5E6IC

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
258
Chain Sequence
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWDTELVETRPAGDGTFQKWAAVVVPSTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
total genus 38
structure length 258
sequence length 273
chains with identical sequence I, M, R
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e6iC01
1CDGA 1OT2A 3JWDC 1OAKH 2YRZA 5C08D 4LVNB 4K3DH 4F7CA 3NCFB 1DLHA 1OCWL 5D2NE 1HXMA 2O93L 3MZTA 3LS5L 3BKJL 2AERT 4PFEA 3RVWD 3VFPA 3VFTA 5D1ZA 2UUDK 4B41A 1Z0MA 3EJZC 2VR9A 3HG1D 1RZJH 3S5LG 4JN2A 3BISA 4BSVA 3SE4A 1H5BB 3KPSB 3O3AB 3HI1B 1B0GA 1EHLH 3AY4A 5EOQH 1MQKL 3FQUA 3HE6B 3MOAH 1AQKL 2DJ4A 1XF1A 2PXYB 4QRPA 4NCC1 2A38A 1LE9B 3FQUB 4LSUL 4JO1H 1QKZL 2Z8VC 1JPSH 2EO1A 2B4CC 2P4AB 2ZCKH 1TQBB 1AXIB 2DF3A 5L2JB 2QQLL 1GPOH 1HDMB 3QDJD 4GUPB 3O8XA 5GGVH 4OV5A 4OD3H 2E6JA 2UWEF 5DO2D 2W0KA 1T22B 4UV4H 1S7QB 4NKMA 4PJ8C 4QRRE 5EORL 1UYWH 2XN9A 3VWKA 4XXDA 1A6TA 5DQJB 2J8UF 5EWIH 2PW1B 4CGTA 1QLFA 2AJSL 4KHTH 5E4EB 4M62L 3P73A 4WDIB 3O6KH 3VH8G 5F8RC 1NMCB 3QZWB 2EXWC 4JVUA 2G60H 3GHEH 3RX7A 3VGHA 1PSKL 1BFOA 1IEAA 4X83A 2FX9L 1AH1A 3F5WA 4PP1D 3T8XA 4DK6A 4MA8L 1CD9B 1IAIH 1Q38A 4M93C 2QKIA 4G6FB 4LCWE 3VXTB 2OBGA 1DEEA 4Y5XA 1P5VA 2BXYA 1CLCA 2CK0L 3U2SA 4I77L 3UROR 1CDUA 4OGYL 5F7UA 1MHEA 1JNNL 2GUOA 1RZJC 1KTKE 1S8DB 2HT4C 3QHZL 5TDOA 4UU9A 1XZ0A 4R4NC 1XH3B 4Z7WF 1L9NA 5CP3A 1MHHA 5B22A 2NY1C 4G8GB 4HHAB 4V1DD 1YEDA 1FP5A 4V1DB 2YUWA 2P8LB 5I1EH 4OZGF 4F7EB 4GQPH 2NY3D 3V8CA 1ZAGA 4DZBB 1MUJB 4M93B 5DHVB 1QO3B 1IBGL 3DVGA 4U1IB 3TJHD 4YDKL 5BRZB 3EYQD 4BA8A 4ENEC 5CD3B 2DMCA 1F6AB 3QIWD 4OZGE 1FNHA 4Q9QL 4LSRH 2EDYA 1GZQB 3TVMC 2A0LD 4K94L 5TPWL 3FB5B 5FFLA 3K1KC 1JNLL 4OLVL 4XCEB 3T3MF 4N8VA 4AQ1B 3S96A 2XKNB 1BBDL 5ESAB 2P5WB 1RSFA 1LHZA 2QBWA 3DX8B 1BBJB 1KTDA 5D5MF 4YHKH 5FGCB 2ICCA 5T1LD 3CVIL 3QXAB 3GB7B 1ED3A 2I60L 2JJVA 3THMH 1KB5L 4I3GA 1K6QL 1CFQA 4P3CH 3J8F7 1S78C 5I71B 4D0BB 1S7TA 1FNAA 3PHQB 4OZFG 3VXSE 4FQ2H 1EEYB 5L0QB 2YRPA 4D8PB 3RWEB 4I0CC 4PJAB 5B38G 2PN5A 3GGWA 2AS5M 4PBXA 4KKBD 4PRHA 1QLEL 3O4LD 3GI8L 1FJ1B 3WL9A 3QAZB 5GS0L 5TFSH 1AP2B 4NO2A 5LGKA 3HG1E 1JI2A 2D0FA 4FQLH 2VZUA 2BHZA 1D5XB 1LO5A 2Y06L 5D7IA 1ZWIA 1A6UH 2XRAL 3L5HA 2CKBL 3GK8L 5LGJB 1QVOA 3DYOA 4AH2B 1U41A 1QEWB 1TJHH 4XP5L 3G5YB 4YHZL 1ZEAL 3LEVH 3BGAA 4ZFGH 1RK0A 1IKNC 1G0XA 1YN7A 2CUIA 1NH6A 2J5LB 1Z3GL 3CFEA 5ENWB 3O6MH 2BRRL 5TGBA 2H32A 1V7MH 4JB9L 1A6AA 2HP4A 1RUQH 2YEZA 3DETD 4MYWB 3F7RA 1UWGH 3K81A 2VL5A 4ZFOB 3KPLA 1J9CT 4EUPH 4YEFA 3HNTH 3FOMB 1QLFB 1YEFL 3S97C 3BD4A 3MLSL 2YPLA 1WFTA 2J3SA 1RK1A 4NQSB 4Z76A 5EZIL 3FQWA 5C09D 4JGUA 3KLSA 4I0PD 4PJFA 4LQ1A 1RFDH 5JPNB 4OLUH 3RPKA 4Q74A 4LRIC 3ZE1F 1INDH 2XZCH 5KVEH 2ED9A 4PRBA 1MPAH 2WUCH 1XF5A 2Y07H 3DBXA 3JTSB 5IFHL 3LQZA 2EXWD 4LHQB 1NANH 5JW4Q 5T1KB 3QO0B 4KV5E 1ITCA 1JZ4A 1EZVX 3NFSH 3EYOA 4C56B 3C5ZA 5FYKD 1S3KL 3VRIB 5IWLA 1W8OA 1L4IA 2CIIA 5D72H 2CDEB 3MCG1 1TNMA 3F7VA 4YE4H 2EZ0C 3UYPA 3NZHL 4RGNB 1DBAL 5EPMB 4Y4KB 4ONHA 1B0RB 1P6FA 1ZANH 1D3CA 2NR6C 2NPLX 2WLYA 4HXBH 1LO3L 4PJHF 1EEZB 3ULUD 4A2LA 1TVBB 5C0AD 2HJKA 4K7PY 4PGCB 3HR5B 3ULSA 3NIFF 4MSWA 1SM3H 4PJ5B 1U93A 4O00A 1BLNB 3DO7A 1IKFH 4PRPD 4U1MB 4FQIL 1HNFA 1JNJA 3L5XH 1DLHB 5DURB 2E7CA 4ALAH 1ES0A 2VQ1A 1MLCA 5CD5C 3P40A 3MR9A 1YNKL 3SBWC 3MV7D 3CXHJ 4GW1B 4L3CA 3BYYA 3IGAA 5BXFB 2DQFB 3QO0A 3BYTA 4JHAL 1U3HB 3JTSA 3X3FH 4MXQD 5SV3A 1RJYB 5TE6H 3FT2B 2H2SC 3O2VL 1DDHB 2J8UB 3MRBB 4NKOB 2BVEA 2HMIC 4QXUH 1T5XA 1QRNB 2V7NA 1HHIB 2FDBP 2NYYC 3DECA 1ZTXL 5E9DE 2CLVA 2G5RA 2BVOA 3O3DB 1RUAL 3FQXB 2VH5L 3B43A 5I16A 1C5BH 2P8MA 4J3VA 2J6EL 2H2PD 5J11B 2UZIL 2AJZB 4KVNH 1MJJB 3BW9B 4KC3B 2ILLA 2QHLA 1NC2D 1OW0C 3PABA 1MRCL 2AEPH 4GQ9L 4NUGH 2ADIB 2ATKB 5JHDE 5KTEH 3UBXB 4WW1B 