5E6IC

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
258
Chain Sequence
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWDTELVETRPAGDGTFQKWAAVVVPSTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 258
sequence length 273
chains with identical sequence I, M, R
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e6iC01
4UIKH 4KK6D 3OKDB 3EYOA 4QOKD 4BQBA 1XMWA 3KPPB 1GJIA 3MJ9H 4I0PD 4LLVB 3DXAA 1KB9K 4LDLB 3BT2H 1XCQA 3MJ8A 4GS7C 1NGYB 3HTLX 7FABL 3QYCA 2CLVA 2OL3H 1PQZB 5J3HC 4J1UA 5DEFA 43C9A 3B8SA 1NCNA 5CKAA 2AGJL 1JK8B 4H1LH 5T3XH 2WLYA 4WI6A 5DGRA 5FV1L 1OWRM 2VLRB 5F6IB 1OTUD 3BZFB 2F5AH 5H94A 4NNYB 5I75B 3NFSH 2EKSA 3MRLA 4YEEA 3HR5A 4PIRF 4ISVA 3GKWH 1I9IH 5HHOB 1CVRA 3WIIH 2O93L 2I27N 5FYLL 2G9HA 4TVPE 4Z95H 3L7FB 1KUMA 5FA3A 1PKQB 4Z7VA 2ZSWA 3BP7A 3OKEA 3QA3B 5AZ2H 1NGPL 4HS6A 3ARED 2X4SB 2CRIA 4HMCA 1A1OB 3MZGB 3QUZB 4RGNE 3GHBL 2IC2A 1A6VL 4HBCL 4QXGH 1RZ8B 5F89B 1LO4L 4G8GA 4NO0B 4ODTH 3EGSA 1HI6A 3KYMB 4HX1B 3W0WA 1U93B 3SDAB 5ALCL 3UJTH 4EI6B 4XP6H 5D2NE 1QSEA 1G7QB 2ATKA 3MJ7B 4K23H 1HE7A 1OAUL 5E56A 1EA9C 3RNKA 4I18C 2JCCA 4LBEA 2RBLA 3VFWA 5I18H 1KCVL 1FNEB 2CKBB 3NABH 2P42B 3P4LA 2R2HA 2IG2L 1KELL 4UB0L 2OTUA 3QUKA 4OM0L 4YE4H 2P48B 4FXLA 1OW0C 2A9MH 4OTXL 3U0WL 4ONHA 3QI9A 4OKDA 2GQHA 2VDKH 1U3JA 3UDWC 2AJXL 3P4NB 4GG8B 2BNQB 3ARBA 4X6CF 1IKFL 1CK0H 1QFUL 2AV1A 3GJFK 2JK5A 1YMMB 5GSVA 4FFWD 1MCWW 3BEVB 4PJAA 5CEZL 5HHMD 4UQ3B 1KJ2A 3V6OA 3B5GA 4CVXA 3D6GA 1WIOA 4YQXH 2VMFA 5ALBL 3PWNA 1KNOA 3ZTNL 3GHEH 5D7JB 1EMTL 4P4RA 2VDML 1ZK9A 4O9HL 3DTXA 5C0RH 2X1OA 1ULVA 3TBTB 2WQ8A 2QSTA 5DK0A 1A02N 3TO4B 5D5MF 4PJDE 4N0YH 4MCZA 3MLPA 4PFEA 3RWJA 4PJ7E 5E9DD 5TH2A 4GMTL 1KCSL 1W8NA 2BSRA 4MNQE 1MFBH 1NAMH 2GTWB 3O41A 3MNZB 5DD3L 3RWGB 1CGWA 1RUAL 1MWAL 1RSFA 2XTJB 2DQTH 2ADGA 2YR3A 5E4EB 4P5KA 3J8F7 3S34L 2DQFB 3MACH 3QIBC 3PQYA 3ESUF 1C5BL 5M7QA 1IE5A 5F7MC 3VFGH 1W0WA 5TE7H 3ISWA 4Q2ZB 1YN7B 1MAJA 3HN3A 2XZZA 2P1YA 1U58A 4JM2A 4OLZL 2W60B 4ZPTB 5JMOC 3T1FB 5I8OL 4Z7QF 5J12B 1WBYB 3I85A 4GAYB 1DBKL 5L7XH 4D0CA 2P5WD 4TQEL 4NKOB 3MSPA 2X5PA 4UU9A 2W0LA 1RK1B 1HH6A 4NOBA 3SDXF 5E94B 1H9VA 3EDJA 4JFYB 1H3PL 1I1YB 3H0TA 3L3OB 2EYSB 3WKMH 3C6SB 4YAQB 5MEOA 1JZ3A 2W1NA 1OAYH 1WFOA 2NXZB 1J8KA 2A0LC 2HLAB 2YRZA 3VFUB 1AR1C 1JRHL 1RULH 5DURD 3LKRA 1UH2A 1JGVH 3HI5L 4ZNEA 3MRRB 4ZSOE 5EULV 1OSZB 2IBBA 3JV4B 4LSDA 4AY0A 1CDIA 5IVXB 4DW2L 4M7LH 4WY7H 1HHHB 4PJHF 3WFDL 2NY0B 2V7HA 4KDVA 3IT8D 3TBYB 3WNKA 5CJOL 2XT1B 3AVEA 4GFTB 4OZFB 3IKCB 2FEDC 2R4SH 4FQXC 4ORZC 3MR9B 1PZ5B 1MIEH 3TNNA 4OI8A 4JQIL 1YZZA 1I1FA 3CIQA 4Y2OA 3V4VH 1FL5A 2FX7H 4UT9H 3WFCH 2YD6A 1KJMB 1GPOH 4YXLH 3IJSA 3GM8A 4LRIC 3VJ6A 1CDUA 5F9JB 3JTTA 3G5ZB 4WJ5B 2FNBA 4JO3L 1D6VH 3OKYA 3DVNB 1YY9C 5SWZA 4P23B 2GUOA 2PYED 3F6IA 5E9DE 1XR9A 2EC8A 2FR4B 2IQAA 4Y4KA 1FO0A 3T0BA 2XKNA 1RV6X 4YK4B 3ZE0F 1MHHA 3T3PE 5AYQA 3PHSA 4NRZB 4RFOH 5LGKA 4GAFB 5IFHH 2YA1A 5GHWH 1DUZA 1E6JL 2NY2B 2NY1D 4R4ND 1FL3A 5D1ZD 2AI0H 3NTCL 1RJLA 1L4IA 4PRIE 2FD6L 5EU4A 4JZOA 1XF2B 1INQA 4WU7A 5HHNA 1CE6B 4OF5A 1K8DB 1KCRL 1UCBL 2X89A 3D0VA 2YUVA 3P9WB 3B9KA 3ZDYE 3SGJC 1JNNH 3BD5A 3BSZH 1S7SB 2EE6A 4YHMH 1XGRB 1FH5L 2P5WE 3Q1SH 5C0GB 4KPHL 4PYGA 1X5IA 1BX2B 4NKIH 2IANE 2RAMA 3AAZA 1P9MA 4N8VB 4QRQB 5IB1B 4MYWB 1RVFH 4ODWB 5IW1B 1MIML 4BJLA 1IEBA 1KG0A 1FGVL 4PREB 1KENL 3PHOA 3ZE1E 5DEGB 1RJYA 4AEHL 2V17H 3GSNH 3HE7A 2QSCH 5KTEH 1EFXA 5JDSB 3L95A 4HQQH 4MJIA 5EO9B 1B2WH 3HNTH 1Q9LB 4MHHI 4FQJH 5DFVD 2C3GA 2P5EE 1BWMA 4RMVA 2IH1A 1RY7B 2NTFA 3WS6C 5GZOD 3KXFE 4Q7DA 4LSQL 2EDJA 3SDCA 5BO1H 2BNUA 4LLDA 4PP2A 3BESR 3RHWK 3OKNB 4Y1AB 3TCLB 5BZWB 4PJXE 4O58H 4JRYA 3X13B 4JY5L 4NM8H 4WU5A 4EVNA 1HQRB 4X9FA 4BZ2H 4WW2F 3U2SA 3VG9C 1BQUA 1M6OB 3FN3A 4JM4H 3U4EB 1A6TB 3PWPD 1RIUL 4LVOB 2J4WH 4LASL 4DZBA 1OF2A 1OARH 4FZEL 3MGOA 4XBGB 3RTQB 3RWIB 4F7CB 1JNHA 5I30L 1EZVY 5JOFB 1BECA 2J6EL 1RIVL 2PYEE 3H2WA 2F74A 3FO0H 2XICA 3WE6A 5JORB 1KEML 3NA4A 4K7FA 2WUCL 4ZMAT 4OB5L 5DJCA 2BNRB 2VITA 3CCHB 1CFQA 3IXTA 3SE8H 5E4EC 4HUXA 5IV2A 3HZMA 4WHYG 2NZIA 3P77A 4U49A 3GEWB 4JCLA 1NCBH 4D9LH 3L6FB 2E9BA 4C58B 4M1DH 5H2BB 1A8JH 1IGIL 3SPVA 4RNRB 2LV4A 5FO7A 2P8MB 3U9PL 4PJBE 5KSVA 2DQDH 1EGJH 3KNBB 4M00A 4I3RL 4KRMB 5CBEB 5FFLA 4P99A 2ICEB 4ZUUA 1DQLH 1J1XH 1S7XA 3HG1D 2C3XA 3GMMA 1NAKL 3EHBD 3KS0J 4HF5L 4L4TD 2A73A 4LNVA 5JIHA 3C2AL 5F9DC 1VEPA 2A74A 3BQUD 1INEH 3T77A 4GMSH 1WUNT 1J0KA 1ZXQA 4IRSD 1FBIH 4PJFF 2ZUQB 4BUGA 4YX2H 1J8HB 5HGHA 4QHUB 4CDGC 1F4WH 3QNXA 5GGSY 5DD1L 5IOPB 3MLSH 1WQVT 2R29H 1MFAH 1S8DB 3MPCA 1YNLH 1T2JA 4R7DA 4WHYH 3IDNA 4TUOA 5IMMB 2WANA 5IVNA 3UJIH 2B2XL 3GMPB 4Y5VB 4MQXC 3VXNA 1D6EB 5T5NG 1G7LB 3TZVC 5I6XB 1BJ1J 4HGKC 5AAMA 3CLFH 2UYLB 2WIIB 2V2TB 3B43A 1R3KA 4W81A 2QR0B 2ZUSA 5FKAA 3FCTB 3SGEH 2YC1B 5AZEH 5JXEC 1CTNA 2FSEB 5MERB 2HLFC 5E1AA 2DTSA 1Z9SA 3MUHL 2PCPB 3HNSL 2LVCA 5HI4C 1ZLVH 3U79A 4LCWD 3EYSL 1ADQA 4LCCA 5BV7L 3F58H 1ITCA 4KRPD 5IWLA 3PWPE 3KLAB 2XA8L 3ZYOA 3O9WB 4X8XA 1MNUH 3OJDA 5EIIB 4OCNC 1A7NH 1MQ8A 2YD4A 3JWOL 