5E6IC

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
258
Chain Sequence
b'SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWDTELVETRPAGDGTFQKWAAVVVPSTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 258
sequence length 273
chains with identical sequence I, M, R
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e6iC01
1BVLB 4HWBH 3N0PB 1NUDA 4G6FD 1FAIH 1EEQA 4LLWA 3J8F7 4DUXA 5E6IA 4KHTL 4OKVB 3DUUA 1BREA 2FBJL 2K3TA 4M62L 2AJ3B 3SPVA 1L9NA 1T6WA 4Y4HC 4JY5H 1FV1B 1SYSA 5JIKA 1I9RH 3OAYH 1NANI 3QFJB 3S88H 1FGNH 4Z7VE 1DUZB 1M6OB 1T04A 4EXPX 1UH2A 5HHOE 2DDQL 1YMMA 3TH4T 1UCBL 4CVXA 4F80A 3RHWF 5KSUB 1RIHH 5B3JE 4DZBB 3MRLA 1EDQA 4UB0H 4F2MB 2BVTA 3BYYA 2PW2B 3GMRA 3DSNA 4PG2A 5TQ0L 2DJ4A 3V4PH 4XP6L 3UYRH 5CFHA 1EHAA 2AJSL 3MACL 4NZTL 4V3DB 4DKDC 4TUOB 4KJPC 3IDIB 5GRYA 2ZJSL 1PQZB 4WGWB 4JFHD 3IKCA 1H3WM 3U9PL 3GO1H 1DVFD 5C08E 2I07A 1MVUA 1R24A 4QO1A 4YH6A 3SEPA 4D0DA 3RY6C 1FAKT 2PETA 3D2UD 4UNTA 3WSQH 1P53A 1N6QL 4H88L 2VABB 4RZCB 2X4QB 1IGFL 4X7SL 3WFCH 3T1FA 4WI5A 1N4XL 4ZO8A 3RVWC 1Q9KB 3FFDB 4Q2ZA 4LQFL 2VITA 3U2SB 1FIGL 2VZVA 1E4XH 2NY5H 3PWPA 3BEVB 1S5HA 2J4WH 4IRSA 3RPIB 3KWWB 2ESVD 2EDBA 2QADD 4K9EH 5BXFB 1T3FA 2P44B 1SMAA 4I0PD 3SDYL 2NXZD 3VFTB 3IJYB 2WNGA 2QL1A 4FFYH 3EDKA 4WWID 1BF2A 2Z8WC 1OARL 3G6AA 3Q6GH 1YECL 5GZND 1NSNH 4MJ4A 2AXGB 2AK1H 5KG9A 3VGFA 2X4NB 3MV8E 1ULVA 1HE7A 5HHQA 3DURA 4HS3B 2ZSWB 4LF3A 4OFPA 3VMPA 5HHMB 4UAOC 4MLSA 2BFVH 1I85A 4G8GE 3I3DA 1JWMB 2VAAB 5C92A 3U7WL 2PR4L 1HZHH 4G8IB 3DARA 3PDGA 4XWGL 5D7SL 3C8DA 3FN3A 3UO1L 1C5BL 3OG4B 3MO1B 4JFYA 1XH3A 5AWNL 3QEQA 4N1EA 2EC8A 1PYWA 2FX8L 1FL5B 1IAIL 4RSVA 1P9MC 3SDDD 4GOSA 2CXKA 3SDCA 3C5SA 2EYTA 1MCWM 1LEIA 4CU7A 2IAMB 4NQSB 5MEOA 4Y19E 3BSZL 2DIJA 4QCIB 2M8XA 4CMHC 2WUCL 5BVJB 4ISVB 5IEHA 5L2KA 1AGFB 5CGTA 1H5BB 1BBJA 5EORL 4XVTL 2OZ4L 2O5YL 4LBEB 2W9DH 4TULL 3VXUE 5IHBA 2H8PA 4NNPL 2Q8AL 3G5VA 5JXAL 1A9EB 1C08B 1IEHA 1BEYH 3MUZ1 4N0UA 1YEDA 4ZUVB 3MFFB 2IGFL 5CAYB 4I77H 4I5BB 3RPKA 4G9FD 4XGZA 1KC5H 3VFPB 4BYHA 1BD2A 1Q0XH 1Z9MA 2P47B 3O6LH 1Z5LB 1LDSA 5C6TL 3BWAA 5E4EB 3AREA 5BZDA 3LN4B 4MNGA 3QUYA 3SY0B 4N8VA 3JV4B 3C09B 4X6BA 2HTKC 4LP5A 5FYLE 4DQOL 4OKVA 3ABZA 4F7TB 4ODWB 3ISWA 3AB0C 1R3IH 2YMXH 4UIKL 1RK1B 1JPTL 1AJ7H 3OR7B 3QRFM 2IG2H 3L6FB 4YPGB 3EYUL 3S36X 3SKMA 3WE6A 4KTDL 1TZIB 2AV7A 5F3BA 2WUBL 2H2PD 3TA3D 5IV2A 1V5JA 4C56A 1M6OA 5JW3L 3AS1A 5C0CE 5I71C 3Q3GB 4XMPH 3KPRE 5E2WH 3QDJB 3V7AE 4XX1E 2JB5L 5T1KD 3RIAK 1MI5A 2OS7A 3FO2B 3REWA 1RZKH 4N0CD 3SDXB 3QDGD 2GY7B 3OKYA 4K3EH 3GHEH 1AIFB 1Q94A 1ZHNA 2NX5A 4OLUH 5AZEH 3TIDB 1AE6L 2D9QB 2MCPL 3KPLA 3VXOA 5KSAB 3PGCB 4Z76A 4L1DA 1Q9LA 1ZVHA 2F8VA 2IANB 5FO7B 4RWYL 3OAZK 4X5LA 4U1JA 3RWJA 3DVFA 3P4MB 2HT3C 3LEVH 2BDNH 3CFKA 3MV9E 1OP5H 3OKMB 1L0YA 2COQA 3NH7L 3MROA 5B8CA 1VEPA 1TITA 1J18A 1FVDA 3PL6D 4IIQA 4OT1L 3CVHH 3C08L 1NGZB 3TGXA 1A6TA 1D5IL 1NCTA 1IZJA 4NKIH 1A8JH 5JZ7C 4LHUD 3OB0H 1RUMH 4U2YA 2IALA 1QSFE 1AH1A 2VR5A 1DL7L 3MRGA 5KW9L 4JB9H 3F7VA 4OD3H 3QIUB 3VG9C 4ZXBC 2EDEA 3KWWA 4OQTA 4QRRA 3EYOA 3GIVA 3MYJB 5H37G 1QFWL 3CZJA 5DFVC 3C60C 3JTTA 3HLAA 3NA4A 1L9MA 3VD5A 4CU8A 2DBLH 4NNXA 1OWRM 4HKJB 1IC5L 3RI5K 2J5LC 3HZVA 4IMLB 1J1PH 3BN9D 4ZUTB 2IPKB 2P5WB 1A9BA 1KOAA 5GS2D 5IT2L 4HQQH 5D1XC 1MHPL 1YN7B 3ZT5A 5BJTB 1N5AA 2Z35B 5CLTA 3C9NA 2AXGA 3WNNA 1L7IL 2VYRE 5GS3A 2A73A 3GI8H 5HPMB 1MPAL 3NA9H 1YNLL 4RFNB 1V3JA 4NKDA 5DJ6A 5F89B 3I6LD 5TE4L 1ZHLA 4JJ5B 4S0SD 2ZCKH 1A1NB 3DV6A 3QXVA 4PJ7B 1TJIL 1YPZA 1Q9OB 5C09D 3HTLX 5D96B 3TN0D 4CW1A 3GIZL 1A2YB 4JPVL 2UY6A 2UUDH 1Y0LB 3DX8A 5ITFA 4N9OB 2WBJA 3S97C 3LIZH 5E24E 4Q74A 3O0RH 3AGVA 4NHCH 4A2MA 1NCDL 4Y16A 4TPRL 1DLFH 3INUH 3QULA 4UTAL 4HK0B 5DT1H 4AQOA 3KLAA 5EU4A 5LGHL 4R6UA 3G04A 5EU3A 4KDWA 3V0VA 3TJHD 3HE6B 2LU7A 3QA3B 1VFAA 2E9WA 1WT5C 5L6YH 4K8RH 3RGVA 4TVPE 3N9GL 4GQ9L 3HE7B 3NFNB 4Q7DA 5SV3A 5E08H 2B4CH 2SEBB 3VWKD 3DVNA 1PY9A 1IC7H 2UWEF 2DD8H 1WBYB 2DQHL 5JIPA 1NCCL 3EFDL 3H3KA 5CHNA 3BESR 3ULVC 4I2XA 2NY6B 4R0LA 3DX7B 3WN5B 4HK3J 2OL3A 1BGXH 1L0XA 4YR6A 4YDLB 1EHLL 1CFQA 1SYVB 3ARFA 3L6FA 4KHTH 5HYSA 1OAYH 2BY3A 2BC4B 1KEGL 2EEBA 4M62H 3BWUC 4UDTB 5JOEA 4R4FH 2APWA 3F62A 1PJ9A 4LSRL 3O45B 1IAII 5B38G 1NL0H 3A6BH 4G6JL 5HGGS 2PYEA 3QQ4B 5E56A 2ZOLB 2DDQH 3HPJA 5EO1A 1LO5B 4AT6A 5MERB 5GS0L 4UT9L 3PGCA 2LTQC 4JR9H 5TQ0H 4A6YH 1U3HA 3P9LB 4KK6C 3JWDC 4MA3A 3CFCL 5F7HA 3F6IA 4JHWL 4RA0C 1QBBA 4YWGL 5FYJD 4PIRF 1KPUA 3O81A 2G5BA 4NZTH 5C1MB 5IMKB 3G6JB 4JFOB 3PJSA 3CC5B 2OTWA 1WAAF 4JRXA 2ZJSH 5C3TA 2I5YL 5F93C 1ETZA 3QJFB 1AQDB 4KJWC 5I75C 3V8OA 4PJ7F 2KBGA 5D2LE 3U9PH 4M00A 4GMSL 1UKSA 1BZ9B 1N5YH 4IRJD 2Z91A 2XYCA 3QBTB 3GKWL 5K9QG 1JWSB 2VIRB 4I4WB 5HYJD 4FXKA 4C58B 1QFOA 2LU3A 4LCYA 4HFUH 4ORGA 4X7SH 1IGFH 3MCLL 3OV6A 5KS9B 5CP7B 1I75A 2VLJE 3K81A 4UIMA 5IW3A 3FFCA 1ZLUK 4PJIA 1CBVH 2AABL 3S36L 4G43A 5D2NA 3SGJC 3O11A 2O93L 4MMZC 2VDPL 1FIGH 3L3HA 3DGCR 3FHQA 1A14H 3ULVE 2DMBA 4LSTL 3DMMA 3OKDB 3C6LB 2IPKA 1Z9SA 1FGVL 3LQZB 3PQYA 1XGQB 3C6SA 1I7RA 2AK4B 5AG8A 