3UDWA 1UJ3A 1WBXB 2NY0D 3QI9C 2EYRB 2JELH 1H3VA 3GMOB 1WAAE 2FBOJ 5C0RH 1TENA 4FQHA 3TNNB 4AMKL 2E9BA 4LPWA 1QHPA 2BY3A 5FIEA 4R2GC 3E3QC 3LKNB 5C2UB 1HKLH 3ARQA 1N7MH 3NA9H 3LEYL 4UB0L 4JRXE 5I9QB 1OOAA 1OSPH 3BE1H 4UILL 1A9EA 4GW5A 3HE6C 5CUSH 1MH5A 5DJ8B 3D85B 1NBQA 3U4BL 1OT1A 3BO8A 4QRQA 1A7BA 3ZE0F 4Y5VA 2OYPA 1NLDL 5I15L 2APVA 2G9HA 4Y4FB 3V6ZB 4B7IA 5KANI 3WYRA 1CLOH 2W9EH 1KEGL 3AM8A 4J23A 4MJIA 4D8PA 4IHOA 4G59A 4YHMH 4Z7UF 4BH8A 1AFVL 3BUYA 1KPUB 1WSST 3GBML 4P2RB 5F1SA 4I0PB 1EEUA 4TULL 4HULB 4GRMB 3IDMB 1A22B 1UEMA 2M1KA 2AJVH 1I1AB 2H26A 3KPQB 2DBLL 2AABL 5H37H 4U6XA 4NHCL 2FB4L 5F96H 1J0IA 2H1PL 4JHZA 5IMKA 4G8FA 1P69B 3QG6A 4KKAD 2BSRB 1VGKB 4PJGE 2R2CA 2JJSA 2V2WA 2XPGA 2HFFA 3BWUC 5E03A 5HGHA 4CVWA 1Z0NA 5B38B 5HBBA 3SGDI 3T77B 4U05A 3OKLA 5ESAA 4Y2DA 2BNUB 4JFXA 3RP1A 3CMGA 5F44A 4E0RB 3V5HA 4KKNA 4RGMC 1RUML 3GIVA 4W4NA 5FK9B 5JLZA 2AQ3A 2I26N 1NCBL 4F2MB 4L8DB 1G7HA 4Q0XL 3OHXA 5C0NC 3NCJH 3GJEA 4DUWA 4FS0A 1REIA 32C2B 1G7HB 2BY0A 3EUUA 5DC9B 5HVHC 5C0FB 4X7FC 3HPJB 4PG9A 5ISZB 4HXBL 4MXQC 4NZUH 5L6YL 1NBZB 4H88L 2F19H 2VYRE 5DJDA 1F4HA 3QO1A 1TVDA 4WV1B 3FN0L 1M71A 3H9SA 2I5YL 4PV8A 1FH5L 2WWMC 1C12B 3RNKA 3QJFB 4F7MB 1F45A 2LU3A 3ZYJA 1KJVA 2IANE 2QSQA 5CJ5A 3LVEA 4JM2C 5HI3D 3SJVA 5DD0H 3KPRE 2OQJA 1CXEA 3MOBL 4WO4D 5EZOL 1UJTA 5K9QI 2FJHB 4ZUSA 5ESQB 2X7LB 2EECA 3BAEL 3VE0B 3MRRB 4HEPG 2GSGB 2GSIB 4YPGB 2H3NB 2Y36L 4YX2L 1FBIL 1I8KB 3O8XD 3FT3B 3TT1H 4FRWA 5FYLE 2XY2A 2DYPB 2UVEA 1TVHB 3ULUL 4ZOEA 1U8KB 5E8DH 4IS6B 2PYFB 7CGTA 3O2DL 2P7TA 4JDVA 5ETUB 2IQ9H 3LKOB 1UM5L 2EDKA 5KSBB 4MGXA 4XAWH 4KKLC 3VGBA 2GSGA 4OLZL 4KZDH 3LSOB 5TFSL 4PJBA 4IRZH 2E6QA 4PJHA 2OJZH 3S34H 1RIVL 2WANA 2IH1B 1NAKH 2ZCLL 3RIFK 1TJHL 3DO3A 5ISZE 3OR7A 4QKXB 4P46D 4LSTL 4EBQH 1XIWB 1IAOB 3QSKB 2A6IA 2V17H 1MCPL 2FYYA 3UTSB 3MLRH 4ESKA 1C1EH 2GTZA 3BQUA 1CD8A 3DXAB 3RZCD 4IRSD 4ZUWA 1G9NC 2NY3C 3DRQB 3M8OL 3VG9B 3EAKA 2YD8A 3NIDE 4K71B 4M48L 2VISA 3P0YH 3WJLC 3BPNC 3C8HA 1HKLL 3QULB 1B0GB 2GITA 4NUJB 1IGTA 3HAEH 2GITB 3H2WA 4NUJA 4RGOH 4MAYC 5F1KC 1RU9L 1P1ZB 4HUNB 4YDKH 3ULVD 4P23D 1A3QA 5D2NC 1XCQA 1HWGB 4NQXB 4RRPA 4XNUL 3QXTA 1SY6H 3NMEA 1Q0YL 3QDGA 4MAUL 1E4JA 1MFDH 1RZKL 5D1XA 1YEIL 1TETL 4DFIA 1HILA 1GH7A 2FLRT 4MD4A 3JV4A 2HYMA 3MA9L 1H8NA 4ODSL 1MI5E 1DN0A 2VXTH 5D93C 2Q8AH 3MJ9L 5I66B 2EEBA 4WFED 2RR3A 4G9FA 1ZSDB 2C3WA 4M7LT 4H5SB 1AGBA 3LHPL 1ND0B 2RFXA 5AZEL 5C0RL 1JHKH 1SYVB 5I2IA 2GT9B 3K2UH 4HS3A 4OZHE 3U36B 1SQ2N 4U1MA 1F3DJ 5L8KB 2BSRA 3T3PF 4DOHB 3ULVF 4PRIA 4ODVH 1C08A 2MTPA 1T04A 1NFKA 1T89C 5IMKB 3OKMA 4NCDA 1QLRB 4MNQE 1SBSL 3NCEB 1KN2L 1ZHKB 1GC1C 5D7JB 1TJGH 4FZEH 5DD5H 5EPMA 3MLVL 4Y16C 1VENA 2JJTC 1CBVL 4XMKL 4H1LH 5I8EA 1IC7H 2X4SB 1RUKL 5I74B 5CGMA 4LHUB 4U6VH 3IJSA 3ARFD 4LLQA 1FSKC 4UQ2A 1SEBA 2A6KB 2W9LA 1HXYA 5F7EH 2F5BL 1IC4L 3O2DH 2EE2A 5FO9A 4Z7UA 3ROOB 3CPLA 1PG7H 2FBJL 3MRNB 4PV8B 3TVMD 3ZDXF 3P30H 5D8JL 2DDQL 4DGVL 5E8PA 4ISVB 4PJ8B 4ELME 1N8ZB 2DTML 4X6BB 1QSFB 2AAVA 2I9LA 4X7EC 1HH6A 5D7JC 1GGUA 5J6GB 3QUYD 3LKNA 4TUKL 4WI2A 3HR6A 3SGJA 3CH1B 3KS0H 1OTSD 2VLJE 2RCSH 4MVBD 3NA4A 4NQDE 1YYML 5IHLB 4JPVH 5TDNA 1FSKB 1C1EL 4N5UA 5FB8B 3VRLE 4NN6B 4PJ9B 4OM1L 4APQC 2C1OA 2VZSA 1VFBB 2VNCA 2XY1A 4PJ8D 3D48R 3F65A 3X11B 4HKBA 3DROA 3DSNA 3BKJH 4WEUD 4FXLA 5L0QC 4GKZB 1NEZB 3IDIB 3DSFH 4F57H 1FIGL 2XWBA 5EORH 5C3LD 2CLVB 5FKAA 1AD0A 1JGLL 3RWIB 2BOCA 3PGCA 4XRCB 3O8XC 3PWPB 2BVYA 4XI5D 1VESA 4WHCA 4K7PL 3S5LB 3S3JA 1YC8A 4HWBA 3HMXA 1RZJL 3ULUE 3EYSL 2ZWLT 1T7VA 4CNIA 2YK1H 1RJLB 1WAAA 4KI5D 4NQEE 5DRZA 5HI4D 3OBAA 2NXZD 4NBXB 3RHWF 4LSUH 3LQAH 3QFDB 2IG2L 4HG4J 2MHAA 3HA0A 2MSPA 4CN6A 1ES0B 4XXCA 3MOAL 5DZLA 4A6YL 4ZAKD 1MVFA 1OAUH 4JREB 4HQQH 4K7PH 3EYFB 3P11L 5A43C 1XGUB 4ZD3L 4HLZH 1MCDA 3UTTA 1WIUA 4U1NA 1IM9D 2HJKB 