2XRAH 3N1GC 3DV6B 3WHXA 1YY8B 1RZGA 4YK4C 5EZIL 2H6PB 3QHFL 5IESL 1JWUA 4RIRB 3UTPD 4AEEA 3C6LB 5HHQA 3ARFB 1Q1JH 1ZANL 4R3SB 4H88L 3QG6B 1FCGA 4OF6A 3WFZA 4I4WB 5D2NB 4K9EL 5CBAB 3DRQB 4PJCE 2XG4A 3D87B 5GJTH 5K9OB 4QWWD 5IBLC 4A6YB 3U0PB 4JFZL 1MH5A 5GGTA 3VWKC 2NNAA 3HUJF 2PETA 3QUXD 2ZOLB 1A21A 1KLGB 3VCLB 2VZTA 1VPOL 1FAIL 4Z0BH 4YHNB 3EFDL 1NFDB 5E8DH 1R3LA 3DX8B 5D93C 2D7QA 2VLMD 3NN8A 4PB0H 1CGSL 1MAMH 1U8JB 1CXHA 3W11D 1MCOL 4UINH 3ILQC 4NO2A 3CSGA 4YIQA 1F4AA 1KFAH 2G60H 2FIKA 4H8WL 1T6VN 5JIIA 4C57C 5JW3L 1FIGL 3H7BA 1FO0L 4JB9H 4M6NL 5D72L 5CKGA 4Y2DC 1BBDH 1P4BH 2HWZH 2DD8L 2I24N 4WO4D 1F8TL 1ZT7A 1JIBA 4I0PB 1L0QA 4QRRD 4U6VL 3FZUD 3IXAA 2MPAL 5I8KL 1CICA 3VWJC 1R5IA 4OKVB 1ORQA 1MRFH 1EH9A 4KROD 4HG4J 5CGTA 4ELMA 1E4JA 3VXTB 2EZ0D 1MRDL 5TQ0H 2EEBA 1B88A 5ANMB 1Q94B 3PDOB 4EOWL 4ONGL 1NMAL 3QQNA 1I8MB 3WS3A 4NGHL 5I1DA 4WFED 1X4XA 1BLNB 4YR6B 4PRHE 3V2AR 8FABB 4OF7A 1HSAA 2YD3A 3QRGH 5HDQL 3Q48A 4M9PA 4FQIL 4PJ5D 4NN5B 2AJ3A 1ITBB 1K5NA 3DX7B 5EU6D 4PUBH 3FOLB 4JFOB 2X4RB 3AREB 1ZHNB 1F02I 2FECI 1TJGH 1XZ0A 1T0MB 2HN7A 1HILB 3WJLA 3H7LA 2ORBL 5GZND 1CTOA 1JHLH 3OAYH 3TA3D 1CU4L 2APVA 4LVNC 4F33B 2FYYB 3EO1B 2R1YB 5ACMA 1A9EB 5FV2A 1CLYH 1FZJA 4TNWF 3CJJA 2BX5A 3SDYL 3HE6A 4MSWA 1FFNB 4XPBL 3I75B 4HIXL 3WNPA 2OJZH 3IFPA 2Z92A 1AGBA 3KYOA 5F7DB 4V1DA 3RVVC 5L2KE 2IFFL 4M7JH 5JPMA 4X7TA 5E08L 2CH8A 1L0XA 4HJJL 4FFVC 3LQAC 2GT9B 4TRPL 1CFTB 1RHHA 2DQCL 3MA9L 4RFEB 4WEBL 2FB4L 1UB6A 2B5IB 3BKYH 5DHVH 1P1ZB 2FRGP 4UT7L 2NX5A 15C8L 2GIYA 2VLME 1FYHB 5SWSD 3L5IA 3T3MF 5HHMB 5IQ9B 4HULB 1N4XH 1FDLL 2O5ZH 5GRUH 1H5BB 2ZUQC 4YUEL 4JFPB 4GAGL 5DA0B 1IILE 4QRSB 4J4PD 1JUFB 2HFEB 3ARGA 4HS8L 1AIFB 5LWYL 2DLEA 4XTRD 1N3NA 3PE9A 5E9DB 4MDJB 3K81A 4B41A 1HHIB 4OGYH 1A7OH 5DHYA 5E6YA 2OMNA 3IDMA 4UMGA 2ZG2A 4XHQA 3OQ3B 1S7RA 4LCUB 3GSQA 5JR1H 5I76A 1FL6B 5BRZA 4P3DB 1NCDL 2COQA 1DBAH 3VFTA 1OQXA 2YD1A 1SMOA 4K94L 3T04D 4GKNB 5C7XL 3SQBA 2I60L 3BPNB 3BO8A 2BK8A 4PRIB 3B2VH 5I1JL 1JHTA 5BMFH 2VSDA 4K3JH 1VADB 1G7IA 5MP6L 1I4FA 4MNHA 1IBGL 5AG8A 4S1SH 3F5WA 4UQ2A 3RWHA 3RWFB 2JE8A 3NGBC 1MFCH 1NDGA 4FQLH 4HW6A 4Y4FA 5D7KD 5JPNB 2DWEA 1ED3A 4E0RB 4K3DL 1HNGA 5EU6E 5GPRA 5KVDL 2D7NA 1SVZA 1KCUH 2P5WB 5DJDB 5E70A 5JDJA 4QHNA 4NQCD 5FYJH 3ZL4H 5EO0A 4L29B 4JAMA 4ODUA 4RGNC 3CPLB 1CF8L 3BZ4B 5T1DH 5GS1A 2X41A 4HWBH 5FA4B 4JRXD 4U7SA 3DX9B 1KTDB 5D2NC 5D6DC 1VFMA 1DVFB 5TPWL 2EDFA 1QHPA 3MBEC 3ECBB 3D25A 5DURB 1I1RA 1NMBL 3X3FH 2P5EB 1AQKH 4L8DA 2P43B 4Z0XB 3MV9E 5FGSA 5D7IA 1K3IA 4PV9A 4LOUD 4WNQB 5CS7A 5DSCA 4P2RD 4Y89A 1FZMB 1D9KC 4P46C 3KJ6L 4R2GC 4QHKI 1OCWL 4E42A 1G9NL 4QRTA 2EXYD 4ZOCA 4ZFOL 3NCJH 3LRSB 1I3GH 1YEHL 5KVEL 1JZ2A 3BZEB 5A16A 3GBML 2P8PA 5SWSE 3S5LA 1VEMA 1RZJL 1J0IA 2DYPD 3P0VH 4ZXBD 4JKKA 4OLVH 4HKZA 1VFAA 1AD0A 1T1WB 3HC0B 4ZTPH 3SE3A 3O8XC 2NW3A 1W72A 4N5EC 2HJKA 4P48A 2GW5A 4NN7C 2YK1H 1DQML 2UY6A 5CILL 1IAIL 5DWUL 3K7UA 2QKIB 2PYEB 2DF3A 3QCUH 3TIEA 5CEXB 3IVKB 4O5LH 1OM3H 5GISL 3TN0C 4X5XB 4HK0B 4L8BA 3PIQB 3ZYJA 4XVSH 3MGTB 5JW5A 5C0BA 3O6ML 4RAHA 1A9BB 2HVKB 3KYKH 4PG2C 3VXSE 5EBLA 4OBRA 4ETQB 2NZ9D 1CE1H 4LIQH 3H9HA 3IDJA 2NY1B 4FABL 4XX1G 4I48B 1R6VA 5D1ZB 5GGTL 1BOYA 4GG6B 5FUZH 1D5MA 1MJ7L 4OT1H 4F80A 5BQ7A 5E2TL 3VGAB 4XCNA 3CVHA 2EC9U 4FXGB 4O2EA 2OK0H 3HZVB 4XNXL 4QXUL 3RI5F 3MRIA 4PJBB 5KSUB 3I3DA 4UILL 3FO9B 3PHQA 4KMTH 3MMEA 2CXKA 5HYQB 1X5FA 3GMQA 1IEAB 4BKLB 4UTAH 1KULA 5C07A 3D2UA 1EO7A 2HJLB 5CD5C 2X4OB 3DXAD 1IGFH 5DJ8A 5INCB 3MXVH 4JHWH 1TJHH 2FHFA 4L4JA 2AP2A 3NCBB 3MREA 4ZS7H 5TE4L 3IF1B 4WW1B 2GTZB 3GJFA 5HD8D 4P4KC 1J0ZA 4FTVE 4JRXE 2Z4QB 4UUJA 4HH9B 4RBPH 3WJJA 2DDQL 4S11A 5IBUG 3I50L 5T3ZL 3VGGA 4HIIB 2XFXA 1IM9A 2YPLA 5IGXH 1AGEB 4X4XB 5KW9L 4XHJD 2DQUH 1A2YB 4OLYL 2E6PA 1IGMH 4HXBH 1HQ4A 2X4TA 2GJ6E 4LPWA 1U91A 5IMLA 2HG5A 5ADOL 3MROB 3RZCA 1HK6A 4GKSB 3RVUD 1A1MA 2GFBA 4P2RE 1S9WA 3OMZA 5IMKB 4KDTC 4G7VL 1DEEA 2QADD 5BVJA 5ESAA 3T4AA 4YO0B 4UAOC 3E8UH 4OZGF 5ITFA 1HCVA 3WIHL 1MOEA 4RGOH 3CFKA 1BEYL 3RWCB 5C2BH 3W0WD 2R1XB 3PWPB 3E3QC 5D6CA 3KDMB 1QSED 2LE9A 3BEWB 2JELH 4I3GA 4TVSa 2OQJA 1BZ7A 3ARDA 4DTGH 1Q9OA 1NBQA 2BVQB 5KS9E 1T7VA 2VE6B 5HGAB 3T0VA 5I1KL 4Q9QL 1TJIL 4HUUB 4PTUA 5FO8B 1KB5B 1C5CL 3HCVA 4X8JA 1LEIA 4APQC 3GJEA 3PWJB 5DRZA 5E6IC 1IQDB 3ARBD 2BSTA 2Z93B 4Y7MA 4PJCB 4KUCF 3MJ9A 1WBXB 5C0EA 3VFNA 5IIEB 3ARVA 1CIDA 3EO9H 3MLYL 1GGCL 2EH8H 4Z76B 1B0GA 3O4OB 2YN3A 5DJYA 2FWOA 2EO9A 1CI5A 4CN1A 3DVFA 2OL3A 4KJWC 5TDPA 1T1YB 2VDNH 4CJ0A 2IADA 3TWCL 3QUMH 1ZA3A 3VXRE 4H1LA 2DTMH 4NHUA 5EC2A 3HG1B 5GJSL 1YECH 4L4TB 1T1XA 2CQVA 2XQBL 3NZHL 4I3SL 2RGSA 1ZT1A 1U8KA 3BQUB 1G7PB 1D5ZA 3BN9D 4JN2A 4M48H 5ICYB 5JQ6H 1S5HA 3FRPG 2HJFA 4UOJA 2MCG1 2VDLL 3MNWB 5D1QA 4PTTB 1P84K 2XV6B 3MO1A 4YH6A 2QQNL 2IJ0C 1DVFC 1NCAH 3PQYD 1FVCB 1KPUA 5DT1L 1EVTC 2AK1H 4OD1L 3RQ3A 2CUMA 4KUZL 3V4UL 4XWOC 4FP8H 4HC1H 1I1CA 5DK3A 4JM2D 4U1LA 3QRFM 5FYKL 1E6OH 4L1HA 3OR6B 1E4XI 5CGYC 3N06B 2JIXB 3HI1B 1BFVH 5E03A 2Y23A 5I1GL 5D7LA 1N6VA 4WWKA 5A3ID 1YUHB 3TC9A 5J6GA 2DIBA 