1OGAB 3G9VA 4E41A 4MNQD 2VSCA 4YXLL 4JVUA 1JPFA 1OARH 4PJ8D 2DQTL 4HDIB 4K2UL 2OYPA 1G7JB 3HI5L 2ZUTA 1AXIB 1D5MA 1YECH 7FABL 1MJ7L 2R29L 4WI7A 4F9LC 4PRHA 4U1SB 2GKIA 5F1NB 1INEH 5BW7A 4PRAB 4H0GA 3F7QA 3D9AL 2A6DB 3TYFA 3VWJD 1FFRA 4YNYA 4LPUA 5DJ2B 4M6AA 3BUYA 3KG5A 3VG0L 5C9JA 2EDRA 4BZYA 2QSTA 2X6MA 2IH1A 4NN6C 4PRBA 2HT2C 3B3IB 5F9JA 4FQXA 5F7EL 4GW1A 4CN1A 2RHEA 5ANME 4E0RB 3U7WH 2PR4H 1DE4A 4X4XB 4OUOA 4XWGH 4MQ7A 1RU9L 5D7SH 3HFML 2ARJA 3UO1H 1C5BH 1EEUA 4P2OD 5AWNH 4RAHA 4ZUUB 2C1PB 3HZYA 4MQXC 2ADFH 4UT7H 1GC1C 2FX8H 2LFGA 3GSQB 1VFBA 4PJEA 5E8PA 2GQHA 1Q9WA 1G1YA 3WEXB 1A02N 2CDGA 4D9LL 3CFJA 3ALXA 1N7MH 5J13C 1ZXQA 2OTUA 3BSZH 5D93B 3VFGH 1BJ8A 1P69B 4WWKA 1T83C 4XNXL 1LP9B 1QFWI 2WUCH 3QA3A 2P8MB 3WS6C 5EORH 1IAKA 1Z9OA 2VN4A 4XVTH 3A0OA 2OZ4H 2O5YH 4TULH 5IVZA 5DD0H 3E2HC 1WBXA 1JNNL 5DD6B 2ATPB 4NNPH 2YRPA 3BJ91 2SEBA 5JXAH 5D6DC 2GSGA 2IGFH 2XV6B 2FGZA 2Z31D 5C3LD 1KT2B 3QEUB 3FT2A 3KLDA 5E2VL 3B83A 3PDOB 5C6TH 1MCWW 4PJXB 2FO1A 4XP9L 5GSVB 2JIXA 3FRPA 3QIBD 2WWMD 3BXNA 5FF6A 4DQOH 5DF0A 4F15C 5KS9F 2V9TA 3S7GA 1BLNA 4PJ5D 2DQGL 4UIKH 1FZJA 2R9HC 4ETQB 3H7LA 2DJUA 5F6HI 2DYPB 3EYUH 3DOSA 1V05A 1O7VA 4OAWA 4KTDH 4B50A 5J4MA 4OZGB 2MNUA 1S7UB 5GQBA 3DO3A 3IXAB 2C3HA 2YEZA 3U36A 3KYKL 2J3SA 4NDMA 4FFZL 5ESAB 1QR4A 2JB5H 2W59A 4HF5H 4HPYH 5A3IC 4X4ME 5DD1H 2C3WA 5GGTA 3FB6A 1K5NB 1N6UA 1DBAH 2JJSC 1MIEL 4LVNB 4PTUA 1YYLL 2MCPH 4WO4A 1J88A 4PP2B 5EBMB 4XRCB 2VLRE 4P99A 5KJRL 5DQDL 4PV9A 2EYRB 4PJCF 4RDQF 5GGUA 4G5ZL 5C86A 4R2GB 4U6VL 3ARDC 5IVXA 4HT1L 3RUGE 1AHWA 3MLUL 1AP2A 3ALWA 1LO4H 1QFPA 4QRPE 3L3GB 3P4NB 1D5XB 1CL7L 4LPYA 2ZSVA 3AFLA 1YYML 3BHBA 1H3GA 2P24B 3T0AA 3C08H 1AC6A 2MTPA 4FZ8H 2V7NA 1D5IH 4MMXC 4PREA 3TZVC 4O02L 2BP3A 1QLRA 2HFEB 3IFPB 3L95A 1OAKH 4Y2DC 3FAWA 2W0LA 4OZIF 1DL7H 2NNAA 3NABL 5EOQH 5JNYA 1JGLL 3QUMH 1IBGL 3RWHA 2ID5A 3AY4A 5MP6L 4XNZC 3P2TA 3IF1B 2AKRA 3E8UL 1ZS8B 2VLLB 4MJIA 4NN5B 4ELKA 2CO6B 4H8WL 1IC5H 1XGQA 4F33A 5I1AB 4ONFL 2PO6B 1QBML 4DUVA 1IM3A 3RZCC 4F3FA 5DMJB 3QSKB 1PGRB 3R8QA 2I60L 4F9PA 4X6DB 5H2BA 1MHPH 1NBZB 4PRNB 1ED3B 1BQHG 4OZHA 3ULUH 5E6IC 2UYLA 5FA4B 4U1SA 4TTDC 5C0FA 5D70L 3CXDL 4JDVA 1D6EB 3LSOA 4KKLD 1PZUB 5FGBA 4LCWE 3MJ7B 3GMPA 2E7CA 4CBPA 3JTCA 1XF2B 4LPWA 3MOQA 4JM2F 3GI9L 3VFVA 5I2IB 1HYSC 5TGBB 1YEFL 3SGDI 1TJIH 3ESUF 4EQ2A 5DK0A 3VXSE 1I9EA 1U6AL 1RMFL 5CJBA 1IJ9A 3GIZH 4JPVH 1HH6A 5ERWB 5DHXB 4LEOB 1HSAB 5ID0A 2F5BL 4PG2C 2C7UA 5HHMD 1FYTA 4I18B 5C71A 3QI9A 4YO0A 2BNRA 4W4NA 2V5RA 4OF8A 2ATKB 3RWFB 3WNPA 2QSQA 4UTAH 6FABH 4Z7WA 2KL6A 2V7HB 1EA9C 1OSZA 3QQ3B 4K7FA 5F7MC 4BA8A 2R8SL 3MJGX 4AL8H 4KVNL 5LGHH 4Y5YB 3NCEB 4JZOB 1F5WA 3NIDE 1QLEL 3REVA 4X7TA 4OIAA 1TTUA 1JWUB 4X8XA 1G7IA 2ATPA 2GI7A 3HZKA 5CD5D 4YHYC 3N9GH 4GO6B 5GIRA 4OF0A 3D1MC 4GG8A 5HYFA 3CDFA 5CZXC 4YBQC 2Y9RT 2BVUA 3JUYA 4DVRH 5E0QA 3BIBX 5DTFA 2ERJC 1Z3GL 1I7TB 4NO5A 3GSNA 3ZKMC 2DQHH 4L3EE 4ZFOL 1CD1B 4YHLL 1NCCH 3EFDH 4QHMB 4V1DB 5F6IB 3PNWB 1MIML 4GXUN 4IRSC 4KJQD 3HAEA 3HNVL 1ZLWH 3TA3A 2GJ6E 1JMXA 5FECB 4WTZA 1KLGA 4C4KT 4WFHE 4RA3A 4DGIL 4ZPTA 5E95B 1ZEAH 1C12A 3LMJL 3A6CH 3EOBA 2JJUA 4ZTOH 4HJGB 3PGFL 5TE7L 4U6HB 4U7SA 4JPIB 3HI1B 4H1LG 1JGDB 1N3NB 1DSFL 3L7FB 4FZEH 5DQ9B 5I8EA 1RJYA 3TIEB 4NN7C 5GPRA 3B9VA 4NZUH 3WLWD 2XTLA 3ZZ1A 4ZFFB 3SKNB 2YD3A 3FB5B 1DDHA 3QH3B 3ARVA 5JW4M 5DJ8B 5EB9A 3ZE2E 3DHMA 2ZG2A 5T5FL 4PG9B 1MHHB 4X6DF 5GS0H 4UT9H 4FQ2L 1F4WL 3QO1A 3T4AB 1OW0A 5M95B 5J6HB 4NUGL 3KYAA 2KZWA 4DTGL 1MAML 3QZWG 5IIEA 3CFCH 4MDJB 1VFOA 4R97B 3QDJD 1KNOB 2FZ3B 1PW3A 1X5IA 2P4AB 3ZDYE 3CFDB 4QTHB 4N90D 1X5GA 3HG1B 3SHSA 4JJHA 1P7KA 5B4MC 2DQFB 1M7XA 1T1WB 1I1FA 3SDCC 4GMSH 5DGQA 2RAMA 1RVFL 2IAND 4HXAL 2P5EB 4WV1A 4JKLA 1I3GL 2VXSL 1P7HL 1SY6A 1DTUA 3QFDA 3BRDA 3LKOB 4FNLL 3UDWA 3QUZB 3H9SD 4RRPA 1D6VH 3FT4B 1HOCB 1M71A 5TDNB 5MEQB 5IQ9A 4X98A 4CRPA 5EIIB 2EE3A 2GAZA 3BPCA 3ARBB 5BO1L 3MCLH 4IS6B 5CBAA 4L8CA 1M1SA 2LU4A 1FC2D 2BSRA 1KCVL 2XQBL 2AABH 1GGCL 1DQJB 4ZAKB 4QT5A 3QHFL 4R96B 3MLTB 2VDPH 5GGSB 1CXKA 3GJEB 2DIAA 4OLXL 4RGMB 1WIPA 2M26A 2OI9C 5IB5A 4MAYC 1TVDA 3RWIB 1E4JA 1H3VA 3D18A 3LVEA 4HKXA 2W65B 4LSTH 3GUTA 1ERNA 5DJCB 3ZO0A 1EGJA 1G6RL 1ZMYA 3EDDA 2FLRT 3O3DA 5H94B 1FGVH 3QIUD 1RZ8B 1ACZA 4HIEB 12E8L 1W0VB 5EUKA 4ELMB 1ED3A 2D4DA 4YXLH 1MF2H 4YFLI 1GZPA 5AAMA 3ZT7A 2DQTH 5F1OB 1YEEL 5IMOB 1BPVA 3KS0J 5IESL 1D6EA 5J1SC 2R29H 1UACH 2ZOKA 2BCKA 4GRWF 4FQQA 1NH6A 1L8JA 1NGQL 4KDVA 1NMCC 4BSJA 1HKLL 1N8ZA 4NT6A 2V2XA 4L9LB 4BK4A 3G5YB 4X8JA 5FA3B 2L0DA 4YFLF 3TFKD 5F7EH 3LD8B 3W39B 4MQSB 1PKQB 4HJJL 1TJHH 4NQCA 3ERYA 4UMGA 3VXME 3VH8B 5JHDD 4MD5B 3B4NA 4LDLB 5IEKB 1QO3B 4OD2B 1RU9H 3KYNB 1NCAH 1IAOB 2Q3ZA 4U6YB 4I18A 3TJHA 2CKBA 4ZUSB 1DFBH 4HUXA 4MA8L 2P8PA 4QHKJ 3FB7B 3IGAB 4X6CB 4KKAC 4Z0XB 2XKNA 3TBWB 2ZUSA 4ZFOB 4D9LH 2Y7QA 4CVZB 3BQUB 5I1JH 4OKDA 5FHBL 4OBSA 1YEKL 5B8CC 4HC1H 3O2WL 3H0TB 3S3JA 3FQXA 2VXVL 4YXHH 5DQJA 1BMGA 4IIQC 4UDUB 1JBJA 3JV0A 1FFPA 2X4SB 2GJJA 1RI8A 2R15A 1QSEB 5J6GB 4KK9D 3HE6D 3HI6H 4HZLB 4HKZB 2CKNA 3U9UA 