA A;  2W46 A;  2D6O X;  3THC A;  3TEY A;  1G9C A;  5F39 A;  3E6D A;  5FZ7 A;  3BKZ A;  5ANQ A;  2WBK A;  1WW7 A;  4LMF A;  1RMU 3;  4D94 A;  2ZAA A;  2WO7 A;  1QF3 A;  1QOT A;  4COU A;  5CFD C;  3AVR A;  2HJI A;  4COY A;  3KSC A;  3WW3 A;  4MHR A;  5EPA A;  5A7S A;  2V73 A;  1WCK A;  1SLL A;  2E7Q A;  3N9Q A;  2PA7 A;  5FR3 A;  1R09 2;  1ULO A;  5DAQ A;  1F9K A;  1GYK A;  2VZ1 A;  3GAL A;  4Q4V 1;  3ZIX A;  1H1A A;  4LO8 A;  2GME A;  1TME 1;  5L7O A;  5IK5 A;  4YGC A;  1UYZ A;  2N7G A;  2BRT A;  4P9I A;  2JDP A;  2XH6 A;  4Y22 A;  1N1S A;  3K2O A;  3WLU A;  1EYB A;  4G4F A;  4QX2 A;  4UW6 A;  4YLZ A;  3WHT A;  3Q8A A;  4PBO A;  2JEN A;  3SCH A;  5FXV A;  3T4V A;  5APA A;  4C90 A;  3FLP A;  5CIR A;  3WG4 A;  2O0O A;  4B3N A;  5AFB A;  4XUP A;  3I3E A;  3LKJ A;  3H8O A;  2I07 B;  3UKN A;  2P3J A;  1IQD C;  1IS5 A;  2RM2 3;  4QPG B;  4YG3 A;  1VIW B;  2WZE A;  1SFY A;  2R07 2;  2XUE A;  1OT5 A;  3GBG A;  3PUI A;  4NWV A;  2LM3 A;  3VL9 A;  4BLI A;  1UL9 A;  2BV4 A;  4QQH A;  3O1T A;  2XGX A;  5F37 A;  1OH3 A;  3U11 A;  4Q5O A;  2ZHL A;  5JAX A;  1XNC A;  2W52 A;  4IXL A;  1AR8 1;  5FV3 A;  4LLO A;  5LWB A;  1TNR A;  2P2K A;  2W1S A;  3D6E A;  1PK6 B;  5FMO S;  5FK8 A;  2LS6 A;  1NT0 A;  3VDA A;  4AED C;  3DXU A;  2XB6 C;  3WQ0 A;  4Y5Z 0;  4OQ9 A;  2D6P A;  1TZO A;  2RS1 2;  5FZA A;  3NL1 A;  3AKT A;  4FOW A;  1RUE 1;  1S0C A;  3ZFF C;  3U4S A;  4OZO A;  1PIV 1;  4B4Q A;  5C8C B;  4WM7 A;  3WF3 A;  3GF6 A;  5FCC A;  5A70 A;  1OKO A;  2ERF A;  2IXH A;  1HN0 A;  4EWE A;  1JZ8 A;  4LBQ A;  4S2G A;  1TEI A;  2WN3 A;  4SBV A;  4FPL A;  2PHD A;  2XXZ A;  4L99 A;  4K40 A;  3UYJ A;  3KMH A;  4NHY A;  3FBY A;  3ZFE B;  3A0K A;  4AQT A;  5KR7 A;  3ZFG A;  4HZF A;  4QQP A;  4CU8 A;  4OHW A;  3N35 A;  5CYY A;  3SH5 A;  5ACA 1;  1HLC A;  1X50 A;  1LNS A;  1CJD A;  1DBN A;  4IEX A;  3ZYI B;  4LT5 A;  2HWE 3;  2OW4 A;  2WNV B;  1UN1 A;  2CWM A;  4GB3 1;  3N7M A;  4PDW C;  3WP6 A;  5J37 A;  4I0W B;  3S5A A;  4LLF A;  3AFG A;  1MQT A;  4O9G A;  4BOW A;  4L11 A;  5JVV A;  4XAB A;  5FP7 A;  3H42 B;  3N4M A;  4HBN A;  1LHV A;  2ZML A;  4JAA