3DSFL 4M62H 2AJYL 4F8TA 4NP4L 2DMKA 4N8PA 4K7PY 1ZHBA 3GK8H 3V6ZA 1GZQB 2R39A 3S3JA 3QDGA 1WT5C 5EZLA 3VH8G 2YMXL 4F2MA 4X6BA 4BH7B 2XIDA 3LN9A 4KRPB 4YHKH 1QR4A 1FLRL 4KKBD 4HJ0C 3DOSA 1QSEE 4MA7H 5I2IA 4KK8D 5D8JL 4XVJL 2V5YA 2DQJL 5JZ7D 1M71B 1H15A 3RL1A 4MHHG 2BDNH 3MODL 3T0EE 5MHSE 3OAUH 5F1OB 1DN2A 1U8OA 3FFCA 3W39B 1RMFH 4DAGL 2RFXA 5DUBB 4B5EA 4DGYH 2VZUA 4V2CB 5L88L 3G6JA 3WYRA 4Y8DC 3AM8C 3UBXB 5I74B 5F1NA 4OCRL 4K7PL 1XF3A 5DJ0A 3PABB 4Q0XH 3AU1A 2VYRE 1Y0LB 4PJ8C 5GGQL 1NAMA 1OHQA 4MA3B 4HUWB 4Q97A 1KN4H 4PGEA 4MD5A 3TNMB 1UZ6F 2YS4A 3RHWF 3BW9B 4LPCA 5IB4B 2ZG3A 5IJVA 3NBNA 1U8NA 1ZHLA 3MOAH 1KTLB 4NSKA 5FECB 3HA0A 1NC2B 5SWZD 3V0VA 4XP1H 3HR6A 4PYHA 4XCYA 4R4BA 4I13B 2IPKA 2G5BA 4Y4KD 4U1NB 1L9NA 4PRPE 4MZ3A 1MCEA 3DVGB 4KHTH 2VN4A 4L8SC 1FSKC 4OZHF 1J86A 4NRXA 2ZCKL 2VXTL 5EORH 5ETUA 4HV8B 2UWEA 1T5WA 3BP5B 1JPTL 1FN4A 3T0AA 2J88H 3OGCA 1AXSB 2AK4A 2PYFA 2XZCH 3HHRB 4F58H 2JF1A 4GXUN 5D5ME 1IVLA 3DRTA 3PQYE 4WO4B 1FPTL 4PP1D 4LEOA 4WGWB 3LKQB 4I18A 5GIRA 4GW4B 1M7XA 2H32B 4QRRB 2X89D 3BKMH 3LKOA 1D5BB 3BUTA 1UKSA 1U8LB 3FB7A 5F9OL 2I07B 1UACH 5E2VL 2E27L 3KYAA 1OW0A 3VW3L 4GKZA 5EUOF 4EUPB 2QQKH 4KROB 3BUYB 1P53A 3PL6C 5AYUL 5C9JB 3UDWA 2X4NA 3QQ9D 3FQNA 4WWID 1A6UL 4YDVB 1KV3A 1VFOA 3IYLW 3SBWC 4YHYC 1BJMA 4IIQB 1JHKH 4O51B 3U9UA 1AO7A 1KN2H 1EDQA 3L3HB 1T2QH 2BOBA 5ACLA 1CDHA 2DRUA 4N1HB 2VAAB 4MXVE 4U6HA 5GRVK 1I7RB 1A5FL 1MLCB 4JJHA 2H26B 3HE7D 1EV2E 1EFXD 3G5XA 4MJID 1JZ8A 4PJ5B 1I9JL 1HDMB 5DMIL 1DUYA 1IL1B 5EU6B 4TUKL 4OLWH 1C08B 5GRVL 3AC0A 3ZE2F 4NFBA 4ZQKA 2VLJA 1T7ZA 1CDYA 5TF1L 5I1CH 3SDXE 4D3CH 5IB5A 3P4OA 4GRMB 4P9MH 3TA3B 3C8DA 4JHAH 5HPOA 5ESVB 1WEJH 4ZG1A 3TPUA 3PP3K 4YHIA 1EXUA 3L3GA 5HYSB 4IMLB 4WRLA 3UCRA 3ARWA 3HS0B 4Z5RA 4JRYD 1C8PA 1VCAA 4RMWA 4MQ7B 3ULVC 1YJDC 4PGCA 3QIBA 2KBGA 4O00A 5KSAC 3MCKB 3MV9B 5TE6L 3ZHDA 4NQTA 4OV5A 4PJHE 2AEQH 3FT3A 3DETC 4U1SB 2OI9B 4J12A 3RNQB 5GRZA 1CZ8L 3JZ7A 2FO1A 4KC3B 3OKOA 3C5JA 3QNZA 2XY1A 1N6QL 2Z31C 1OD9A 5SWSB 2F8XC 2D31A 5F1IA 4ZO7A 5EOCL 4HFWA 3JV6A 5E7FA 3M17B 3IDYB 4G8EB 1K4DA 3MRKB 1L9MA 3KPOB 4P2OB 1NBYA 2Y07L 1ZHKA 2ZKHL 4GXUM 4OIIH 1ZKAA 5CSBA 4YHPA 1T1ZB 4DZ8B 5INDB 4OBSA 3QBTB 1MEXL 4JCMA 5EOTA 5L2JA 4NT6A 2AJSL 2C3VB 4FQHA 3MRCA 1V7MH 3WLBA 1NSNL 1OAQL 5I9QB 3HLAB 3WD5H 3ZE0E 4UIKL 1BBJB 5DVMA 3QXVA 4XCEA 3PGFL 1HSBB 2FHBA 1CFVL 3GSNA 1QD0A 3VXSB 1JGDA 4LAQH 3EOAA 3O81A 4RZCA 7CGTA 5IJKC 4K71C 1QLEH 2OR9H 4S2SA 4BQCA 1G7JA 4FQXA 3EO0A 4OD2A 3L3IA 1EO5A 1KIRA 3QIWC 1RZ7H 2YD2A 2BOCA 4J3OC 3GKWL 4LRIA 4YDJB 4MJIE 1I7UB 35C8H 1SJVA 2FX8H 2XWBB 4X6DA 1NBVL 4KXZI 1KYOK 5F1SA 1WIPA 3K2UH 3OKDA 4D0BA 4NQCB 3ZDZE 4WFHD 5E99L 4XVUD 4WUKH 3ULVH 1YJDH 1NGYA 2VUYA 1UGNA 3UYPA 3BX7C 4MCYB 4KI5D 2XZQH 4FTVB 5I74C 4JRXB 1BJ8A 4EIZC 1AGFB 4HKJB 1MREL 3RUGA 4G80B 4HGWA 3RGHA 1I3RB 1ZWIA 5C6WH 4N90D 2VLRA 1OGAE 2K7PA 3MRFA 4XP6L 2A9NL 4JQXC 2CIKB 4ZTOH 4FQ1H 3F62A 5HGGS 3NABL 5HHOA 1PAMA 3FB8A 1BREA 4P2RB 3SGJA 2ESVA 1FE8H 2BVYA 3VXUA 4KK5C 3L7FA 5T1KA 1PKQA 3E1F1 1BQLL 4X98A 1MCRA 3FT4B 4MJ2A 3QA3A 5EPMA 1JGLH 3NAAL 1G7HB 5K33A 2X4SA 1QQDB 3OXSA 5IVOA 3PJSB 4M61B 5IFAL 3KPRE 1EO8L 3BPOB 5HYEA 1EGJA 2B1AH 2DYPB 4ZXBB 1B0RB 1H3WM 1OP5K 5HHPB 2IPTH 2BXZA 5GXBB 1LP9A 1RZ8A 5CMAB 5DK2B 3KYMA 4HX1A 1SQ2N 3SDAA 3R06A 1N0LA 4M5ZL 4ZUVA 3BD3A 3LDBC 3WEXB 5KS9B 2ZCHH 1SEQL 1FNEA 5B4MC 2VLKE 4N0YL 4ERSH 3W5NA 1BQHG 4JPIA 3WS6A 1JL8A 4N8CL 3VD5A 3IDUA 3PDGA 3VMPA 5FB8B 3P4NA 5IM7A 2BNQA 2P7TB 2X1PA 2CK0H 5ERWA 1CCZA 2FGZA 5DVOA 5JNYB 4KQ3H 2K3TA 3GNMH 5LQBL 4XNYL 25C8L 4QYOB 4EJ1C 1FGNL 3VFGL 2E6QA 5KSBF 1REIA 5H8DA 3N1PC 4P3CH 3TF7C 2IF7A 5IF0B 4EI5B 1LDPL 3LEXA 4NC1E 3TBTA 1WFNA 1QFOA 4JFHE 2G2RA 3IETA 3OXRB 4JZJB 2KQNA 4PJGF 1CICD 1JFQH 1RUQL 1BVZA 1XCQB 3MJ8B 4PJFE 5E2JA 3D39A 3O2VL 4FQCH 3MNZA 3O3AB 2CJUL 4J1UB 3RWGA 5DEFB 2IQ9L 2YA0A 4JGUA 43C9B 4BSWA 2HKFH 2Z9TA 3GSXA 4KTDL 4EUPG 4YXHH 2BVEA 3WKML 5E2UL 5H94B 2CRMA 4M5YH 2KH2B 1XGUA 1Z0MA 1AY1H 5HSFA 2EKSB 4Y8AA 2P44B 3HR5B 5LCVH 3O0RH 12E8L 3HAEB 1YN7A 1J87A 3BPLC 1FRGL 2G9HB 3OAZK 2DM4A 3DPBA 4ZPTA 5FA3B 4Q9RH 4KKAC 3MJ6A 2QADB 2ZSWB 3BP7B 2HRLA 3OKEB 4M7LL 4YFLI 5HDLA 1ORSA 1T21A 2E3VA 1OP3H 4HS6B 4HT1H 4NKOA 4BH8A 2VABA 3MRJA 1RK1A 2C1OA 4KVNL 2CLRA 1NMCC 3EFFA 4P2OC 3EGSB 1HI6B 3W0WB 2LTQC 3EYUH 1V8HA 3L3OA 1UKTA 3C60C 3C6SA 3HE6D 1CBVH 3ERYA 4UT9L 4NUGH 1QSEB 1WCBA 4KAQH 3FN0H 4YXLL 2GKIA 4LQFL 4EUPH 3VFWB 2R2HB 4V1DD 4TOYH 4JPKL 2OTUB 3BDYL 4CU8A 4O2FB 1N6UA 1TENA 3QUKB 1D6VL 4OFKA 5C08E 1OSZA 3JV4A 4OFDA 5IVXA 4WFFD 4ONHB 4MGXA 1HHHA 5DFTA 3KGRA 4WUUA 2W0KA 1A22B 3ARBB 4YHLH 3TBYA 5T33L 2NY7H 4XGZA 4R8WH 1S7WA 2AV1B 2JK5B 2NX5D 4QHLA 1TMCA 4PJAB 4WGVB 1A3RH 2R8SH 1KJ2B 1UCTA 1PY4A 2J5LB 3I2CL 3PWNB 3HUJE 1A7RH 1KNOB 4ODSL 1EERB 4X6EA 3AMLA 5MI0B 4P4RB 3DTXB 3ABZA 4LVEA 3ARGD 4XMPH 5DK0B 1JNLH 3PWLB 5I73B 1VDGA 3G5VA 1HKFA 3IDXL 4WJ5A 2QV2A 3ZYIA 4ZUWB 3VMNA 2BSRB 3I84A 4BSVB 3NPZB 3OX8A 4FG6D 3WHE1 2FR4A 4FQ2H 2EDHA 3IKKA 3UJJL 5BRZD 1CD8A 5J9PA 4FRWA 2WWMD 2X9YA 4LF3A 