4M5ZH 4OUUB 1RJZA 1I9IL 1B3JA 2FZ3A 1U3ZA 4K94C 3GB7A 5FGRA 4RZCA 4XP5H 4YHZH 1II4E 4RAHA 3BGFC 4HIIA 5IQ7H 4KK9C 4YFLF 1GXEA 2A6JA 3PL6C 1NCDH 2CKBH 4WU7A 3TWCL 4P2CG 1A7OH 2P5WA 1G84A 1E4WH 3PWLB 5L88L 4KQ4L 1SMAA 4XAKD 1OLLA 5HDLA 5ID0B 4NT6A 1ZA6B 1V7ML 2ATKA 4P9ML 1KB9J 5SWZE 3H7BA 1H8OA 1OWRM 4N0FA 4Z78A 1N5YL 4FG6C 4RFEA 1CR9L 1NCBH 3QJHA 3WMSA 1LEGA 3VXSA 2R39A 1A1OA 4LLYA 5AAMA 3UPAA 2XKUA 3BOVA 3B4NA 2XTLA 4OF5A 1QR1A 4R7NB 5F21B 4RGND 4I18B 4H25B 5KSBF 4POZD 1IFHH 1OLZA 3FOMA 3WLBA 3NVQA 4ODVL 3SY0B 3P0VH 3VFGH 3VFMB 3QJHB 1CK0L 1FYHB 3P2TA 5DS8B 1KOAA 4PPTA 4R3SA 2N7BA 2YS4A 1CCZA 5AZ2H 3HLAB 1E28A 3GO1L 4E0RA 3PDOB 4J3OC 1BFVH 3RWCB 2HLAB 2DI9A 5CUSL 2NW2B 5EIIB 5DD5L 3VMOA 1KFAL 3C5JA 5K9JL 1PLGL 4MQXD 4ZSOE 3WFHA 5D2NA 2JJTA 1M05B 1KCVH 2QKIB 2DMKA 3E0GA 3CLEH 5EOCL 3V0VB 5DJYA 4HGKC 2IPUG 5KVDH 1CE1L 2IQAB 4M1DH 5J9PB 2I07A 1T2QL 5MEQA 2ENYA 2NY0B 1WISA 4HGMA 5I15H 1I85C 1S9WB 4YBHA 4DK3A 1BZ9B 4JLRB 5E2VH 5IJVA 4L8BB 4I0PA 1KIPA 3QQ9C 5E5RB 3B83A 3U82B 1NKOA 4QRUB 2DM4A 2ESVB 2Y72A 3D3VD 5C0BD 2FH6A 4ZXBB 4MJIB 3AVEA 4HC1A 4NQEB 5CCKL 3GKWH 5DMKA 4MAUH 1I9RH 4GUPA 1XGTB 4G6JH 5T1KA 1RZGB 1INQB 3LY6A 3TA3A 4Y4HA 1WLHA 1KUMA 4QTIH 4XPHH 4L4TB 3RVTD 1K2DB 2GJ6A 3ILPA 4GW4A 4LSTH 4DN3H 1KLUB 3ALPA 4C57C 1AO7D 5GGSB 4QRTA 3ZKXC 3BIKA 5CEZD 5B4MC 4RWYL 5ILTL 4QRRB 4LHUG 2MOVA 4BM7A 3HE7A 4GKZA 3EO9L 1WFNA 5CP7B 3KPSA 3O3AA 4NNYB 4E9LA 5F1IA 4NJ9H 2VAAA 5FA3B 4P57B 3K2UL 4WW1A 3HC0A 3EDJA 2XA3A 4JY5L 4NNXB 2CK0H 5JHDD 2YA1A 5DXWA 3VWJC 4XPFH 3O4LA 5AG8A 1KJMA 1BAFH 3RX8A 2ICWB 5F97E 2EDEA 1N3NB 4DZBA 3CU7A 4HF5H 5SV4A 1VKXB 5HHNA 5HHOB 2IH3A 4X0KA 2X9XA 2Z9TA 2CXGA 1QRNA 1PYWA 1S7WB 4HJJH 1S7SB 3GRWL 4G8GA 2J8UA 3MRBA 1JFQH 5EU7E 1S3KH 1ZGLM 2JLLA 1D5XA 3PJSB 4G42B 2N4IA 1N2RB 4G42A 15C8L 3FJTA 1EMTL 5B8CA 2P24B 2NY2D 2GUOB 1TDQA 1HXYB 2VIRB 2MNUA 5ICXA 3EGSB 4K3DL 3LDBB 4JY4B 4LCCA 5HPMA 5DHVH 4JJHA 1VFUA 1ZT4A 2DQCH 3P4MB 2VLRE 1FZJB 4X6CA 3NAAL 2M8XA 3QEQB 1JYNA 2DRUA 2VITB 1FPTH 4G8GE 3JWOH 1PKOA 2WY3A 4ZNCD 5MEPA 4PGEA 1ZT1B 1CU4L 5DF0A 1DCLA 1QBBA 3DX9B 1CLYL 1HSBA 4OCWH 1HCVA 4HV8A 3L3JB 1K9TA 1H3UA 5DMYA 3UCRA 3GI9H 3JWOC 1K3IA 4YO0B 3WXVL 4UZGA 3K8LA 1R3KB 3KXFB 5CEXA 2FHFA 5L8LB 5I1JL 2YBRB 1Q9KA 5FUZL 2AJ3B 3VFNA 4PBVC 3BEWB 1QLEH 5M7QA 3MRFA 5A2FA 1IGIL 2YSSB 5F1NB 3UJTH 2XKNA 2F54B 3CLFH 1EFXA 3V52L 3UZEA 3N85L 4XPGH 3U4AA 3MLUH 4KJWD 5TDPB 2OR8A 4YDLC 2DKUA 1F6AA 5DA4A 5DJ6B 4JFDB 3FB8A 1W0VB 4C4KO 4KTEH 5EA0H 1W72L 4HKJA 2LTQB 2W60A 1MUJA 3BH9B 4QRPB 1OD9A 4F7TA 1RUPL 3AMLA 3PWNB 1CGWA 2WLZA 3BPLC 1NGXA 3RY4A 4PJDB 3T0ED 4PGBB 1B88A 2ZZUT 5FDWB 2XG5A 4XC1L 3MMEA 3AMKA 2BVQB 1HSAB 1S8DA 3QDJB 3G5XB 3QQ9D 4MJ5B 2X4UB 5CGTA 4KQ3H 1L6ZA 2APTA 2I07B 5MEQB 4J3SA 5JUEL 5J56B 2MKLC 4TQEH 3RVXD 2E7BA 3WJLA 3S88H 3VWKD 1Q0XL 1VPOH 4MJIE 2XXCB 3MRLB 2Z31A 4MS8D 4NRYA 4Z7WE 5IHUL 3RDTB 1J8HA 3C2SA 4QTHB 4PRNA 3ARTA 4H8WL 3G04A 1MY7A 3ECBB 1DQML 5DC4B 2AABH 3MYJB 3G04B 4O2CB 4JZJA 4M8QA 4RFNC 3EO9H 4NO2B 4EVNA 4KJWC 1AP2A 2VLMD 4U49A 4PJEF 2N1KA 2CQVA 1NGXB 1HIMH 4I18A 1PG7W 2HFEA 3IDGA 3WKNA 5DMIL 5SWSE 3V6FB 4K71C 5EU4A 4PJAE 3GSQB 2VE6A 1R24B 1T1WA 2KQMA 4XPBL 4RFOH 5K9KB 1HDMA 2JJWA 1J18A 5LBSH 2IBBA 3SJVD 4V3EB 3D18A 2J8UE 3V4VL 2G2RB 2SEBB 1A21A 1Z9MA 1CN4A 1WC7A 1PLGH 3UP1A 1K8DA 5F9WB 1XGQA 1NCUA 2VXQH 4IMKA 1DR9A 4WU7B 1F11A 3MLYH 2C3VA 4BZYA 4ZDHB 4AEIH 5F9DC 2X05A 3TN0D 5IHBA 1UXSB 1VEPA 1YECL 1A3LL 4KK6D 1NFDE 4APQD 1J1XL 1K8IB 5T33L 1DBBH 2BCKA 1WZMA 3VFTB 1PSKH 2BFVH 1FO0L 3NACH 2AXHA 1SYSB 4LCCC 3WE6B 3PG2A 2ORBH 1NAKL 1MREL 1YN6B 3V6OC 3OGCB 5ICXB 3AAZB 4JM2B 1SM3L 3EW3B 2NXYB 1G7IA 3MUJA 5I1LA 5J6HA 3O6FB 3WN5B 4HUXA 3NABL 4NIKB 1MRCH 4HLJA 3MA7B 4KQ4H 4PGEB 1CXFA 3QG6B 3O45A 1IAMA 1QSED 3ARDD 3CSBA 3PWPA 3G9AB 2NTSP 1SEQH 