5E6IC

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
258
Chain Sequence
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWDTELVETRPAGDGTFQKWAAVVVPSTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
total genus 38
structure length 258
sequence length 273
chains with identical sequence I, M, R
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e6iC01
3JTSB 4AEEA 2EDJA 2YZ8A 4EVNB 3THMH 1FYTD 1GOGA 3WJLC 4GLRI 2AEWA 2CUIA 4HXAH 3ZDYE 5T3XE 2OP4L 2NY1D 3RBGA 4MS8C 4AH2B 3QO1B 1KIQB 1B6DA 2DJSA 3MCLH 1LVEA 4PTUA 5DQJB 4YHNA 4JO4L 4PRPD 1HNFA 4U3XA 5JW4M 2ENSA 4KKBC 2HWZH 3BQUC 4OCXH 5JQ6L 4Z7UA 2IBZX 2PO6A 3MRBB 4UTAH 2VQUA 5F3BB 3IDXL 3N50A 5HVFB 2V5RA 5DRXB 3PL6B 5C0GB 3D3VD 5C09D 4ENED 3AB0B 1FP5A 3C8HA 1FV1B 2HG5A 2QEJA 4IRZH 1BPVA 1FL6A 3KPOB 1WTLA 3KLDA 5JW4Q 3U4BH 4O51B 2DQTL 4HKZB 3UTTA 5IM7B 1VFMA 1IC7H 3RVWD 1JZ7A 1FE8L 4OBSA 3DI2B 4XNMA 2IQAB 5J12C 2OK0H 4KVNH 4KTEH 2VAAA 4M7ZB 3UYOD 5SV4A 1F4WL 5GZND 4E5XA 4HIEB 3QIUB 1AD9B 1EFXB 4ZSOA 5GGSY 3DVGA 5K33A 4JRWA 2C1PB 3HCVB 5IHUH 1AJ7L 1Q72H 2QQQA 2ZG1A 4O9HL 2BVYA 2ZPKL 5A1AA 4R4BB 2PW1A 5D1ZD 2ICCA 1ZXQA 1G84A 1U8MA 1I85C 1KNOA 4ZOBA 3RVVC 5CEXB 4OJFH 2JIXA 4QY8A 5IB5A 3VWKA 1MI5B 5CHNA 4I0CC 5DEGB 5LAXA 4AENB 4UIKH 4NKDA 1NMAH 3T2OA 3U9PH 2VN7A 2CLRA 3DURB 3HNVH 4LHUA 3TEUA 3QUMB 4GXVH 4HWNA 1MVUB 3UYRH 2Y7QB 3EO9L 2ATKA 5EU6E 2BC4A 2V17H 4OBRA 4YNYA 1K4DA 3SKOB 3TYFB 3A6CL 5ACZB 4NSKB 5ACMA 4OGYL 1ZLSH 3ZKSD 4JFZL 3BVNB 2QKIB 4HK0B 2FBJH 4EUPB 1KT2B 2GSIA 1WWCA 5T1KD 3VCLB 4DW2H 4HV8B 4ZD3H 1DN0B 4PGBA 3SJVA 3SPVA 4KRPD 3FKUS 3PHOA 4JO4H 3LN5A 2AJXL 3ULVC 3OV6A 4KXZH 5FYJD 3F62A 4PJDA 2R1YB 4JN2A 4QHNB 3UTTD 5KSUB 1MF2H 3MRPB 4LVHC 2A0LC 1HN1A 1XT5A 3BWUC 3G5ZB 2ADGA 5CD5C 3W9DA 3BP6A 4NNPH 3UBXA 1KJMA 2EDFA 1KPVA 1KXTB 4MA1B 2HMID 2DMKA 3CIQA 5C0JB 3TBYB 1CFQA 1XF2B 5C8JA 3NIDF 2QSQA 4XCNB 1ACZA 1JFMA 3AM8A 4NO3A 4I9WE 5FYJE 1KCRL 2JB5L 3K0WA 1QFWI 4MDIA 2NY5L 4ESKA 1QRNA 2VDOL 1B2WL 4FQ1H 2Y06L 4JO1H 4LCIH 4OTXH 2V9QA 4M5ZL 4XNYH 4HJGA 1C7SA 2YPLA 1WQVT 4H26B 2XT1B 2DI7A 3VJ6B 5BRZD 3LKPA 3MRDA 4XXCA 2GCYB 3JZ7A 1RJCA 3O81A 5IEKB 3S5LG 2QBWA 3AU1B 3EHBD 2FZ3A 5TFSH 3ZZ1A 1AXTH 4JHZA 3U1SH 1BJ8A 8FABB 1D5ZB 3RDTA 5I75B 1EHNA 4X4XA 3MBXH 2P47B 4WGWB 1FO0L 1CWVA 3QUYA 4JDVA 4GKSB 3X13A 3GMLA 2XWJA 4JQVC 5CJXC 4PRPA 5DFVC 35C8L 1K6QL 1JRHL 2COQA 2DQGL 5JMOC 3PF2A 4YDVB 1CT8A 3S37X 5CZXD 1FZMB 3W5NA 4MXQC 2DM2A 3G6JB 2GYSA 3DROB 1YPZE 4NWUH 3QDJB 3IGAA 4Z5RA 2XTJD 4QRRB 1X4ZA 4LCWB 3GJEB 3ARDC 1AR1D 4KZDL 4OGAC 4X7FC 3GSXB 4CVUA 1WSST 4EI6A 3MJGX 1BQHA 4GG8A 3K8KA 2HKFL 3P40A 4HJ0D 4E41A 5AD0A 1I4FB 3ZKXC 4Z0XB 2J6EA 4KROB 3QEQD 1NCNA 2ZOLA 1MF2L 2D9CA 2OR9L 3V7AE 5E94A 3BP7B 4YDVA 4N5EA 4JJ5A 3V4UL 5CEYA 1WT5C 1A7PH 4FFZL 3NABL 5HHOB 4JZOA 4OZIB 4LPVA 1R0AL 5IMLA 4IS6A 1G7JA 1M05B 1XIWA 3LEYL 2W9EH 4OFYA 3OF6A 4Y4KB 3MGOB 2C3GA 5E0QA 1OQXA 3A6CH 1DLFL 1WWBX 2FZ3B 1A5FL 1FLRH 4HWZB 4X5LA 1NAMH 2Q1EA 4P23D 3OG4B 1OWWA 4YDKH 5KJRL 2YPLB 4FZ8H 4PP2A 4TUKH 2CKBH 3WJJC 1OGAE 5D1XC 5E4IA 1UCTA 3ZE0F 4PJFB 4OZ4A 3V0VA 4WGVB 4YDIL 3D69A 3D39D 2VLRE 3KS0J 5AAMA 5DJ0A 2OYPA 4P57A 2O5YH 3SQOH 3JVGC 4Z7VA 5CBAB 3K2MC 4PGCA 1KCKA 1EAPB 2E8YA 2Q7NA 3O6FD 3SKMB 3GRWL 1BD2B 1UEYA 4FMFA 2MHAA 5GGVL 3GMNB 4OLVL 1MNUH 1S7VA 4G9FA 1I9RL 4P3DA 1MQKH 5DUPL 2YWZA 4MNHB 3TBTA 4HIJB 4U1SA 3LN9A 3BN3B 4KI1A 2ZCKL 4CVXA 4HAFA 3QZWA 5HI5D 2CLZA 3L7EA 1J8HA 3WNOA 5EZIL 4XP5L 2ZUVA 5K9QI 3EZJB 1ZT4B 3HI1A 1FE8H 1QSFA 1DN0A 2CKNA 4MD5B 3CGTA 4PGDB 4JFPB 3QDGB 2GSIB 4KUCF 5GGSB 4O58H 3E2HC 3JWNC 1RURL 3QDAA 4EDXB 3EOTH 4YBLC 3RNQA 4XP1H 4KFZC 2X1QA 4U7SA 2EDXA 1MY5A 5IOPB 3PP4L 5AYUL 2AXJA 5KVFH 2WQ8A 1P4LB 2A74A 1D6VL 4Y2DD 4XPAL 4L3EA 5DD1L 1W0YT 2XPGA 1P2CB 1IM3B 3P11H 2OXHA 5T1KB 4LP4A 4OZ4B 4QRUA 1SY6A 5HHPA 2Q7YB 1RZJC 2H3NA 3WFHB 2CRMA 3CXHK 2ZKHL 1Y6KR 3RGHA 1EUUA 3GO1L 3MA9H 3DJ9A 4R7NA 4X5WB 3V4VL 2FLRT 2GQHA 4ZFOA 3OR6B 1ZHLB 1U9KA 4LSRH 2NY1B 4HPYL 1CFSB 4QRPA 1LE5A 5EO0A 3RIAF 3RVTD 3CCHB 2JTDA 4Y5YC 4OGZA 5JOPE 1HSBA 3S34L 1QBMH 1YYMH 2VDLH 3GB7B 4X7EC 2ILLA 5F21B 3EYOA 4KMTH 3T1FB 5SX5K 1OAYH 3FRPG 5E70A 3OXRA 2Y07L 3QIUA 4HC1A 1T7WA 3GMRB 4Y4HD 4H25B 3M1BB 1WZLA 2NZ9D 4LPXA 4MAUL 4H88H 1GIGL 3H0TB 3JV6B 3GMMB 4EN3D 4RIRA 4XCYA 5CJQH 2WQRA 5EORL 4BZ2H 4Q9RH 1FFPA 3ALWA 3QWQB 1OOAA 2EKSA 2KBGA 3NAAH 3VFSA 4JVWA 3BUYA 5D7SL 2XWTB 3QCUL 5C0GA 4H20H 1AR2A 5FOBA 4LCUB 4DGVH 4LHJB 1DQJB 4Z5RB 4RDQG 3MRBA 3O2WL 3DYOA 3QT2A 4R4FH 1JP5A 4RRPA 2JCCE 3NZ8B 4JFDD 2N56A 2FIKA 3PV6A 4PP8C 5FYJU 5GGRB 3VG9B 4M7JL 2NX5D 3QEGH 1I9IL 4OQ1A 3QNYB 2NY2D 4ENEC 3ULVE 2Q8BL 4GAYA 5JDSB 1PQZA 4Q9QL 1MREH 3WO3B 1AO7E 4P2RD 2APXA 4BFIB 1T2QL 5IV2B 1YYLH 3IJSA 2D03H 1PKQE 3BZEA 4HLZH 4JFDE 4DKEH 1KJ3H 3QQ3A 5F8QC 1TVBB 3QIBA 5AZEL 1S9YB 1ZS8A 3BKJH 2HJKB 4KHXH 4QRPD 3MGTB 1VGEH 3MLXL 1MI5D 3MXVH 1Z9SA 3VXRE 1XCQA 3FQWB 1UM4H 2R23A 1BEYL 3STZA 5D6CB 3S5LA 4GJTB 4WCYL 1WV7T 3EUUA 3QQ3B 3WUWA 4OCRL 5GGUA 3X11B 4PJAE 2BHUA 1ORQA 1L7IL 1L6ZA 1CDJA 4LSPH 1CFQB 1XF2A 1EO5A 