1IGJB 4HBQA 3EO1A 4LKCA 3ZKXB 1SVCP 4GMTL 3VMOA 4H5SA 2WY3A 3VA2C 3HE7D 5FV1L 2HLFD 5BS0D 1S9WA 3GMQA 3D39A 3EFFA 4UTBL 4NQXA 2DM4A 2NTFA 4WTWA 2AQ2A 1KEMH 3RL1B 3LB6D 3SO5A 5IWLA 4HULB 3CK0L 3O3EB 4Z7OE 3X14A 1K6QL 5C0RH 1U8HB 2EYSA 4FQLL 2RJMA 4N9GB 2NY6D 2NY4C 3LN9A 5E9DD 2YKLH 4PJBA 5ACLA 5J3HC 1MCSA 5EUOB 4QRUB 3CSGA 1S7XB 3DVGA 2HN7A 2F54B 2AEQH 4PB9H 4GRWH 3KYKH 5CEZH 5B39A 4I3SL 4FFZH 5EO0B 4LVOB 4OLZL 4PRIB 1OP3K 4OGZA 2NY7L 1MQKH 3F7YB 3RDTB 4ELMF 3HR6A 4B0MM 1BFTA 4WFEE 3HNTL 5DJ0B 1UM6H 3IDMB 2NX5E 1MIEH 1MWAL 1YYLH 4MDJA 4UU9B 2IFFL 5HVWA 1HH9B 4PDCE 1I3RB 2BSED 5KJRH 3QNZB 1K2DB 3B5TA 4IRJA 3UTPE 2X4RA 2H9GB 3QO0B 1PFCA 1T1WA 4NRZA 3QG7H 5F9WC 5GSRB 3UJJL 4Z78B 1FO0H 4G5ZH 4Y16C 4R7NA 3SDAB 5GGQH 1CDIA 1T4KB 3UZQA 4JHAH 5DZNA 3BKCL 1OSPL 3OKNA 4HT1H 4XTRD 4JAMA 5T3ZL 5IFJB 1G7MA 5EU6E 5I9QC 4MJ6B 2A6KB 2R4RL 5I30L 4WI6A 4H26A 3WS3A 1CL7H 1R5IA 5JDSA 1YYMH 3QIWB 1R0AL 5T1LA 5EIIA 4XC3L 5EBLA 2YUXA 3MOBL 3ARBA 1HHHB 3V6OA 4Q6IB 4U33A 2AJZB 2E27H 3MNWB 1OQXA 1QRNB 3M1BA 4P9MH 4ZPVA 3WNMA 4CUCA 1FZKA 2UV3A 1QBLL 3NABH 4DK3A 1MQ8A 1JGLH 1IBGH 4G59A 5E5MA 3MRRB 4JGJA 3I6GA 4WTXA 3NCFB 5MP6H 3LQAH 5D7IB 3E8UH 4JFPB 1RJZA 1F3DH 1OGTB 5DEFB 3WNKA 1UWGL 3ULSB 5HGAB 4PJDB 4ONFH 3VI4E 1HIML 1QBMH 4R0LC 1YNTA 3SE3A 4HIHA 3O3BA 1G9MC 2I60H 1KXQE 5DJZA 3PABA 2VLME 4GAGL 1SM3L 3ZYZA 3ES6B 3MA7B 3DTXB 4W81A 1ADQL 3BZDA 5DK2A 3GB7A 3E3QC 3C6LD 4BSWA 2GK0A 3MBXL 2HFGH 5D70H 4Z0BL 4ZS6D 3CXDH 3HB3C 1NCBL 4JQXC 4NBXB 3BFOA 3ZMRA 2ADJB 1OGAD 2XWBA 2FX9L 4OIIL 4GAYA 5BRZA 5C7XL 4PGCA 2ZWLT 4HUVB 3ZKNC 3QCUL 3MV7E 2P49B 1YEFH 1EAPB 2BVQB 1PY4A 4TN9A 5ICYB 1PG7X 4YC2C 5F72S 2BX5A 1DN0A 1U6AH 3K80A 1RMFH 3MLXL 5DRZA 3BGFB 1ZLSL 1IAOA 5DSCA 5FB8A 3JSSA 3IDYB 1B6UA 2FBOJ 4Y89A 3ZE1E 4OCYL 4YQXH 4V2BA 1J8HB 1KLUA 4LNRB 5HYEA 4F8TA 1DN2A 2F5BH 3MGAA 4M5ZL 2VDKL 3BEWB 5EUOF 1I1AB 2UZIL 4NRXA 4KRNA 4TVPH 3TVMC 5EU5A 1X3DA 5I1KL 1G7QA 2R2EA 5FKAB 3KPPA 1HHKA 2R8SH 4KVNH 3NMEA 2H6PB 4RGND 1OL0A 1V8HA 3KR3L 4JFED 5ICXA 4NCC1 5F7NC 3HMXL 4K71B 3RVUD 2ICES 5HI3D 3LRSA 2DM3A 3DBXB 1FZOB 4YX2L 3VFMB 1G7HA 3TO4B 2CUIA 1II4E 4HKZA 3BH9B 4NCC2 1XGPB 3VFOA 1DBBL 4WNQA 2VAJA 2VN7A 5C6PB 2WINA 4ZSOE 1FBIL 1FL3A 1AD9B 4NO0A 2YC1B 2OJZL 1JPGB 2G9HA 3S35X 4YHLH 2DLFL 1MIMH 4ENED 5BMFL 5JLZB 3OJDA 3HNVH 3VXRB 4X7FC 5CILH 1S78C 1CTNA 4NUJB 1JZ8A 2H2SC 4GG6B 1BFOA 3JTSA 3IDJB 5I8CA 4KJYA 3QXTA 3X17A 1XZ0A 4J12A 4DGIH 2NY0B 4OZ4A 4XPAL 1VGKB 3LMJH 5DMGC 1MFNA 1TTGA 4LKXB 3E3QE 2EE2A 3QG6A 3PGFH 1DCLA 2BOCB 4JM2D 1DSFH 1A3RL 1HCFX 5GS0D 3ECBB 2F54A 1PKOA 4D94A 2QKIB 4FXGA 1GAFL 4P57B 2HG5A 3WFEH 3WO3B 5JPNB 2PXYB 2PYEE 1O5DT 4MS8D 5DVMA 1T21A 1TFHA 4N8VG 5CJOL 3BE1L 2X42A 4JDZA 5T5FH 3CVHA 3WIHH 1IQWL 4JFZL 4FQ2H 1H0DA 4LMQI 1GOGA 4HFWB 5HHPB 1IKNC 4NUGH 3IJSB 3CVIL 1MAMH 1F3JB 2VOTA 3VRLF 4KAQL 4L3CB 5F9DC 4J8RA 1S7VA 4UI2A 3O8XB 3R06A 2FLBT 3DV4A 3K3QA 2H26B 3SDAA 5JW4R 1XR9A 4JRXE 5DRNA 3HNSH 1EXUB 5J12B 2NXYD 3PWUB 1YQ2A 5SWSA 1K85A 5C70A 4HXAH 2QR0B 1YJDL 2VXSH 4WWKC 4ZUWA 3QPQC 3SQBA 2MHAA 4FNLH 3EYQC 4RAVB 3ARPA 4Y5XB 1H3TA 1VKXB 1CFTA 1UENA 2A74B 4R2GD 4O9HH 5INCA 3MNWA 2HJFA 4L4VE 3RWCB 4TNWK 1QRNA 3NZ8A 5BO1H 1XCQB 2GCYB 1MLCA 4UV4L 1AXSA 2DKUA 5ESVA 4NQDB 1CF8L 1SJHB 1KCVH 2XQBH 3FFCE 1GGCH 4PJIE 2DF3A 4QYOA 3LZFL 3P30H 4UV7H 3QHFH 2HVJB 2X4OA 4OLXH 5D7IA 1XAUA 1A6AA 1OGTA 1KV3A 1YY8A 1NFDF 2BY2A 3BIKB 2CIIA 3OX8B 1CFNA 1FZMA 1ZLVH 4NHUA 3HS0A 5KVFL 5L8LB 2H32H 1J1OL 4QF1A 5E4IA 1G6RH 2J88L 3MRPB 3PQYE 4Y4FB 4P2QD 1NDGA 1U91B 1JNHA 2FWOB 2Y06L 2BNQB 4PD4K 5ILTL 1KENL 3TO2B 1GGIH 5CJXA 4KRMB 2WV3A 2QQKL 1YEEH 4K23H 4R3SB 5IESH 2KDGA 4KK8D 3NPSC 5CSZA 1F6AB 2PO6D 4OCMC 1NGQH 4NO2B 5C0JA 4NBYB 4OM0L 4C57C 4CJ0A 5LXGL 4M9OA 5FDWA 6CGTA 5HDQL 4GG6F 3T2NH 4PS4L 1RURL 4HSQA 5LBSL 5IJKC 2FIKB 2FR4B 2FATL 2GTWA 4HJJH 3CZFA 2R69L 5I74B 1U36A 4LNRA 1UB6B 4JFQA 3VJ6B 1U8LB 3N06B 1I1AA 2DRUA 1KGCD 3MA9H 4Z7UB 1PEWA 3WIIH 4MA8H 1AKJA 1FC1A 4WRLA 4PJEE 1I1YB 4BQ6A 5F7LB 5I0ZA 1G0XA 5GGVY 5DA4A 3VFSB 4QXTB 43CAA 3O4OC 3E6FA 4PRPA 1L0QA 1OPGL 1A6UL 5FHBH 5DRWA 2YS4A 4OCXL 5C0GA 1AHWC 1KPRA 3QXDB 4A2LA 3GSXB 3HC3L 2R1YB 3R0NA 4GRMB 1X7QB 4M03A 1YMHA 2QADC 5EZLA 1M05A 4MVBD 1T5WA 3OF6D 2XZAL 4U1IA 3GDBA 5IMMA 3MLWL 3QHTC 1JCKA 2VQ1B 2NXZC 3B9KB 4ZO9A 3IFOA 4GMTH 5KOMC 3LY6A 4HUWB 3AY4C 1FFQA 1CLYL 1UGNA 4S1SL 5GZNC 2E3VA 3FOLB 1P84K 1PG7L 2FJHB 3RNKA 2WZPD 3CK0H 4A6YA 4POYA 2XN9B 4LKXA 1K6QH 4V1DD 4F9PC 4FQLH 4NIKB 1MJJB 2BOCA 1MRCH 4GBXB 1ZGLB 5CINL 2BSTA 1CR9H 3ECBA 1NMAH 3DO7A 1MCCA 4H25A 1GRWA 2R23B 5I0DA 2D0FA 5IMLB 4XP4L 4BZ2L 2CQVA 3MLRH 1JZ5A 5FGBC 1ZA3B 4UINL 1MUJB 4I3SH 4OLZH 5E00B 4KVCL 3BAEL 2NY7H 3CPLA 2EIZB 3KPNA 3U0TA 4M1CD 3SDDC 3HNTH 4LLQB 4JFHE 4PB0H 1KJMA 4G6AD 3ZYOA 1MWAH 1OF2A 1T1XB 1J87A 1QNZL 2IFFH 3SCMB 3WHXA 4FQCL 4NC2B 4X80L 3H9SA 4PRDA 3QI9C 4R90L 1VACA 2UWEA 2A6JA 2W07A 5D1QA 1MCOH 3T4YA 4RQQA 1ES0A 1WFNA 4Q0XL 4ZDHA 5T3ZH 1B0GB 4KV5F 2A0LD 1KIRA 2R4RH 3UMTA 5I30H 1UM4L 5HGBA 2D03L 4E42A 2R1WB 5ISZB 1R0AH 3U4BL 