A;  4FP3 A;  3NNL A;  2CGN A;  2ZOE B;  1KJR A;  2EIG A;  2ZZQ A;  3HWJ A;  2K46 A;  1CAX A;  3AL6 A;  4AF9 A;  5A1A A;  4HVR A;  5A6Q A;  4A42 A;  1AJK A;  1D0H A;  3GZE A;  3USU B;  2YBP A;  1WLD A;  1RUH 3;  1OQD A;  3RFR A;  1S0B A;  4OLL A;  5EJ1 B;  4CDX C;  4Q4Y 1;  5DXD A;  4ZKT B;  2D6N A;  2MEV 2;  2Q8E A;  1F31 A;  3IPV A;  4EWD A;  2JDZ A;  4IE7 A;  1MS3 A;  2WII B;  2YBS A;  2OT7 A;  4Q1R A;  1AYN 3;  2C24 A;  1MZ6 A;  2R07 1;  4LBK A;  3B3Q E;  1S0F A;  3ZR5 A;  2WRA A;  3KCX A;  4XFI A;  4DRV A;  1B09 A;  3KZ4 C;  1W6Q A;  2RMU 3;  1GAN A;  4A45 A;  2FDH A;  2FDF A;  1PZ8 A;  1GIC A;  4N53 B;  4OZX A;  2A3Y A;  4R9D A;  5GLV A;  1GLH A;  1LCL A;  1BQP A;  2XVG A;  4HKW A;  4F3J A;  4H3W A;  4A2U A;  3V0B A;  1OOP B;  2XLA A;  2AC1 A;  1PGL 2;  2GN3 A;  4RR3 A;  1QJY 3;  2FCT A;  2V09 A;  4KL1 A;  1JOD A;  2GMP A;  2R0F A;  3PVN A;  2ATF A;  4GWJ A;  4LHL A;  2YY1 A;  4CPB D;  4AVA A;  4IND A;  3BAL A;  2PHF A;  1H8T C;  3H7J A;  2Y6J A;  1P8J A;  4HON A;  2VMH A;  3EYP A;  2CDP A;  4KNC A;  4GH4 C;  1ASJ 1;  2D5F A;  3G7D A;  3ZN6 B;  1H2L A;  4CVU A;  3ST7 A;  4F7Z A;  1PVC 1;  5AC9 2;  3THD A;  2YU2 A;  3ACL A;  3WXP A;  2JDN A;  3KF5 A;  2A75 A;  4AFC A;  4DIQ A;  3GCW A;  4E27 A;  4LUM A;  1G9B A;  3I49 A;  5FZ0 A;  1US3 A;  4XAC A;  4K7J A;  2BFU S;  2JKX A;  5JXI A;  4XXA A;  1Y9G A;  2A73 B;  4YPJ A;  5IFP A;  4BMB A;  4JRL A;  4NPR A;  3VKM A;  4W6Y A;  3GM8 A;  1VRB A;  3K51 A;  4ASM B;  4YW7 A;  3KHC A;  1AR6 2;  3AM2 A;  4QPW A;  3UKV A;  1NUK A;  1RUD 3;  2HEY F;  3I3Q A;  2BER A;  1QJU 2;  1V0A A;  3JUU A;  5LK5 A;  3ATG A;  1UU5 A;  1XU1 A;  4NIA A;  3T2O A;  5KC5 A;  4HSJ A;  1RUI 2;  1NG0 A;  3P5B A;  3RRD A;  1UPI A;  1W2O A;  5C8W A;  4KU7 A;  1L7Q A;  1WA4 A;  5SV8 A;  5FY0 A;  1GWL A;  4PI2 A;  1LOB A;  3H8U A;  4Z07 A;  4IEU A;  1Q43 A;  3KCC A;  5F6K A;  5C9A A;  4XFF A;  5C70 A;  3BCW A;  5CFD B;  4OUM A;  2IWG B;  3SEE A;  1I6X A;  2BZD A;  5CNA A;  1SBD A;  5FPV A;  4NWW A;  1ULD A;  2ZPX A;  1H0B A;  2PMW B;  1CZT A;  3UT0 A;  2EXH A;  1ZZ8 A;  2R06 3;  2PLV 3;  4LIU A;  1L7L A;  