3C5SB 5IFJB 12E8L 5HPMB 2QSCL 3G5VB 1OHQA 1VEMA 4KGLA 1OY3B 1G7LA 4WI9A 4I48A 4PRHD 5DMKA 4G6AC 4FZEL 4WU7B 3W9DB 1I9JL 3PWJB 4RFEB 5FO7B 5D2NB 4L8SB 4WIQA 1FVCB 3HZMB 4QHNA 4KRPB 3SDXB 3U7YH 3BI9X 3L5XH 2H2PD 5DC9B 2BP3A 2DYPA 4PGBB 3QCTL 2CJUL 4KI5E 3OAUL 2NY5C 5DT1L 4Q9QH 3SE4C 1IAIH 4Y5YB 3B9VA 3RKPA 1IBGL 1IFHH 4E9LA 4DCQB 3S96A 3BGAA 4P3CH 4ODXA 3O4LE 3C6LA 3QIWC 3W2DH 5HVHB 4LLUB 2KUTA 3MV8D 4G6JL 3D2UB 2F5BH 4F37F 5HGGS 4BSWB 4OD2A 3TA3C 32C2A 4NRYA 3WLBA 2X05A 4POUB 1U8IB 2V2TA 1F4HA 3QXWA 4XPBH 3ZKNC 1JVKA 2Y5TB 3PV7A 1C08B 4JO2H 4KKAC 3MLYH 5D7SH 4DEPB 5EZOH 1P5VA 1MHPH 5IW1B 1SHMA 3ARPA 4GAGH 4YXLH 4GKNB 5HGBB 5SWSD 4Q6IA 4X6CE 3EJJX 2QADC 3O6LH 3DARA 4NFDA 5JXED 1HI6A 3QNXB 3MNZB 3O2VL 4HQQL 3T0WA 3KYAA 1DLFH 1RU9H 1QLRB 1UB6A 2DWEA 3L3HA 5B3JF 5HVWA 4HPOL 1GAFL 5B8CA 4KJWD 4M48H 4Q74A 3S35X 2YC1A 1DCLA 4U7MA 4NKMB 3AC0A 1NFDB 3K4DA 1T0MA 1NGYA 4D0DA 2EDTA 8CGTA 3LB6D 1CFVL 4I0KA 5MENE 1NFDA 2JJWA 2XZZA 1WGOA 4LEOB 3U2SB 1U8JA 2VLJB 5I1EL 4PJAB 3AS3A 3DVIA 3UJJH 4F7EB 2HKFH 3DXAB 3G5YB 3O2DH 4JANB 4GSDL 3MA7A 2P5EA 4WUKL 1OCWL 2BVUA 1ZK9A 3ZL4H 3MA9L 1JNHB 4WO4B 2VLLB 5CKAA 4OCNC 1C16A 1OSZB 3R1GL 2QJDA 3MLRL 2EC9T 4LPTA 1LEIB 4OV6F 1PX4A 2GT9A 3ULVF 4KKNA 2DQCL 5F6IC 4ZUWA 2JB6A 3LKRB 4TULL 5C7XH 3B8YA 3LQMA 1JWUB 3GMQB 3AREC 5DLMH 4L8BA 1NCBL 1MHEB 4QF1A 1A1NB 2YD6A 4J6RL 3OGCB 1DUZB 2B39A 5DMYA 1FGNH 1X6NA 5IROA 4N0UA 3FHQA 1GPOL 5GHWL 4R7DA 2VDMH 3VFRA 1A8JH 3GI8L 4NQEE 4MXVE 4OLZH 3HNSH 2LU3A 5ILTH 1HKLL 4K23H 2AK4A 3MZGB 3PWVA 2IANE 1I1AD 3L5XL 1KN4L 5DJ2A 5DI8B 2H9GA 3GNML 2Y06H 2XKNA 4Y16A 5EU4B 5MI0B 4NO2B 4MA3B 3QDJE 2BNRA 3UC0H 1G7LB 4YHIB 2R2BB 2VDRH 3VWJC 3SDYL 4YXHH 2C7UB 5C0RL 4P4RA 3BT2H 3FONB 5DYOB 3BW9A 4Z7WE 3G9VA 3KPRB 4QRTA 4U0RB 1U92B 5DJCA 5C2BH 4OCRH 1GGCL 4BH7B 4ONGH 3CZFB 4XC1L 5HI4C 3RHWF 1R5VA 1FFQA 4L29B 3H9YA 2AEPL 2D7TL 5B3NA 1CLZL 2WBJD 5DXWA 1N7MH 2EIEA 1IJ9A 2QQKL 3EO1A 4ZS6D 3KNBA 2W91A 4GO6B 3SKNB 1YNKH 1NAMA 3WIHL 1J5OL 5TQ0H 3FOLA 1N3NA 5C70A 3HE6C 3VXNA 1YDPA 3Q48A 1EGJA 4JM2F 1HCVA 5E00B 3VXRD 1RJLB 1AP2B 3ZTNL 5DUBB 4RRPG 1Q94B 4HGWA 3BOVA 1H0DA 4S2SB 3ALPA 1S9WB 3STBA 1HIMH 5FDYA 2H1PH 5CUSH 5LCVH 1L9NA 2R0KL 4F9LA 5C3LD 1F2XK 1E27B 3WSQH 2YEZA 4HUVB 2IEPA 1C5DB 1NC2D 3SOBH 4NO0A 4ONGL 5JUEH 1E28A 5CD3B 1FN4A 4TSCL 1X5JA 1BQUA 5FECA 1S3KH 1WBXB 4JR9L 4RBPH 3HFML 4J4PD 1YNTA 3PGFL 3P9WB 4OZIF 2H6PB 3T2NL 4C83A 1T20B 5EWIL 4OI7A 1CD9B 4L4VA 5E2TH 5EG6C 1LO5B 1U6AH 4HS6A 3U4AA 2I9TB 1R3KA 5E00A 1Z0MA 4N0CC 3IAGC 2EIZB 3HZYB 2YPLE 2ZUSA 3I2CH 3MYZA 3NCBB 4WI3A 2W92A 3H8NA 2VXVH 1ZGLP 5IW6B 1PDKA 5TQ0L 4XVUC 1ZWIB 4MQ7A 1YNKL 3PL6D 2WWMC 4D9RE 1HK6A 5DK0B 1F8TH 5I18H 2OZ4A 4MHHI 4FFEX 2Y9RT 4QTIH 4KUZH 1ZMYA 5DQDL 1RSFA 5KVMC 3O8XD 3S34H 3NTCH 1YN7A 5C8JB 3KLAA 3OBAA 2W0FA 3FB6B 3HUJE 4WV1A 3TJHA 1JPGB 3IETB 5IIEB 3UBXI 4S1RL 3VFMA 2B0SH 4Z7NF 2BNRB 2ED7A 3OB0K 1WZKA 5DO2C 1VADA 3VI3F 4HUUB 1A4JB 3BWAA 3PWNA 1QR1A 4H5SA 2M8XA 5CP7A 1DVFD 3EZ8A 5CCKH 2A0LD 4PLNC 1FH5L 3MNWA 4OFYD 1E4KC 4XVTL 3MTRA 1QO3B 5KN5B 4N0CD 4RNRB 3LKSA 3ET9F 4NKIH 4UILH 3BP5B 2W9LA 3KPLA 1F00I 3HUJB 2Q6WA 1MRDL 5KS9B 2X4PB 5C07B 5CZXC 1MCWW 1JHKH 1SEQH 3HZKB 5L8KB 3KJ4C 4MXVF 1ETZA 2DM7A 3HI5H 2M26A 2UZYB 3WKML 2PCPA 5EN2A 4U1NB 3MRHB 1X4XA 1T1ZA 1IEAB 2YPVH 1R3JB 1IGIL 1VHPA 4D3CH 4OV5A 4R0LC 2FEDC 4EXPX 5JXEA 4QGYA 4G8FA 4MZ2A 4P2OD 3UTQB 3VRLF 4ZYKA 3A67L 3WHE1 4PJ8A 4UZGA 3VXSB 1FNGA 4P59L 4X0KB 5CEZL 4MD4B 1RUML 2F54D 4NUJB 3ARBB 3ZKQD 1O0VA 4I77L 4OZHA 1YEHL 3BDXA 3T4YB 4MNGE 3UO1L 3TIDB 4DGYL 3U0PB 4Q7DA 3JTTA 4I18A 3CMGA 4ZXBA 1LP9F 1NC4A 4QXGH 3X12B 4F58H 3TN0A 3TO2B 2NMSA 3KJ4B 4YHMH 2WK2A 4HGMA 3EYVA 4NN7C 1BZQK 4OM0H 5DJAB 1EAPA 2A6DA 1ZSDA 2DQFA 4N0FA 4X9GA 3BKML 3RTQC 1L9MA 4OZFA 4NT6B 4NUGH 5DZOA 5JA9A 4U33A 4P46D 4K8RD 3QCVH 4HFWA 2LABA 2C4XA 5HDQL 4K8RC 1HHHA 3DX9A 1XGTB 3FMGH 1A6VL 4XX1G 2H32A 3KYMA 2HFEA 3LRHA 4G9FE 3FB7A 4DZBB 2X4UA 2YBRA 2YA1A 5B8CB 3MYJB 1OP9A 1RZJH 4E0RA 2AW2A 1OTSC 3NH7L 2ZPKH 2FEDD 4WTXA 2E6QA 5IQ9B 4HPOH 3O45B 3MNZA 3NIFF 3IDGB 1IAKB 2ESVB 1INDL 2PYEB 1MCDA 4QHLB 5BS0D 1QYGH 3VD5A 2AJSH 3MRMB 5D7KD 1SJEB 3DGGB 3C5JA 2VDNH 3HB3C 4IDJL 3HE6D 1D5XA 1FN4B 2X10A 2Z8VC 4GRWF 3HPLB 2PNDA 3MLYL 3CPLA 1MY7A 3R8BB 1CL7I 3VXTB 5I17A 1QQDA 3EJZC 3WNPA 4JPKH 4CDHA 3RQ3A 3OKEB 3PXJA 2B2XH 1E27A 2FD6H 5GRUH 5GS1B 4C4KO 5D6DA 1DFBH 3QXAB 5LGJB 3Q3GA 4ZFZA 1T0NA 3CXDL 1R24B 2DKSA 1MCIA 3SEPA 4G6JH 1BBJA 1K8DB 2ZOKB 2MNUA 5E4EB 4UQ2B 3S96B 1LNUA 3FFCD 1CDGA 1YY8B 3W2DL 2AJZA 4OQTA 2D7QA 2ZSVB 3B6SB 4LGPB 2NCMA 3BKYH 1NBYB 4XVTH 1NLDL 3RZCB 1RJZB 4LNVA 3U0TB 3KHQA 4RMVA 2XWBA 2B4CH 2J8UB 4LKXA 4OFIA 1BX2B 3K7UA 3HUJF 3Q6GH 1YEKL 3VFPA 4YHOH 4Z8FL 2XNAA 5DMKB 5JXEC 5TF0A 1BM3L 3PXHA 3VI3E 4HC1L 4M6OL 1HKLH 4K23L 1S5IH 3ZTJH 4JFFB 5DQDH 4Y5XA 4ETQB 3NCCB 3F7RA 4ODTL 2RBLA 1MQ8A 3OJ2C 4FQJL 4ODHH 5DHXB 4PJXF 3HNTH 4CVZB 2V9TA 3WE6B 4L3ED 1T4KB 3C60D 4OCYH 3SO5A 1I8MB 4PD4J 3RVUD 2FYYB 3QISA 1PFCA 1ZLVH 4JO1L 5BQ7A 1NDMB 2ADJA 4R4FL 2CGRH 3V5HA 3RWIB 3U4EB 