3VMNA 4RBPK 1JV5A 4HUUB 2Q87A 5CAYB 1LQVA 5C2BL 1FBIH 4RMRA 3WIFB 4KKCC 4P49A 4HWZA 1A7PH 3IDIA 3VRJB 2VZ1A 4KROB 1DQJA 4U1GC 3O2VH 1BGXH 3U79A 5I73B 4LCYB 3BHBA 2G5BB 3O9WA 4KTEL 1NDMB 4RFNB 1JGDB 2VQTA 1I8IA 2C1OB 3RJQB 2IANB 1U2CA 1FG9C 5DD3L 3CUPA 2I27N 3LN5A 3W0WB 3QCVH 4JFFD 2JCCF 3HNSH 1HI6A 2GY7B 5E24E 5HHNB 2O5XL 3L3KA 2NLJB 2V9QA 2Z93A 3LB6D 4YX2H 4N1CA 3S98A 2UY7A 1JGUL 3C60D 4D2NA 5BS0A 1MCLA 3DMMA 4K9EH 2YUZA 4XXCC 2X4RA 1IT9H 3HPLA 1KLGB 4LK4A 3S4SG 4YGVB 5FHAH 2KBGA 4JFPB 3QDJE 4GAFB 4FMFA 1IGCL 3MRDA 4LPUA 1INDL 1ZLWK 3MLTB 1CWVA 2GCYB 5DHXB 4QHKJ 4HIXL 5C86A 3V4UL 3QFJA 1AO7B 3QR2A 4YE4L 4TNVK 4OCSH 1CZ8H 2JB6B 3U9PL 1V3KA 1P53A 3IXTA 3MGAA 1UXWB 1NUGA 3ET9F 1HHKB 4LBEA 5I1AA 1PEWA 4OFDA 3UAJD 1DL7H 4OM0L 4L8BA 3S7GA 1KLUA 3UJIL 2EDHA 3EJJX 2R0ZL 4AL8L 3C09B 3ZSSA 4LKXA 1HQRB 4HUVA 2V7NB 4U2YA 5T1KD 5SX5K 5GISH 5BZDB 1HH9A 4TUKH 1MHCB 5HHMB 2NY2B 3D9AH 2Q6WB 1XF4A 3LPFA 2IG2H 4N9OB 3TBYB 5GZOC 2A73A 5EOCJ 1UCBH 4MNQA 3IKCA 2O5XH 2BVPA 2VXVH 3GK8H 3HHRB 2BNQA 4PJFE 2WW8A 2Y9RT 1BZ9A 35C8H 2F58L 2AV7B 2BNQB 4OCMC 3K1DA 4PLOB 4XTRD 5IEHB 5DD3H 3KVQA 3IS1X 4IDJL 3STZB 3ARFC 1U95A 5I1KH 4POUB 3VH8B 4DAGH 1BFTA 3LKQB 4PJ7F 2Q6WA 2D31A 3I6GA 4P2QD 1MFEL 2VN4A 4I2XB 3G08B 1Z3GH 5JXEC 1D9KA 1EZVY 2Y4SA 4WFHD 1K8IA 1NSNL 3WO4B 4GAJH 2UVFA 4KMTL 3AUVA 3UZQA 2A77H 4N0YH 2VDLL 4MB4A 3TO4C 2DQTH 4JG0L 4S1QH 1XR8A 4PJGB 1A6ZA 2CD0A 3H9HB 4JDZB 2WWKO 4G6KH 5GJSL 1X5HA 2FATH 4P2QA 4POZC 4WEMB 1CLOL 1V8HA 2W9EL 1U91A 3IDJB 3WNKA 4YHYB 4F58L 2D4FA 3OXRB 4FTVB 4NYLA 3GSOA 5IHZB 2QTEA 5KTEL 1GGIH 2XQYK 2BOBA 2ITCB 4HAGA 1OWWA 4KY1L 1NGZA 4QXTA 4WI7A 3QI9D 4H0GA 1KN2H 4PIRF 5E00B 3X13A 2NW3A 2P5WE 1FLTX 2DQEH 2F5BH 2J4WH 4Z78B 1O7SA 1AE6L 4Z95L 5CIPH 1KB5H 3C6LA 2F53A 4RIRA 5MHSD 2PYFA 4HKXA 1AGCA 5I0DA 3SCMA 5FYLH 4DZ8B 4P4RA 1OTTD 2OZ4A 3FT3A 2NY5H 5J4MA 4RAUA 1I8KA 1JZ2A 5KVFL 1MOEA 2EDRA 5DUPL 2NYYD 7FABH 5IT2H 5L7XL 1XMWA 2MQ3A 1G9EA 1L7TL 1DFBL 5DRZB 4E42B 5EFIB 3VRJA 2X1XR 5IF0A 5GSRB 4Y0GA 2V5YA 3S4SB 4JANB 4XNXL 5JDJA 4WNQA 4NQDB 4MXVE 3EYFA 5JDSA 1KJVB 4K2UH 3DI2B 3ZKXB 3DWTA 3P9MA 1QYGH 4NZTL 2UZYB 3KPRA 1JBJA 3H3PH 3MRPA 3RAJL 4GKSB 4IOFC 1JE6A 1F4YH 1N6UA 4DGYH 2FX9H 3QUMA 1R3JB 4N90D 4K55A 3SKOB 4DKFL 3QUKA 3KR3L 1W0VA 4F33B 3FFCE 3V2AR 1ORSA 4JFHE 5DGQA 1UG9A 3W5MA 1FO0H 1EGJL 3SCMC 1A0QH 3JUZA 1OL0A 1Y18A 1N4XL 2AK4D 5GGVL 3GSVB 5D96C 1MVUA 3BSZH 3SKJL 4HGWB 5ECJE 5DEGA 2HH0L 4PLKC 4WU5B 5E8DL 2AXFB 1ZHLB 5C6TH 3MLYL 4Y19B 3QG7H 3QHFH 3I02A 4UT6L 4P9HL 4KHTL 1JUFB 2FJGB 4PGZA 3X14A 1YUHB 2ZCLH 4HV8B 3EHBC 5ADPL 4U3XA 2P46B 4ZQKA 3DVIA 2VSDA 5FUOH 3HC3H 5INCB 3QEQE 4JFED 3UZVB 2WBJC 2ZG1A 1FGNH 1OAQH 2AEQH 2K7PA 2VITA 5CEZH 3C9NB 5IV2B 1IGMH 1OQOA 4JRXA 1YJDL 2HKHH 1JPST 2XACC 1U8MA 4QO1A 4V2CB 3MNWB 4F7EA 3QEQD 3FB6A 2BC4B 3LD8B 2XWJB 1LDPH 3SKUD 4K8RD 3TN0A 1D9KC 2X4SA 4FA8A 4N68A 5HGBA 3U36A 3D85A 5JXED 4LRNL 3JSSA 1MFAH 2V5SA 1CXIA 4JB9H 2DWEB 1ZSDA 5LCVH 2P5EA 3VXUA 4JPKL 4ZMAT 5HHVH 4OF0A 4LARL 5CBEA 4PLKD 2FEEI 2ZUVA 4X8JA 3W82A 1U8JA 4X4XB 3MGTB 5FGBA 4FQ2L 1MIEL 4Y19A 5KBNC 4XP9H 5DRNB 1TMCA 4GAGL 4EZMA 4M7KL 3QNYB 3I3EA 4FQLL 1IEAB 2ZSWB 5C07D 5FO8A 4PY8I 1D5MB 3GIZH 3I75B 5D7KD 3NCBB 5DDHA 3OAZH 3G6AB 5GIRB 3S3PA 1BVLB 1H3GA 5I66A 5CMAB 4NC2B 3K8KA 5C08B 1L7IL 4XXDB 1EUTA 1FYTB 3QEUB 3CU1A 2R0WL 5JTWA 2EDBA 5FYKL 5AD0B 2YPVL 3R0NA 5C9KA 4MCYB 1EIBA 3FFCA 1IQWH 5F7WC 4GAYA 3DGGB 5MI0B 1J8HD 1ZHNB 5F89B 3EFDH 1KT2B 4CU8A 3DXAD 1N7ML 2NY7H 1BM3H 5DDHB 3ES6B 4PD4K 4KK8D 1CGSH 3MBEA 1IBGH 1L8JA 1GGBH 1MF2H 4OT1L 4X5XB 4ZUVB 4XPHL 4I8DA 5I8KL 4P5MB 5IK3A 3ALXA 4CAGA 1Q8MA 2VDNL 1BLNA 4JG1L 1H5BA 3VI4F 1S9WA 1AY1H 3A67H 2ATPB 2DLFL 3BH8B 1OGAB 4YPGA 3LRSA 1MELA 4BELD 3AREC 4ZSOB 1GSMA 1GHFL 2HN7A 3N1QC 3U0TB 3FQNB 5KSBA 2VLRA 4BH7B 3IDUA 