4OI9A 2HT3C 1MPAH 5D5MB 3F7VA 5FYKD 2OX5A 3FN9A 3PQYB 2VXVH 3RX5A 1W0WB 2V17L 4X4YA 3CFJB 1X5XA 5KTEL 1Z3GH 2SEBB 3VFPA 4XC1H 2DLIA 1K8DA 3BKJL 4XZUA 4W4NA 1U58B 5J56B 4AEIH 4DUVA 4FMFA 4Y4FD 4Q74A 5CSGA 4DN4L 1S7SA 5F1KC 1RU9H 1VESA 4L4VD 5BO1L 5C3LD 4D0CB 2QQQA 4OFYA 5L8JB 1TNMA 3VGEA 4HPOL 4LARL 3W81A 2ZPKL 3HZKB 1HH6B 3B83A 4XPGH 2VDQH 4PBWD 5DUML 3MLZL 5DLML 4N8VA 1T83C 4QRQA 4RAVB 4Y5XC 4Z7UA 3HRZB 5IB1A 3H0TB 3O6KL 2X1QA 5MEOB 1QUNA 4BZ2L 4PB9H 1D7FA 4HUVA 2W92A 4V3DB 1RJCA 1UC6A 5DHVA 4JM4L 3RVWC 4BFIA 2WWKT 5BS0A 2A6KA 4Y2DA 1T5XA 5HHVH 5EO9A 1L6XA 4J3UA 2BVUA 2D9CA 3A6OA 1MCKA 1QNZL 1DEDA 2VDPL 3QB7C 1CXFA 2V7HB 1XGYL 2B4CC 3D85A 1M7DA 3CFBA 1V7NL 3D5OF 3THML 3TCLA 4YDKH 1SY6H 4U1KA 1YEKH 3TNNB 4L8CA 2F9BT 4LGPB 1ZLSL 1I1FB 4F7MA 1AC0A 1VGKA 1NCBL 2JTDA 4YBQD 3IJSB 3U4EA 1A6TA 3REVA 4G6AC 1MFEH 3R0MA 4EI5C 3VJ6B 4OZ4A 4G6KH 1R3HB 2GUOB 1LILA 4D9QD 1DQLL 1XR9B 1DSFL 5JOFA 2IQAB 1EHLH 2XKNB 4IRZH 3L1OL 1X5YA 3MTRA 2QQLH 5GS0L 1CS6A 1MHHB 5C0BD 5JORA 4A2LA 4P9HL 1DUZB 2CKBL 3CCHA 4HWZA 1DL7H 1FL3B 1PG7H 1RJLB 2MOVA 5DD5H 4YX2L 1JF6A 1GOFA 1F3JA 3S36X 5FGBC 3QEQA 4KRNA 4JZOB 1INQB 4WU7B 2R0ZL 3MLSL 4TN9A 5HHNB 1VKXB 1X3DA 4OQTH 4RNRA 1IGCH 4NWUL 2OS7A 3BHBA 4DVRL 3UJIL 4HWBA 4X9GA 2VRAA 3BOVA 4U1HA 2P8LA 3K1KC 5CBEA 2ICEA 1AE6H 4L4VE 3D2UD 1HIMH 2RB8A 4YWGL 3LIZH 2F58H 4L3EA 3AAZB 3BGFC 1PJ9A 4XBPB 2CKNA 3IFLL 5HVHC 4S1QL 5K9QG 2PR4L 3P9LA 1IEBB 2BVPA 1QLRA 2EKJA 1KG0B 3KLSA 2CO7B 1RUPL 4GUPB 1RJYB 4R90H 4B7IA 2APWA 1J8HA 3WL9A 1AR2A 3HE7B 2EE3A 4XC3L 1EFXB 2MNUA 4MJIB 1TZGH 2NLJA 2B4CH 4RWYL 2YPLD 3LSOA 3T0EC 4Z7WF 4KJYA 1SBSH 4TSAH 1A47A 2NTFB 1D6EA 3WV0A 4X83A 1GAFH 4CMMA 3RZCD 5TF0A 3HAEG 3LY6A 1YEJH 2UYLA 2BNUB 2WIIA 1I8KB 5ABDE 3MLRH 2HT2D 5DJAA 4U0RB 3FCTA 3ARTA 4HWEH 4UV4H 4JRYB 4YDLB 3QNYA 4HAFA 4WU5B 4EVNB 2X4PB 4MB5A 2QHLA 3U2SB 2R23A 2D0GA 2PCPA 2GITA 4TTGA 1FVDB 2YN5A 1CVSC 3TCXA 2MQCA 4M93C 4DZBB 1JNHB 1OTTD 3ARDD 3DROA 1HXYA 5EIIA 2UVFA 3LN4B 4NCC2 1QBLH 2F74B 3DV6A 3WE6B 1FCCA 4K7FB 3U82B 3MRBA 4JO4H 1J1PH 1DLFH 4AQOA 2VITB 4WI7A 3C6LA 1CFQB 3IXTB 3SGDH 3HAEH 3ARFA 4LU5L 2B1HH 1INDH 4HUXB 4J3XA 4R3SA 1DQJB 1E4XH 3P77B 2DMBA 1MCCA 3I6LD 5D2NA 5D6DA 2JB6B 2D7TL 5CBAA 2WUBH 3WHE0 3SPVB 3MBEA 3TH4T 3SCMD 2KDGA 3IU4H 2VLKB 4M9OA 3P40A 4FQPA 1G6RH 5KSVB 4J7RA 1SYSA 3CXHJ 3L3JA 4FFZL 3QT2A 5T3XD 2ZOLA 4RA3A 1KLGA 3WFEH 1S7XB 3AFLA 2F5BH 4FNLH 3GMMB 4YHNA 1D9KA 1KC5H 1S7TB 3SKNA 3BJ91 1DBJH 3T77B 4EBQH 3VFSB 1U8JA 2VERN 32C2A 1W2KT 1H8OA 3LS5H 4G6ML 4ONFL 5D1QD 1SYVA 3B5TA 1HXMA 5HGHB 2YXMA 3IB4A 4C4KT 1DTUA 5C2UB 5AWNH 3O8XA 3NACH 4G59A 4N5EA 4R7DB 3IDNB 5FOBA 2ATPA 3W2DH 2YPLE 4PJDA 1DP0A 3QRGL 4PJ7A 4LFHG 3LD8B 3FQUB 5DFWH 4XNQA 5TGBB 1T3FB 4MNQA 5TQ2L 3TN0A 3L9RA 4U3XA 5FKAB 4M6MH 4K2UL 1F6FB 1MCDA 2DI8A 2X2YA 4WWKD 3LEVL 4AG4H 4NFCA 3GRWL 1UM4H 4NNXA 1EBAA 9CGTA 2J8UE 1KPVA 2RR3A 3EJZC 2NYYC 2HFTA 2PW1A 3TYGH 3KJ4B 2ADJB 3QDGD 4K3GA 3IU3B 2ITCB 5AD0B 4E5XA 3M45A 1Q0XL 3TP4A 2O5YH 1OSPH 2W9DH 3OJDB 2E9IA 5FO9A 2APXA 5D9SA 3DX7A 2B8OT 1GGIL 4OZGE 4WEUD 4JFOA 2BSSA 4PP8C 3WHXB 2R4RH 2BCKA 4NQVA 3BKYL 1RZGB 3FFCD 4Z18A 1T0MA 4G7YH 1UWXH 4N9OB 1JWUB 1N0XH 4N9GA 3UTTA 3VU2A 4LLQB 5HHQB 3QUMA 3QUYC 4E41E 2FYYA 4F33A 3GSVA 2R1YA 5HGDA 3A6CH 3R4DA 5J3HD 3PGDA 1H0DA 2GY5A 2PN5A 4P4KA 1UXWB 1UJTA 4C55A 3V7AE 2GSGA 2AV7A 1RUKL 1AD9A 3NA9H 2H1PH 5DR5L 4HWUA 4GXVL 3QAZC 4OCWH 5F7DA 4ZSOA 4ACPA 2NNAB 4HMEA 3S96A 1LEGA 1KTRL 43CAB 4NHCH 2MCPL 4G43B 3T2QA 3TV3H 5T3XE 1FORL 1CXLA 5I1EL 4NHUE 5CFHA 4X7CC 4LDEB 1LO3H 2LU7A 4YDIL 4OCSH 4PGDB 1DBAL 5L0QB 2HKHH 4HC1A 5SV3A 4EQ3A 1P5UA 4JREC 3VA6A 1FZOB 3RAJH 4IBLT 4YIQB 4D94A 1HKLH 3HFMH 4JFPA 5CIPH 2H41A 3H7BB 4NKMB 5GGUB 2XA3A 2WBKA 2DQGH 3P11H 4R97B 3UPRB 3E3QA 3DIFA 2C5DC 2HFEA 1ZT7B 3K46A 4DK6A 3VG0H 2F19H 4FQLL 5E9DA 4MDJA 1CICB 5A2FA 2OTWB 3FRPA 1HHIA 1OAKL 1KCUL 2DM2A 3VXPA 2K9UA 4AIOA 3MRGA 3GB7A 4APQA 1FL6A 3I9GH 2LFGA 3EYQC 2YUZA 5E6IA 3W9EA 3TVMC 5IFJB 4HWBL 2QL1A 2NY6C 3OTTA 3WS3B 1AO7D 4PRIA 5I1DB 3JUYA 1A0QH 3M1BB 1VADA 2WK2A 4KQ4L 1HSAB 3BJLA 1T66C 3NZ8B 2WSKA 4JKPL 1AQKL 2X9XA 3RWFA 2MTPA 1R24A 1S78C 3OGOE 5JPNA 2AJ3B 4HBQA 2W9EH 5ID0B 5C6PB 3QFDA 1YC7A 2VLJD 1RZKC 4WW2C 1XZ0B 2HN7B 5I8CB 4R26L 2J8HA 4KH2A 2IANA 1G9MC 1UWGH 2DI7A 3FFCE 3NCJL 1JBJA 3VH8A 3V52L 1I3GL 2JJTC 3OWEA 4IMKC 4NQSA 3G6JE 2H8PB 5HJ3B 4U6XA 3BZ4A 3QDME 4PRAA 3HE6B 3E0GA 4JN1H 4MSWB 4YGAB 5BOPA 5FA4A 2MSPA 3QR2A 2BMKB 2HTLC 1DVFA 3IFPB 2Z92B 1S5IL 1AGBB 3C08L 3QIBD 3KYOB 4N1EA 3R8QA 5HGBA 2CPCA 2C7UA 4W6YB 4ZNCD 1AFVL 2P5EA 4JHBA 4TUJA 5JPMB 1ZMYA 4EN3C 4Z0XA 4JG0L 5J06A 2AJVH 4JPVH 1RHHB 3KXFA 1A7PH 4WNQA 1ZAGA 1UB6B 4KZEH 1WJ3A 4QF1A 1MCNA 2NX5B 4J6RH 2WP3T 4PJXA 4XP4H 1CE1L 3MUZ1 4RWHA 4JKLA 4F9LC 4P2QE 4TVPL 1UZ6E 2HFGH 3ZO0A 4DGIL 5FUZL 1PLGL 3EBAA 3GSOA 1WT5A 3PV7A 2ARJA 2EO1A 1NLBL 2DOCA 3ARGB 3KAAA 5GSRA 2A0LD 2ZG1A 4NC1C 4PLJC 5IHZA 2ERJB 4KMTL 4HFUL 1AR1D 3C09C 3T09A 3VFRA 3OZ9L 1QVOB 4RISL 2QKIA 2PYEA 3O2WH 3CFEA 4Z6AT 1G0XA 1I9RH 4HK0A 5E00B 3GSQB 