5FCUL 3QIWD 1HHHB 2A6KB 1DSFL 1YY8A 4NCC2 1A14H 1DE4B 4GQ9H 3C09C 1MCQA 4M7LL 4ZODA 5EU5A 3OKMB 4L1HA 4WI4A 1JV5B 5D96C 5D7JA 3KXFD 1H3PH 1P7HL 1F3RB 3VXUA 4X99A 1UJ3B 4AJ0A 3KJ6L 4OI9A 4UOW1 2VWEE 1AKJB 2GK2A 3O0RL 4YHKL 3WHXA 1MEXL 5J6HA 4HWBA 3V7AG 5EBLA 4M7KH 3S36H 4HJJH 2IPKA 5GGRA 2K7PA 1QFHA 1WIOA 1CQYA 1FFOB 3T0EC 3KPMA 5DTFB 3LSOA 4DGIL 2NPLX 1C1EL 1HIML 3K2UL 2BOCB 5INCB 3OKLA 4L4TD 1FNGB 2QR0A 2DLHA 1A6WH 1KEMH 3KWWB 4RCAA 5F7YC 5HGAA 4A2MA 5CZVL 5FYLE 4GMSL 1N5AA 1FNLA 1WCBB 1A7OH 4I4WB 1XGPB 2Q76A 2P24B 3LQAC 3RY4A 4RGMC 5L88L 4Z7QE 4M7LH 2B1AL 4WTZA 1DSFH 5I16A 2BY3A 2BC4B 2PCPB 4RIRB 4XCYB 4RBPK 1I7RB 3FB7B 2CGRL 4KQ3H 1U8KA 3MRGB 3Q0HA 1UACH 1GGUA 4GS7C 1G7QA 3VXOA 4MNQD 2DKMA 4KKAD 1IC1A 4HDIA 2QL1A 4YZFF 5GS1C 4P99A 3EBAA 4ZO6A 2IPUK 1KGCE 2JLLA 3GSWB 2IG2H 1TITA 3BT2L 4RAUB 1F4XL 1I1FB 2E27L 1GGIH 1RHHA 1CCZA 4B41A 5GPRA 4HCRH 4QRRE 3V5DA 4DAGL 5K59F 1YYML 1AY1H 4MAYA 2IH3A 3EFFB 4U1MB 3U0PA 2QHRL 4H1LB 1UZ6E 2VLJE 3ULUF 2P7TA 1FQ9C 5D4QA 3TYGH 7FABH 4BZYA 3MBEC 3P0VH 2MKLC 4JRXE 3T8XA 1J1XH 3EYQD 1A6TB 2BNUA 1KUMA 1UWGL 1I8KA 1M71A 1KCVH 1J1XL 5IJVB 2AI0L 4P46B 5I1AB 1FJ1B 4J3TA 4AEIL 4HH8A 1IQWH 4H0HB 3C5ZA 5I66B 4C4KT 5KSAB 5CCKL 4NQVB 4CUCA 2C3VA 1FV1A 4P2YA 4JM4H 4I0PA 3UTSA 3CX5K 5D1QA 3D3VA 4IRSC 2Q6WB 5KS9A 4JY4B 4G59A 4HT1H 1CE6A 2I9TA 4DQOL 1QLFA 2DQHH 3RL1B 2IG2L 2Z31C 5DR5L 4RNRA 4WO4C 3P77B 4Q0XL 4YFLF 3R1GH 1FL3B 3RPIB 2PTTA 3ZTJG 1FPTH 1QFUH 1TZIA 3IVKB 3TLRA 1X5AA 1F3DJ 3P0GB 4U1LA 3HG1A 5I1DB 4OSUH 1MJJB 4WU7A 3RJDA 1H3GA 3Q2CA 1AGFA 1RZIB 2J2ZA 1KLGB 1IZKA 3E8UH 4W4OA 1QEWB 2OX5A 2MSPA 5CBEB 5I0ZA 1MNUL 4NQED 1DBAL 1YN7B 4HZLB 1DVFA 1ZLWH 2O61A 1SYSB 4P2QD 2R2HA 3BGMB 3CMOL 5F88B 3HR6A 4TOYL 2P8MB 4QO1A 1KYOK 5J1TC 3FFCB 1V7NL 2FJFA 2Q86A 3QA3A 3LEXA 5HGHB 3VA6A 4NHUE 2J8OA 1FC1A 3PGCB 3IDNA 2XRAL 4P2RA 1GRWA 1KF9B 4RGND 2VZTA 1PBYA 3PNWB 3IXTA 2R1WA 2VQ1B 4QCIB 4QNPF 3BE1L 4LSVH 3W0WD 2ZCLL 1TQCB 3QR2A 4J12A 1LEKA 4IRSD 4ZUTA 1OGAB 3LRGA 5D6DC 2CKBL 3DXAE 4JFEB 1SBSH 3PWPA 5HHQB 3P4MB 3TPUE 4DFIA 3MPCA 1AGDB 2CDGA 1TTUA 5B39G 1DQDL 4ETQA 1G1YA 2DLGA 1W72B 3FQNA 5FA3B 4U6TA 2DQUH 1WBXA 4W6YB 4X8JB 5HPOA 3JV0A 4WWKD 4XPBL 4Y2DC 4P9ML 1Y0LB 4JZOB 2E7LE 2HTKD 3W0WE 4WFHD 3BEWB 4OLWL 1JRHH 1NEUA 1KELH 5TGBB 3W81A 5FCSH 1D7FA 1MCJA 2EC9U 3MBXL 4LOUC 4Z7QF 1BFVL 1M6OB 5CJ8A 1CBVH 1J87A 1UH2A 2X70A 3QDMA 2WBWB 3BD4A 4LCCB 1IC5H 4BKLA 3GUTA 1YJDH 5D7IB 5CEZD 5BOPA 3NIDE 3WKMH 1SMOA 2CJUH 3FO0H 5JHDA 1VKXA 1JGUH 1P1ZB 2LAGB 1T0NB 3QDJA 4LCWE 2R9HC 3GSOA 3JV4A 2HTLD 1B6UA 5EBMB 1Q0XL 3VFVA 3MRCA 4GOSA 5CMAA 4XBGA 3EFDH 1EDQA 1A9BA 1WTGT 4K8RH 5JOPD 4Y5VC 3C2SA 2VDQH 3GMLB 2G60H 4MA8H 2AJUH 2VR9A 5SWQA 3KPNA 3ULUE 3SO3B 5HTSA 3MFGB 4G43B 2E6JA 1S7SA 4CRPA 4F57H 3SGKA 3OAZK 5BS0B 3ARDB 5LGHL 1T89C 5ICXB 5DQ9A 5F7FA 5I71B 2VITB 1G9EA 4RMUA 4JKPH 4N1HB 4Y89A 3S7GA 1V7ML 1MWAB 3T77B 3DV6B 2GTWA 5FKPB 1JHLL 2CMRH 3TV3H 5J9PA 3MLXH 3RWJB 4FP8L 1MRFH 3QULB 4TN9A 1CFNB 3JUZA 1NL0H 1QBAA 3KYNA 3GBML 1NMCC 5GZOD 2FEEI 5HI5C 4G8EA 3ZDZE 4R6UA 3CVHH 3RWHB 1ZSDB 1N0XL 4WFED 2LFGA 3NCEB 3QUKB 4LLVB 4AY0A 2R29H 5EC1A 3RUGA 3DX8A 3OB8A 5E6ID 3PGFH 5K9QG 3TH2T 1VERA 4HX1B 5IB1B 4P5KA 4PLKC 3SE3C 1QHOA 1J1PL 2UWEA 2ZNWA 4Q2ZB 5BS0E 2GT9B 1TFHA 1RQ5A 3BE1H 3LN5B 2ZJSL 2JK5B 2PN5A 3DVNA 1U2HA 5LGKA 1EHLH 3WSQL 2EH8H 2XA3A 3RU8H 4HF5H 4AZ8A 4K7FA 3V79C 1AC0A 1XGRA 4UUJA 3GJFB 5E8OA 4K9EL 5E99H 3VXSE 4PJHA 3VFOB 3CFEA 1B90A 2NY3B 2Z35B 3I50H 5DJYA 4YDKL 2FBJL 3OF6D 3K80A 2BX5A 2BY1A 1MLCB 1BGXH 4J3XA 2XN9D 5EN2B 3QDGE 2EDNA 2DJ4A 4JPWH 1RIVL 4KK8C 4PGCB 1U8JB 4LEOA 1CLCA 3OPZH 4TSAH 5GS0H 2FJHA 2GJZA 3FO1B 2VOTA 4E42A 4D8PB 3HUJA 4NKMA 1R0AH 4F7TB 2ADJB 4NOBA 1HWGB 3EDKA 1M6OA 3WN5C 1DBMH 2EDOA 5LVEA 5DWUH 4KK9D 1FORL 5BCAA 2Q20A 5TGBA 3VE0A 2A38A 5CP7B 4PJGA 4KQ4H 1HQRA 2XN9E 1VADB 4ELMF 4CL7A 1D3CA 3EO0B 4X98A 5DF0A 3IETA 5CAYB 2AJ3B 5FYKE 3VXPB 3KDMA 4Y16D 5I6XB 4GRLA 5E2WL 1J18A 5CSBA 5JQ6H 1JBJA 1T03L 1C08A 4NRZB 5F1NA 5IMLB 2VZ3A 1ZA6A 4U1GB 4N5UA 5GJSL 5C0AB 1Z5LA 1AD9A 1EFXA 4ZSOB 4I3SH 2XNAB 3U0WH 1XF4A 3RY6A 4DKDC 2RGSA 1K2DA 1Q9LA 5E94B 5D71L 3EJYD 3PG2A 4LBEB 3N85H 4NQSB 4PIRF 2OL3L 5I9QB 3HKFA 4JKMA 1RUKL 1KIPB 3U7WH 5IQ7H 2BSRA 5T3XL 3MUY1 1AGBB 4ONHB 5IJKC 1E4XL 3LCYA 3PJSB 2W60B 1B4JH 1S7TB 3D25A 4OCLC 3EYFB 3MXWL 4X4ME 1S7WA 4KK9C 4F3FB 2J8UF 5E9DA 1QSVA 2CR3A 3TZVA 5C86A 1J0YA 1PQZB 2AEQL 4K3JH 1NCCL 3T04D 1N2RB 1JFQL 1BQLL 4UBDD 3G6JA 3IDXH 5T5FH 3LS5L 1M7DA 5DD6B 1JGDA 1P7QD 4Z77B 2DQCH 2NX5A 4GS7B 3DX7B 3VXRB 3HRZB 5D7IF 2FECL 5HHOD 1RJYA 1FG9C 3B9EA 3WIFA 2AJVH 5D2NC 5I1KH 5CP3H 5BRZE 4MD0B 1A7NH 2RJMA 5EUKA 1H0DB 4LDOB 4S2SA 2HFTA 1CI5A 2O5YL 3RFZC 3LVEA 1Q9KB 4JY4A 4NZUL 3MLSH 3H3PL 1C12A 3BPNC 3BXNA 3HFMH 4EKXA 4OQTL 5IQ9A 5E8EB 1AC6A 3GKWL 4KAQH 4XNXL 4ZO7A 3IFLH 2B8OT 2BRRL 2NQCA 1GOHA 3T0XA 2A9MH 2CKBA 3O11B 5SWZA 5ITFB 5CJBA 3DX9B 4KDTC 5AUMB 3HE7C 5IESH 4Y4HA 3FFCA 1ADQL 4M9PA 5IJVA 5IKCB 1FO0A 4PLJD 3CZFA 4XWOD 4V3DB 2IALB 3QH3B 3O3AA 5T1LD 3AREA 1FAIL 4DZ8B 4MNQE 