3DV4A 4MA3B 3T1FA 5A3IC 2X4TB 3SDYH 2P7TB 3DVNA 1R6VA 4NM4H 3ZKNC 1AGCB 4B50A 3LD8C 3EKCA 5CFHA 3GHBH 4Q2ZA 5GRVK 3WFDL 1NPUA 3W39B 4F9PA 3DOSA 4DKAA 1NDGA 1YQ2A 3LS4H 3RKDC 1LEIA 2A2QT 3CSYB 4HZLA 3MBXL 1X4XA 4RGOL 1NMAL 3V6OA 5INCA 1AR1C 1J12A 5IMMB 1MSPA 5ERWA 1SVCP 5HGDA 1A5FL 2X4PA 3P0YL 4JFFE 4XP1H 3IF1A 1A1OB 3G6JA 3BKCL 4YHLH 2FL5A 4JQIL 5E5MA 2ERJC 4L8DA 3FN9A 3MXWL 2BNRD 3CVHL 5D7IE 1R5WB 5JHLH 1NGWB 4WU5A 1PBYA 3B2UD 1JMXA 2XNAB 3MROA 2OR7A 4JFXB 3IAGC 2DJUA 3OJVC 25C8L 2HKFL 4IRJC 1H8SA 1RULH 4HBCL 5FOJA 5L2KB 3FCTA 3H3KA 1AQKH 1H3PL 3NIGF 3RWDB 3E3QE 5T1LB 3FL7A 12E8H 1YEHL 3BIAX 4X7CC 4XTRC 5I1KL 4NPYA 4S1SH 4EJ1C 4X6DF 2FZ3B 2ARJA 2CRYA 5C7XH 4EDXB 5E0QA 2FCBA 3EZJB 4OCXH 4U2ZA 2GJ6B 5D7SL 2CIKA 1C16B 5I1HH 1S9XA 1FZKA 2AXGB 5DMKB 3GGWB 4PJEE 5TE4L 4W6YB 2VZTA 2B39A 2KDGA 3Q6GH 3CMOH 2R9HC 4TRPH 1S7TB 1MPAL 3RGVC 3VG9C 1HQRA 1NC2B 4H20L 3OJDB 3AS3A 5FYJH 1KJ2B 4HAFA 1KJ2A 1C5CH 3OJDA 4OFKA 2BRRH 1KYOK 1I3RA 4QCIA 5KG9B 5IQ7L 6FABH 4AQOA 4YDVB 1KCUL 2IC2A 3ULVC 4A6YB 4FQCL 4GMSL 4LF3A 3O2WH 4MD5B 5GQBA 1S5IH 1J5OH 4U0QB 4ETQB 3WFHB 5HYSA 1U8PB 2NY5C 1BX2B 3OQ3B 3WNMA 2EYRA 4PP1C 5IB4A 3TA3D 1VFBA 3L3DA 4UINL 3HLAA 4FQ1L 4LASH 3A6OA 3OKKA 3PWPD 4LLDA 4LKCB 4I48B 5DS8A 4C55A 3MQIA 1FDLL 4YK4B 3N9GL 3QWOB 2F5AL 1OGAD 5IIEA 1ZEAH 3RPIB 2E7LC 1W0YT 2DN7A 4IEFB 5BS0E 1Y0LA 1FL5A 4XWOD 3RVUC 1ZMYA 5D5MA 1T0NB 3OB8A 2DQTL 1JWSB 2ICWI 2WMPA 3LMJH 4LQFL 5CJBA 1D6EB 3FRUB 1A1NB 5F3HB 3L6FA 3JTTB 4ODUA 4QHLB 4FXGA 2V2TA 4L8SB 1IJ9A 2XNAA 5D7LD 1U92B 1JWUA 1XH3A 4NC1C 4P2QB 1M7DA 5FO9B 5IW1B 3GMQB 4NRXA 3WHE1 4KUCF 3RL1B 1X5ZA 5DURD 3LN4A 4M61A 3SKMB 1H3XA 1J10A 5DLML 1Z9LA 4OGZA 5GGVY 5ACMA 2VQ1B 5KW9H 2XRAH 3OG4B 4BQ9A 4WUKH 1DE4A 1DEEB 2NY2C 2R0ZH 5GRJL 4AL8H 1I1AD 2EKSB 4WHTB 1DDHA 4Y8DC 4NN7B 3G08A 1UFUA 3P0GB 1EK3A 2DQUH 4PGCA 1JHLL 3DIFB 5B3JE 4LSSL 1OGTA 5FEBA 2HJFA 3AAZA 4JM2A 4U1NB 3MR9B 1RZ7H 2HT2C 5DQDL 2A83B 2FIKB 5EO9A 3TBTB 3QRGH 2E9WA 4MB3A 1IGCH 5LVEA 2VUOA 3VWJB 4YXKL 1A6TB 2GT9A 2OLDA 3FT4B 3T1FB 3BGFB 2E7LA 4PGJA 3VWJA 1MFAL 1CTNA 1ND0A 2O61A 3M1BA 2AI0H 4G6MH 3ULSB 3OF6A 3QZWG 5C0AA 2FD6L 3B9EA 4CADB 1TTGA 3E6HB 4PY7B 4AEIL 4BFEA 1DEDA 1WEJH 4YFEA 4ONHB 3MCLH 3D25B 2FHCA 3GMRB 1TITA 3NZ8B 4XRCA 1ZE3C 3L5IA 1WBZB 4FZEL 3CH8A 2Q76A 1CS6A 4LP5A 1LO2H 1F4XL 4NHUA 5E2WH 3PIQA 3LKPB 3TCXA 4YDIH 1A9BA 3SKMA 4WV1C 4XVJL 5EIQA 1CFSA 1A7NH 4NKIL 3TT3L 1ZHNA 5F89A 5C92A 3GNMH 3BEVB 2EDDA 4OF6A 5EUOE 1G6RA 4R90H 4Y4FD 1KLGA 3CJJA 4F37K 4HX1A 3ZTNL 4Q6IC 3V0WH 2FYYB 2CR3A 4HMCA 3GSQA 3Q5YA 3DURA 5IW6B 4L3ED 2CK2A 4HH9B 1MEXL 1HIML 3CMOL 3QDAA 3G5YA 1YY8B 3LQAC 3FRPG 5E94A 2EYTB 4YBQC 3LQMA 3W2DL 1RMFL 4NJAH 4P46B 2R2EB 1N8ZA 1WWWX 2DQDL 5EN2B 3QUYC 1W0WA 5JA8B 1FIEA 1RIUH 2E8ZA 4GRWF 3RJDA 1QFUL 4WJ5A 3UAJC 3LKOA 1H3WM 1AR2A 4X6EA 2FO4A 4M3JA 3MGOA 4PRNB 1J8HB 4QTHA 5IBUG 3WNNA 3O0RH 5DJ2B 1U8PA 1ZVHA 4A2MA 3IJHA 1CF8L 1OQXA 4HWZB 4PJAA 3RWEA 5IFJA 5EO0A 4XNMA 5A1AA 4U6VL 5SWSA 2EIZA 3VJ6A 5GXBB 5IV2A 2E7HA 4HXAL 5DGRA 5EU6B 4HJGB 2R0KL 2IPTH 2G60L 5D7JA 1EGJA 2RJMA 4JKPL 3T0EC 4PJ7A 4JFEA 3WS3B 2D03H 1WV7T 3SGEH 4BUHA 3MMEB 5JZ7C 4XWGL 3KLAA 3UTQB 4MHHI 1TZHB 4Y4FC 1CIDA 1ED3B 2R0LH 3PHSA 4HWEL 5BRZE 2JK5B 1X5YA 2HAZA 4G7VL 4M1GL 2XZCL 2JCCB 3MOBH 1AKJD 1I9EA 1SJHB 3B9KB 3PWUA 5IJKA 2X40A 4JJ5A 1QPXA 4J7RA 5CHNA 4O2FB 2AK4A 4G9FB 1DN2A 3ZTNH 1XGYH 4KAQL 3N85H 4XPGL 4OBSA 1U8IB 1WFOA 3CSGA 4IMKC 4ZQKB 1DUYB 3MLXH 1U8IA 3TNMA 3VXOA 3SHSA 5I1GL 1RZ8A 4Y19E 4G3YL 2WM0A 3A67L 4BFIA 4OZIF 3WHXB 4H0IA 3VXNA 4G8GD 4G6AD 1CI5A 2C7UA 3ZYIA 1XCTB 3CK0L 1CFTB 2J6EA 5DI8B 5KVMC 1UVQB 5CLTA 5EC1B 4Z77A 4U1KB 4MNGE 1NAML 2Y1VA 4LPTA 1RZ7L 4N0UE 5F9OL 3HE6D 2IWGA 5DA0B 5LWYH 4U0RC 2CGRH 2N56A 2YKLL 5I1DB 3WV0A 2R1WA 5CGYD 3MODL 4JFQB 2CDFB 4MD0B 3CX2A 