1JNJA 3ULSB 5BRZB 1F4YH 1TJHL 3Q3GB 3MGTA 1DQQA 3S7GA 1K4CB 3V4PL 4ETQA 4A6YL 3GI9L 4ODVH 3AM8A 1YEFH 3EZ8A 4ZS6C 4I48A 4M4PA 3BO8B 2PO6B 1KLUA 3IRPX 2CUHA 2FEDD 4ZUTB 4FQXD 3UP1A 1X5JA 1J11A 2FO4A 4PJ8A 1G7IB 4MNHB 2UZXB 1C1EH 1A6ZA 2DKSA 1RZKH 3F5WB 5FGCE 4UQ2B 3REWB 5KSUA 1G9MH 4CMHC 5EUOE 1NDGB 3R1GH 2DQUL 2R0WL 2VR5A 4M7KL 4Y4FB 3JBG7 2DWEB 1ED3B 1NKOA 1N64H 4L4VB 3F7RA 1ZLUH 4HXAL 1YY9D 4GAJL 4QHNB 5EG6C 1YEGH 5EO0B 4I8DA 1P6FA 4L8SA 5B39G 5GS1B 3I02A 2K7QA 3CX5J 4FHBD 1I7TA 1J1OH 3BH9A 4PY7B 2XY2A 2Z4QA 3OPZL 2DJUA 3ZE2E 3D25B 1UM5L 3TBSA 4S1RH 5DYOA 4LSRL 1AJ7H 3A6BL 4L8DB 1CDGA 4OQ1A 2YPVL 3I6KA 1GGUA 3F65A 3ZKSD 3L5JA 2E6JA 4YC2C 5D7IB 4KGJA 2Q6WA 4PV9B 1N2RA 4YJZL 3U0TA 2ESVD 3MROA 5C6TL 4GKSA 3VI4F 1IC4H 3VXUD 1BVLB 5KVFL 5T1KD 5EB9A 4E42B 2A6DA 5IMKA 3PL6A 5F9WC 2Y06H 4NZRH 3VI3F 2P8PB 5ITBL 4OGXH 4WTWA 5DZNA 3NCCB 1RD6A 4HKZB 5GRWA 4OLUH 2PXYC 4R7NA 4XP5H 2AERT 4LLWA 4PRNA 4N0FB 4DUXA 2NW3B 3PWPA 1W72B 5HHXL 3WMSA 3HC4H 4R97C 3QEGL 2FGWL 1R5VA 2QBWA 3BGMA 3GMRA 3BEWA 4QNPE 5FF6A 3P0GB 2VDOH 3NVQA 3TIEB 1CQKA 3AS2A 2DTML 3LKPA 3G08A 1TTUA 5J11B 2VE6A 4Y4HB 3R8BB 1X7QB 3FQXA 3H9SD 5JW5B 5C0BB 3RWEA 1KIUA 3PWJA 3H9HB 5JQ6L 3IDJB 1RZFL 1IQDA 4G5ZL 3FONA 4BSJA 4KY1L 5C1MB 5D1XB 1D5MB 4PJCA 2H45A 2GSIA 4YZFF 1B90A 3CVHB 4ZFGH 3ORJA 1BD2A 4O2EB 2FJGB 3X3GH 3VA2C 5KVGL 1H3GA 3MRIB 1T89C 2O5XL 5I1IH 3JV0A 3SKUD 3PHQB 5KSAA 4ODHL 4ZUSA 3GMQB 1CXKA 5I17B 4AJ0A 3ZTJG 2Z8VC 1UM6L 1P7QB 3D2UB 2GK0A 1UG9A 3KPNA 5DJ8B 2Z31A 3D39D 4M62L 3MRMB 1G7PA 4X9HA 3MREB 5DMKA 5EA0H 2G5RA 3NMEA 3GJFB 3GK8L 2FHCA 4KK9C 2IGFL 5DD0L 5IP4A 5J6HA 4G6JL 3V8CA 1HEZA 5LGHL 2XFXB 1QP1A 1A4JA 2YPLB 4OGAC 2EECA 3ZDXF 2CR3A 4MA7L 4XWGH 1PX3A 1HQ4B 3UZEA 2X4TB 4QTIL 1U91B 3RZCB 5C0DB 4G9DA 2A2QT 1A1MB 2GFBB 1S9WB 3OR6A 5L6YL 3VXUE 1DEEB 2JIXA 3HI1A 3HI6L 1MSPA 1RMFL 3D18A 1JMZA 4DKDC 3BIKA 4X7EC 3ZTJH 2J8UB 3TFKC 1CLOL 5IJKA 4UI2A 2DWDB 1EJOH 1F58H 4OJFH 3CX2A 5CUSL 1HNFA 3CFKB 1GZQA 1MCSA 4CJ1A 1CLCA 4PRHA 5HDBF 1EZVX 4LVHB 3UZVB 1ZGLP 3QIWA 3F12A 1HYSC 4OF0A 2OQJB 3ARDB 5CJQL 1Q9OB 1TCRA 4LLUB 1F11B 4JFDA 4PBXA 4XCFH 4K8RC 2ED8A 4PTUB 4MQXD 4MJ5B 2GJJA 5I1LB 3HCVB 3BD4A 4X8JB 2AVGA 1LEIB 4IS6A 3H9SE 3TZVD 3W39A 3CSYB 5DUBA 2KPNA 5DRZB 3E6FA 4WUUD 1AHWC 1WAAF 1SVCP 1O7VA 4KVCL 3MJGX 3JV5A 4QTHA 3D9AH 5D4QA 3O4LE 5C0EB 2HLFD 2PO6C 4GW1A 3VFNB 5CGMA 2DBLH 1HHGA 3DNKA 1DJSA 5SX5K 5FEBA 5L8LB 1B0GB 5JTWA 3SCMB 5HI4D 5C0AE 5DJYB 4MA3A 3V8OA 5ILTH 4HUWA 1BQHA 2OL3B 5HTSA 5TDPB 5BZDA 5L2KA 4R0LB 5FAAA 3VD4A 4JQXA 4MQSB 3S3SA 4X9IA 2IADB 1YYMH 3SGEI 3BAEH 3HMXA 4AH2A 4H1LB 1I8IA 4IDJL 4NHUB 5EC2B 1KPRA 3CMOL 2CDFA 2E7CA 2XQYK 2NY5L 1WTGT 4MZ2A 1T1XB 1NC2A 2QQKL 1ZT1B 2NCMA 4R4FH 4X99B 5DQ9B 1D5ZB 4JN2B 1IC5L 1N7ML 1S5HB 3D39E 2HJFB 4X9BA 4DOHE 5LBSH 1IC1A 3O3UN 5D1QB 4KV5F 5KSBE 3NCFB 1NEZB 4W6XB 4HV8A 1JHKL 3MO1B 4UT6H 4UIMA 1AXSA 5EBMB 4NN6C 1UH3A 4I77H 1UT9A 4CVZB 1M05B 4PJGE 1KBGL 4MNGE 5IBLD 4M43L 5MENE 2H32A 1M4KA 3VWKD 1D5BA 1WWAX 3EAKA 3P2TA 4XPAL 5T5FH 1U8LA 1LEKB 1Q0YL 3NIDE 1ZTXL 1N5AA 1GL4B 4HH8A 1AQDA 3LQZA 4EUPA 1O5DT 4OFYD 5J6GB 5C9JA 1MCPH 3MLUH 4LCIH 4M1GH 1J7VR 1GXEA 1ZHBB 1BAFL 3MFFA 4XMKH 3V6ZB 2R0LH 3ILQD 4OM1H 4C83B 1GGBH 4NZUL 3QDGB 4GO6B 1GC1C 4F2MB 4X6BB 4IJ3B 1BFOA 2WNGA 4K8RH 2EZ0C 3P9MA 5C09D 1NJ9B 2H26A 2WBWB 3MLVH 4LPUA 3TF7A 5I2IB 2CUIA 5BS0D 1FNHA 3DO3A 4GSDH 4Y2DD 2VZSA 5IKCA 4P59H 5ECJE 1IT9H 5EU6A 1IL1A 1E4WL 2VNCA 4Q6IC 5FK9B 1H15B 2HH0H 4RX4D 2ICCA 2BY0A 2R2BA 1U6AL 3BIAX 4Y4HC 3JWDL 5I1HH 3FFCB 5D71H 3S36L 4GS7B 5EC1A 2M1KA 3VWJD 3D85D 3G6JB 3QDMB 4X4ME 5F1NB 2NY4C 3S37L 2EE9A 1GRWA 3RP1A 3Q5YA 4DWHA 1XF3B 4IMLA 5DJ0B 5D1XC 4D2NA 2IPUK 3HS0A 4OIBA 2CMRH 1U8PB 4OIIL 4JY4A 1NAMB 2FZ3A 4HZAA 4YLQT 1FQ9C 5DS8A 1MFDH 4MD5B 4PGEB 5FHAH 3CD4A 1NGXB 4ZOBA 3MV9A 5IJVB 5DZLA 2Q20A 1U8NB 1ZHLB 4NSKB 1YQVL 2Q8BL 4U1SA 1U3YA 1QYGH 4V3EB 4MD0B 2EEDA 3FRUA 1QFWH 3U1SH 4QXTB 4XCYB 4R4BB 1PEZA 4PGZA 3UPAA 2G5BB 4LPYA 4ELKA 4F8QA 5IG7A 3Q5OA 2E9WA 4P2QB 1QLEL 3CMGA 4NRXB 5ETUB 5JUEH 3C8HA 2UWEB 4G8IB 5FUOL 3WDIA 1T5WB 1FN4B 4F3FB 2PYFB 4P2OA 5AEAA 2EE2A 4U7MA 3MV11 5GRJL 1T1ZA 3C60A 3QO0B 2I9TA 1WLHA 3CFDA 3N1QC 1RZ7L 1KB5L 3QEQD 4OUOA 5FYJD 5D7SL 4I18B 1JN6B 1IAII 2AGJH 3CDCA 4JLRA 3RVVD 5DJ6B 2VN7A 2FX8L 5DI8A 2R2EA 5CZKA 1U8QA 2X9WA 3T8XB 4Z8FL 1BBJA 4J4PC 3K2UL 1CGTA 5FUCC 4GKZB 1F2QA 1GC1H 4FFVD 2Q76B 1CDBA 3VXSA 5DXWA 2X4NB 4K3HA 4YBLB 1TQBC 3QWQB 4F7PA 1QSFD 1CFNA 5M94B 2YD5A 4L3ED 5FYLH 1BGXH 1JJUA 2BXYA 4HSQA 1LE5A 4HPYH 2DM7A 3ULUF 3U9UB 3K80A 3QSKB 4JANB 3PGCB 2BOBB 1NGPH 1S7UA 5FGCB 4U6HB 2FATL 4LVHC 2NXYC 4ZOAA 5C09E 1J8HD 1BPVA 3LKNA 1JCKA 1UENA 3G5XB 4U2ZA 3GHBH 5BS0E 3VFOA 1A6VH 1SY6A 2YRPA 3F7YA 2OCFD 4HBCH 5E24E 1LO4H 1I7UA 1IFHH 4JKWA 2VLJB 3OKMA 4HK3N 2XWBA 4FA8A 5IB5B 1WICA 4OLXL 2V5SA 2GI7A 3P4OB 3BRDA 1I85A 4PD4K 1JYWA 4RA0C 4CNIA 3QCVH 4N0CC 1EAPA 4KHXL 5EZOL 1KCVH 4LL9A 2IG2H 4HD9A 4NRYB 1KELH 2W91A 2ZUUA 1MHEA 4YHIB 1R0AL 3L3GB 1YYLL 2D7OA 4OM0H 1XGPA 4Z5RB 4FTVA 2N56A 1JF5A 4PLOB 