2JJVA 4D9QD 1G6VK 3T1FA 4XMLL 2MCG1 4R0LB 1KTKE 5F96L 1EGJH 4HKXB 5KAQF 3BISA 4AMKH 2ADIB 3QPQC 4XB8A 2ATPB 3PWLB 3SCMB 4MA3A 3EO9H 4GG6F 3WKNA 1UADC 1OSPH 2DYPD 2FO4A 1N7ML 2QADB 3IB4A 5F6IB 3WNLA 2AEPH 3H3KA 5EORH 1URLA 5CJQL 3V6OE 3VG9C 3WFHA 4UT9H 3GSWA 5HHPB 4OLWH 5HI3C 2DIJA 4XZUB 3RL1A 5B4MD 2NY4D 5FOBB 3PQYE 5IVXB 2XWTA 3H9ZA 4YXHL 3SDYH 4DUWA 1YA5A 3BRFA 3OKKB 4QXUL 3QEHA 4NWUL 2JIXD 3N1QC 1HZHL 2R69H 5DJYB 1VFBB 1FVEA 3G6AA 3DETD 2K9UA 2IPUG 4M5YH 1QFWH 1NC2A 1TZHA 4JG1L 4JFPA 2Z93A 3MV9A 5INCA 3M45A 2HLFC 2VLRD 5A2LH 2ERJC 4KGJA 1PG7W 1TQCC 4J4PA 5ILTL 4KROD 1OT2A 1QRKA 1IGCL 3MO1B 5F1IA 1KCSH 2VLLA 12E8H 1B0GA 5DJXB 4R4BA 1GGBH 2VERN 2FWOA 1EEQA 1CG9A 3LZFL 5CGYD 1ROWA 1FLTX 5BXFA 4FXGB 3IDJA 5EO1B 1MIML 4HXBL 5DJ8A 1JCKA 2FBOJ 1I75A 4Y1AD 3X14A 2UVEA 4RFOL 3MLWL 1JTPA 4CU8A 3DO7A 4MXQA 3UZVB 2X4TB 4LIQL 4NQDE 5FKAB 4UOW0 1MHHB 1II4E 4L3EB 5E2UL 2SEBA 5J06A 3MC0A 3OTTA 2L0DA 1FNEA 2W9DL 5E2UH 3ECBB 2A1WH 5EA0L 5I8KL 2FYYA 5EZIH 5H35B 2XZQH 4GBXA 2DQHL 1TLKA 2C26A 4TSBL 2EYTB 3WLWC 3F12B 3QIWB 5JIHA 5HVHC 1R5WB 5KVDL 4UT7L 3O4LD 3EYUH 5GIRA 1ITBB 1BECA 3SDDB 4WUUE 3W9EB 5HYJA 3MXWH 2J5LC 3B4NA 2A83A 5FM5O 3O6KH 1UQSA 3VFUB 1UM6H 5HHOA 3LKOB 1WVZA 4QGTA 1IM9A 1UWGH 5KOMC 1I8LC 3ARDD 3O2WH 2NX5B 3OMZA 5EBMA 3QRGL 5HYIA 3RVTC 3GMNA 4MA7L 1NGWB 4M93B 3RWEA 1UJ3A 3OR7B 3RIAK 5B39A 4PRNA 4XBPA 1QD0A 3IS0X 3IU4H 3BO8A 3S37H 3JTSA 1QFOA 3QB7C 1HZHH 4YEFA 5B3JE 2AJYL 2XQYK 3EYFA 3GGWA 4WHDA 4XMKL 3LV3B 4KHTH 4QRRA 3HI6H 1WFNA 4QRQB 3MOBL 4MAUH 3OR7A 1JZ2A 3ULSA 2BNQE 1U8PA 5L2KE 4NQSA 3ARGD 2I5YH 1FORH 43C9B 3GDBA 4YPJA 3NABH 1IM9B 4B7LA 4LF3B 1A2YB 4W6XB 5ELIA 3WXVL 1MFDH 3MUGB 4MCYA 4CNIB 5I1LB 1MFAL 4FFWD 3T0EA 3QUZA 3S37L 2YPKA 4PJEF 3TN0C 1AJ7H 4ODWA 3U36B 5LWYH 1PEZA 5CINH 1OPGH 3BH8B 4BFGA 8FABA 1XIWB 4IS6B 4YHZH 3T0EB 1U91A 3J8F7 5EPMB 1IQDB 3MUGA 3MRDB 3PIQB 4PJCA 5FK9A 1P69B 4OLXH 3BIKB 3GSNH 1OARH 3VFWB 3TFKD 4JFFD 2VLME 6FABH 4ZQKB 1AI1L 4S1DD 4UV4H 3UAJD 2NXZD 1D6VH 5F1KC 4LRIC 3O9WD 3QIBB 3BAEL 4PBXA 1U41A 4UT7H 4WW2A 2A9ML 1MJ8L 5E56A 2JJTA 1J1PH 4PLKD 3A6OA 1CGSH 1NCDH 3LHPL 1TIUA 5MEOA 3MLSL 1FHGA 2MCPH 3Q3GB 1DLHB 4APQD 1BVZA 4P4KB 3MRLB 4MDJB 4TUOB 1CE1L 2EXWD 3BP6B 5GRVK 5EDXA 4P23C 4I2XB 1E4JA 2MPAL 2FH8A 1GOFA 4IMLA 1HH9A 1LDPL 3RIFF 3VFUA 3BKJL 4HUWA 1CD8A 1QHPA 2RCSH 3ZYIA 4M5ZH 3MJ9A 4S10A 1P4IL 3P73A 4OCYL 1NL0L 2FATH 3RDTB 2V7HB 4M8QB 9CGTA 4ZUUB 4NYLB 2BXZA 5ENWA 1DQJA 2BVPB 2WP3T 4QT5A 1CE6B 2DDQH 3O45A 1JZ8A 1S8DB 4XTRD 5EWIH 4ERSH 3SQOL 3BH9A 4MX7A 4M7JH 4GUPA 4JR9H 5GS2H 4MJIB 1BD2E 3MV7D 3O6ML 2VUYA 1TTGA 5E03A 1NH6A 5F7EL 1F4YL 2JCCF 3UBXG 2VL5A 3MLZH 5D7KE 1W72H 1I3RB 5KJRH 2VLRB 4G3YL 1MRCH 1J05B 5DJAA 2DWEB 3L3HB 3QI9D 3BFOA 5C71A 1ZANH 1EBAA 1PX3A 3CFJA 3OJDB 3PABB 4FNLL 4NRXA 1SEBB 2D7PA 1UXSA 4QRPB 5CZKA 4XGZB 1CXEA 1ZLSL 1NUGA 3RAJH 1KJ2B 4CN6A 4J3OC 3MRPA 4D2NA 4JN2B 3LQAH 1RZ8A 3DECA 1GL4B 1ZGLB 2FIRT 5LBSL 4OD3L 4LPWA 3UAJC 5I1CL 1YEGH 4K94C 4AL8L 2XICA 5A16B 5BV7L 1KIRA 4N5ED 2VAAB 3VH8G 4X7TA 1NMAL 1XH3A 3JVGA 2DBJA 2QKIA 3L9RA 4D9QE 2FHBA 3U46B 3QG6A 3IXAA 3GSOB 1IEAA 4WWID 5IM7A 3I02A 4O51A 3UTTB 5D1XA 1NFIB 2D0HA 3VFNA 4LSRL 4TVPH 1ADQH 2NLJA 3QRFM 4JGJA 5DRXA 4MD5A 5DRWB 4ZTPL 2B20A 3HMXA 4WFGD 4QKXB 4I18C 3DMMD 2AV1B 3LKNA 5CIPA 3F65A 5GGTA 1A6VH 3QRGH 1Z2KA 4ZNEA 4I2XA 4W70A 3HRZA 3IT8D 4L1DA 4XAKE 2JELH 3ZSSA 2D9QB 4N90D 4NZUH 3GI9H 4PG9A 5TDOA 2F58L 3GI8H 5I30H 1D9KB 2P5ED 3TO4B 5HD8D 2CQVA 1X5KA 2CDFB 3HHRB 4KKLC 4Z78B 5ETUA 3CFBB 2WWKT 3LMJL 1IC7L 3O3EA 3QQ4A 3O6FA 2PYEE 4R0LA 2QSTA 2C1PA 4I1NB 3D2UD 3KAAA 5DVMA 4J6RH 2OL3B 2WBKA 2JCCB 2YA2A 1AP2A 2XYCA 4I3GA 4N1CA 5L2JB 1YDPB 1N59B 2VXSH 1NDGB 4C58B 3QWOA 2VO5A 1MHCB 2IF7A 2P8PB 2ZZUT 2ZWLT 3LS5H 4L9DA 1I7TA 1J8HD 2UWEE 5I74B 2NY6B 3ARBC 5F7UA 4X6CB 3ZE2F 2DIAA 4P2QB 3NACH 3G5XA 4NQCE 5J0BA 1E4KA 1IM9D 2BXYA 3OG6B 1GZPB 5FYKU 5K9JL 25C8H 4IOSD 4L4VB 4UTBL 4BFIA 5D7LA 4NRZA 5F1NB 4S11A 4APQA 5DVNA 4GW1B 1Y6NR 4HUXB 4LSSL 3DPBA 1GHFH 2C7UA 3GI9L 4J8RA 1BIIA 1QSED 4KK6D 4NN5C 4U6HA 3WIFB 5MEQA 3DXAD 3N85L 4WDIB 3MOQA 1MOEA 3FQXA 4NJ9H 4IOFD 1TXKA 1A2YA 2M1KA 3DOSA 1JGLH 1HQRB 3OAYK 4G5ZH 1UA6L 3U0WL 4HUVA 3MQIA 4F9PC 4DKFL 2DQIL 1AH1A 1DANU 5KVEL 2ADFH 2NY7H 4NQTA 4KPHL 1KBGH 1MCOL 5DGRA 3W39A 3RZWA 3S4SB 5I9QC 1S7WB 4F3FA 2E6PA 2YK1H 3FO1A 4PGEA 4MJ5B 1OPGL 2CH8A 2APFA 5C0BA 1LO4H 4J2XA 2YUVA 4UV7L 2R4RL 1VACB 4QHMA 3CZJA 5B39B 1MHPL 3OGCA 1ORSA 5HHXH 4M61B 5BV7H 3SDCB 1FZMA 1KPRB 3V6FB 1T1WA 2OR9H 2JELL 5IF0A 4HFUL 1DANT 5GS0L 3QPXH 2EDEA 5B4MC 4K3DH 1CVSC 1T22A 2G5RA 1U8QB 4JDVB 2V2WB 4X7SH 1ND0A 3FCTA 4NNXA 1JNNL 3DSFH 2DQJL 5KW9L 3QJFB 5EH1A 2UWEB 1ZHNB 2HFGH 2DQUL 1KJVA 3PWUB 4C56A 5FB8A 5C0IB 4MAYB 5KSBF 5L88H 2GCYA 1IAIL 2EH8L 5I1HH 3TH4T 3EKCA 5ERWA 2H9GB 3QUKA 4OZFG 4RAUA 1J05A 3HE6A 3NIGE 4WEMB 5IR1B 1A6WL 1YECL 4XMLH 1FYTA 4KRLB 4OT1H 1NSNL 3D85A 4QRUB 5D1QC 2R0ZL 3C87A 4BK5A 3PDOA 5DD5H 2LVEA 5SWSA 3WEXB 5I71C 1YEGL 1PJ9A 5EOCJ 4GG6A 4LVOC 2YD4A 4OD3H 4M7ZC 3ORJA 5FKPA 3WFBL 4R4ND 