4J3UA 2CLZB 3MOBH 3VFWB 2L7JA 2ESVE 1FJ1B 4IOSD 5IROA 1O7SA 5KSBF 3UZVB 4O2EB 1I8IA 2AEIT 2P5ED 5FK9A 1NC2D 1P6FA 4PTTB 4EI5A 1QVOB 1FN4A 4S1QL 4XI5D 3MUJA 1QBLH 2ED9A 3QUZD 4NJ9H 3W5NA 1HQ4B 3BPLC 1YC8A 1C5DA 3C5ZA 4NM4L 2HRLA 4G3YL 4P46A 3LDBC 5E8NB 4PY7B 1T2QL 5IUSA 1UWGH 3OMZA 3PP3K 1A3QA 1C1EH 2Z4QA 4Y4FA 3EHBD 1HIMH 3GMNB 4JRYA 2H2PC 3TA3C 4ZAKD 2BNQA 4E9LA 4MDIA 1PX4A 4P5MA 3AROA 3EOYG 4GAGH 1FNEB 3TFKA 1MHCB 4NSKB 4M6ML 4KHXL 1LGVA 2DMCA 1PBYA 4PLJD 2E7LA 4Z0BH 1NCBH 2VL4A 4BJLA 2HKHL 4JFFA 2LV4A 5J9PA 4OIIH 2FX9H 5C7XH 4OGAC 3E6HA 3QCUH 5K93A 1CICB 2V5MA 3G6DH 3OL2A 5GISL 4YXKL 2DQCH 3AU1B 4FQHA 3G5XB 5L8KB 1ZLSH 1QA9B 3L7EA 1U8LA 4P4KA 1S9XA 4YDJB 1NKOA 4ZYKB 3I84A 4JY4B 4NZJA 3CH1B 1A0QL 1YC7A 3QNXA 2W60A 2VDKH 3PDDA 4KWUA 4ZODA 4XPTL 1FYTE 3TJEL 2BNRE 2HFFA 3MXVL 5I1KH 4XPGL 4Y4KD 3VFSA 1P5UA 4Z7WE 4AJ0A 3EAKA 3CSYB 5GRXG 3W0WD 4F7MB 5TF0A 2X9YA 2C4XA 3KR3H 3OBAA 1AXTL 4QXUL 5I8KH 5ALBH 3GSXA 4WV1C 3HMXH 3KS0H 4G9FE 4Z7VB 2WBKA 1I1RA 3S34L 3SKJH 4PGDB 1SQ2N 1T2JA 5KVGL 5M7QA 4QWWD 4I48B 4EKXA 4YX2H 5BS0A 2HTLC 3KPOB 2GFBB 3BQUD 3OR6B 4NKMB 3TPKA 1DBBH 2X4TA 3TWCL 3V2AR 4AENB 1KIQB 3NIGE 3BH8B 3MV11 4QHLA 1FBIH 1XGTB 4L5FL 1Z0MA 3QUXB 1U8IB 2VWEC 3CUPB 3BX7C 1T1YB 4HUNB 5E9DA 2JCCF 3DX6B 1QSED 3TEUA 4MGXA 4D8PB 1RIUH 2CXGA 1ACYL 5CIPB 5C08B 4D9RD 1RUAL 5AUMA 1OP9A 5F7UA 4LRNL 2J8UF 4MHHG 1KG0B 3T0WA 5IFHL 4WJ5B 4FQJH 3ZHLA 3QDGE 4NM8L 2R23A 4QRQB 1UJ3A 1A3RH 4TRPH 3O9WA 1ZA3A 3BP7B 1QRKA 1YEJL 1FVEB 3OGCB 2YD2A 1YQVH 4CU6A 3UPRB 3OKOB 3CD4A 2FH6A 1QR1A 3FRPG 4FFEX 2V5TA 2BRQA 5JOFB 1RD6A 2PCPA 4CAGA 2VJXA 5IOPA 1BX2B 1MAKA 3I02A 1AGBA 5IB3B 2XA8L 4W6XB 4KAQH 1S7TB 3TJHC 4PRID 3VI3E 4WUKL 3RDTD 1EPFA 3QUMA 4M1GH 4YGVB 5IW6B 1CI5A 4M8QA 1RZIA 4XC1L 4PGJA 5MEPA 4Y4HB 3MLYL 3C2SA 1UXSB 2WBWB 2CDFA 1YJDH 5DHVH 5E8EA 2B2XL 3MV8B 3KLHD 3W2DL 1AO7A 3ARGB 4P5KA 1T5XB 3EOTL 4KPHL 3FO9A 4P9HL 5JW4Q 1QFHA 5D71H 2GTZA 2LE9A 4UV4H 4RX4D 5AD0A 4JFDA 2FYYB 1PDKA 2QSCL 2MQCA 1CF8H 5ICZB 3D25A 3RX8A 1KJ2A 3LZFH 4EOWL 3QIWD 2VWEE 5JMOC 1LHZA 4Y1AA 4ZO7A 2RIKA 4JZNA 1G7PA 1SEBA 3WHE0 2J6EH 2YN3A 1FFOA 2VUYA 3BI9X 4CDHA 4H20L 3PGDB 3ARYA 3T65A 1J1OH 1DLHB 4BFIA 4QOKA 1XR8B 2J88H 4ZQKA 5EIQA 5FUCC 3B6SA 1I7UA 2XWTB 3DSFL 1MJUL 1A4KB 5ADOH 2Y06H 5C2BH 1FNEA 1KYOK 5IWLC 3PWNA 5IB2A 4X9HA 4D3CL 2A83B 2QQKH 1KJVB 4XZUA 5I73C 3IU3A 2AQ3A 4NZRL 5C09E 2N4IA 4R7DB 1NLDL 1NUGA 1ZSDA 4PJCA 5JW5B 5C8JA 4OM0H 5LXGH 2VLKA 3MJ8A 1U8PB 1UZ8A 4E5XA 3BJLA 3QYCA 1U9KA 5HDQH 1E4WH 1RURH 3Q5YA 1NAML 1TENA 4GFTB 1X5HA 3AUVA 4S1DD 4DN4L 4EI6A 1DR9A 1EEYA 1L6ZA 3EO9L 2R69H 4NQCE 1U8JB 4JQVC 4WHYH 4F37K 1ZOXA 5B38B 1FNGB 3IDNA 1JK8A 3F5WB 3ALPA 4L9DA 4F7CA 3T77B 3L5JA 3CSPA 3O2DL 4X0KB 3MGTA 2AEPL 5K9JH 4U1GC 4KK5C 4IRJC 3S4SA 4J4PA 1MFBL 1QPXA 1JF1A 1JRHL 1T20B 1U2CA 3T0EA 5KANG 1JHKL 2NY5C 1LD9B 1OPGH 1E6JL 1ITBB 4HJ0C 4K9EC 4HMCA 5HGDB 3DECA 5I76B 5SWQB 1ND0B 4PGDA 4FFVD 2IPTH 3GGWA 3KPMA 5I1HL 5C0CB 4M6NL 3HC3H 4YIQA 4UAOB 5HHOA 2YD5A 3SGEI 3HZMB 2BVOA 4GRLD 4JZJA 4NKMA 2DWEA 4CMMB 5CLWA 1INQA 3B9AA 1EZVX 1A47A 1KIQA 3V6OC 4QRTB 5JUEL 4YHML 1FRGL 5BOPA 2BRRH 3DRTB 1JN6B 3V79C 3MLWH 3QEHB 3ZDZE 2ARWA 3BGMA 3MRQB 2Q6WB 3TBYB 3DETD 4JKKA 1MLBB 4NWUL 5DJAB 5I1GL 1ZA6B 4LLYB 5LGJB 4PJ8C 1D9KA 1CLYH 3TO4D 3UZEA 4S1SH 3VXNA 1KYOJ 4JM2A 4TQEH 5EA0L 5DJXA 1BBDL 1BVKB 3D39E 3MV9B 5FUCE 3TBTA 1S7RA 5CIPA 4G8EA 5DJDA 5EOTA 2JK5B 5HDBE 3ZDXF 3SE3C 3OKKA 3VWJC 2EDLA 3JWNC 4YFDB 3VXRD 4APQD 4ODUA 4GKZB 3IYLW 1CG9B 4PJBE 1OVZA 3OAYK 1KFAH 3MNVA 3KXFB 4XP4H 3FQRB 4BZ2H 3V6FA 1OB1B 4WFGD 3NAAL 4X5WA 5LQBH 1GL4B 3HAEG 4P2OC 2NY0D 1EH9A 1UH3A 4UINH 3TBSB 1V7NL 3UTSA 4F7PA 3IAPA 3BAEH 2JB6A 4WTZG 1QOKA 1IM9A 3OGOE 3IFLL 2EH8L 3HR5A 2E7HA 4FA8A 3O6FA 2HLAA 5L8JB 1BX2A 4OFYA 5C0AB 5ADPH 4QHNB 3WHE1 1LE5A 4RMVA 4L3AA 4U49A 3DGGB 4K7PY 5CJQL 3MODH 3EKCA 3DHJA 1W8NA 5T3ZD 4FQCH 3RWEB 1FG2A 4X80H 3I75A 1HI6A 3KAAA 1RHHA 2YBRA 3AB0B 4U1NB 4R90H 5HYJE 1B9ZA 1HILA 5E94B 2P8LB 4X83A 5DI8B 5SV4A 4LFHG 1T0NA 1M7IB 1AGCB 3QXAB 1UM4H 1UQSB 2D03H 3O8XD 5CEXB 1T5XA 2FD6L 5I71B 3RIAF 4WUUB 2E9IA 2Z31C 1HWHB 2VQUA 3BW9A 4JN1L 3U46A 3KJ6L 4G8GA 1MFAL 2MKWA 4TNVK 2YSSA 1HSBB 5I8OH 3V6OE 5KN5A 4IJ3B 1T7XA 2NZ9C 5ICZA 4BFEA 2P7TA 1CFSB 4JQIL 3LKNB 1D5BB 3PWLB 4KQ3L 1NLBL 3FRUB 1EUUA 3FZUC 5C0EB 2CLRA 3BDYL 1IC1A 3DXAB 4MNQE 1JL8A 4NM4H 3ZT6A 3D3VB 2ZUYA 4G3YH 2KPNA 4XCYB 5K9QI 1R5VA 4RBPH 1IQDA 1T2QH 3OJVC 1DLHA 1F11B 1NAMB 1ZWIB 3IXTA 3L3OA 3VGAC 4Y19A 4NQDD 1RZKC 1U95B 3DX9B 4YHPA 4ZTPL 4DW2L 3GRWL 4OCWL 1TJGL 3RY6A 1A7NL 4MZ2A 3VXUA 1JZ6A 5F8QC 2ZUVA 3HKFA 4OCSL 2YA1A 2VB5A 5BQ7A 4M6MH 1K4DB 4JHZA 3MMEA 4OV5A 1I8KB 4KHXH 5E2JA 1WWBX 1WIUA 2YOCA 2F15A 1MH5A 5IR1B 2HKHH 5IW1A 4JKPL 2VXUL 3L3DB 1H9VA 5HD8D 4GKOA 4XBGA 3VG9B 4NQTA 5GRJL 4FQIH 5D7LD 4ZXBB 4HC1A 2EDFA 5GISH 4HIJA 1FNGA 4PGEB 3F5WA 3Q5OA 3MUGA 4D0CA 5FGCE 2YRLA 1X5AA 1A0QH 3U6RA 1U2HA 2J5LB 2NR6C 4HAFA 4HIXH 3F12B 2IQAA 5JIIA 3CLFL 1LK3L 4JPKL 2F58L 3BZ4A 5ELIA 3LKRB 1H3UA 1T20A 3MRBA 4P3DA 3W9DB 4XPGH 