4JRXA 2PUQT 4HKJA 4OTXH 4B0MM 4G80A 4LGRB 1A6WL 3WNNA 3QIBB 1A1NA 1I3RA 4X5LA 5T3ZE 3UZQA 3G9AB 2AJXH 2Y5TB 4DVBA 2WW8A 2XWTA 1QFUH 4R0LC 3TT1H 5F71A 4OV5B 4RFNC 3SE4C 3FT3B 2OBGA 4UV7H 1NFIA 2GJ6A 2X10A 3DV4B 5ALBH 1JMXA 3OKOB 4PJIF 3ZTNH 5EO1B 3C5JB 1EMTH 2ZCLL 5D70L 2VDMH 3LKSA 3GM0A 3HZYB 5DUPL 5B3JF 2D31B 5F1IB 1J0JA 4OQTA 5EU7E 4HFWB 3JV6B 3PJSA 4M61A 3ARRA 4RGND 3VD9A 1K4DB 4Y5XA 1NBYB 1T83A 4KJQC 1S9YA 1ZHKB 1MCFA 4NPYB 4GMTH 1KCSH 4AM0A 2VXQL 5EOTB 1RURL 5DD3H 4NT6B 3QEQE 1RUAH 5FYJE 1MWAH 2FIRT 4P3CL 3MRHA 3MBED 3V7AG 2W0FB 4FQHB 4L5FL 3UC0L 3WEXA 2Y36L 3S34H 5F96L 4XCEB 2Q8AL 3GSNB 5LGJB 1HHKA 2ICWI 2OZ4L 4Y19E 1YEEL 4G3YL 1JGDB 2M2DA 1SJXA 3EOAB 4RZCB 1D9KD 3GBNH 4P46D 4FQCL 3MV01 4R2GD 1QSFE 4OLZH 3RVXC 4L3EE 4S2SB 1G7JB 1W8OA 2P7TA 3AGVA 2QSQA 4URTB 3QXAA 4FQXB 1O7SA 3EO0B 3HMXL 4OD2B 3BPCB 3L3IB 5EN2B 3BP4A 1DBKH 6CGTA 1NLDL 1RHFA 3SJVE 4TQEH 2NZ9C 5J57B 1KIRB 3LH2L 4PJEF 3CLEL 1J5OH 3RY6C 2BOCB 4IOFC 1NEZG 3WN5C 3CZFB 4QRPE 3O8XD 4U7KA 5J8OA 4N5ED 3VXRA 1HH9B 4EI5A 1GOGA 4RRPG 3WO4C 3V6FA 3PNWA 4X6DB 4D0BB 3OXRA 3H3PL 4JZJA 4MNQD 2EH7H 3TN0D 4LSPL 1U36A 3HI5H 3LHPH 4MA1C 4BQ8A 3ZHLA 5TJWK 5ELIA 3O3AA 3OBAA 2AJZA 5BVPL 1YPZF 3RUGB 4HGWB 4FXKB 4DW2H 2X4UB 5E8PB 2ZWLT 3EYUL 1ZWIB 3WFDH 1NUNB 1CBVL 4YPGB 3MRFB 4Z7WE 5CJOH 1ETZB 5FGBA 4I2XE 4NYLA 1IRAY 4TOYL 2CSPA 3HAEA 2B0SH 4JQIH 4LIQE 4UZGA 3FB8B 3ARZA 2ESVB 1QFHA 2R56L 3VXUB 1F45A 5MEPA 5CZVL 2EDBA 3MLTA 5T1KB 1L8JA 4X98B 3RIFF 5JW4N 5EPMB 4L9DA 4KTYA 3MRQA 5CD5D 2M8XA 3OXSB 1G6RA 2YD8A 2FL5A 4YHLL 5ADPL 2NY7L 2ZJSL 4JO3H 3UTTD 4Q9BA 1AXTH 1LP9B 3QXTA 1ONQA 2D0FA 1LNUA 1A7RL 4P4KD 3VRJB 4XXCC 4LRNL 3R06B 4M6OL 2CGRH 5H35B 1RFDL 5C3TA 4ZUVB 1JGUH 4PLKC 1D5XA 2Z8RA 5CZXC 4XMPL 4EEEA 1SEBA 5KJRL 4LK4A 4F7EB 3NTCH 3T0EA 4O2FA 3TH2T 2HA1A 3TT3L 1CDCA 3CUPB 4JPIB 3H9SB 2FD6H 5K93A 3V7MA 3T08A 1VFBA 3RI5K 1KCRH 1UCBH 3UXFA 4XX1E 4LEXH 4YBLC 5IM7B 1EJ6A 5ERWB 3H3KA 1NUGA 4DQOL 4AYFA 1FG9C 1QRNA 1FH5H 3QI9C 1UH4A 3TM6A 1DBML 3VG9B 2XYCA 2IFGA 4KPHH 3BE1L 3FTGA 3QIUC 3UO1H 2BHYA 1Z3GL 4PGBA 4P57A 1QACA 4EXKA 1ZV5A 3LEXB 2C3WA 4KGLA 4AEIL 3SKJL 4NNPL 2G2RB 2IAMB 3PWLA 4HLJA 1KENH 3LPFA 3TJEH 3IETB 1NC4B 2AJUL 4ZUWA 4BSVA 3D39B 4PRPA 2IALB 4APQD 2KKQA 4BSWB 5ICZA 3GSXB 2JJVA 5E6ID 1UWEL 3V5KA 5D5MA 4LSQH 2VZOA 1XGUB 3WO3B 3MYZA 2Y72A 3T65B 4PRID 2A1WL 4PJGB 1P7KA 4MNGB 3ME0A 3CFJA 2SEBA 3U4BL 1ZLWK 3IDIB 4KJWD 4JVWA 4JY5H 1EVUA 3INUL 5C0CA 1NFDF 3G04A 5GGRA 1PEWA 4ODXB 2KQMA 3SKOB 1ORSB 1T21B 5JW4M 1N59A 1H3XA 3N9GH 3VD7A 2FDBP 4LASH 4BH8B 2IAND 4FZEH 2VABB 1J0HA 3RVTC 3HZKA 2C1OB 3MRJB 4UOW1 3TBVA 5JIPA 2CLRB 3UTTE 4KKLC 4YDKL 3QJHA 5DVKA 4DN3L 3EFFB 1U42A 2J6EH 4RAVA 1RIVH 1S3KH 5BV7C 2YKLH 3HRZA 5A3IC 5CCKL 3MYJA 1GZPA 3P30L 1WCBB 4GJTB 3P0YL 1KEMH 1DVFD 1KTKE 2WUCH 3VDCA 4OB5H 5AUMA 1JI1A 2UUDK 5CJBA 2P5ED 2V5MA 3JWOC 4XWOD 4G6KL 1OPGL 3SDXA 4RMUA 4BUHA 3TZVB 3QPQC 5CIPA 5I15L 3KXFD 1IGIH 1QFPA 4WUUB 5CGYD 4XMLL 1WC7A 1IMHC 3U9PH 4XGZB 2O26U 1FFQA 1S7WB 2FLRT 1X44A 4XVTH 4QHLB 1TMCB 1CLZL 4K9EC 1J18A 4I3RH 5JW4R 2JB5L 5LG1A 1PG7L 3LCYA 4AQ1B 2NTSP 4HF5H 1NAKH 4X6EB 2ENYA 3C2AH 1MJUL 2VJXA 1XGTB 4PJHA 2E8YA 2VIRB 3TJHC 4OQTL 1JZ7A 4HJ0D 3E3QE 4GT7A 3G5VB 4WVRA 1R3HA 1IZKA 3OX8B 4WV1C 4DCQA 5J9PB 4N0UA 4LF3B 3KR3L 1XF5A 4BFEA 4H8WC 3CK0L 3F7VB 1U0QA 1A6AA 5F7EL 4M8QA 4R90L 4X4YB 3P73A 5TDNB 4FN0A 1PD6A 3GSRB 4PJ8D 3VFPB 1FNAA 5E7BA 3MGAA 1VKXA 3WXVL 4XZUB 4JFEE 5FHBL 1CG9A 3MV8E 1U3HC 3VWKB 3HNSH 5IROC 2DM3A 4TSAL 3HNVH 4K7PX 3EYSH 5EU3A 1B4JL 5BV7H 3O6FC 3L5WA 1YEJL 4U3HA 3CNKA 3S4SB 2XA8H 3DURA 1KYOJ 1BFSA 4JPWL 3B9KC 4Z7OE 5D93B 1A7QH 4LHQB 4WI5A 2EIEA 4O02L 4XBPA 4Z7UB 4UV4L 1XEDA 4HUVB 5I19L 3JWOH 5C09B 4HIHA 3H3BC 4GUPA 1YA5A 5DHVB 3DI2B 2W07A 5C0IA 5EZIH 5J1TC 4BFIB 1P9MC 5BS0B 3QHFH 5IESH 2A6KB 4Y2DB 1U8HA 1T5XB 5HI5C 1S7VA 2YPKA 2N7BA 5BJTA 3KPTA 4H88H 4OFVA 5FKPA 2ID5A 1A14L 4K9EH 4JDVB 5IHUH 3ESVF 3VWJB 3D85B 3CAFA 1M7DB 2GCYB 4JFZH 2JJUA 3MUGB 1I8KA 3RKDC 1RPQA 3CFBB 3PL6D 5C8JA 3Q5TA 1LO2H 4U1KB 4L8CB 1GVIA 3C5SA 2BJML 4F7MB 2X4PA 3EFDH 3FHAA 3SDCC 1E4XL 1OGAA 1VGKB 1CWVA 3BMVA 3L5XL 5AAWA 1FVDA 2CDEB 1EHAA 3ZT7A 3DJ9A 1MCOH 3REVB 5FOJA 1DFBL 3GMOA 2VQUA 4OZ4B 5FGRA 2IAMC 2KZ1B 2ADFH 4LSSL 4H8WH 4NZTH 4XAWL 1JZ4A 1UKQA 3HPLA 5JW3H 3FOMA 1FC1A 4M6NH 4U1MA 3LN4A 5D72H 4WW2A 4MB3A 3KPRA 3SN6N 4B53A 5BW7C 1DBJL 4LVNB 1TTGA 4EBQL 1GYAA 2JJTA 3LZFL 1H3TA 2MPAH 3MUY1 1L7IL 4HWZB 5I8KH 1AKJA 3B9EA 1D3CA 4LLMA 1DQJA 1T6WA 1CR9L 1F3JB 3QEQB 5E2WH 2JB6A 1BD2D 1Z9MA 3ULVD 1MRDH 3NACL 1II4E 3ZLQC 4YHOL 2VLKA 3BHBB 4B7LA 5KSAD 1NMAH 2AQ2A 4U1HB 4EN3A 2ICWB 2P8LB 4ZYKB 3DETD 5F9AC 4JG1H 2J7LA 1KJ2L 3MLWH 4MX7A 2VXSH 1RUML 1QSFB 2MQ0A 1C7SA 4K94C 4L3EB 4OZIF 2CXGA 1S7TA 5HDQH 2E7MA 4MXWH 2Z31D 2CRZA 4KKCC 4FQIH 1MQKH 2D03L 3A67L 1UM4L 3O6LL 3P9LB 3UTZA 3VFSA 2BVPB 4F9LA 1JGEA 1QLRB 1TQCC 5T1MA 5IB3A 4MWFA 3CSBA 2C4XA 3WL9B 2ORBH 3VRIB 3TH3T 1CU4H 2NLJB 3EOTH 3BZDA 1NL0L 2XPGA 3LSOB 3D69B 4N1CA 4UOW0 4U6TA 2O5YL 4KJYB 3FQTA 5F7UA 1YMHB 4XRCA 4MAUL 