3NA4A 3TZVC 1CU4H 2ITDB 43CAA 2OS7A 4OCWH 4ZFFA 3CDYA 3L3KA 3MV01 3TN0B 3TO2A 1DQLH 3VWKC 2AAVA 4Y4KC 1QNZL 3UBXB 4XVUD 4P9HC 2F8OA 5J11C 5ISZD 3F7YA 2F5AH 2JB6B 3DRTA 4Y4FC 5DA4A 2BVQB 1UWXH 1OAZL 1CLOL 3TNMA 3P4NB 4U7KA 4RZCB 4WI5A 3MV9B 4JKPL 3IKCB 3F7YB 4ODVH 4Y7MA 5SWZE 1BWMA 3RTQB 1NUFA 32C2B 1JI2A 2FDBP 3WO4C 4KJQC 3WHXB 4LHQB 1VFBA 3MACL 4KI5C 3TYFA 5MEOB 3V52H 2HMIC 3FRUA 4UDUB 4PJXE 3TZVD 4JM4L 3OKMA 3VRIB 1BVLA 1WZ1H 2ZSWA 3AMKA 4PJXB 5IROC 3ZDXF 3QEGL 2EE9A 4IRJB 3EFDL 5A2KH 4PY7A 1NGYB 3ULVD 1CLYH 2G5BB 3TPUB 4ZQKA 1KN4H 5IQ7L 3TF7C 3UJTH 4A6YL 3DTXB 1S7QB 3ISWA 1ZVSB 3G6DL 1MWAA 4J1UB 3T77A 3VWKD 1QLRA 1U0QA 1UB6B 2PXYA 2HA1A 3GKZA 4P4KD 4PJCB 4OZGB 5FK9B 4CVZA 1JGEB 1CE1H 3SCMA 4M43L 1YJDL 2PW2A 3D0VB 5I76B 2V17L 4GKNA 5CINL 4HKXA 2MQ3A 1HXMA 5GJSH 3UYRL 4D0CB 3NAAL 5CSZB 1J0ZA 5FF6A 3NPSC 2OTUB 3IKKA 5TDNB 2IH1B 2KH2B 1U8OB 1U3YA 3BAEH 4G42A 4JFEA 3OHXB 1DUYB 4LKXB 2MJWA 4MQ7B 4OJFL 2FRGP 2F19H 1ULVA 4GRMA 3AS1A 3IXTB 2XQYG 1XF5A 2VDLL 5C0AD 5I15H 2YMXH 1S9YA 1ZS8B 1S9XA 4IDJH 5I19H 4NBXB 2ITCB 4AIOA 5L7XH 4KTYA 3WIHA 4Y4FD 1LO5A 1TPXB 5T5NF 4HWBL 4CADB 1DVFB 4PG2C 5KTEL 1CGTA 4LSVL 5JDSA 5L7XL 3QXAA 5LGJA 3RZCD 2UV3A 4BH8B 5I1IL 2ZKHH 2VZVA 2DI8A 2XRAH 1CT8B 5E9DD 4PDCE 2YD7A 4OCSL 1OGAD 5I17B 4MVBD 4Q9CA 1P7QA 3OSKA 3QO1A 3SDAC 1AXSA 1D5XB 4JZJC 4X4XB 5E5MA 4PJDF 3H3PH 4O00A 1IEHA 1T2JA 4HUXA 1EJOH 4FQXC 5DK2B 4CGTA 4OZFH 2NW3A 2CDGB 1OP3K 5CJ5A 2P45B 4KK5D 5GGUB 5I1KL 1IGFH 4ZS7L 5TF1L 3MREA 4FXKA 3C6LC 3F12A 3QIWA 1H3PL 5EUOA 5ESAA 5J8OA 1CK0L 3VJ6A 1AGBA 3D85D 5L0QC 5C09E 4PUBL 1NFKA 4XMPL 3HS0B 3KXFA 3SKJH 3S4SG 2FB4L 1MLBB 2IANA 2B1HL 3O41A 1VENA 4Y4KD 4JZJA 4YGVB 4ZUVA 5IFHH 1YC8A 2EYSA 3MLWH 3KPQB 4HT1L 1JFQH 4X9BA 4MCZB 4PRPE 1SYSA 5ALCL 2RFXA 4RA3A 4AQOA 3HR5A 4ZDHA 1X4YA 1Z3GH 3DMMB 1H5BA 2WIMA 3E2HA 3O3EB 3IDIB 2X5PA 4R26L 2CIKA 3AY4A 1WZ1L 5IMOB 3VDAA 1JNLH 1Q1JL 5LGHH 5I76A 1FNHA 4NM8L 3D9AH 3WDIA 1F58L 2DM3A 1LP9A 3NZHL 1TNMA 3U9UA 5DJ2B 4TVPE 2A9NH 3FFDB 2AV1A 1HNGA 5JORB 4ODVL 1JHTA 1T7VA 1HWHB 3MLVH 4N8CL 3UTQA 4BZ1L 1XGUA 2XPGB 3MRQB 3T1WA 4NNYA 1RIUH 1AY1L 3TBWB 2EXWC 3ZDXE 1RZGB 1OAZH 3BVNA 2X42A 3QIBC 2IADA 5I16B 5E1HB 1FFPB 3QUXD 1DUZA 3OKYA 3SE8H 2N1KA 1F6AB 4LNRA 5C0CE 3HA0A 4EBQL 5IVZA 4TTDD 2VXUL 3QUMA 5EU7C 4TVPD 1K4CB 1SVZA 2YN3A 1XGRB 5BW7C 3RTQA 3DBXA 4KQ3L 4HS8L 5K93A 5JIIA 4RAHA 1Q9WA 1U3HA 1N64H 5D2NE 1OSPL 3EYOB 3U83A 1A3LL 4NOFA 1INQA 4GT7A 3F5WB 3TF7A 4MJIE 4PV8B 2DQDL 3RA7L 3MV9D 3MOAL 4L4TE 3EFFA 1OW0C 2IH3B 3BD5A 2XG4A 4HG4K 2DJUA 3D39A 3I50L 2O5ZL 2JF1A 3BDBA 4HKBA 4PJBF 3C09B 4UAOC 2GUOB 4NC0B 4W4NA 2Q87A 4U1GC 3RUGB 1LE9A 4PS4H 3L3OB 4M8VA 3E6FB 4G3YH 4ZPVA 1PSKH 2DL2A 1V8HA 5JOEA 2A6IA 4NC1E 5EO9A 1X5YA 3AMLA 4P57B 5D70H 5T1KA 3CAFA 4RGMB 1G7QB 3V6ZB 1T83A 5D1QD 5DMGD 5CS7A 2ICEB 2L7JA 1KB5A 2V5SA 3REWB 5IW6A 5JNYA 4UIMA 5GRXG 4FFVD 3TIEB 3N9GH 2JJTC 2AV7A 3WN5B 3MV8E 4NQDD 3WE6A 4Y4FA 1ZKAA 4U1JB 4LRIA 1A1OA 3ZTNH 4LSQH 4QXGL 2PO6D 4F58L 5HYQB 3V6OC 1INQB 2YK1L 3NCYS 4XP9H 3TVMD 5JR1H 1AKJD 4R90L 4XH2B 3WIIL 1UXWA 3E0GA 1JHLH 2MPAH 4Z95L 4EI5A 5ICZB 3BP7A 3WFDH 1CLZH 2J8UA 5F1OB 3MBEA 4LLYB 1TZGH 4AH2A 1FPTL 1QFUL 1R3IH 1N26A 1VESA 5BZWB 5C2BL 5AD0B 1P1ZA 2EDRA 3KR3H 3MACH 4HGWB 1UCBH 4JDZA 3UPRA 3PGDA 3AS0A 3E1F1 4GW4A 5ESVA 2ZOKA 1V05A 1HDMA 5I8CA 2OQJB 5M7QA 2G60L 3P4OA 5IMMA 2IAND 1RVFL 3LKQB 1YMHA 5F9OH 3UXFA 4YH6A 3KLHD 3U82B 2X4NB 1WC7A 5DVKA 2HVKB 1FZOB 2AEIT 4NKIL 1KACB 1G6RL 1MFEH 4IJ3B 4JFED 3SGJC 4OZHE 2HN7B 2DS4A 5JLZA 3L95B 4HK3N 5GZNC 5FUOH 3EOAB 3ARGA 4KK6C 5B38G 4EN3C 2E7HA 1MFCH 3ARZA 4ELKA 4XP4L 2AXGB 2NXYD 4LARH 5DZNA 2EICA 5D7LB 2RFXB 3L95A 4WWKB 1QA9A 1A4KB 2UZIL 4CNIA 5I1LA 3IDGA 1IAII 1X9QA 1Y6MR 3PWPB 3IDYC 3V2AR 4LEXH 4DUVA 5T3XH 5D6CA 4Y0GA 2V6HA 4FTVB 4OT1L 3RGVA 3S5LB 3SO3C 2VQ1A 3QFDA 4TQEH 1KXVC 3PNWA 5H8DA 4FQPA 4F7TA 3P2TA 1HHIB 1U8HA 5AEAA 1CGUA 3K81A 4K2UH 4NJAL 2Q86B 4KKBD 2XTLA 4JPWL 1LNUB 5C9JB 3V0WH 4N8VG 1VCAA 2QTEA 1MAMH 2Y6SD 1B0RB 5KVGH 2CDFA 4RX4D 5JPNA 4GXUM 1YNLH 3RRQA 1A7OL 1NKOA 4Q97A 2VZOA 1XIWC 3LKRA 4ZAKA 4BELD 3QUXC 4HH9A 1DP0A 3B9KA 1PKQA 4JFDA 1GXEA 3O3BB 3ARBA 4UMGA 1LEIA 2A6JA 2I9LB 1UENA 4LSTH 1WBZB 1MJUH 5ANMA 5F93C 4HV8A 4WW1A 1J8HE 3T0VA 1NFDF 5EC2A 4Y5XC 2ICWJ 1T3FB 3WS3A 1R3JA 3GIZL 1HYSD 4PP1D 4KRMB 2R0WH 3QXTA 4I77H 2QADD 4AQ1B 3V0AC 3QHZH 3IU3B 4K94H 1NLBH 4PJAA 2Q3AA 3D6GA 2XZAL 2WAHA 4LPUA 1AQKL 1UT9A 5JOFA 1G6RH 3FT4B 3RL2A 5J13B 5DRNA 5FYJL 3C08H 4PRHA 5DR5H 4AENA 4Z0BH 3QDMD 2OTUA 4RGNB 1OF2A 1QO3A 4N90E 4YFEA 5GSVA 4YC2B 4HXAL 3O8XA 2JIXB 1PLGL 1X5FA 4KI5D 4XGZA 3PHQA 1ZLUK 1FZJA 2IBBA 4FQJH 3CCHA 5C07D 4G43A 4GAJL 2HT4D 1IQWL 4WV1B 3LY6A 4OB5H 4G8GB 1TJHL 5LQBL 1HILA 3BSZH 5E8DL 5KANI 5SX5H 2ERJB 2PXYB 4R2GB 3LPFA 3PQYB 1A47A 5IVXE 4CMMB 5FUCC 4PV9A 1J1OL 1I8IA 1KCVL 4Z95H 3GNMH 5IK3B 4PJ8B 3SGDI 5AAWA 1ADQA 1I7UB 4G8FB 1K6QH 35C8H 4RAVA 3TYGL 3ZSTA 1DQMH 4P9HL 1BLNA 1RIHL 1MWAL 5TE6H 4F15C 5BO1H 1R5IB 3M8OL 4M03A 4LIQE 4RGNC 2YSSB 2EDWA 3ES6A 1T2XA 1A6UL 3KVQA 3LDBB 