2AI0L 4R97C 1FFQA 1LNUB 4MJ2A 4X6CB 2F19L 3QUKB 1TPXB 5D2LA 1QSVA 2ZUTA 4PG2A 1IEBB 3OZ9H 4P5TC 3OKYA 3RKDD 1OTTC 2WINB 1S7UA 3QUYB 4O51B 4PJHB 5CJXA 2EZ0D 2A1WH 1CGSL 4P46C 5D9SB 3KPRB 1NCWL 3O3BB 3IB4A 3LPWA 4JR9L 5B3NA 5EA0L 1A4KA 3OKDB 1JPFB 2XV6B 5GJTH 4WI9A 4DVRH 3KYKL 3SCMB 3ZKQD 4NWUH 4PYGA 3BO8B 4QRQB 4DQOL 3DX7A 5DQJA 3DV4B 2CSPA 4MA3A 1CDHA 1OF2A 4OGXL 5C09E 4QYOB 4HZAA 5JOPE 3VXUE 1SJVA 2V6HA 3T0VA 1HHHA 1F6FB 2LU4A 3LRSB 3SDCA 2NTFB 3T0EB 1UB6B 5FYJU 3T0DA 3SQBA 3BX7C 1EHAA 4G8EB 5DRXA 3WXVH 3WNPA 4ONOA 1KBGH 1CDCA 3ZHKA 4R8WH 1T1YB 2BX5A 3O2WL 2WBJB 1J5OL 5H35A 4U7SA 4FFZL 1MNUL 3I6KA 4FOMA 4Y7MA 1FH5H 1MWAA 4PD4J 5GGSY 5J1SC 1CGVA 3W11D 3ARZA 2X1WL 43CAA 4X6CE 2GAZA 3ILPB 4GW4B 3VFVA 1ACYL 2EE9A 4JCMA 2BVOB 2GY5A 4PY7A 4EDWH 1RZGA 1YJDC 3T2NL 5C0AB 4LLMA 2IBZY 2F54A 2QQNH 3VD3A 1DQQB 2YSSA 4OZFH 5D96B 3NCYS 5EC2B 3ABZA 4CU7A 5I1CL 1HXMB 3PGDB 3QEUA 2GKIA 4OKVB 1X7QA 5A2LH 5CZXC 1JK8B 2Y7QB 4Y16D 3U6RB 5EU6E 3SDDC 2VLLB 4ERSH 2QQQA 3SBWA 1T1XB 3ARVA 4XZUA 4DGYL 3RVVD 2X4QA 4XVTL 3X3GL 1U58B 3TYGH 2FJFB 4M1GH 2AKRB 3RTQB 3KPPA 3KYAA 4Z8FL 4S1SL 3D0VB 4GG8B 3P4OA 1DSFL 1G7MB 4TUJB 3V0VA 5CBEB 4DCQB 3MO1B 1TVBA 4N90E 5DEFB 1U95B 3PXJA 5A16A 3O6KL 5F9JB 5D93B 2EE6A 5JXAL 2JJSC 1YQVH 4QY8A 3ZT7A 3GO1H 5BJTA 3P77B 5C6TL 5HPMB 5JIHA 3O6FC 3WN5C 4M61B 2LQRA 3KPSE 4LEOA 5DUMH 1HHKA 5I1AB 4WWKC 1F4XH 2CDEA 3WD5H 1M1SA 2I24N 3G5ZB 5JR1H 3U4EB 2X09A 3O6FD 1JF1A 4HMEA 3QFJB 1AI1H 1BWWA 3EYUH 1A1NA 5HHXL 2DQJL 1BP3B 1ZK9A 4XGZB 1KCRL 1XGPB 3O41B 1YMHA 5JXAH 2ZPKH 4ZAKA 4PJFB 3D2UB 1PFCA 2WIIA 4B53A 1DLFH 5BS0D 5H35B 2OR9H 3OKKB 4JFEE 5GZND 1QBLL 4JRYA 4FZ8L 2CO7B 2KKQA 1K4CA 3ARFB 2IBGA 3X3GH 4M43H 3CFCH 2RB8A 3C5ZC 3OKNA 1BX2A 2VL5B 4ZFOA 2XWTB 3GMNA 3VXMA 1UQSB 3PABB 1UC6A 1I9RL 4QRTB 3D2UD 3RDTC 3D2UA 2X70B 5IVZB 1G7QA 5E6ID 4HS6B 1ETZA 4QYOA 2ZSVA 2H45A 3CDGB 1Q72L 4UDTA 4X9BA 1AHWA 1NEZG 3VXMD 5KVEL 1KTLA 4MCZA 4P5KB 1NLBH 3W0WA 1ZLVK 4FFWC 5C0CE 4NKOA 1R3LB 4RMUA 3OKDA 4AK1A 3U4EA 5AUMB 4BJLA 4BKLB 4ZS6D 2C1PA 5KS9F 3KWWA 3TGXA 1JRHL 1MJ8L 3B5TA 3BHBB 3P0VL 3T4YB 1EEQA 1VA9A 3EIFA 3SDDB 4QRRD 5CZVL 3LKSA 3QUYA 5C08E 1RI8A 3OL2A 1BQUA 1FNFA 5EU6D 3WIFA 1EJOH 3OX8A 4JRYE 1JV5B 3ZKND 4X9IA 1MRDH 4HDIA 3N1GC 3TVMA 2QLVB 4JFQA 4W4OA 5J06A 3CD4A 1LEKA 2HT2D 3HR5A 4RMSA 5T1MB 5GSRA 5JOEA 5E9DA 3RQ3A 1PW3A 3MRMB 2IPKA 3CDGA 3EO1B 2X44D 3REWB 2YA0A 3X11A 2HLAA 4I13B 4YDJB 1NUDA 3G5VB 3V95A 1KEML 1AGFA 1XCTA 3U48A 3TFKC 3WE6A 2R23A 4MS8C 8FABA 2CIIB 2E6PA 1WBYB 4G8IA 2NX5A 3MODH 1CT8B 4DZ8A 2UUDH 1XR9B 3NN8A 3G6JB 2F5AH 1DUZB 5E08H 3HB3C 2VABA 4NKDA 4K8RH 1K3ZA 1T2JA 1PG7X 4L8SC 4NOFA 2XQYG 2GTWB 4H20H 1U3YA 5LCVL 3NFPB 5IBTH 3IXAB 1MWAB 1LE5B 3BZ4A 4LQFH 3IXAA 3MRCB 5F6IB 3NFPA 4L3AA 1JYWA 4ZTPH 5FXCH 3ZKMC 4Z7OF 2ED7A 3H7BB 2ITDA 2YHGA 3RGVB 1CGYA 2DYPD 2BNRE 4TNWK 1FN4A 4LLQB 4UQ2B 2E7MA 4LVOB 3LCYA 2CKNA 4OLYH 4EVNB 3CLFL 2HLFC 5C1MB 1JCKA 5AG9A 2YC1B 3ETBF 3HG1B 4JFEB 5GISL 1AGDA 3VWKC 1YY9D 2A9NH 4G9DA 1PZ5B 5FHBH 2Z92B 5CEZL 4AEHH 4QT5A 12E8L 2VLRD 4YBLC 1NUFA 2YD9A 5HGAA 5C6WH 1W2KT 1A6WH 2XICA 4NC0B 2HJLA 1FIGH 4PJEA 5GRVL 3C08L 4CJ0A 5FOBA 2I9TB 2VWEC 1C08B 4PY8J 3PQYE 3MRJB 5DVNA 1WUNT 4WGVB 1PY4A 2VZOA 5JO5A 4WUUE 4ZO6A 2EDNA 1T83C 4ODTH 4NDMA 1BD2D 2JB5L 3U7WL 4TSCH 4OCYL 4Z5RB 4OQTH 5IEHA 3SKJH 4L4VD 1CG9B 1I7RA 3BDXA 3P73B 4K9EC 4WDIA 3Q6GL 1EBAA 2R69H 1IGYB 2F74B 1U8OA 4IOIA 5DQ9A 5IB2A 4NN6C 5HD8D 3PHOA 2OTPA 4F7TB 5EZJA 3W9DB 4HBCH 1UADC 5EC2A 2R4SL 1YQVL 4YWGH 4M62H 1RHFA 4Y1AE 1N5AB 1KTLB 1I3VA 4MCZB 3AXLB 5F88A 3S36H 5I1DA 2AK1H 4HJ0D 4ZXBC 1NEZA 4MA8H 3PL6B 3L3HA 3U83A 4MMXC 5EIVA 1WTLA 1CFTA 5DD6A 2ZSWA 3MRIB 2DICA 4HK0B 4K2UL 1TJIL 4WO4A 1KCRH 4KXZI 4U6YB 4WFHE 4GRWE 2DDQH 3I84A 2CRIA 1I4FA 1V5JA 3ZDYF 1QRKA 3FB5A 4P2OA 5T3ZL 3FB7A 