1QNY A;  3I59 B;  4FFH A;  1AL0 G;  1IG3 A;  1JHN A;  3CJI A;  4KH9 A;  2MEV 1;  4I3G A;  4LEJ A;  3I2D A;  3QAC A;  5FYS A;  1DIW A;  1ULC A;  5C4W A;  2KD7 A;  3U0Z A;  2XML A;  1W9F A;  4XJW A;  4XUQ A;  4JGY B;  1DYK A;  3CL1 A;  5DUX A;  1N3P A;  3A21 A;  3Q8F A;  4TYS A;  3BPZ A;  1NKG A;  2GH8 A;  1WMF A;  1D7P M;  3UGH A;  1BCX A;  1EAH 2;  1MS1 A;  1CAV B;  1TE1 B;  2DVD A;  2QFE A;  4Y1Y A;  1W8F A;  2XHN A;  4AQS A;  4EQV A;  5FQ0 A;  2DVG A;  1WLC A;  3AKR A;  1HB1 A;  3D8C A;  4Y4R A;  4YM2 A;  4BIS A;  5BV6 A;  1HQL A;  3VHP A;  1NXD 1;  4N9H A;  4M3C E;  5IYY A;  1YRZ A;  1ZYB A;  4M0H A;  1FMD 2;  1JTZ X;  2B42 B;  1DYO A;  2XL7 A;  4W8J A;  4BDV B;  2J22 A;  1PGL 1;  1G8W A;  4XAE A;  1RTV A;  4CXY A;  1PX3 A;  2ZAB A;  1VAM A;  4YFZ A;  2WS9 3;  3DF0 A;  2VUL A;  4YM1 A;  4ZON A;  3O1M A;  2MHF A;  3A0N A;  1IS4 A;  5F3I A;  3RWK X;  1AL2 3;  1GQP A;  2XG3 A;  3F2Z A;  1CPN A;  2VCA A;  2BTV C;  2CGO A;  1DQ6 A;  5FYH A;  5LBB A;  5T50 A;  3RSJ A;  4AED B;  2VMF A;  4LBL A;  3FLR A;  4Q4W 3;  2YXS A;  1RMU 2;  1VB2 A;  1AR7 1;  1JH5 A;  1R08 3;  2AEN A;  3WDV A;  3ZXE A;  4IEP A;  5JSO A;  4XF1 A;  3ZFF B;  4W65 A;  4XIK A;  2QQO A;  4FPF A;  1V6L A;  1MAC A;  3CQO A;  4BIF A;  2QQV A;  2VW0 A;  3O12 A;  2XBO 3;  4QM8 A;  1WLW A;  3GNE A;  2RG4 A;  1UW8 A;  1W8U A;  3BI3 A;  5L9V A;  1ZZB A;  3R6S A;  2ZZJ A;  4BCU A;  5F3C A;  2JG8 C;  2A6X A;  3PDQ A;  2DBI A;  4YW6 A;  1DGR A;  5K7P A;  4AVV A;  1QJE A;  3GYD A;  4IEV A;  3KV9 A;  4UFH A;  4Y24 A;  4LO7 A;  2ZMN A;  3BB6 A;  4KWK A;  5CFC C;  2DTY A;  2RS3 3;  5A33 A;  2ZX0 A;  4FFG A;  4PDW B;  1CX4 A;  1A78 A;  2Q1F A;  4IDZ A;  2R30 A;  2TBV A;  4BQ3 A;  4K8F A;  4NHX A;  2WUH A;  3E5X A;  5A3O A;  1OUS A;  4CCE A;  5ERL A;  1W3X A;  2OUJ A;  3B5L B;  1VRH 1;  2RM2 2;  2VVD A;  2E32 A;  1OPM A;  4SLI A;  4DRR A;  3VL8 A;  3WUD A;  4CCC A;  3N9M A;  3WP4 A;  5FUN A;  1YWK A;  4W50 A;  2ZKL A;  2UWA A;  5EJZ B;  4ZXE A;  5IVY A;  5IT6 A;  2LAL A;  5E8A A;  5EYX A;  5LW9 A;  3C7H A;  4IV3 B;  3JU9 A;  4A6O A;  2O8O A;  4NID A;  1MVQ A;  2EAA A;  