4PREA 5BV7B 2DMBA 4EQ3A 3C8KA 1A6UH 2YHGA 2D0FA 1NCAL 1RK1B 4XNZC 1DBKH 2CRYA 3EIFA 1KIUA 1L7IH 3B2UD 3LH2H 4X6DA 3TBSB 3VGFA 3SGJA 3KPSD 4X7CC 5DS8A 2VJXA 1SY6H 5J1SC 3CXDH 5JORA 1A21A 2DB8A 4AEHL 2EECA 3IFNL 3CDFA 1E28B 3HLAA 4UV4L 3SGDH 1IKFL 4S1DC 1QR1B 3ARSA 4MNHA 1HQ4B 1PSKL 2IAMB 2VLKA 4YDJA 4I0PD 3UTSD 1VGEL 2P5WA 1ERNA 2VC2H 3VD3A 5J6HB 3ERYA 3NPSB 2OM5A 2F74B 1UKQA 3LS4L 1A02N 4DKEL 4JQXC 5SWSE 4AEFA 4NQXA 3ZL4L 5E5RB 2F15A 1W72A 1BD2D 3MRIA 5FHBH 3MR9B 4GG6E 1Q8MA 1WBYA 2Z91A 1IC5L 4E5XB 3H9SD 5L2KB 1JIBA 1AO7A 3FQRB 2GJ6A 3K46A 3L3GB 4Z0BL 4PY8I 2P8LB 4X6EA 5IBLC 4PJFA 4L3CB 1QBLL 2IANB 4XNMB 1JE6A 2F53A 3QSKB 3CK0L 3HE6B 5IGXL 1ONQA 1SVCP 3MUZ1 3ZT7A 2BCKB 4PYGA 3H42L 4L29A 5EUOB 3IJHB 2XKSA 1T3FA 3MRRB 4M3KB 1T21A 4MJ6B 1IQDA 5IB2B 1OTUC 5EU6D 4NUGL 4H8WL 2V2XA 2NW3B 3ZT6A 3CFCH 3PE9A 4DFHA 5H2BA 4KZEH 2O61B 1CGXA 3RBSA 3WIHH 2VABA 3K74B 3QUXB 4Z7UB 4GAYB 1ND0B 3B5TA 5FCUH 1EERB 5F8RC 1DBJH 2DLEA 1G9MH 1P7QB 2X6MA 5D7LD 4N8CH 4U3HA 4MA1C 4FQLH 1UGNA 1BMGA 5F7EH 1MJJA 4U1KB 3PWPD 1GIGH 3IAQA 4PGJA 5FDWB 3FB5B 1MELA 1RUPH 4U31A 2VDKL 4M61A 3GM8A 2NNAA 4QYOB 2NY4C 1JI1A 2OR7A 4OAWB 3OXSA 4MXWH 4MGXA 5EB9A 3R4DA 5BVJB 4JRXB 3ZDZF 3BZDA 3GSVB 3BDYL 3CUPB 3NCMA 4QRRD 1MAML 3GGWB 1CDYA 5ESQA 1C7TA 2BY2A 3D25B 2UY6A 1Z3GL 1OW0A 1K8DA 4KRPC 5D5MA 1T1YA 4JRYD 5I66A 5BZWA 1NAMB 2DLIA 1IBGH 4U0RC 3GSNA 5T1MB 4UT6L 2J5LB 4HG4J 3INUL 4FTVA 2PO6C 3CFDB 5TE4L 3SGEH 1FJ1A 1T80A 4NM4H 4Z7WA 3HRPA 2KKQA 1KB5H 4KY1L 1U8OA 4UILL 2KZWA 2EIDA 5C08A 4OUUB 4UQ3B 3N06B 4JFEE 5HYQA 2EE3A 3C8DA 5TF1H 3T2QA 2APWA 3LHPH 2VSCA 2W59A 4WFHE 4IRZL 4APQB 1HHJA 4RFOH 2YD3A 4DKAA 5DLML 5C0DA 4JRYE 3O3UN 5LXGH 5FUOL 2FD6L 5GRUL 2AV7B 2E3VA 5IWLA 4P2QA 1JMZA 4C55A 2J6EH 2XTJC 3MV7E 4LLQA 5EOQH 2AQ1A 2YBRB 2V7NA 1KCSL 3U2SA 1J11A 5GS2D 2AXFB 5EBGA 3SE3A 5JHLL 3P9MA 2Z8SA 2GITA 4ZPTA 4D0DB 2X41A 5D72L 4MDIB 5IP4A 3WNKA 4IRJA 5TE4H 5JW4N 4P48A 3S3PA 4LLMA 2YC1B 4XBEL 1SYVA 3UJJL 2OSLA 3MR9A 4BSVB 1I9RH 2JJSA 4BFEA 1IGYA 2G9HB 5BXFB 1S9VB 2XFXB 4LHUG 3Q5OA 1MHEA 3MJ8B 2P24A 3OKDB 4LLYA 4PJHB 1KJMB 5IG7A 3WXVH 5HGBA 1YEFL 1MH5B 1U6AL 2F9BT 2WSKA 3VGDA 4HF5L 1F4XH 2YRLA 5HDQH 1FYHB 5F70A 3QAZB 5DTFA 2NXYC 4OFPA 5HHMD 1EV2E 4O02H 3ARED 5T5NG 3W11D 4NO0D 1U8IA 3IDMB 1MH5A 3O0RH 1NC4D 4TUKL 3SOBL 4G9FB 5GGQL 2P4AB 4YHML 1D6EA 4XWGL 2LV4A 2RR3A 5F3HB 5F9WC 5IBTH 3L3KB 3DX8B 4NSKA 3OJVC 3I75A 4M3JA 1R3HA 3VWJA 5IEHA 2YSSA 2XQBL 4JHBA 5DD0H 3BIBX 4WTZG 3KLHC 3I3DA 3OAZH 3DUUA 5HHME 3G6DH 1T0MB 1H8NA 3V5HB 5A16A 2D31B 2OJEA 4JN1L 2NY6C 2HKHL 4DN4L 3D85B 2X44D 5IGXH 4M93C 4NQEA 4ALAL 1VPOH 4OLYH 5IBUB 1CICA 2MMXA 4JG0H 5D7IE 3S3JA 4GW5B 2IMNA 1V7MH 2BVEA 5ICYB 5CEXA 4EUPG 5AG9A 3ULUD 2YPVL 1A4JA 4HJJL 4PB0L 1KG0A 2ICWB 4HKJB 5K9OA 1GC1H 4BUGA 1KJVB 3BGFB 2NTSP 1FRGL 3F6IA 3F58L 4IIQC 2J3SA 1EHXA 4BQBA 1NBVH 3MV8B 1AXIB 3WL9A 5FA4B 1TJIL 1BFOB 5C0AE 1A1MA 1AD0A 5C0CA 3WLBB 4K8RL 3S8WA 1WAAE 2OBGA 1YMMD 1CGWA 1RJZA 5DFWH 3N1GC 5DO2D 4HKZA 2G75A 4XPAH 4ODXB 4LKCA 5ESAB 2MKWA 3PP4H 5KVFL 1KJ2H 4M1GH 3JV5A 2OMNA 4NCC1 4UQ2A 1AHWB 1CN4A 2AEQH 3L3DA 4LLDA 3S36X 1DFBL 2Z4QB 3CUPA 4WCYH 2ARWA 4KUZL 4P2OC 4JRXA 1JF1B 5EOCL 4ZUUA 2B2XL 5DMJB 3UPAA 3D39E 3MV11 2IMMA 3LQZB 2VYRE 2VUOA 4LQ1A 3AVEA 2AS5M 3OKEA 4XNYL 1P6AB 1MCCA 4KY1H 5FO7A 1PZ5A 3MCKA 1C5DA 2P42B 3NZHH 5HBBA 1JTTA 4GAFB 5JMRA 4V1DE 3L7FA 4L8CB 1IGJA 3K1KC 4TTGA 4X8JA 2F53D 1G0DA 4PJHE 3BSZL 3Q1SL 3WS6A 4GFTB 2EE2A 3NFSH 2WINB 2IQ9L 3AU1A 5E9DB 1TVHB 4OLVH 1LHZA 3N1FC 1PYWA 3G9AB 3L5WA 1XGYL 3UYPA 3NH7H 1JNNH 3VXNB 1JF5A 5JW5A 4QHKJ 4BSJA 1CXIA 3UEZA 4X7SL 4ZUTB 1ZA3A 3BDYH 1YN6B 2J88H 4HHAA 4WJ5B 4ZUVB 1H3UA 3FMGL 3KNBB 3HS0A 3EO1B 2BDNL 1FVDA 4Y1AB 5F9AC 4LDEB 3BQUD 4ISVA 3UCRA 4N0YH 4PUBH 1NDGA 2X89D 3QIBD 4JLRA 3BGMA 4ZD3L 3BESR 3VXMA 1CL7H 2DQFB 4JM2C 2P1YA 1N6QL 1QR4A 1GYAA 1G7IB 4V2CB 4EQ2A 1W0VB 5FM8A 2OI9C 3FT2A 5E4EC 4NQDB 5IVNA 4HK3J 2DD8L 3CFCL 4KZEL 1NGQL 4ORGB 1T66C 1P4BL 3QUYC 1JGEA 2MWCA 3O4LB 4ONFH 3HG1B 5I1DA 3BRDA 4PJGB 2VDPL 1OTSD 2HFFA 2FLBT 1KFAL 4FQCH 1JL8A 5A3IC 5ALBH 3NN8A 1U8PB 4R7NB 1P7KA 3KGRA 4UIKL 3LN4A 5DS8B 3P4LA 3P4OB 4JHWH 5IMMB 5KZCB 1EHLL 1QLEH 3BYTA 4P0DA 1KT2A 3F7QA 3HZVA 2FX7L 4JDZB 2VDRL 3QUMH 5DMIH 4ZOCA 5HHVH 4MB4A 3HC4H 3MRHA 5D72H 4MQXD 5IMKB 5JHLH 4XPTL 2E9IA 5IHUL 2MQ0A 2VC2L 1X7QB 3P11L 3L5JA 3Q1SH 2CLRB 2P44B 5GGTH 2HT4C 3M1BA 5I1AA 2DWDB 4EUPH 3UP1A 2FO1A 1J88A 3SDXE 2PF6A 1ZT4A 3HI1B 4KK5C 2IC2A 5IHZB 4PP1C 1NPUA 1TJGH 5T33L 4HIXH 4EXKA 2H2PC 5H94B 3Q6FA 3U7YL 4CVXB 3QDHA 1H3TA 2NY0D 1BOGB 2QHRH 5IG7B 4AIZB 3VFMB 5EOCH 3OZ9L 1YQVL 2GTZA 5IBUG 1GCFA 3TT1L 5A2FA 1RHHB 4UIMB 4GBXB 1IRAY 1OD9A 1XCTB 4J1UA 5CWSA 1Q9OB 2ZUTA 4WUUD 5E08H 2VLRA 1KJ2L 1SYVB 3KPPA 2GY5A 3RZCC 1JHKL 1SEQL 1XIWD 5TE6L 4AK1A 3HMXL 5D71H 4TPRL 3RIFK 1A9EB 3MLRH 4RSVA 3ALXA 2C3WA 3NCJL 4WI7A 3QNZB 1FAKT 3EDDA 5EU7E 1I7RA 4XPHH 1T03H 1DL7L 4AG4L 4CJ1A 3E6FA 3HPJA 4HIHB 4QEGA 1R3HB 2ZCHL 4PP2B 3TA3B 3KPOA 1KLUA 4FA8A 1Q0XH 1TJHH 5ITBL 5E2TL 1A6ZB 3UJIH 4BQ6A 1BJ1H 3OKNB 