3FQUA 2APTA 3E6HA 4HIXH 5TGBA 4HGMA 4CMMB 3QDHA 5DTFB 4PJFA 5B39A 4D9RE 1T3FA 3RWDA 3BN3B 5K59F 5HYFA 2EYTB 2JIXD 2IFFH 1C5DA 2BERA 3LB6C 5E08H 5DJAB 4GG6F 4FZ8L 2YZ8A 4HJJH 3RDTC 2HTKC 3QNYB 4HDIA 5K9KB 4TRPH 2R23B 2GITB 3MA9H 4WEBH 3RJQB 2FB4H 4PJBF 4I2XB 2ADJA 5FDWB 4PRHD 3BDBA 15C8H 2H1PL 3IU3A 2ITCA 5AD0A 1E4KC 3GSUB 1FDLH 1ZOXA 3QIWD 4XPTL 3NGBB 3PWVA 1Y18A 5JHLL 1LO0L 3IJYB 3SO5A 1U8IA 3DROB 4YUEH 1HXYB 3CVIL 4JR9L 4GAGH 1G9NC 3VI3E 4JFDD 1VSCA 3LV3A 5IWLC 3DLQR 2Q1EA 1U3ZA 4D0DA 3C5ZC 2VXUL 1RZJC 4OCSL 3MRBB 4RGNB 5LWYH 2DLHA 4QCIB 1MVUA 4LLQA 2YEZB 2HKHL 1F4XL 4YFDB 2V2XA 2NW2B 1QO3A 3LAFA 3KPQA 5D2LF 1HKLL 1UXWA 4Y5YC 1NCDH 4NDMA 1I7ZA 3GZKA 4TPRL 3K4ZA 1BD2E 3MBEB 5IQ7L 3S35H 3ULVE 4PG9A 3P11L 1XT5A 5L2KD 2AEPL 4K94H 5C7XH 2H2SC 3DUSA 1SYSB 3L3JB 2I60H 3NCMA 3MRNA 3EYFB 5C08A 5I1JH 3MOBH 43CAA 3WFHB 4G43A 3JWNC 4KMLB 5MP6H 4AIZA 2WBJC 2HT4C 1IBGH 1D9KB 4P46B 1NC2D 4TTDC 2F53E 4R2GB 4KK5D 3SKNB 4YZFE 1X4YA 3FFDA 4PGDA 32C2B 1WV7T 4K3DH 3NCYS 4JY6A 5KVDH 5DGQA 4P49A 1SYVB 1HXMB 4DUWA 1FZOA 1MJ8H 3HUJA 5J13C 2PXYA 1OTSC 1U2HA 4NKMA 5GGUA 3B4NA 3O8XB 4M7ZB 4L3CA 3OKKA 4M7LT 2W59A 5FOBB 2ATPB 3UPRA 5JHDD 4PJDB 5B21A 4NN7B 5FCUL 4POZC 3BP6B 4PJ7B 5TFSL 3AB0C 3S6CA 2XZAL 5JOPD 4XNQB 1X5AA 5B4MD 3NFNA 5TPWH 4BFGA 2E5EA 5B8CC 4MNQB 2EDEA 4X4ZA 3TN0B 2OTWA 3L9RB 4XCCH 4L9LC 4ZAKC 5L9DL 4H20H 4C4KO 1J10A 1UWGL 1FV1A 4JFXA 4HHAB 4OUUB 4NNXB 5IBUB 1H3UA 1KPVB 1MCJA 2PW1B 3ZDXE 5IFJA 1AP2B 3S4SG 1T7YA 1XGQA 3RIAK 5SV4A 4H26A 3KJ6H 1G9NH 4MVBC 5LXGL 1MLBA 5KVEH 1YEHH 4E5XB 1T89A 3GBMH 3M1BA 5DRWB 3NZ8A 2EDOA 1RZJH 1BOGB 3GMLA 4M3JA 5FO9B 5IW3A 4LHUD 5D9SB 2AJVL 5ID0A 2WQRA 4JFDE 3BMWA 3DYMA 2BSSB 4NQVB 2BCKB 5EU7C 4PDCE 5I8CA 2VZ1A 4HEME 2YXFA 1Y6KR 4N9GB 1DQMH 3UTTB 5HDBE 3QUMB 1IAIH 5DWUH 3GSVB 5HGDB 3T0DA 5KBNC 1GCFA 3PGDB 2H8PA 1H0DB 5HJ3A 5JOEA 3ZKQD 4P4KB 4DEPC 4PS4L 4EZMA 2FX9H 1MRCL 2GSGB 1BP3B 2AV7B 1I1AC 2V6HA 1AD9B 2BMKA 2OXHA 3FAWA 4M6AA 4FABH 2Y6SC 4ZSOB 4AIXA 3S96B 1LEGB 1WISA 3MV9D 4OI7A 5C92A 1MJ7H 5E2TH 1WAAE 3TO2A 2WLZA 4MS8C 2BZDA 3O2WL 4KTEL 1TETL 4XNXH 5HXMA 5C9KA 1PX4A 5CJXC 4KKAD 3NPSC 1F4YL 2A38A 2HAZA 4KFZC 4KZDL 2GAZA 3HMWL 3P3YA 4FFYL 4TSBH 4UAOB 1MI5D 3TFKA 2VDRL 2AKRB 3H9YA 3QG7L 3KLHC 4P2OD 1NCCL 1Z9LA 2XXMB 3C60D 4CRPA 1RZKL 3KHOA 3DIFB 4EKXA 5TE4H 5JHDE 2BHUA 1PY9A 1URLA 1N64L 5JOPE 1KJVA 2R69H 5IUSA 1CL7I 1QVOA 1QBAA 4PY8J 5KAQF 3I50H 5T3ZH 3VXPB 2Y1VA 3FO2A 4KV5E 5E00A 3MRGB 3GB7B 3N50A 4APQB 5KW9H 3ULSA 4GRLC 3Q3GA 2P4AB 3VXSD 1AXIB 1GHFH 2EDRA 1U9KA 5E6IB 1AHWA 3W9EB 1K4CA 1L0YA 4OD3H 5ADOH 4BZ1L 1A4KB 4ZUTA 2PO6A 4DFIA 3QH3B 4NC2B 3BKCL 2VH5H 4NBYB 1BFTA 1EEUA 1TFHA 1Z9OA 4P2YA 4FOMA 3REWA 4QRUA 1R24B 3WIHH 1YMME 3STBA 1Q9WB 2EDDA 3QFDB 5I16B 1LVEA 1FYTA 4L4VA 4PY8I 4W68A 4GW5B 4DKFH 1KCKA 3NIFF 2IANB 4QHKJ 1QBML 4IRJC 3VH8B 3L7EA 3U7WL 2Y06L 4CN6A 4NQSB 1JI2A 4U6XB 4MA8L 4Q9QH 1TJIH 1ZGLM 4PRAB 1AH1A 4OLUL 1KJ3L 4FTVD 1C5CH 1KXVC 2HT3D 4PY7A 3LQAH 5F88B 1UA6L 1OB1A 1X6LA 5HGBB 2C7UB 3RRQA 3MCLL 4DGVH 1XFPA 3SO3C 4L1DA 4TUJB 2J8OA 2EEAA 2VDOL 3B9AA 4J3TA 4WFGD 2GJ6D 2E7HA 3KXFB 4NIKB 2G75A 5H37G 4GOSA 1XIWC 3GIZL 1BVLA 1WBZA 4QF1B 1ADQL 3WFBL 4PJXB 3VD3A 1X4ZA 3MCG1 4LNRA 1IAIM 1MI5E 4NUJB 5CEYA 4GH7B 1RK0A 5GJSH 3PP4L 1DDHA 3DI3B 3GSOB 5I0DA 2LVEA 2XQBH 3MFGB 4I3SH 1WFUA 2ARJB 4ZFGL 5GSRB 4N0FA 4M7ZC 3SOBL 3S9DB 5I1IL 1B0WA 2VDLH 5IHZB 3RVWD 4LLAA 3TESA 2WP3O 3VFRB 1ZEAH 2DKUA 2QQNH 4Q6IA 3CFEB 4KWUA 4Y4HA 1X7QA 4O2CA 5DT1H 1OLZA 4OD1H 1DQQB 4ESKA 1HZHL 5H37H 2B39A 1OWWA 3A0OA 1KLUB 3CU7A 4MAYB 5I1GH 1MCHA 5D1XA 2FO4B 4PJ8B 2WINA 2Y9RT 3FQWA 4U2YA 3K8KA 2FJFA 1A6ZB 2FJGA 2AJYH 4NP4H 1ZS8A 3T4YB 3E2HC 2R0KH 3MRPB 1MUJA 4G6AD 3VXRD 1D5IL 2X4QA 4EI5D 3AY4C 2YMXH 4Z7NF 5I17A 1TCMA 4RCAA 1P7QA 4YNYA 4P5TC 1KEGL 1FLRH 3V5DA 3ULUE 1J05A 4F7TA 1JPGB 5DMGC 5IK3B 5D8JH 4M3KB 4L8SB 5FM4A 1FSKB 3MRMA 2DQJH 3I02B 2RIKA 1EJOL 1T20B 1EK3A 1F58L 4MMXC 3AMKA 4OJFL 5JXAL 1I7TB 3BH9B 5HYJA 4DAGH 1UADC 3O3EB 2EDNA 3DMMC 3TBSB 5L88H 2X44D 2EYRA 5DYOB 1Q9KB 4J8RA 3I6KB 1HINL 4OSUL 4I5BA 2ICES 4OCRH 3IJHA 2Q6WB 1N2RB 3U0TB 1BM3L 4WFGE 5GGQH 3NFPA 4XCFL 3AS0A 5C0DA 5E5MB 3LPGA 2A6DB 4XPHL 3HKFA 1UJ3C 1MWAA 3PL6B 4J3VA 3HB3C 2Q87A 1V5JA 2WZPD 1X5KA 2J8UA 4NFDA 2DQIL 3D9AL 4YHYB 2DWDA 3FB6A 3W9DA 4R7NB 2DBLL 4LLWB 1IC7H 1MELA 5C0NC 4PRNB 1BQSA 2GJZA 3ZKMC 4PJIE 5D96C 2ZCKH 1R5VB 2VXTH 4CBPA 4PJ9C 3BGMB 1TVHA 3GMRB 5FF6B 1JPTH 1UQSB 3RKPA 5IT2L 3V6BR 3LKPB 3G08B 4LLUA 1RIHL 1F11A 1VGEH 4OZGA 4Z77A 4NQXA 3T0ED 5MHSD 2VC2L 3FQXB 4JO1L 2HMIC 4MJ5A 3GIVA 1FPTH 5I1LA 3RWEB 3JSSA 1JYXA 4HJGA 4N0CA 5KG9B 1OTTC 3CSYA 4E41A 1Y6NR 3FONB 4JE4B 4JO2H 4MJ4A 3ZKNC 1FIEA 5E2VH 3PV6A 3WDJA 4NO5A 2GSIB 4U31A 2Q7NA 1BD2B 1QRND 4XPFL 2XWJB 5AYUH 2VKWA 3SCMA 4Q6YA 5KSAB 1A6UH 4R0LA 3D48R 3VRLE 1TXKA 4JDTH 4NJ9L 4ZUSB 3CDGA 4C56E 1MCBA 5HPMB 2GK0B 5T5FL 1N5YL 4Z9KB 1PW3A 3KPNB 1A5FH 3QHZL 4KMQA 4X5WB 5K9QI 2Z31B 4PRPD 1I9JH 4X99A 5DMIH 1MCPL 3MLUL 1C12A 5DQ9A 3TBWB 3CFCL 5DMKB 1Z5LA 3RJDA 4UBDD 3FO1A 4PJEE 