4CDX B;  2EXI A;  2R0H A;  1JMU B;  1GZT A;  5FBZ A;  3GJA A;  2RJ2 A;  4Q4V 3;  2C9A A;  2HLE A;  3AP4 A;  5FMB A;  1TME 3;  4IE5 A;  4DUW A;  1N1T A;  3SLI A;  4CEW A;  5FZ1 A;  1OVS A;  5IHR A;  3I2F A;  2GND A;  2VXJ A;  3MIB A;  2FD8 A;  1KDM A;  3DEC A;  5A7W A;  3B01 A;  4Q8L A;  3NV4 A;  3M8L A;  3ZDS A;  1US2 A;  4XFA A;  1UU4 A;  3V56 A;  2GC0 A;  4B29 A;  1WCU A;  1LES A;  1SLI A;  2XJS A;  3B69 A;  2E9Q A;  4FOV A;  2ZA9 A;  3O5S A;  1Y43 B;  4GWN A;  4LO5 B;  2E33 A;  5AVP A;  1UXZ A;  4K1Z A;  1MEC 3;  4M4P A;  4C8D A;  3T30 A;  3ZSK A;  4ARX A;  4LUK A;  3S57 A;  5LA9 A;  2WAB A;  1YEW A;  1AXK A;  2VPV A;  2FZ1 A;  3JCI A;  4PIY A;  5JI7 A;  5CAD A;  4QAW A;  4FPC A;  5D8A A;  1FXZ A;  1O8S A;  4XUR A;  3M3O A;  3FHA A;  4CUG A;  1ND3 C;  4K8R B;  4XDP A;  3TNQ A;  4MGZ E;  2JE7 A;  5A80 A;  2CY6 A;  2YFZ A;  1DG6 A;  4N9I A;  1UD1 A;  2DUO A;  1AR8 3;  2HWE 2;  5JWP A;  1H8T B;  3BU7 A;  3AYC A;  3DPR A;  3WP3 A;  1A34 A;  1XSR A;  4GH4 B;  1Y7B A;  1ODM A;  2PXJ A;  3NST A;  3PLQ A;  2R1D A;  3OJB A;  2D40 A;  1VMF A;  4Y20 A;  5A32 A;  1BXH A;  3ZLI A;  2R7E B;  2YZ4 A;  3OF1 A;  4MO3 M;  5KBF A;  1AYM 3;  2PHT A;  1OA4 A;  4YW5 A;  1J1T A;  3I3D A;  1AX0 A;  1LOE A;  1DU3 D;  3RWN A;  1PIV 3;  4RFT 0;  3ZXJ A;  5FYY A;  2BWC A;  1K5M C;  3OG2 A;  4R9C A;  2G1M A;  5FY1 A;  2P37 A;  2BVV A;  1RUH 2;  1OSG A;  3RZK A;  3IPV B;  3FWE A;  3MIG A;  5B4X A;  5IAX A;  2HBT A;  5G05 L;  2ADE A;  5J98 B;  2XJP A;  4BA6 A;  2ZJC A;  4O9E A;  4AVC A;  4K6B A;  2W94 A;  5ACA 3;  3I7D A;  3I2H A;  3KT1 A;  2XVL A;  4LK6 A;  2IXL A;  5ISL A;  1XE7 A;  3VBO C;  1AYN 2;  1IPJ A;  1YO8 A;  2G9Z A;  1NE6 A;  2RM2 1;  3HVD A;  4GB3 3;  1T6B X;  1W6Q B;  2BGP A;  2BP6 A;  4XQ4 A;  4DNY A;  2JDK A;  4ATF A;  3I3M A;  3E5U A;  1Q8V A;  4M3C B;  3ILN A;  4QGN A;  5FZ8 A;  2RMU 2;  2JG9 A;  4N7I A;  1JZ4 A;  3AMM A;  5JMO A;  1VAL A;  2NPI A;  3DL3 A;  3W9A A;  3ZXA C;  1GZW B;  1AR9 3;  1ND2 B;  3AMH A; 
#chains in the Genus database with same CATH homology