3QFJD 4Q6IB 4YO0A 3GSRA 4WW1B 5ANME 3IS1X 1DBBH 1QP1A 1ZHNA 4NWTL 4U3CA 3T4AB 2QR0B 1MSPA 1UYWL 4GRWB 5GJTL 4JRYB 1L4IA 1MREL 5HI3D 1WBZA 3VWJD 5CGMA 2YWYA 1E6OH 5C08D 4LK4A 4WHTA 2R8SL 4Z7NE 2DL9A 3KPMB 1KEGH 3WFDL 1CICC 4M48L 1J7VR 3PP3K 5FYJH 1YUHA 3CSGA 4Z7WB 3EDFA 3WDJA 4P3DB 1WIPA 4YIQA 3VFTA 3SDCA 1AKJA 1S9VA 4U1IA 5ACLA 5KSBE 1ZEAH 3SKMA 3OKKA 4DK3A 3GIVA 3MBED 1G6RB 3X3GL 3HZVB 2VKXA 1I1CA 1JPFB 3V8CA 3DRQB 3OAYH 1MJ7L 5TPWL 3QEQE 4D0BB 1V5JA 5C0FB 2QQKH 5DJ6B 5BMFH 1LO2H 4LLWA 5DD5L 4FFWC 2BDNH 3D0LB 3MNVB 4NKOA 2HAZA 5BVPH 3MV9E 1X3DA 4LSUH 1Y18B 1UC6A 4MJID 1N4XH 5FHBL 4RA0C 4Y5VA 2ATPA 3BZ4B 4RDQF 2YA0A 5E2VH 1HOCA 4JKLA 4K7PX 1U92A 1YNLL 4P3CL 3KPSE 3MGOA 2R2EA 4NBYB 3IDIA 2OTWA 1JWMB 2FJGA 2V2WA 4NQUA 2C1OA 1WIUA 5KSBB 1ORQB 3AREB 3EYQC 4LCWD 4CN1A 4YBQC 3I6LD 5HYSA 3FJTA 3CLEL 5IHLB 3O3DA 1HHKB 3V6FA 3ARQA 1KPRA 4Y1AA 3STZB 3CDGA 4ZS6C 5ITFA 1QRNE 1NCUA 2B4CL 3QXVA 1MCEA 2NXYB 5GS0D 1F6FB 3B9AA 1T1YB 1H3WM 4KKLD 1ED3A 1G7HA 4V3EB 3K8LA 1AIFB 1YQVH 4X8XA 2Z9TA 1KCLA 4F57L 2WMPA 4OZGF 4PGEB 3BUTA 2W1NA 2DQTH 1BIHA 5KG9B 5D8JL 4HZAA 3LRSA 1BBDL 4IJ3C 5CLTA 5GRVL 3UTPE 5ID1A 5C07E 3SDXF 2H8PA 2FR4A 5DMGC 3FB8A 5F1SA 3GJFK 3NIFE 3RNKA 4KPHH 3D18A 5TDOB 1RZIA 4BM7A 4PR5A 3TH3T 3VRJA 3MXVL 5GSRB 2GIYA 1A3RL 3QXUA 1I3VA 4HAGA 3TPKA 4C56D 2CIIA 4HS3A 1NJ9A 3A0OA 5LQBH 4WHTB 3RKDC 5AZEH 4U6HB 4XPTH 5CIPB 2IBGA 4X80L 1YEDA 3SPVB 3FO0L 2RIKA 3QUML 5DRWA 2YXMA 3GSRB 5KZCD 2XXCB 4LLDB 3P3YA 1PW3A 1INDH 1AGCB 2CDEB 1JJUA 2X1XR 4UTBH 4ODBD 2C3VB 5FUZL 3DXAA 4JANA 2PUQT 1ONQB 2HLAB 2Y7QA 3CVIL 3TP4A 2FX9L 1XH3B 4P23A 5L2KA 1N59A 5K9KA 4NKDB 4P9MH 1GZQA 1XF4B 4KTDL 4NO5B 1QOKA 4OZFB 4N0FB 3WL9B 2VXSL 2W0KA 3BKMH 4G80B 4V1DB 5DD3H 5CWSB 3GB7A 4NQXB 1LE9B 3I84A 1J0JA 1IL1B 4NFBA 4EDWH 4FZ8L 3GK8H 5CSZA 2AJYH 2X9WA 1KJ2A 3L3JB 2VNCA 1D9KA 1U58B 2FWOB 5GGQH 1H15B 2P5WB 3IU4L 1EMTH 4F8TA 4H0GA 4GSDH 5I30L 4O02L 2NZ9C 1I1FA 1YEHH 4ZFOB 4GBXD 4ZAKC 2A77L 1UM5H 2Y07H 3TJEH 3QDJD 4X0KA 3WFZA 1FZKA 2UUDK 3HMWL 3PP3H 2G5BA 3I6KA 2F5BL 4JFFE 4E42B 1BZ7A 5E6YA 4PY7B 1ODAA 3Q5TA 2UWEF 4XXDA 5DURD 3VH8A 4ZFOL 1B3JA 3ZE2E 4QHUA 1XGQA 1P4LA 3PQYD 1K4DB 3FRUB 4IBLT 4G8IB 1RU9L 2DTML 4PJIB 3U46A 1MEXH 1T7YA 3WS3B 2IBZY 1UB5B 2EEBA 4PRBA 3QUZC 3VFOA 3TBWA 3V4VH 2VXTL 2FECI 4MAYC 3F7PC 3LS4H 4O5LH 2A1WL 5EA0H 4CJ0A 5JXAH 4XZUA 2AERT 1KCUH 2AVGA 3OKLB 4K55A 3ULUC 1CXLA 1P7KB 2F19L 3UMTA 1MI5A 1MCLA 4R8WH 2OJZH 4OM1H 3MNWB 1FH5H 5FYLD 1HILB 2CIIB 4HS3B 3NBNA 1RI8A 4Q2ZA 5AYUH 2AABH 4K07A 5L9DL 2VN4A 4JFXB 3VFGH 2YUXA 4PJ5D 3MRLA 4K7PL 4UU9A 4FNLH 1I1RA 2X4SB 1G9MC 1H9VA 3BHBB 4JDTL 2OSLB 4BSVA 3LRSB 1UJ3C 5EIIB 4U1HA 4F8QA 5I8OH 3VXMB 4AEIH 4DVRH 1CTOA 4G8EB 1PEWA 3WUWB 4WW2B 1I8LA 1UM4L 3DWTA 3KPQA 5JW3L 5JZ7D 5F9OL 2EDLA 3D1MC 1OAXH 3CLEH 4A6YB 2XI9A 2BOBA 4J7RA 4ORZC 1T4KA 4L4TB 2BNQD 2HG5B 3KR3L 3VG0H 1YEJH 1U36A 1NLDH 4NM8H 4KJPD 3ZKXB 1D5MB 3IAPA 4LVHB 4HWZA 4LFHD 2EDDA 3QJFA 1ZAGA 3GFUA 4GAJH 1WICA 2IPTL 1Z6JT 4P5TB 5AZ2L 5H37H 4EI5C 4G6KH 4L8CA 1UWEH 3OX8B 1Q0YH 2X4QA 2R56L 4YHNB 1JYVA 4LSUL 1UZ6F 5CEYB 5EU6B 1VEOA 1LDPH 3DX7A 5E24E 1UACL 1Y18A 3VGEA 5HSFA 4U0QB 4LSQL 5JZ7C 3S88L 4P4KA 2D7OA 1REIA 5E6IC 3W0WA 4DGVL 1BWWA 3RWGB 2H8PB 2FR4B 3GSUA 4DOHB 3QCUH 4U2YA 4QHMB 1EAJA 5DUBA 4X9FA 5IBTL 5D7IA 1EGJL 1T6VN 3CU1A 3QDME 4Y16C 1OAUL 2PYFB 3GIZH 5L9DH 4U1IB 1T83C 3L3IB 5E5UB 3WFBH 1HXYA 1I9IH 2EZ0C 5ABDE 2WW8A 4S0TD 3FB5A 3QJHB 2OJZL 4YK4B 5MP6L 1TPXC 4XTRC 3U9PL 1YEFH 4OCSH 1BFOA 2AQ2A 4XH2A 4YQXH 4XVJH 4K71C 3AXLA 1ZA6B 5C0AA 3B43A 1UQSB 2LTQB 4PRID 5I8EB 4OQTH 1JMXA 1DBBL 5DC0A 3C9NA 1I7ZA 4P4RB 4BFBD 2ENYA 3MRMA 2WUCL 3NMEA 3QUZB 3DYPA 3MLTA 1E4XI 5D2LF 4UI2A 2PYEA 2HN7A 1ZVHA 1XF3A 1CFSA 2BNQA 4XP6H 3BPCB 3AFLA 3WYRA 4YDLC 1BOYA 3QI9A 5FHAL 4DTGL 2VRAA 3G04A 2H3NB 5E9DE 1ZLUH 5F7LB 1FNEB 3LKQA 3UO1H 1F11B 1FG2B 4U49A 2OQJA 3IJYA 2FEEL 2QQLH 3LEXB 5E8PB 5HGHA 1MFNA 3QWOB 2FJFB 2R1XA 4D94A 1KPUB 3DUUB 4NKQB 2BJML 1J0HA 3DO3A 4OLZL 5AWNL 3HI6L 2A6IB 5EO9B 4R4NC 5LKNA 4EEEA 2D4DA 2R4RH 2NZIA 1JN6A 1S7UA 3EOBB 5FGCB 2F74A 1JZ6A 3DV4A 5CJOH 1E4XH 4PJCE 1RIHH 5CLWA 1YJDC 2BMKA 4LARL 4K71B 4PGDA 3Q6GL 4ZO8A 5DJXA 3DUSA 4M43H 5TQ2H 5IHBA 3HI5L 3RPKA 3IKCA 3G5ZA 4F80A 1F58H 2AXHA 2NY2B 1BAFH 3QZWB 4PJ5E 3B8SA 3PHOB 2HWZL 1G1CA 5TH2B 2D7NA 1QFWM 4YE4H 4Z7VE 4FABH 4P5KB 3CNKA 5E2WH 4FG6D 5CFHA 5ALCH 1NFIA 1GHFL 3SY0A 4NQVA 4HJ0C 2FX7H 1Z9LA 1K85A 4OIIH 1Z9OA 1H3XA 1CTNA 2ATKB 5D7JD 1MVUA 1XR8B 5C6WH 4YDIH 4L9LC 4I3RH 3LDBC 2R1XB 4CMHC 5FKAA 4M6AA 4DUXA 5J11B 4TUJA 1IGML 1DBML 1I8KB 1PG7X 2FX8H 4FQCL 2J4WH 5J9PB 1I8IB 1QSFE 3FFDA 4LIQH 5CHNB 3L3OA 2UYLB 2GI7A 2OZ4L 4L5FL 4P5TC 5H37G 5DSCA 5E1AA 1A5FH 1FLRL 2GTZB 2VITA 5F71A 4OF7A 3V6OA 2BY0A 1RMFH 2PW1B 3DHMA 3HC0B 1MPAL 3HC3L 4N9GA 3H42H 1DQQB 4PV8A 2XY1A 3FCTB 4LQFH 2XACC 3E2HB 1ES0B 4LSTL 2C3XA 1U8QA 4KJPC 4OZIA 3S6CA 2FGZA 3JWDC 2Z93B 4LOUD 2BSTA 4P23B 4GMTH 4LCYB 1X5LA 1X7QA 2JJSC 3IF1A 4CW1B 2ZOLB 4JZJB 4YGVA 4OKDA 2LVCA 5GGRY 1KGCD 2XTJE 1EEZA 4RMSA 3RI5K 4Y88A 4R97C 