4J1UB 5KVDH 4U1KB 3MRNA 2YPLD 3T8XA 2V5YA 4ZNCD 3V0AC 4KKCC 2XPGB 1AXTH 4G42A 4QXUH 3DROB 4X6EA 5JPMA 3SJVD 3KPRA 2CRYA 3S34H 1A7RL 2ITCB 3M45A 5KVGH 3DUSA 1GGUA 1O0VA 1ZTXL 1WICA 5F3HB 3MLVL 4MJ5B 4GW4A 4PJFF 5IVOA 1C16B 4NP4H 1I3UA 3SN6N 3TWCH 3DIFA 3BDBA 3O2VL 5C0NC 4WHDA 2F8XC 4LAQL 3QNYB 1XGRB 4L5FH 4PJ5E 5LG1A 3ILPB 5EPMA 1K9TA 1R5WA 2FL5A 3LS5H 4TVSa 3GSWB 1NBYA 3VFNA 3MV9A 4PBVC 3EJYC 3G9AB 2GITA 2JK5A 1IGTA 1X5FA 4LSPH 2MPAL 4U1MB 3NCYP 5DUPH 4MX7A 1ACYH 1XIWB 3B9KD 1XFPA 5I15H 1RUAH 3MLPA 2A6IA 4LRNH 2VKWA 3V6BR 1AC0A 5IFHH 2E8ZA 5DEGA 4NM8H 1CXIA 1ZVYA 5CJXC 5D8JL 1ZANL 3UTTB 3LPFA 1FO0A 1QSFA 2D0HA 2O26U 5FO9A 1TETL 2VLJB 1VADB 1JRHI 3CFEA 4ODSH 5HY9B 2QQNH 1EEZA 1B88A 2GEEA 1JI1A 1P4LA 1BFSA 5KSVB 2ARJQ 4K8RC 2NLJB 2FO4B 4XP1H 2VISA 4RAUA 4BM7A 3MRKB 1I7ZA 4PJAF 5GRWA 4MAUL 2B4CC 4WUKH 1T03L 4G80B 3MZGB 3QQNA 4UQ2A 2R0ZL 5F70A 3VFRA 1F2QA 3FTGB 2FEEL 4LCUA 4XC1H 2XNAB 1LO2L 1OP5K 5FM5O 5IG7B 5CD5C 5B39G 3QHZL 2DMKA 4N5UA 4JN2B 3QXAA 4AIZA 1NC2A 4HH9B 4X4YB 3G08A 3X13B 5MENB 2DWDA 2ITDB 2AXFA 3HRZB 3EOTH 3G5ZB 4P3CL 2Z93B 1HSBA 2N7BA 3ZYIA 4KPHH 4M7JL 3OB0K 3QCTL 5MHSD 3UTQA 4KJQC 3UCRA 5JMRA 1P2CA 1MY7A 3TCLA 3QXUA 5C0EA 1LE9A 1PAMA 3WDIA 43C9A 4RFEA 4EOWH 3ARSA 5ISZD 3PIQA 4NOFA 4M8VA 2ZUQC 1U8QB 3K2UH 2D7MA 2VNCA 1F11A 5B3NA 1EHXA 2Q8BL 5IVNA 5AAWA 2B39A 4RNRB 4H20H 3EJZD 3HC0A 4QTIL 4NHUE 5I75B 4AM0B 1QLFA 4WW1A 4ALAL 4LLDB 1NGWB 1RUPL 2UZXB 2YXMA 4WI4A 4ODTL 3S8WA 3DSFH 5C2UB 1MJUH 3CDCA 2R2CA 3W9EB 3WLWC 4D3CH 4LEXL 4OZFH 5TDOA 4NC1C 2YUWA 2OSLB 3B43A 2C9AA 1BJ1H 4DVBB 3W11D 1HWGB 5INDB 4OI7A 1NEZA 4MXQD 5FYKL 5FO8B 5IB1A 3V0WL 2GT9A 3LRGA 3S3PA 5HHME 4NKQB 1CGYA 2K1MA 2OP4H 3C60A 5C07A 4P2RB 1Q72L 4Y4KA 4DN4H 4H1LB 3WJJC 3EO9H 1U8MA 4IHOB 2WP3O 2GSIA 4JY6B 2ICWB 3W0WA 2UUDK 5CBEA 2GJZA 3KDMB 3MC0A 5D1XA 3CMOL 1CICD 4LHQB 4N5ED 4LGSB 2B1AH 1ITCA 3TBVA 1MFBH 4LCIH 1RZFL 1JRHH 3FQTA 3VCLA 1L6XA 1JHKH 3K7UA 1A1OA 4PYGA 2CK0L 5D1QC 2EICA 1BIIA 4NQVA 1YEGL 3QZWB 1E6JH 4PRPE 3FQWA 3LPGA 5K9OB 2P48B 4FN0A 4WU5B 2EKSB 4LLVB 5MI0C 1WISA 4WHCA 4Q9QL 2RQ8A 2WM0A 4M6NH 1DJSA 2E5EA 5EC2B 3VD7A 1IGML 1IZKA 4NN6B 3KNBB 1J1XL 1CD9B 1LEGB 5ETUA 5IROC 1HQRB 4LGPB 2HH0L 4YHMH 4EI5C 4CADB 2APBA 4ZNEE 3QIUC 2VLRB 3TC9A 4NWUH 5DHYB 4DKFL 3MRFA 2G5RA 35C8H 5SWZB 1CDGA 2FX7L 4P46C 4Z95L 3WIHA 5EA0H 1BBDH 4L1HA 1D5ZA 1TZGL 5D2LA 5J13B 3V5DA 4EDXB 2NZIA 3RUGB 5IF0B 4XAWL 5FYJL 1NUFA 1S9VB 3QUXD 1K8IA 1FFNB 4OFKA 4YDVA 2JJVA 4NC1E 5JTWA 3UTZB 3L3IB 5LAXA 3S9DB 3L3KA 3E2HB 1J10A 5DS8B 4BH8B 4X9FA 3TFKC 3PXJA 4U7MA 4JKMA 3QUKB 1WUNT 4P4RB 1FL6A 1QFUL 3H7BA 3BUTA 3VRJB 2VLJA 1VADA 2E7LC 5C08D 3NAAH 5TF1L 4POUB 1FNHA 4U1HB 4I8DA 4LNVA 1RFDL 4JRWA 1HHIB 2Y5TA 5KSVA 3IFLH 2EH8H 1MCPL 5T1DL 3JWOL 5D96C 5DEZA 1EO7A 1OAXL 3DRQB 5FCSH 4P4KC 2IANE 3OWEA 4WU7B 4N8CH 5CJQH 5F71A 2ICWI 4QY8A 4F15B 5I66B 3T3MF 5JDJA 4F8QA 3H9SE 4HKBB 4PP1C 2FSEB 3D6GA 1XCTB 4HGWA 3EBAA 1OAQH 4CNIB 4FTVA 2UWEE 4JN2A 1NKRA 4QXGL 1LNUA 2HT4D 1TQBC 1BHGA 4MD4B 2ITDA 3U48A 3RNQB 2H32A 1XGYH 3QJHA 1G6RA 2AJUL 4NYLA 4U1LA 4PJGB 3WFHA 2FD6H 2HMID 4OUUA 3SQOL 4K3JL 1A21A 5HHNB 2X9XA 1X5JA 2GIYA 4LLUB 4I0KA 4JN1H 2VC2L 5GGRA 3HUJB 5I1IH 1FVCB 3KJ6H 4EN3D 4Y4HD 3MGOA 1F4YL 1PZ5B 2CLVB 5ID1B 3VE0A 5ANMA 3VXSB 3R1GL 1WCBA 1NC4D 1HXMB 2CMRL 2PTTA 1CIUA 4MYWB 3ARGD 3ROLB 32C2A 3LB6C 3BDYH 4NPYB 5A16A 4WY7L 1ZT4B 4LPVA 3UP1A 1A3LL 1JHLL 4G7VL 4RWHA 3OKLB 3MRCB 4AM0A 5EBWB 5HXMA 2K9UA 2E7MA 3ARDB 4GSDH 5E1AA 3WN5C 5DXWA 2VZ1A 4HPOL 4DW2H 4JRYE 5FM4A 3FB8A 3GRWH 4JG0L 4OCWH 4XBEH 4QEGA 3EGSB 1TJGH 4YBHA 1J05A 5EDXA 2FHCA 1EFXB 5I6XC 3O3AB 1S9KC 2X1XR 4YAQA 5I1DA 3SKOB 3TZVB 4J23A 2ZG3A 2OQJA 4P23D 5JHDE 2E7LE 4OF7A 1A6ZA 1A4JA 2XFXA 4Y2DB 4JFFE 3K8LA 2VXUH 2D4FA 1UYWH 5CUSL 3O9WC 3WD5H 3BP4A 1WAAE 2FJGA 4PP8C 5GRJH 1J11A 3C5JA 5CGMA 4PJ7E 4IHOA 1DBMH 2CD0A 2VE6B 4XNZB 3OAUL 1CGXA 3KPSB 4O51A 1RIVH 1WIOA 1JNLL 1ORSA 3RZCB 4XTRC 1IC4H 3CLFH 1IEBA 4JPKH 2F58H 2P46B 4LLWB 3BD5A 5E6IB 2WQRA 4F9LA 3DUUB 3WUWA 4WW2F 1KACB 3MQIA 3SPVB 3ZE0F 1W72L 2I25N 4WU5A 5GJSH 4M61A 1SYSB 1A6VL 5FYLD 1K4CA 4U6XB 1A7RH 3IVKA 2VR9A 1T04B 4LU5H 4X4MA 1ZTXH 3MLVH 5BS0E 1U8OA 2F8OA 1YMMB 1Q1JL 5HGHA 4NJAL 4MXWH 4CVXB 1G0YR 2ORBL 3BZEA 1H3XA 3MRLB 2DQEH 3O2VH 3GJFH 3ARQA 1OLLA 1VFUA 5C0CD 3GMRB 4LAQH 1VGEL 4XPFL 4HUMB 2WIIA 4FABH 4PJGF 4BZ1L 2MMXA 4APQA 5E9DE 4N1CA 4MLIA 1T83A 3HUJF 3EW3B 1MOEA 2MPAH 4ZS6C 1BWWA 1MWAA 3IKCB 4QRPA 5E8DL 4LIQL 1CE6A 1CFVH 5IBTL 3UTZA 1CDCA 2I07B 4BH8A 5DS8A 2YR3A 1MVUB 1R24B 4D0DB 4WENB 2VO5A 4YHYB 5D8JH 1ZANH 1UJTA 1LEKA 1P1ZA 5CKGA 2PNDA 1PLGL 4PJHF 3OXSA 3P73A 4HUUA 2V6HA 2ERJB 3RIFF 1QZ1A 3LPWA 3T1FB 2LAGB 1HHIA 3KPQA 1RPQA 2XZCL 3K0WA 4Q2ZB 2VITB 3PHQA 1KN2L 2ZCLH 3EYSL 3PWPB 3KXFD 4IRSB 2HJLA 3ARXA 3MLZH 5DA0B 5I19L 5I66A 4RGNC 1T22B 2W0FA 5DC0A 5TE6H 4QLRA 4MAUH 1DUYA 1T03H 2R0ZH 3RVUC 5SX5K 4BH7A 5E8OA 1SBBA 1ZAGA 5C0AD 2Y6SD 1GZQA 3X3FL 3S5LB 1UEMA 4NBZB 3G6AB 3WLBA 3T0EC 3MX0A 2X9WA 2ZNWA 5KG9B 1N64L 4LCWA 4NN7B 2CO7B 4HCRH 2V2TA 2CJUL 