4NQED 5TF1H 3LPWA 3U4AA 1NEZA 1GGBL 3IFNH 3VGHA 5J6HB 2Z8SA 5EWIL 4K8RL 4OCXH 4RRPA 5EBMA 5KS9F 1KGCE 1HEZB 5LAXB 1A4JB 4XXDA 4LFHD 5CSZA 4CVZA 1DCLA 1M05A 3MX0A 3MXWL 2L7UA 2MHAA 2BRRL 5GS3A 3SGDI 2Q7YA 3U30C 4G9DB 3SQOH 2HH0L 1ZVHA 1F90L 5C0CD 3PP3H 3K1DA 5I1HL 1LEKA 1YPZE 3QCTH 3D18B 4UDTB 3BIKB 5TE6H 2AAVA 2LQRA 2NMSA 5HDOA 4K71B 4F57H 5KN5A 1B6UA 1MHPL 6FABL 4TSCL 1P4IL 4U1JA 4MQTB 2V2WA 4C83A 1HHJB 5CINH 1DBBH 4PRHB 4WWKC 1N6QH 2XI9A 5IB2A 3QIWB 3F12B 5EOCH 1NJ9A 5FHAL 3RY6A 5CD3A 3LVEA 3WN5A 1R3JB 3SHSA 1TCRB 2KZWA 2VAJA 4POUB 2Y07H 2ZKHH 4JFDB 2VQ1A 3QWOA 4RAUA 5FK9A 1MEXH 5HI3C 2YBRA 5C71A 3X14A 4IS6B 1VHPA 3IDGA 4RGMC 3OR7A 4ZFZB 3E6FB 3ETBF 1UVQA 3RX8A 1NSNH 1OAQH 4QTHB 4PRBA 3QZWG 1S9KC 5JUEL 3WXWL 3QDMA 1AGCA 4RMQA 1JPSL 3PGFH 4GW1B 5CWSB 1CFVH 5DHXB 4MAYC 1HHGB 3OJMB 4AL8L 4JZNB 3EJZD 2NYYD 1U8PA 1QRNE 2K1MA 4GQ9H 4J2XA 3B3IA 4QT5A 1NANH 4XBEH 1BQHB 1YNKL 5BZDB 5L2KB 1AI1L 4AMKH 2OM5A 1UFUA 3KPSE 4LSVL 4GBXC 1NGXA 4AH2B 4TULL 5E4IA 3FJTA 4Z7VF 1I8IB 2OSLB 1KPRB 2WIMA 2CDFB 1ZE3C 2ED9A 4X6CE 2HRPH 4MD0A 3BVNA 4UNTA 1RQ5A 5AG9A 3ET9F 1GC1L 4QXTA 1LK3L 4Y16C 1OAXH 4H5SB 1TITA 1W72L 4ZO8A 1XAUA 1V3MA 4P2QA 1BGXL 4CDHA 1NBVH 4G8IA 2XKUA 4HPYL 4NQEE 1B6DA 3QUYD 4UIMB 4F3FA 3EKCA 5E99H 2Y7QB 4KRLB 2JCCF 4YFEA 4OCYL 4UNUA 4J3SA 2R2CA 3U6RB 4XXCA 5B3NA 2CR6A 1IAOB 2APFA 1SM3L 3QO0A 5JHDB 3B5HA 1ND0A 2DQEL 4S1DC 2IH3B 4YXKL 3LDBB 1MREH 2EDLA 1JN6A 2J6EA 1IFHL 3GO1H 4PV8B 4HKXB 5DJ6A 4OZHA 3LS4L 1PSKL 4UTBL 5C0CE 3T8XA 3OKLA 1N5AB 3ELAT 1AQDB 2A9NH 3LQZB 3CVHL 4HAGA 3QCVL 2Q76A 3QPXH 5EOQL 5DQDL 4PJAF 2VSCA 3SDDC 5I66A 3NCEB 1KXQE 3MFFB 4ZPVA 4HZLB 1IGYA 2X1XR 3WUWG 1BQLH 1BFOB 4JANA 3PGCA 1QTYT 3NAAH 3P9MB 2AABL 1NFDE 1BMGA 5IFAH 1EO8H 3QIUA 1R3IH 4Z7QE 5EUOA 3TT1L 4LHUB 5IKCB 4UV7L 3S97C 1S9VA 1MCIA 3DUUA 3VFVA 2R2BB 1TZHA 1OP5H 3N1MC 3CXHK 2FCBA 3OB0K 4WTZG 2MQ3A 1GGYA 4M5ZH 1OGTA 5EC1B 3MRDA 5KVMC 2J2ZA 2R1WA 3HC3L 1LE9B 1SEQH 3UAJD 3RGVC 4NRYA 2B20A 3UTSA 4G9FE 3EYQD 4X0KA 4QOKE 5BCAA 2CDGA 1GGTA 3T2NL 3TVMD 4JY4B 3UTQA 2FZ3B 4N8CH 1RZIA 1OGAD 2NY6D 5DS8B 4JM2F 2BC4A 1U95A 2Y5TA 5I1AB 3ARYA 1T66D 1EX0A 3BPLB 5ANME 5LQBH 3DV4A 3FRUB 1S78D 25C8H 1K6QH 4X80L 1FGNH 4XNYH 4CU6A 1XF4A 5EBWA 1CFSA 5EO1A 4O4YH 3RFZC 4ELKB 1YDPA 3VXMD 5IG7B 3HZYA 1MI5B 3IFOB 4XP9L 3GBNL 1G0DA 1LDPH 1VACA 2LABA 3WSQH 3KPRD 4MXVF 4N0UE 2I5YL 1NMCB 1NCWH 3IS0X 1MJJB 1RUQH 5GRYA 2LTQB 1JP5A 4NPYA 1AKJD 5C0FB 3C60B 3O2VH 5GGSA 5MEQA 2I9TB 2JKXA 1A3LH 3CFDB 1DANT 5F3HA 2HTLD 1J5OL 2CJUH 2IQ9H 2E9JA 4JLRB 4KTDH 2OYPA 2W0FA 1C16A 5LJYH 2VLKD 2ZNWA 2C4FU 3KPMA 5DI8B 2R2EB 5E2UH 2YOCA 2PW2B 1U8QB 4EN3D 3U36B 3MJ9L 5LGJA 1QR1A 2EH7L 3MLXH 3BT2L 12E8H 1A6PA 4LPTA 4F7PB 3LHPL 4ODBD 1CFNB 3O3DA 2OL3L 1FRGH 1LE5B 1ZVSB 1NBZA 3T0WA 4IEFB 3UYOD 5DRNA 5T3XL 3BPCA 5EN2A 1S7UB 2L7JA 3CC5A 4Y0GA 1DLHB 2F5AL 3DHMA 3OAZH 3NFSL 1T0NB 4MMZC 3LKNB 4KVNH 3VFOB 3K4DA 1I9IL 3CZFA 3F7YB 3TJHA 4XNUH 3WIIL 2B0SL 4PLJD 5HHME 1HH9A 3OKMB 4JFHD 3VDAA 2BVOA 2EIZB 3QISA 4Z95L 1J88A 1BHGA 3BDXA 1ZVYA 2QSVA 5J1AA 4CNIB 4LQFH 4HKBA 5AZ2L 1EAPB 1AGDA 1SJEB 4WV1A 4H0IA 3O3BA 1CGXA 5I71C 4JPKH 3BDYH 1MHEB 1NDMB 2OR7A 1XGPB 4HCRH 4IOIB 2QLVB 1AXTL 4QXGL 4FXKA 4ODTL 1G1CA 1M7IB 1SBBA 2X4UA 5E8PA 4ZS6D 1A1NB 1WTLA 3UJTL 4DVBB 4YPGA 5T33H 4RDQF 1ETZA 2XWTB 2CGRL 1FC2D 4K23L 1JGUL 3RU8H 1GH7A 4CGTA 5I18L 1R5WB 1TVDA 1NFIB 2GJ6B 2OMBA 1OAZH 1U3HA 5IROA 5F6IC 3B6SA 3I2CH 5CP3H 8CGTA 4ODSH 4YE4L 3RIAF 5I75C 3LKSB 5T1LA 2A9ML 3O6FA 3RL2A 3VXME 2VDKL 2OJEB 5EH1A 2Y5EA 4LEXL 1ZA6B 1LHZA 3DGGA 1CK0L 3IDXH 5JO5A 4Y5XB 1J0YA 1S9YB 1LDSA 1O0VA 2Z0BA 1T22A 3X11A 4AM0B 4WHCA 4YQXL 4PJIB 3UJJH 3OF6A 3VRJA 3GHEL 3UO1L 4F9PC 3MRHB 5H35A 3QUZC 3ZDZF 1CD1A 5C0RL 1EUTA 4OFIA 3WIFA 1FJ1B 4QHMA 3SY0A 4MLIA 3TJEL 4F7EA 2X1WL 3SDAC 5GS0C 5C08D 1HHKB 3CUPA 3VGDA 3H9SA 5ACZB 5DO2C 1MFBL 3EW3B 3DO7A 1NAML 4P9HC 3BKJH 4YHZH 4PRDB 3QXAB 4FMKA 3O4LA 1P2CA 3EJYC 1EEZB 2DQTL 4DN4H 3BP4B 1PG7W 1YEDA 5C0AA 3MACL 3P4MB 3EUUA 2PXYD 4HPOH 4LARH 2ZPKH 1X9QA 5IR1B 2Q3ZA 5TE7L 5DUMH 3MLZH 5DLMH 4C56B 3VXRB 1WWCA 3O6KH 3V6FB 2X09A 3PNWB 5IEKA 1Z6JT 4OZIE 2UZIH 2DIJA 2IAMA 1NC4A 1N8ZA 5D7JC 2VZ3A 4RSVA 4KJPC 5L7XL 2DLTA 3TIDB 2VZVA 2ZUXA 3N9GL 3GI8H 4PJEB 2IALA 3TO4C 5KSBA 1NGZA 5ISZA 1QNZH 3L3DB 5BW7A 5GGVH 2AJZB 3SKMA 1JYVA 1T04A 2VDPH 4FQQA 1S3KL 5IVZB 2YKLL 4X7FC 3LMJH 1XGYH 1BIIB 1OAYL 2YSSB 3T65A 1FZKA 2Q86A 4PJGA 4MNGA 1V7NH 5BXFA 3THMH 1NCTA 4NYLB 5MENA 1RULL 2MWCA 4JVPA 2XTJC 3IDIA 1ZLSH 1JGVL 5K59E 1S7QA 4UDUA 3EOBA 5MEPB 1YPZB 3MLTB 3T0XA 4GG6E 3K8LA 1F97A 1F3DH 3B9VA 4ODXA 3SKOA 4WY7L 4LHUG 2YUXA 3MRQB 3MA7B 1G6RB 2FL5B 4LSUH 3BGFB 4XVTL 5HVHB 5J7CC 5A2IH 2R4SL 2XG5A 1V3JA 5J12C 1MIEL 1CL7H 1DSFH 1ONQB 3L1OH 4KK9D 3V4VL 1LNUB 2FX7L 5GS0H 4WEMB 4CW1B 3WFCL 3K3QA 1GPOL 5DJ2A 3DVIA 1D5XB 3KPLB 4P9HH 2CKBH 4OGAD 4XAKD 1SEBB 3DX6A 3T0EB 3B8YA 3V5HA 4K55A 2NXZC 1UXSA 4KI5F 3DHJA 3TZVA 1VEOA 2R0ZH 1VFBB 2X7LA 3G6AB 2E7LC 3QEUA 3M8OH 4NWUH 2ARWA 4DVRH 5D2LE 4WENB 4X4MA 3FMGH 2N1KA 5JXEA 1QEWB