2EDLA 1FFPA 2EEAA 3GKZA 4DN4H 3STBA 2PR4L 4JREC 1U8NA 1HH6B 5ILTH 4U4BA 1L0YA 2O61B 5IT2L 3KJ4B 4JJ5B 5F6IC 1IGFH 3O41A 3KHOA 4JDTH 3QCTH 2Z93B 3CPLB 3FHQA 3DX7B 5EBMB 3BZFB 2EYSB 3BD3A 3VMPA 1YEJH 4ODTL 5ICYA 3ZT5A 4IM8A 5GRUH 1ADQH 2R15A 4TSAL 4D9QE 4OZIE 1T6VN 4YEEA 3E6FA 3CVHH 3DIFA 4CVZB 4J4PC 3HZKB 3B2VL 3QQ3A 4MA1B 2X7LA 3OG6B 3CCHB 3C9NA 4NM4L 4JRXD 4XBEH 1FZJA 4LL9A 3QRGL 1KC5H 1PVHA 3Q48A 2Q3AA 5DYOA 3SDYL 5C71A 3EDFA 1N6QH 2CRZA 5ADOH 1A02N 5DYOB 3TFKA 1AKJA 3ROLB 5T5FH 3EGSA 4L3EE 3RI5K 5F7LB 1YUHA 1QFWL 5L9DL 1RHHA 3HRZA 3RL1A 1KJ2L 3GM8A 3QQ3B 1UM4H 5AYQA 3S88L 1Z6JT 3HZKA 1R3HB 3WFDH 4HIHA 4W6WB 5I2IB 3E6FB 2FR4B 4KQ3L 5I1LB 5J6HB 2R2HA 1RZKH 3WFBL 2EIBA 4S1DC 4HIEB 3F58H 2Q7YB 4OLWH 5D4QA 3TBWA 1JWSA 3O4LE 4YFLI 3EDKA 4QRPE 5DLMH 2KPNA 4QEGA 2RHEA 3HPJA 4PG9B 5ISZA 3BN3B 1C7SA 1YDPA 4HH9A 2CO6B 2APBA 1LGVA 4M7LL 4PJ7E 1T4KA 1S9YB 4W4OC 4YHNA 5E2TH 2BCKB 2MCPH 1D5ZA 4HCRA 3BDYL 4G80A 4PJXB 4LLUB 5D70L 1JF5A 5DC0A 2P49B 1DQDL 2F54E 2VAAB 3C87A 1P1ZA 4ZOCA 2H6PB 3HZYB 5LKNA 3PNWB 4NO3B 2YPKB 5MP6L 1MFBL 4LRIA 4HK0A 2Z4QA 2HFFB 5LWYL 5ESVB 3LKRB 5I75B 3D3VA 5M95B 4YXHH 4TPRH 4GBXC 2XTJD 3UBXG 1T5WA 1G9NH 1FCGA 4JHWH 1N5YH 1OP5H 5K93A 3HTLX 4N0CC 1FZOB 1T3FA 3HAEB 3HI1A 3PP4H 4NZJA 2N7AA 3GIZL 4LASL 3I50H 2P42B 4M6AA 4UT7H 2DLTA 1TFHA 1ZGLP 4Y4HB 3QA3A 4ZTPL 2QHRH 3RIFF 1EHNA 4OCLC 3T3ME 3GJFA 2V5RA 3JXAA 1I1FB 1YNTB 3B9KC 1X5IA 5IVNA 1FGVL 4QRUA 1HEZA 1KIUA 1KENH 3RKPA 1U8OB 3BPLB 3WFZA 4L9LC 3VFUA 5KJRL 4N0UA 1DJSA 5EZOH 3G6DH 4M8QB 3TZVA 1UA6L 5EUOB 3QPQD 3H6JA 3SKNA 3DTXB 3U7YH 3MLPA 1FNLA 4HQQL 1DP0A 1QG3A 4OM0H 1MCQA 4J12A 4XWGH 2IQAA 3KPNB 4LARH 4D9LL 1FFRA 5H8DA 4X9FA 1PD6A 2ESVE 5F9OH 4DUVA 5I1HL 4KXZH 2OX5A 1WZKA 2DQIH 4M6NH 1FORH 1I1CA 1N4XH 4HBQA 1KXTB 4N0CD 4G7VH 1SBBA 3RNKB 5JR1L 5FHAL 2VQUA 3GSNH 1XR8B 4PJGA 3SY0A 4KK9D 4QHLA 2V2TB 2IGFH 4KKAC 1F8TH 2P45B 1CFNB 3QO1B 1HWHB 1OVZA 3DV6B 1RZFL 4P9HH 2DQHH 4HC1L 1JFQL 2ITDB 3MFFB 1MCKA 1RUMH 4FXKA 1K5NA 3QCTL 4K7FA 4OFYA 3FB8B 3S9DB 5CZXD 1YMMD 4Z7VA 1QP1A 4ZTOH 2AEQL 3D25A 4YHML 5FUCE 4F80A 4F3FB 5HVHB 4WFFE 5FK9A 3DTXA 5KVFH 4Z6AT 1NMCC 5HYJA 3QPQC 4OIBA 15C8H 4CL7A 1IM9A 1IZKA 5D71H 4G43B 3ARDB 4BFGA 1YEEH 3T04D 4Y89A 1IC1A 5CHNB 1WZ1L 4G8IB 1LP9A 3D69B 1RZFH 1V3MA 3HCVB 1X5AA 5HHOE 2BNQD 3QEHB 1X3DA 3RUGB 3F12A 2MHAB 4ZSOA 4RZCB 1E6OL 3WFCH 3REWA 3V0AC 5DTFB 1AR1D 1OGAA 2HWZL 2YPLD 4G5ZH 3EO1A 2EDXA 4XHQA 4P2QE 4CNIB 5DZOA 4IIQA 4XH2A 5ANMA 1D6VL 2HT3D 1Z5LA 3C6SA 5BOZG 1LK3L 1UT9A 4WEBL 4Y5YA 1QACA 1KG0A 3UTPE 2PKDA 1TLKA 2ZOKB 3F62A 3GNML 2OL3A 2PXYC 4JM2F 1FNSH 1G1CA 3RWIA 4ZO9A 2GJJA 1AD0B 5EU3A 1WWCA 4PP8C 4OD2A 3W2DH 5CSZA 2ADGA 1NANI 3C8KA 4LCCB 4X9GA 3DPBA 3B6SB 2E9IA 1TQBC 3SDDA 4D94A 4CU6A 2H6PA 1J0ZA 3CFBB 3QFJD 4NCC2 4NRXB 5B4MD 4Q9RH 5DUPH 3TBVA 4XB7A 2X4OA 4JKKA 3S5LA 1IM3A 4UBDD 3BMVA 1U92A 3BWAB 3WUZA 1PDKA 5DR5H 2WBWB 1P9MA 4ZS7H 2NY4C 4H26B 3Q2CA 5E99H 1GCFA 1A7NL 4NKIH 2COQA 5ACLA 1BZ7A 1AXTL 4LSPL 2VKXA 4Q6IA 3QH3B 4FQHB 3IDNA 1PKQB 5JW4R 2UZIH 5E7BA 4K07A 4LEXL 4C56E 5T3ZD 3LN5B 5IGXH 4DVRL 2VDRL 5EO1B 1WF5A 4BQ6A 2G75A 2FEDC 1FE8H 4HIHB 4WWKA 3UEZA 1M7IB 2G5BA 3OKNB 3KYOA 5E08L 2H32B 4V2BA 3RL2A 4DOHE 2FL5B 3HC4L 1A8JH 1RU9H 2R1YB 1KIRB 1EHXA 1BZ7B 3AB0B 3B9AA 1QTYT 3MJ9A 1UACH 4BZ2L 3SEPA 1T1ZA 2WP3O 4ZYKB 1KG0B 3TIEA 2OK0H 2VLKD 3CXHK 1E4XI 1XGPA 1GGIL 3ARGC 3QIBC 1J0YA 2X4OB 3LIZL 4PJBF 2JKXA 43C9A 2C4XA 4UV7H 4KI5F 3OKMB 3HZVB 1RAMA 1N64H 5DTFA 1Q9OB 3L1OL 3OAUH 1JHLH 4PREA 3ZHDA 5D1ZC 4PRPB 4DAGL 4MZ2A 2EDTA 3ALWA 2OK0L 1EJOL 4ZPTA 3QXWA 5HYFA 3TJHA 2H41A 2QADB 1OAUL 1YNLL 3W81A 3CNKA 1DZBA 3L3GA 3P77A 4XP9L 3STLA 1T7ZA 3LH2H 4CMHC 5I18L 2X6MA 3CVIH 4EDXA 2FEDD 4APQA 5D1XD 3MCKA 3D0VA 4NKQB 4XMPL 3RUGA 2D4DA 2HTKD 5I0ZA 4WENB 4WO4B 5FCSH 2VDOH 4I18C 