1NGYA 4P3CH 3DURB 1LMKA 4LF3B 2JJSA 4RGOL 5KS9E 3QCTH 4ENEC 1JPSL 3U0WL 4JFDE 1YN6A 2XA3A 5JOPD 1N6VA 4HLZH 4PJ9D 4OF5A 4WUUD 5I1EL 2UVFA 1XH3B 3THML 4I3GA 3FCTA 3HCVA 5HDLA 1PYWB 2AXHA 4TTGA 1WBZA 3TT1L 5IHZA 1QKZL 4QTIH 3SDCB 4ALAH 1U93A 3C5SB 1BQSA 2EYTB 1LEIB 4JM2C 1JF5A 1RUPH 5GS0C 5MEOB 5FUOH 1OGAE 1A6WH 3MBEA 4P2YA 3DXAD 3GBML 3D3VD 1Q38A 1A64A 2QTEA 5D7LA 3V52L 4MA1C 5IEHB 5L2KB 1BBJB 2HT3D 1MCDA 3NPZB 4NKOA 2H8PB 2WWKT 1GGBL 3PV6A 1S7QA 4PJCE 2I9LA 3MRIA 3AAZA 3TYGL 4XCNA 3V0WH 4EVNA 4JG1H 1LWRA 2QV2A 4N0UB 4Q58C 2F53D 5IB4A 1KN4L 2D31A 4L3EA 4MAYB 3WKML 4X9BA 4I9WE 1MFCL 4XGZB 2YPLA 1BD2B 1GVIA 3D0LA 3O6FC 2GJ6A 4RGNE 3WNOA 2AP2A 4RFOH 4WI9A 4BK5A 2NXYC 3BWAB 3AREB 5BZDB 2YPKA 4D0BA 4JFEE 4MNGB 3QUYB 3SJVA 1E28A 4N8VB 3CMOH 4ZXBD 1NGPH 3KPTA 3WJLA 4X6BB 5KSBA 1W0WA 5TDPA 3FO0L 3OKEA 5FM5M 3QXWA 4KH2A 1U92B 4OZIE 3KGRA 2P45B 3H3PL 4R2GC 4ESKA 4NWTL 1P4IH 5E2TL 3T0EE 2CK0H 5K9KA 1YDPA 1OAZL 2X70A 3SKMB 3WE6B 4DAGL 2AV7B 5F3BB 1NMCB 2EC9T 3P77A 4X5XA 4U6XA 5IV2B 1TCMA 4C56B 1DBJH 2EECA 4ZG1A 1P4BL 2Z92A 1IGMH 1ZHKA 1AR2A 4B5EA 1MI5B 2M1KA 3REWB 3VDCA 8FABA 1WFUA 3PE9A 1Q94B 1ZHNB 2NX5B 2VDML 3PP4L 1KCLA 1A7QH 4NQED 3KPLB 3VXOB 4Z76B 1Q9LB 1TXKA 1GYAA 3WUZA 4LARL 3U4AA 1BAFH 4U0QB 4U1JB 4OLYH 4Z95H 1MEXH 3RWJB 1ZLWK 2HWZL 3K4ZA 1S3KH 3ARTA 3CFKB 1UXWA 2PO6C 4DGVL 3NN8A 1IGCL 5FYJH 3H42L 5CMAA 5C9KA 2D0GA 3MROB 4Z7NF 5B8CB 4JO3H 2B0SL 1FVDB 4G8FA 4YHKL 4CGTA 3U82B 4KZEL 5IKCA 1T2XA 4IIQB 3FOMA 4LOUC 5C0DB 1A6TB 2X5PA 1KCRL 1XIWD 4DGYL 1PEZA 5FOBA 3JXAA 2IALB 2FJFB 3Q6FA 5HDOA 5TF1H 1XGUA 4OLWL 1T0MA 5DHVA 5JA8B 1JUFB 2BNUA 5F6HJ 3MRGB 3UTSE 5F7YC 1RFDH 3F7VB 1NFIA 3NFPA 4KQ4L 3UTTD 4QRRB 5T1DH 3JWOH 3EYOB 3GIVB 4Z77A 3JTTB 3ESVF 4P2CG 4U0RC 1BECA 1OAXH 1MJ8L 1T22A 3HLAB 2XQYK 1YUHA 1JVKA 4HMEA 4NNXB 3HZVB 5IJVA 1I4FA 4LHJB 1S5IL 4Y0GA 2BHUA 1A9BB 3GHBL 3S5LA 3ULVD 3F7PC 2NY4B 1N5AB 2J6EA 2ZP0T 3C9NB 1HNFA 4TUJA 4XNMA 2A73B 2AJUH 3ZKSD 2JCCA 1ZV5A 4K3JH 3SQOH 4UQ3A 4BFGA 4NKDB 5DJ6B 2C4FT 4GW5A 2Q76A 2VDLL 1ZHLB 4KRLB 4J3XA 4MD0A 3DV6B 3VXMA 1YPZB 2W9EH 1MFEL 3R1GH 2FEDC 5MEND 2J8UA 4K94L 4CW1B 2CMRH 4P2QE 4O2FB 5DUML 3DX8B 5ITFB 1B90A 1B0RA 2WBJB 1A3LH 1NANH 1Z2KA 4KKBC 5F9WB 4Y16B 3QULB 4HGKC 3B8SA 5I1CL 4HS6A 2R2HA 4ZS7L 3KLAB 4KY1L 3S96A 5I9QB 1T7ZA 4X6DE 5EU4B 3G04B 5EU3B 3O4LA 3V0VB 4FMFA 1HINL 3DYOA 3STBA 3VD3A 3IT8D 1VFAB 5BOZG 4F7EB 4KJWD 4PLOB 1CXHA 3RGVB 3WKNA 1B6DA 4G6AC 5DO2D 1KGCE 2P42B 1FCCA 2CRMA 3DVNB 2OI9A 2X05A 4MAYA 3STLA 1EVUA 4BUGA 3IJHA 4EDWL 3WL9A 4YHZH 3WYRA 5CHNB 4I2XB 4GKSA 2NY3C 1JNLH 4R0LB 4OCLC 3S37L 5DMKA 4LVEA 1U92A 2ZPKH 1DEEB 2OL3B 4P2RD 4UNUA 5D1ZD 4YR6B 2VXQL 1CFQB 3ME0A 2D7NA 2ED7A 3ARFB 5HYSB 3LHPL 4Y5VC 1F8TL 3LQAC 1W72H 1NBVL 1A6VH 5EN2A 3OPZH 5FKPA 3RU8H 2VQTA 2PYEB 2GUOA 4IOIA 3NACH 3HPJB 5EO1B 3HHRB 1TNNA 1N26A 4NJAH 1PD6A 3S4SG 2AV1A 2ORBH 2OR7A 4AT6B 4OGXL 4R9HA 4YFEA 1XF1A 1ORQA 1U3HB 5EO9A 4MA3B 1VGEH 4XPFH 4LSQL 4RGMC 4GRWE 4V1DE 5CEZE 3L5HA 4BZ1H 5GZOC 3ZTNL 1KPUB 4P5TD 2G5BB 4KZDL 3K74B 3L5WA 3PJSB 4UT6H 2XTJD 2OTWB 4JRXB 1MCNA 3N1PC 4PLJC 1ETZB 5EU6A 1YPZF 5E8DH 2JELL 4I1NB 4LIQH 4K7PX 1P7QD 5IBTH 5D5MA 3TV3L 2XOTA 1YNKL 5SWZD 2Z91B 5C0DA 3TP4A 4JHBA 1B4RA 2C1OA 3GSOA 3KYOA 3QWOB 5GGTL 2MCG1 3V7MA 4FXKB 1PLGH 4LCYB 2FJFA 1TIUA 4YEFA 1CZ8L 5F44A 4ORGB 1JUFA 2X89A 3WFDL 4WGVB 1EAJA 4UIMB 3FFCB 4PJIB 5J57B 4G43B 5D2NB 5ACZA 3O11B 3FQUA 2CIKA 2XQYG 3MR9A 3L3HB 3WIFA 4Z8FL 4Y4KC 1DQMH 1Q0YH 2G2RA 5D7JD 1R3KB 1CGSL 1WEJL 3SGKC 5I19H 3LKSA 4XVSL 3DMMB 3EYVA 4XXCA 2YWYA 3I85A 2EH7L 3J7HA 3PQYB 3K2MC 3V5KA 3C6SB 1I7RB 3TPUE 4JFXA 3IETA 1AR1C 3MREB 4E41B 4EN3A 2HKFH 1JPFB 4QWWC 4LASL 1PG7W 1D5MB 2P5EE 3HC4L 4N68A 1EBAA 4JKWA 1N64H 4PRHB 3X12A 2CJUH 2CH8A 3H9HB 1F42A 3TYFB 4WI3A 1OCWH 3MV7A 3FT3A 2H3NA 4YNYB 3BUYB 4D9QD 3IDXL 4IMKA 4WVRA 1TZHA 5C9JB 5JXED 2IH1B 4PRBB 5F9JB 4FQXB 3U0WH 1LO0L 4GW1B 4O2FA 1DE4B 1YEIL 4YDIH 5KZCB 4MQ7B 5I1EH 1OAUL 2ARJB 1KCUL 1LK2A 4W6WB 4NQUA 3GM8A 3THMH 3FO1A 4IRZH 3M8OL 3HZYB 5A3ID 5FHAH 1KJ3L 2W38A 3TT1H 4L4TD 1VFBB 5JR1L 4PJEB 5E8PB 1QKZH 2EDTA 1Q9WB 2H45A 2V2WA 3SDXF 2BZDA 2CDGB 4HHAA 3CFJB 2OTUB 4ELME 4KRPB 4WWKB 5FYKD 4UBDD 4AYFA 3V52H 4EBQL 4MCYA 1FSKC 4F7EA 4TNWF 1IAKB 1BQLH 5IVZB 3ARDD 3GBNL 2X1OA 3D69A 2A77L 4JVPA 3MRJA 4OFIA 1FH5L 1WBXB 3L5IA 3TT3L 3CNKA 2EZ0D 2G75A 3MRHA 4JLRB 1IFHL 2GSGB 4ZSOA 4G6FB 3D85A 2WLYA 3ZL4L 1IMHC 5DC9B 3WKMH 4KMTL 3FN0L 1PKQE 5C07E 4GLRI 3TZVD 1MFCH 1R3HA 3FT2B 2OLDA 4RIRA 4LLMA 4Y2DD 5T33L 1JZ7A 4P49A 3W0WE 3MRDA 3OZ9L 4KC3B 2FH8A 1DEEA 2JIXB 4G9DA 1JZ3A 3KLHC 3BXNB 1R3JA 3FO0H 4G6ML 5FF6B 4XPHL 1DBKL 3E3QA 2FBJH 4GXVL 1MY5A 1BLNB 3KPSD 1FZJB 1A1MB 4NWTH 4JQXA 5E2TH 4K3DL 2VERN 3NPSB 4DAGH 4OAWB 3NCCB 3RZCD 1OTUC 3UJTL 5T5NF 4P59L 3GSNL 2CRZA 4WFHD 1P4BH 2YEZB 1IGYA 1NQBA 3HRPA 5E6ID 3U36B 1WQVT 3BGAA 1UCBH 4NDMB 3Q48A 4TTDD 5BZWA 4UUJA 2IMNA 3FB6B 1F3DJ 2VDMH 4TSCL 3PP4H 1JGUL 4PTUB 3B9EA 4XP6H 4WO4B 3EO0A 5ITBL 1WV7T 1HYSD 1DQQA 4D9RE 3RQ3A 3TVMA 1ZT7A 2AJSH 3MACH 2VL5A 3T2QA 