 2OX0 A;  5FZ3 A;  4D6R A;  4CCL A;  4EZ4 A;  2YU2 A;  4QXH A;  5FZO A;  4DIQ A;  4CCM A;  3PUQ A;  3PTR B;  4GJZ A;  2XUE A;  5FZ0 A;  4D6S A;  5FYT A;  5FYB A;  5IWF A;  5FY8 A;  4UF0 B;  5F37 A;  4NUB A;  5FY4 A;  2GP3 A;  5A7Q A;  5IVC A;  5IVJ A;  4QX7 A;  5FXX A;  5FV3 A;  5LWB A;  5FZM A;  1VRB A;  3KV6 A;  2XDV A;  5FZL A;  3N9M A;  2Q8C A;  5FUN A;  3DXU A;  5FZB A;  5IVY A;  4D6Q A;  2P5B A;  5LW9 A;  5FZA A;  4QU1 A;  4QXB A;  5FPU A;  4DO0 A;  5IVF A;  3U4S A;  5IVE A;  3KVA A;  3N9N A;  5F32 A;  2YPD A;  5FZG A;  5FY0 A;  4LIV A;  2YBK A;  5FYV A;  2OQ7 A;  5IVB A;  5FZI A;  5FXW A;  5FZ1 A;  5IW0 A;  2Q8D A;  5F2W A;  5FZE A;  5A7W A;  2XXZ A;  5FYU A;  5FZF A;  5A1F A;  3UYJ A;  5FPV A;  5FP8 A;  4AI9 A;  5CEH A;  4Y33 A;  4V2W A;  5KR7 A;  4LIU A;  3KV5 A;  4BU2 A;  5FZO B;  3RVH A;  5FYS A;  4C8D A;  5IVV A;  5FP9 A;  5FY7 A;  4LIT A;  2XML A;  4HOO A;  5FZD A;  3LD8 A;  5A3W A;  3DXT A;  4E4H A;  5LY1 A;  3PUS A;  5FJK A;  4CUG A;  4GJY A;  4XDP A;  3KV4 A;  5FP7 A;  4BXF A;  4CSW A;  5E6H A;  5A7O A;  5A80 A;  2GP5 A;  4QXC A;  3OPT A;  4Y4R A;  5FZH A;  3K3N A;  4BIS A;  4TN7 A;  3AL6 A;  5LY2 A;  5FUP A;  4CCJ A;  5F2S A;  2PXJ A;  5FYZ A;  3PUR A;  5F3E A;  3PU3 A;  5FZK A;  5FXZ A;  2YBP A;  5K4L A;  3ZPO A;  2YU1 A;  4V2V A;  3ZLI A;  5F5A A;  4GAZ A;  4IGQ A;  5FY9 A;  4CCN A;  3AVS A;  5FP4 A;  3KVB A;  5F39 A;  4IGO A;  4LXL A;  5A7W B;  5FZ7 A;  5FYI A;  5ANQ A;  2Q8E A;  5FJH A;  3PU8 A;  5FYY A;  3N9P A;  5FZ9 A;  3PUA A;  4IGP A;  2YBS A;  5FY1 A;  3AVR A;  5FZC A;  2OT7 A;  5F3I A;  4EZH A;  5A3N A;  4UF0 A;  3NJY A;  5FY5 A;  5A7S A;  2WWJ A;  4AAP A;  5FYH A;  5FWJ A;  2VD7 A;  5FZ6 A;  5FPL A;  4ASK A;  3N9L A;  3OPW A;  3LDB A;  5F5I A;  5A3P A;  2OQ6 A;  3N9Q A;  5FYM A;  5F5C A;  5ISL A;  5FPA A;  4GD4 A;  2W2I A;  3U78 A;  5FZ4 A;  5A7P A;  4EYU A;  5FBJ A;  3K2O A;  5FP3 A;  3AL5 A;  5FPB A;  4CCO A;  5FZ8 A;  3N9O A;  4Y3O A;  5FYC A;  4CCK A;  5A1L A;  5FWE A;  5F3C A;  5FXV A;  2OS2 A;  5A7N A;  3K3O A;  3PDQ A;  4HON A;  4XDO A;  5F3G A;  4URA A;  5A3T A;  2WWU A;  4QX8 A;  3KV9 A;  4QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...