1XFPA 2ZUUA 1WCBA 1FSKB 1S5HA 4MJ5A 4GKZB 3TGXA 5KAQG 1Q9KA 5L8LB 3VD4A 2EDHA 2HFGL 4HEPG 3IFOB 1F2QA 5FYKD 4WY7L 1IKFH 5DK2A 3JWOL 4X4MA 2CUHA 4QXTA 4M62L 4NPYA 4KWUA 5T1DH 3B9KD 1LP9B 2FO4B 1E6JH 4OLUH 1A7PL 4LEXL 5GRWA 4EOWL 4FP8H 5FGRA 3SGEI 2DTSA 2VIRB 5JDJA 1YZZA 1U3HC 4I8DA 2WBJC 4JFQB 3NGBB 4HS8H 2YD2A 2EZ0D 4PYHA 4NQDA 3FB8B 2CIKB 4OFDA 1A7RL 5IFJA 1I1YA 5HI4D 2NY6D 1A64A 1IEBA 4XVSL 3ROLB 3SCMC 3WO4B 4UINL 1J86A 2Z4QA 2WBJA 4HMCA 4W68A 2V2XB 1RZ7L 1JNJA 3SQBA 3LD8C 5IEKA 4Z7UE 4N0UE 4P9HH 3FTGB 1OGAA 3QG7H 4FQ2L 1J8KA 1JUFB 3P30L 1B2WH 5DA0B 2XY2A 1CICD 4O4YL 5B38A 2M2DA 4YAQB 4FFYL 4XPFH 2DM4A 1FFRA 1PG7L 5KS9F 2Y36L 1Q9LB 1CR9H 1P5UA 4OB5L 5ADOH 5JW5B 5DGQA 3BXNB 1A1MB 1OAKL 3BZEB 4WO4D 1IT9L 3GMPA 2Z31D 3KYKH 3DIFA 3VMNA 5HHOE 1WFOA 2FJGB 2NY3D 1MIEL 3D9AL 3TA3D 5C0JA 1AXTL 1KULA 1JNLL 1Q1JH 4PJBE 2H26A 1GPOH 2NY2C 5GHWH 4ELME 4FG6C 4LHUD 3K4ZA 2NXZC 3BEVA 1FGNL 2YRPA 4MCYB 2R39A 3F7VB 3QIUC 4O2EA 4Z7VF 4U1LB 1QUNA 5FXCH 4OZGA 2AKRB 3PL6C 3DSNA 4NZRH 1P4IH 2R1YA 4YUEL 5SWZD 3QG7L 4N1EA 1M7DB 1S7QA 4X83A 1AQKH 2AQ3A 2Q8AH 3P77A 1NBZB 2ZUXA 3UZQA 4XPGL 4PJ7B 2FHCA 1QLFB 3BN9C 5TQ2L 2NW2A 1KCRH 5ESVB 4EUPA 3TT1H 3NA9L 1F90H 4XCEB 2OI9A 1DZBA 3T2NH 5ACZA 1OLLA 4EN3B 4X7DC 3C5ZB 1HSAA 4GRMB 4ZFZB 1A1NA 1S3KL 1NGXA 3KPSA 4D9LL 4WUKH 3CFEB 1RUKH 2F58H 3FT3A 5AWNH 1DN2A 3CXHJ 4P46A 1YUHB 4M6NH 3IDMA 3E3QC 2QQLL 5IK3A 5E7FA 1AI1H 4OFKA 1LK3H 4PFEA 1OAYL 5D9SA 4YR6B 1SJEA 5FHAH 1X5GA 4Y1AE 4G8GA 5FYLL 1ZVYA 2LU7A 2DQJH 5KW9H 2DBLL 3ROOB 2YD5A 4F2MB 2GFBA 4HKJA 2WZPD 2P5EE 1ACYH 4HWBH 5E1AB 5DSCB 2P46B 4OI8A 2XFXA 4TNVF 4P5TD 2PXYD 1HHGA 4P49A 4R2GD 3MYJA 4KQ4L 1MUJB 2Q7YA 1KB5B 1FGVL 2VXQL 2APVA 5EZOL 1OT1A 1RULL 1XMWA 4JCMA 2OK0L 3VXUE 2I27N 3FT4A 3RL2B 5F6HI 3P0YH 2UZIH 2NY3C 3VXSD 4Y2DA 4LFHG 5J1AA 3QUYD 3OPZL 3T3ME 5DJ8B 1QPXA 1EPFA 1GGTA 1W0WB 1ACYL 2Z35A 1L8JA 4PJ7E 2VISB 1S7SB 2NTFA 3AAZB 5KVEH 4K7FB 2FL5B 5J3HD 4M6MH 3O4OB 4JY6A 3ZHLA 4YHLL 5F89B 5IW1A 1WCQA 3T4YA 2V7HA 4M8QA 2GW5A 5GRZA 1DEEA 4MNGB 5FGBC 3LSOB 3CDCA 5MENA 3QCTH 3MLZL 1FFOA 2CO7B 2ZCKH 4XHJC 2V2TB 3E3QE 1EXUB 2F8XC 1T1WB 5CMAB 1K4CA 2V5TA 2ID5A 3MCG1 3VU2A 4Y4HC 2YKLL 3HE7A 1F13A 3GRWA 1KYOJ 4ERSL 1NCBH 5TJWK 2OXGA 5C9JA 4R96B 2OI9B 4LLMB 4XCEA 3EYUL 1YPZA 1WT5A 2Z8RA 1JYNA 2HP4A 3DX6A 1AIFA 1F3JA 5DHYB 3RP1A 3MRQA 3KPLB 1QTYT 1HYRC 2DYPB 5IFAH 2B1HH 2C9AA 5IFHL 5T3ZE 2EDQA 2F8VA 2W9DH 3DV6A 4AT6B 1O5DT 4G7VL 5CJOL 3MCLL 5D2NA 5KSVB 4H5SB 2Z31A 5DQ9B 4KV5F 2MTPA 3ARDA 4RGNE 3O6FC 5FB8B 5TDPB 5EIQA 1IC4L 4IRSA 4YHPB 1EJOL 3STLA 4Y4KA 4NBZB 2VABB 3QUXA 1RZKH 3LZFH 1FFNB 5A2JH 3U36A 1ZHBB 3BMVA 4OUUA 4UQ3A 3WCYA 3V7MA 1C8PA 3D87B 1AGDA 1OAKH 1KEML 4MCZA 1KTDB 1ZLVK 1MJ8H 3BZ4A 4QRSA 1G9NC 4JLRB 1J12A 1A9BB 3MRRA 4JQVA 5CJXA 4JREB 4FFYH 2X1OA 3JV4B 2F53B 4R8WL 4L3CA 4TNWK 3BKCH 1E4WL 4JPVH 2X4RB 2ZSVA 4EI6B 2GJ6B 2Y5EA 4NDMA 4X6FA 1XR9A 2D2OA 4LRNL 2EIZA 3HZYA 1RZ7H 2VMFA 5ESQB 5F88A 4HS6B 1LGVA 4YHZL 3CX2A 4OD1L 1A6AA 5I1HL 2WINA 1GC1L 1ZTXH 1HE7A 4PPTA 4QXUH 5MERB 4OAWA 3HG1E 4XC3H 5F6HJ 2NNAB 5LWYL 4F7CA 2I60H 5MHSE 3ZKMD 1U8NB 2VLKB 4YDJB 5FYKH 5IVXF 1BQHG 3T65A 1E6JL 4OLUL 3I9GL 3RJQB 4DEPC 5C9KA 4FHBD 4WEBL 1SBBA 3TJEL 4HFUH 3HAEA 1N2RA 4HBQA 3TBSA 4KMTL 5A43C 4IIQB 4PJ5B 3D3VB 1RUAL 4I0PB 3UTSB 3HG1D 4HLJA 3SDDD 1LEKB 2G75B 5BO1L 4JFYA 3GSQB 1F4YH 1T66D 3REWA 4G7YL 4A6YH 4LCCC 3PWPE 4MHHG 1WAAF 3QG6B 3VXQA 5I2IB 2H32B 3SHSA 4HW6A 2SEBB 3PGCA 2IAMD 3W82A 5C0CD 1A9EA 4LVNB 4O2FB 1O7VA 1AE6L 1Q38A 2OCFD 2IFFH 4NO3B 3I6GB 2FX9H 4X6DF 1JPSL 5C0EB 2KZ1B 1UA6H 4BUHA 3KPRA 4L4VE 5TE7H 1IZJA 5HJ3B 4KAQL 2VR4A 4XNXH 5CBEA 3VG0L 3AGVA 1CGYA 5D7JC 3HC0A 4OKVA 5ISZA 2VKWA 4G6MH 5KVDH 3PHQB 2DQEL 3KXFE 5CD5D 4XRCB 4NZDA 3DETC 4KXZI 4M4RA 5H94A 25C8L 5EZLB 2CD0A 2WUBL 5C0BE 3C08L 3LKNB 4FQHA 3T09A 4K3EL 4G7VH 4J23A 5ECJE 1VDGA 5J89A 4DOHE 3PWVB 1HINH 4X6DB 4GQPH 3KPTA 3GHEH 2WUBH 3L6FA 4U6YB 4YPGB 3UZEA 4FQQA 4MNQB 3SBWA 4TRPL 1YYLL 4NHUB 1FVEB 1XR8A 1EVUA 4UOJA 4PJIA 1QVOB 4N0UB 5E2JA 4GUPB 4G6ML 2VE6B 4O2CB 1R5IA 4LVNC 4JRXD 3ZKMC 4I4WA 3T0ED 3I3BA 2OTPA 4X7TB 4PB9L 1NKRA 3BIAX 4YDLB 3MRJB 3QPQD 1QSFB 4NYLA 5DEGA 1HCFX 4RZCA 5LAXB 2IFFL 1FIGL 1IAMA 3P73B 2R15A 2VXTH 4N0RA 3WD5H 2WWKO 1C16B 1OSZA 4RWHA 2DLFH 4H1LA 4HUUA 3QHFL 4ZTOL 1FZJB 2VISA 1CDIA 1FC2D 5J57B 1U58A 5EUOF 3FT2B 1LO0L 1DLHA 3FB6A 3K4AA 1B0RA 3KLAB 4DAGH 5GSVB 2NYYC 3EGSB 1OF2B 3RWHA 5DFVD 4GG6B 4HMDA 2E27H 2X9XA 4Z7OE 2IALA 3QH3A 5E2VL 3WEXA 1I1AC 5IKCA 4PD4K 5CGYC 4HDIB 1VGKB 1D5BA 1UG9A 3FHAA 4ISVB 3MOBH 2EYSB 3KYNB 1U3ZA 1U8KB 3MRGA 2DICA 5I2IA 4K3HA 3QFDB 1C5BH 2PR4L 3KXFB 1WWWX 5HHXL 5DEFA 3IU3A 3NFPB 3U79A 5GS3A 4X4YA 3RDTD 1FGVH 2XOTA 4PRIA 3VXMD 5I1CH 4IMKA 4KVCL 5I73C 1RZFH 1XEDA 4ONOA 1HKFA 1PYWB 1ZTXL 1RIVH 5L6YH 1NANH 3IDYB 1KBGL 1G0YR 1I7ZB 3C5ZD 3N0PB 1MCFA 3Q5YA 5EBWA 4BQ9A 1FIGH 4XVJL 3QXDB 2HJFA 1RJYB 1HH9B 1F5WA 4N8VA 4XT1C 3WDHA 1TQBC 3RU8L 4MXQD 3FO2A 2HYMA 5DD6A 4F7CB 4Z77A 2BRQA 1YQ2A 4MS8D 5F9JB 4RX4A 1NBYA 2N7BA 5MERA 3QWRA 4E41D 3MLUL 1G0XA