4PV9B 1B3JA 1YMMD 2KKQA 3X11A 2EDNA 5GGUB 4MWFA 3V7AG 4XX1G 1A22B 2HWZH 3O4OB 3D87B 2MWCA 5DRXA 4DGVH 5IVXB 2X41A 1IGCH 4W70A 4ZD3L 4P0DA 1AHWB 1AP2B 5F7FA 2B0SH 4YHKH 2PYFB 3QWOA 4KXZI 3UAJC 2ZSVB 4KZEH 1ZHBA 1X5XA 3QDHA 4L4VA 3BHBB 4S1DC 1N6QH 4NC0B 5EUOE 4H88H 2V7NB 3F58L 3RJQB 3OTTA 2QADB 3PWVA 3U0PA 4PREB 1KCRH 1CU4L 3GSUB 4DGYH 1QLRB 4XCEA 3L95B 3MJ6A 4U31A 1N4XH 3U1SL 2X7LA 2NXZB 4LQFH 4PRIE 4FG6C 2NNAB 3FONA 5JNYB 4MHHI 3X3GL 3RWHB 5CWSA 1R3KA 4M7KL 4C83A 5CZXD 2NY2D 3BT2L 2AKRB 3IDYC 4MJIB 2AEWA 1QQDA 4ELKB 3SDYH 1NGXA 4F33B 3SO3C 1IM3B 4PJFA 3ZKMD 4F3FB 3MREA 3OJMB 5CEYA 5T3XL 2B5IB 3SOBL 2D7OA 4FFVC 2NYYD 3GHBH 5H2BB 5C0BA 3PWPD 4IRSD 4FTVE 5ESQB 4ONGL 4OZHB 2UYLB 4GRLC 3GEWB 4XHJD 2BOBA 1FIEA 4O4YL 4GQPH 4GLRH 3QDMD 3H9HA 5C0FB 2ADIA 2RFXA 4JDVB 2O5ZL 4PJ9A 3LSOB 4M3JA 1JP5A 5I18L 3KLSA 2EIEA 3TLRA 3GMPB 4ONHA 3RTQA 4ODHL 3VFVB 3DETC 4JANA 4OZFA 3DUHA 1HEZA 1IKNA 4HWEL 1MFEH 1EGJL 5DK0B 4K94H 1S8DA 4ODBD 1XF3A 3GSVA 1HH6B 3ZSSA 1E4KA 5ID0B 2D7PA 1JIBA 1IAIH 2C7UB 1FYTB 5D6CA 5EFIA 3QI9B 4YO0B 1ZLVK 1MELA 2BNRB 3UJIL 1F00I 1NEUA 4APQC 1R3LB 1XT5A 4FFWC 4Z7WB 5I1CH 4PGBA 5C0IA 1HYRC 4EUPA 1OSZB 4K7FB 4KY1H 1ZVSA 2F53A 3QEQD 3LQMA 3CX2A 3DJ9A 5L2JA 3REVB 4X7TB 4QRSA 3VRLE 1G7IB 1FQ9C 3HZKB 4PJAA 3FMGL 2Q8AH 3G6JF 4JLRA 3EJJX 5GIRB 4GG8B 1SEQL 2A38A 2CKBL 5I17A 4L8SA 5DTFB 3BPLB 5CSBA 4AEIL 5L2KD 5IVXF 1WGOA 3P4OA 4LMQE 5FYJU 3VXTA 4NO5B 3GSNB 3OHXA 4WDIA 4EDWH 3LDBB 5FUZL 1L7TL 2Q87A 2F74A 3OJ2C 3UBXA 1TNMA 3LS4L 4GKNA 3HAEB 3Q1SL 3TA3B 1FAIL 3S37H 1VA9A 3DPBA 5JORA 2IBBA 4J6RL 3O8XC 1KLGB 1NEZG 1JPTH 1A1MA 4ZPTB 1C12B 1BD2D 2APXA 3LHPH 5T1KB 3EOBB 1N2RA 5J12C 5AYQA 3BP6A 4TYUA 2WUBH 3ARED 4JM4L 1AGDA 1NFDE 3QUYD 5JW3H 3CIQA 5I8EB 1BOYA 3W81A 3S88L 1RJYB 2HYMA 5FOJA 1V3KA 4FOMA 5IJKA 1T89A 5E99L 3ET9F 4G7YL 3RVXC 1DDHB 4UILL 1C5CL 3MCKA 5KANI 1RIHL 2Y1VA 4UB0L 3W5MA 3QFJD 4JPWL 1AE6H 4OGXH 1DVFA 3QO1B 4OZHF 4C56D 3V4PL 1UZ6F 1CQYA 4RWYH 2BK8A 4LSQH 5IIEB 4NFCA 4C59B 1AD0A 1OTTD 3D2UA 5I1LA 1UWXH 1Y18A 3ZTNH 3VXRE 1MI5D 3I6KA 4WFED 2BVYA 1P7KB 2NX5D 2X4UA 2QJDA 1I1FB 3NH7H 1MCKA 3GO1L 4WFGE 2JELH 1REIA 2PYFA 1X6NA 3MBEC 5HD8C 4WV1B 3TV3H 4KKAD 1KB5A 3H2WA 4OT1H 3QFDB 1YNKH 5T1MB 2ESVA 1NAKL 5GGRY 4NO3A 1M71B 3GSUA 4DUWA 1CT8A 5IQ9B 4X98B 2GAZB 4I0PA 1CZ8H 3BPCB 2BXYA 5CBAB 2R2BA 3WFDH 1H15A 5T3ZE 4L8CB 5KW9H 1N0LA 2BSRB 1TPXB 3LV3A 1LP9F 4FRWA 4BSVA 2E7BA 4URTB 4QT5B 2FRGP 1QFWH 5IB5B 2VR4A 1KSRA 5I74C 1CGSH 3D18B 2FB4L 4QHUA 1IL1A 3WXVL 4HKXB 3PP3H 4XVSH 3GUTB 5L0QC 4QNPF 2EH7H 3O3DB 4DJMA 3EOAA 5DUBA 5F88A 5HVGB 3WJLC 1EMTL 5IT2H 2IMMA 4X6FB 5EUKB 4QRRD 5ESQA 4Q9RL 4ODVL 1I8MA 1IT9L 3CFBA 1GJIA 4DEPC 1GZPB 2A9ML 1L7IH 4LASH 1MCBA 1H3PL 1MPAH 2ZOKB 1YNLH 2BCKB 4XHQA 2XWJA 4FQQB 4PJXF 2FCBA 1WCQA 2IADA 4L8DA 1A6PA 3GRWA 4Z5RA 5HHXL 5TE4H 1N8ZB 4NT6B 2V2XB 3SDDA 2MKLC 2NY4D 3IDXH 4X8JB 1Y6NR 4RMRA 1LO0H 4NQCB 1YY9D 1YEIH 4XCFL 4OZGF 1KTLA 1OAUH 1VEMA 4MSWA 3B9KC 5DYOA 2CKBB 1NCDH 2VKXA 4TPRH 1KJ3H 3BRGC 4LPXA 4HUXB 2P8PB 5J56B 1R3LA 3JV6B 5JR1H 1HNGA 1CDYA 3LKQA 2XKNB 4Z9KB 3BPNC 1C7SA 4CVWA 4YHNA 2Y7QB 1CK0L 2WBJD 4LVHC 4G9FA 5JO5A 1FYHB 5D7LE 4M02A 1LQVA 3T3PF 2W1NA 2W9DL 4FXLA 5JQ6L 1QG3A 1JI2A 1LDPL 3FQXB 5EOCL 3GBNH 3MNZA 4EJ1C 2IAMD 5SX4I 4PR5A 2A77H 4GQ9H 1FH5H 5DQJB 5FDYA 1WZKA 3UEZA 1FFPB 5DD3L 2V9QA 1BEYL 3TNNA 3VRIB 3GMOA 3U9UB 3ZL4H 1G9NL 2VDQL 1YJDC 5H8DA 1CVSC 4KMTH 4KV5E 3EO1B 4LKCB 3BOVA 3RGVD 4H5SB 2YPLE 5T33H 3DI2B 1S9WB 3GMQB 3OZ9H 3D39B 3EFFB 4NQXB 5AG9A 2NTFB 1EHLH 3GJFA 3SJVE 4X99A 5HI5C 5KSBE 4G6MH 5E2UL 1IRAY 4XPHH 4RCAA 1DBKH 1R3IL 2YMXL 5T1KA 1KEGH 1S7WA 2IH3A 3X14B 2IG2L 4N0CA 3QDGA 5I73B 1EZVY 1HXYA 3CMGA 4X7EC 2EYSB 4K3DH 4S11A 2WW8A 4LSRH 4PJBB 1JTOA 4ODXA 2LQRA 4XXDA 4LSSL 4P59H 4G6JH 5E03A 3GSNH 3DVGB 2HN7B 4XMPL 4LPTA 5E2WL 3ARFD 3IDGA 5B39B 4P5TA 4F37F 1V7ML 3HAEH 2EXYD 4FHBD 5AYUL 4K3EL 2CRIA 2VUOA 4M7LL 3C8KA 3EJZC 2JLLA 3M17A 5AZEL 4HG4K 3IB4A 2B1HL 3LKPA 3NCMA 1JGUH 3BRFA 1URLA 5ITBH 3PL6A 3WUWG 1P7QA 3ZKND 1J9CT 1AGEB 4JHWH 4YWGH 2PYED 4KMQA 5K59F 4U1GB 4IRJB 2BVEA 1WC7A 1KB9J 1IEAA 2ENSA 2X4RB 1Q8MA 5HYJB 2I5YH 4NRZB 2E8YA 4LHUA 1FCGA 1A5FL 4R7NB 5KSAD 4XBPA 3SGDH 4AZ8A 3OKNB 4HIIA 4ORZC 4I3RL 4ZD3H 1U3HD 2BXZA 4JAMB 4LCCA 1G7MB 2Q86A 4M93C 5T1MA 1I3VA 4H26B 3WS3B 3GKWH 1R5IB 3V8CA 3CVHL 5A2IH 5JDSB 3P9MB 5T1LB 5D7JA 5EBLB 4JRXD 4NKIL 3F58H 4ZFGL 1OWWA 2OMNA 3S36H 3M1BB 4ZPVB 1FZKB 4JB9L 4HCRA 3LEXA 4WW2A 2JJTC 2BMKA 3X3GH 5E5MB 3BP5A 1EX0A 1HCVA 4M7KH 4LRIA 3I6GB 5KVMC 1RJZB 3EZ8A 1QTYT 2XXMB 1NDMA 4L29A 3FFCD 3RFZC 5SX4H 1YNTB 4X6FA 4HIHB 3O3BB 3VWJB 5F1IA 5T3XH 3CDGA 2BJML 5DJZB 3PABB 4K2UH 1RUKL 2W0KA 5C09A 2DM2A 3HI5H 7FABH 1A7BA 4ONGH 1MJ7H 1JPST 4CN4A 3GMMA 1WTGT 1S78D 4WIQA 3TN0A 1WZMA 3DMMD 5DK2B 3GB7B 5HJ3A 4BSWB 2GK0B 4O4YH 2P5WD 4AG4L 3D9AH 5I18H 2VZTA 2JCCE 5ISZE 3V5HA 4DZ8A 1JFQL 4KI5F 4HG4J 4E41D 2XWBB 3VG0H 4GAYB 5BRZB 4PGCB 3S3SA 1MCRA 1RZGA 4HWEH 4NNYA 3U83A 1DN0B 4PRHD 5DRZB 2J8UE 3HFMH 5DSCB 5FB8B 3TNMA 5J89A 3R4DA 4PJBF 2HVKA 1KLUB 4PJHA 3JV6A 4NRXB 2O61A 5GS1A 5L9DL 3ROOA 1ZE3C 1DLFL 3IU4L 3INUL 2H41A 3PUCA 3UJIH 3WO4C 4FQXD 1OLZA 5EU5B 5DT1L 3SKUD 1G7QB 2R2EB 5DFWH 3FN9A 1QD0A 1HHJA 3KPPB 3VWKA 1E4XI 3BO8A 4XNXH 2FECL 3VDAA 1HHKB 2IWGA 3F65A 2D7TL 4HWBA 4X7CC 3MRMA 2C3GA 4PY8I 1J5OL 4NCDA 3O4LE 1NJ9A 4TNVF 5ICXB 5DVKA 5L6YL 1LVEA 4K8RL 1JNNH 4XNYL 3BPOC 3LRSB 2JF1A 4FP8L 3PHOA 3BZFA 4KI1A 3BMVA 3VRIA 1SEQH 4KRPD 1G7HB 2B4CL 2CKBH 2WIMA 3QPQD 3T08A 1KTDA 4U7KA 4XPBL 1VEOA 3VFOB 4WNQB 2WINB 1FL3B 3IFNL 4NO0B 5E2VH 2OX5A 2NW2A 1CXFA 4CKVX 5FUZH 2G9HB 3QCVL 1QACA 2PTVA 1T7VA 5EIVA 4XP9H 4PV8A 3LS4H 3FQNA 3VGAB 4M3KB 3OJDB 1CLCA 5KAQF 2HT4C 3L3JA 3Q1SH 4TOYL 2ADGA 3LN5A 1CFBA 4J6RH 1BGXL 4XXCC 4JGMA 4G6KL 1BFOB 3JTSB 2HMIC 2DQGH 4JE4B 3T04D 4IOFC 5I8CB 4KJYB 1OAYL 1XF5A 4LSVL 1XZ0B 3E0GA 4WEBL 5EZJA 1CLOL 4OZ4B 4N0FA 3EYFA 4EN3C 4R4FL 2YD6A 3CXHK 3QG6B 4KUZL 4JM4H 4NRYA 2DLHA 4ACPA 2JIXD 1VCAA 2GK2A 1YEHL 1X4XA 1NL0L 3A6BL 3RWGA 3ARGC 4FXGB 3BVNA 1TLKA 2HG5B 5E99H 4AIXA 4G7YH 3RWDA 2DQIL 1D7FA 1T21B 4UILH 1C5CH 4JQVA 2XKUA 4JDZB 4IMKC 1E6OL 1DANT 3CVHB 4JPWH 3MOAL 2DTML 1H0DB 4BFBD 4JR9L 1AGEA 4A6YL 5DQDH 1FG9C 5C6WH 4EZMA 4J8RB 1S7VB 5HYQA 5HYJA 3R06B 3DV4B 5TH2A 4U6VH 2QSVA 1XR9B 4GUPA 1F97A 4P23C 4KROC 5DRNB 4WO4D 3MLUH 4KMLB 3LOWA 5SWSB 1N5YL 3ARUA 1S9YA 5D5ME 4ZUWB 1JFMA 1RY7B 3RY5A 2MHAB 5DVLA 3P9MA 2B7DT 1MHEA 1NAKH 1CFTB 3VXQA 4M48L 4O02H 4X6CF 5IK3A 5INCB 4HFUL 1MRFL 3BMWA 2HJFB 4HMDA 2ILLA 5IBLD 3NZ8B 5DJYA 4YPJA 4H0HB 1X9QA 1MLCB 4DCQA 1CBVL 1AXSB 5ESVB 5EBGA 1HDMA 4MNQA 4AQ1B 5HVHC 4QYOB 2BHZA 4PJ8A 5E7BA 2X4OB 1A14L 2X4PA 1A6AB 1YY8B 4PYHA 2CIIB 2FB4H 3WXVH 1CFNB 1FZMB 4XNQA 4H8WH 3I2CL 4U3CA 2NW3A 4M7ZC 4XWOD 3QDMA 4NHUB 3HS0B 4QF1B 3RVTC 3VWJA 1KCKA 3CXHJ 1NDGB 1EMTH 2EEAA 1JNHB 4Q9RH 2EKJA 4ODVH 1IT9H 2DOCA 2C3VA 2A9MH 1KIPA 1U58A 4MJID 4M4PA 1SJEA 2H1PL 1H3PH 1INEL 5CSZB 3VU2A 4P2OA 3V6ZB 2AK4D 2C3XA 4HV8A 5C0JB 3GI9H 5HHXH 3VGHA 5FDWB 1TVBA 1F13A 3DNKA 1CXEA 1QEWA 3ZDXE 1RK0A 1MFDL 4HWZA 4XH2A 2GTWB 3S5LG 3GK8L 3CZFB 1TMCB 1XMWA 2E6QA 4ZFZA 4XCFH 1G9EA 4UOW1 4JFQB 5J11C 1VENA 2ADFL 4UT7L 4AH2B 2ICEA 3CCHA 2YXFA 4GXUM 4RBPK 5I16B 1JHTA 1AKJB 4XVUC 5H35A 4DOHE 5HYIA 5GHWL 3UTOA 2KUTA 1N7ML 1E27A 3VFGL 5DLML 2ICCA 43CAB 2E6JA 1CK0H 3E6FB 4YK4C 2PW1A 4PRPB 1ZGLP 1UVQA 1T66D 2VRAA 2Z31A 5DRWB 1QLEH 4ZOCA 3UPAA 3K4DA 3KYMA 5FCUL 5C0GB 1FYTD 2EDWA 3QI9D 2LVEA 5JQ6H 2BNRD 5DD0L 2DB8A 4WI2A 1LDPH 5DWUL 5EOCH 1FPTL 5D9SA 1KPRB 2OJEA 1XF4A 2BVPA 5EC1A 2HRPL 4AIOA 1RAMA 5DD3H 1YMHB 3QIBA 5EZLB 1W72A 4WEMB 1N59A 4GS7C 1M05B 1WZLA 1T5WB 5ENWA 1Z3GH 2PUQT 1G9NH 4U1IB 2CR3A 4PJ5A 1U8KA 1UWEL 2VDQH 4WHYG 5GRVK 5IMMB 4IM8A 2ZUQB 5DR5L 2BSSB 3N1MC 3IFOB 3LAFA 1BVLA 4CN6A 2Y6SC 4R4ND 4P9HC 2LVCA 5E2UH 2XACC 2ZUUA 3RNKB 4A6YB 2AJ3A 2EDHA 1FV1A 5TE7H 1DP0A 1CD0A 4HEME 4K3HA 3FHAA 2JJWA 2CK2A 4ETYA 3QFJA 2BSTB 5D7IF 1NUNB 4M6OL 1DUZA 3DO7B 5DVOA 4H25B 4LSSH 4OGYL 1IAMA 4PJDF 3VFUB 4PJ9C 2DYPD 3AM8C 4HF5L 2FECI 4HPYL 5KSUA 1V7MH 4DZBA 3RTQC 5AYUH 4F2MA 3B2UD 3CPLB 5TFSL 2PW2A 1F4WH 4IJ3C 5DD1L 3KPNB 4LP4A 4M7LH 3U0TB 1DBAL 2B1HH 1KJMB 2D7QA 4DTGH 1OF2B 2AQ1A 4OGAD 5ALCL 4JCLA 4TUOA 3LEYL 1GGTA 3WHXB 1E4KC 3IDIA 4LFHD 3H9SB 3MSPA 1PQZA 2RCSL 3QRGL 5HBBA 4PRDB 1UT9A 5CD3B 1VACB 2UWEB 2A6JB 1A5FH 2DJSA 5D1QB 3T4YB 3IRZA 1RVFH 4RQQB 1ES0B 4I3RH 1I3GH 1LO4L 4ZDHB 1RV6X 1KIRB 5MI0B 5HGBB 4E42B 5ABDE 5B21A 2MJWA 3SBWA 2VABA 4FZ8L 4RZCA 2WMPA 2X4QA 3KXFE 3JZ7A 4POZC 1OAKL 4ZFGH 1CQKA 1Q9KA 1WJ3A 3FFDA 1WTLA 1I8IB 2J2ZA 5FK9B 4EI5B 3U2SA 8CGTA 5EOQL 1FN4B 4YZFF 3BEVA 3QUML 4L8SC 5K33A 3RPIA 1IILE 4AEFA 1C5DB 2HTLD 5T3XD 3C5ZB 4XVJL 5BXFA 5C0AE 4P46B 4MQTB 3VFTA 3IJYA 1WK0A 2Z4QB 1F45A 12E8H 3BYTA 4JRYB 4PJFE 3BIAX 5F7WC 5BV7L 2BJMH 3CJJA 4MDIB 2AS5M 4P5MB 1RUKH 5A2FA 5C0BE 3ULUL 2K7PA 2XICA 3K8KA 2X4NA 1N0XL 3V6ZA 2VXTL 3K1KC 5JHDB 1KJ2L 4B41A 5JOPE 4AG4H 1HKLH 4HS3A 2ZSWA 4WUUE 4JFFB 2AW2A 5HHMA 5J9PB 1JFQH 4S1RL 3LH2L 1JWMA 2VAAA 3E6HB 1T89C 4G8IA 1GH7A 1TMCA 5F21B 4FQHB 3P3YA 3MO1A 3L7EB 4P4KB 1S9XB 2MOVA 1FE8L 4AH2A 5DDHB 1DVFC 3DXAE 2R39A 2R4SL 2CUMA 3D3VE 3QWRD 1FL5A 1DZBA 4C4KO 3QNXB 3GSRB 5I16A 2W60B 1I8LA 2R0LL 5L9DH 3IU4H 2IAMA 4NQSA 2HFFB 6FABL 4QCIA 3OG6B 4NQCD 4QGTA 1SJXA 1TQBB 4AL8L 5BVJA 4ISVA 1EV2E 1X5ZA 1AGFA 1RZJL 2D7TH 1XIWC 1H5BA 3AMKA 2P1YA 4LBEA 1YEKH 3O2WH 2F53E 1MREL 3U7AA 1J5OH 2VXVH 4Q6YA 3UYPA 4XNYH 1TVHB 1F4AA 1A9EA 1C08A 4FP8H 4PJAE 4ZUVA 3MFFA 5BS0B 2Z9TA 4DVRL 1EIBA 4Z7QF 4XPBH 3A67L 4I0PC 4I5BA 4ZNEA 4BQ9A 2X4TB 4DWHA 3VFPA 2BSSA 4QHLB 4ERSL 3IFNH 2JE8A 1Z5LA 1MCIA 3QCVH 5DMIL 4CJ1A 1KPVB 3U79A 3LN4A 3L9RB 3ZTJH 3SY0A 5E9DB 4UTBH 3JV4A 5TJWK 3I9GL 2EO1A 1CDHA 1OQOA 4F7TA 4TOYH 4ODWA 1KULA 1RK1A 4G6KH 3OR7A 4YPGA 4KFZC 7CGTA 4C55A 3BDXA 1ZEAL 4LSVH 4WEBH 5AUMB 1WVZA 1NBQA 3A6CL 5I6XB 1CLOH 1TZIA 4MNHB 4ZTOL 2OR9L 4KI5D 4KUZH 3D39D 2OXGA 4FZEL 1UJ3B 3Q3GA 3VFUA 1YEHH 4NZUL 4LAJH 5KOVC 3O9WB 4NQEE 3QDJA 4XNUL 3FO2A 3SDXA 3WJJA 2DQIH 1U3ZA 1AIFA 1QR1B 3TIDA 1E6OH 5HYSG 5KSAA 1CXLA 3QQ9D 3MOAH 2DTMH 2PCPB 2IANA