3ZMRA 2EC9U 1XGQB 4LEXH 1SMOA 2DI7A 3WS6C 5EIIA 2IEPA 4KRLB 4C56A 4X7TA 1NCDL 2HTKC 4TYUA 3D5OF 2NX5E 2MQ0A 1MFNA 3UYRH 3VXPB 1YEKL 4XVSL 5E8EA 3AXLA 3Q5TA 3QIWC 1FAIL 1YEFH 3FFCB 3PDGA 5DR5L 3JV0A 3SO5A 4LVOC 4FXGB 4LCIH 4Z7VB 1GGCH 4X6FB 3UJTL 1JF6A 1NAMH 5HXMA 3QEGL 4YZFE 3CFCL 3FRUA 1G7LB 4JPKH 3SE9L 4KKLD 1YYMH 5GSVB 3CK0H 3HKFA 4FXKB 1T0NA 2FECI 5IB2B 5E6IC 3L3OB 5KSVA 4H88H 3E1F1 3EOBB 4HPOL 2XN9D 2NY0C 4ZUTB 5T3ZH 5IIEB 3H0TA 2IMMA 3U0PB 4LSDA 3DRQA 2OTUA 4NQVB 5FYJD 2OJEA 4JQXC 2GIYA 5D1QA 4O4YL 4TNVF 4XCCH 3TBSB 4YHYC 3PUCA 1RY7B 1V05A 3MGTA 1JPGA 3S3SA 3UPCA 3PWLA 2HT3C 3AB0C 2VLKE 3R8QA 3RDTA 5KSUB 1VEMA 3KAAA 4X8XA 3OR7B 2K3TA 3QIUA 4P99A 1BREA 4Z7VF 5FGSA 1WCBA 4J8RB 1GZPA 1AHWC 4YNYA 2Z31D 4MS8A 3BPOB 2NNAA 1BOGB 1H3PH 2RQ8A 5A2KH 1I1YB 2ZPKL 1EMTH 1U42A 1EBPA 5DK0A 4OSUL 4OTXL 3HNVL 1RJZB 5KSUA 1BFSA 1TVHA 4Y5YC 3JVGC 3QDGE 3WFEL 1O7VA 1RMFH 1E4KA 5IK3B 3MJ7A 2W0PA 5JA9A 1C12A 4HWBH 3THML 4MA7L 2OS7A 2W60B 3BH9A 3K46A 5HDQH 3ZKSD 4LSQL 5GS3A 3VXUD 4FFWD 3HZYA 4JFOB 4HPYH 1S7UB 1KT2A 3MLWL 2P43B 3D85D 4LDLB 3ZYZA 2O5ZH 2QSCL 1DSFH 4UOJA 2C3HA 2BOCB 4N1EA 4YGAB 2XKSA 3TJEL 2WBJD 1KCKA 8FABB 5ISZD 3VI3F 4J1UA 1U8QB 1MEXH 1I7ZA 1R3KA 3KXFA 1N6VA 4O9HH 4X6DA 2YPKA 1OB1A 3T2OA 3FFDB 4MJ6B 4Y2DD 3JV6A 2ZUYA 2VO5A 2DIAA 4FQXB 4W68A 1OB1B 5F71A 3QIWB 4XCCL 1ONQA 1FNGB 5BRZD 1P4IH 5E7FA 2V2WB 4YUEH 1AC0A 2FD6H 1CYGA 3ZZ1A 3LDBC 3BPCB 1ZV5A 4NQUA 4X4XA 5KSAA 5J1AB 4UTAH 4YHIA 5AEAA 1TETH 5HGDB 2EIEA 3GIVB 1LP9E 1I8LA 1JMZA 2BNUA 4DUXA 3BVNA 2A9NL 2AK4B 4XMPH 3LHPH 3RBGA 1BQHA 3MRHA 5HGBB 1BM3L 4F15C 4LSSH 2KL6A 3RTQD 1QBML 3CC5B 4U7KA 1HH9B 4OD3L 3O6LL 4G8FB 4LKXB 4WWKD 3BI9X 1GPOL 2VAJA 3S4SA 3BZFA 4JG1H 3AFLA 3ULUH 4PJ7B 3WS3A 4X5LA 1WFUA 2BMKA 5C8JA 3CCHA 1A9EB 2EDWA 1GGBL 1YPZB 3MCLL 1K4DA 4PJCB 2EIZB 1UZ8A 4OZHA 1GRWA 2R2BA 3WNOA 2BSTB 4XPAL 4MX7B 3QIUB 4F8QA 3TNNA 3TLRA 1QSEE 1KN4H 4BQBA 3MLTA 1KJ3L 4NNYA 4GBXB 4U6YA 2A74B 2F58H 1NC4A 1WAAF 4WJ5B 3MRIA 5TE7L 4GW5B 4O4YH 1CVRA 4JQVA 4NFBA 3VI3E 3H0TB 3U0PA 5IB5B 1I9JH 1OCWH 2MFNA 5K59E 2LTQC 3FB7B 2YUVA 4F37F 3QP3A 4Y4HC 4U6HA 3QUZC 4Z0BH 3TA3B 3RUGF 3G6JE 3UTOA 4M7ZC 3BZDA 5LGHH 4WHYG 1OD7A 4KJYA 1XGTA 3INUH 3EJYC 3W11C 3TV3L 3GMPB 3UJIH 3C8DA 2ENSA 3RRQA 2D0HA 1C5DA 3ARSA 4A6YH 4Z0XA 2FECL 2CUMA 1A6ZB 3H9HA 3BW9A 3QT2A 3V7AE 4M7ZB 1I7TB 2ZUXA 2OXGA 2VJXA 4GW1A 2P8MB 4X7TB 3RZCC 1VEOA 4L3EA 3LKPA 1MLCB 3FO0L 5E8NB 4FFVC 1S9VB 4M02A 1T6WA 1X5XA 1HHIA 4MWFA 4IDLA 5D7LB 5HYEA 3UTSA 4JVWA 4I3SH 4WNQB 1LK2B 5ADPH 3LKQA 4KK8C 3RHWK 2UWEB 4O02H 1T03L 3MV9A 2V2XB 3BP7A 5IUSA 3KR3H 1I8LC 4XZUB 2OZ4L 4ORGB 3VGAB 3ELAT 4ELMB 3JWDH 5KS9B 3RDTD 4YHPB 4R3SB 1G9ML 3KDMA 3JBG7 1A7RL 1LP9B 5DFVD 5KANG 4KTDH 3HI6H 4JPVL 1MHCA 3TBTA 3ARBA 4GKOA 5E4EC 2OM5A 2DYPA 4LLMB 2XT1B 5E5UB 4KRMB 4ODXB 2WNGA 1QFUH 2IAMB 4LPCA 43CAB 2Y6SD 4U3HA 2NY3B 4HUKB 4MNGB 5JPNA 5C2BH 3DNKA 2FWOB 3IFLL 4HXAH 5BOPA 1BJ1H 4ZNEE 5HJ3A 3U46A 2IADB 3I6KB 3MV7B 3RVWC 1L9MA 2B20A 5C07E 3V5KB 4PG2C 3EYOB 1QSEB 4WUUA 5J8OA 1IEHA 2GCYA 1JUFA 2FJGA 4CJ1A 4OZIB 1BQLL 3MRDB 1EO7A 5ALCL 4R0LA 4WWKB 4QNPE 5HHQA 1KTRL 5DUML 4PJ5D 4GJTB 2BDNL 4LLAA 1VDGA 3N1MC 3MLZL 3TO4D 5F96L 2P5WD 4PS4L 4HIIB 2E8YA 2FSEB 2D7MA 1T2QH 4XVUC 4YDJA 4LCWD 3LS4L 5I1CH 3EYUL 2ERJB 2HVKA 1IL1A 4NP4L 3VG0L 3IDGB 1FVDB 2VLME 1IC4H 4OUUA 3SO3B 4EQ3A 3KPNA 5FF6B 3NN8B 3S35H 4D9QD 1F00I 3RTQC 4L4TD 2QL1A 1A5FH 1CT8A 2PETA 4XP1L 4X6CF 1EERB 1IAII 1NQBA 3MYJA 3VH8A 3SKOA 3TZVB 3DVFA 4N0UB 4PJXF 3MUGA 4C54A 4FFZH 4Q9RL 1UKSA 2QSTA 1FJ1A 4NRYB 2J4WL 4R9HA 1A6WL 4YAQB 3IKCB 2WINA 4MD5A 1MFCH 3EJZD 3I9GH 2IBZX 5E6IB 5H94B 3HUJF 5LAXB 2NY4B 5MEND 1YNTA 3K74B 3OB0H 1LK2A 3UO1H 5HHMA 2AGJH 2XZAH 1LNUA 5CILL 4JO2L 1ZWIB 4YQXH 2X9YA 1I3RB 2IAND 4QCIB 4D0CA 4EUPB 1CFQB 4JGJA 4N5EA 4U6XB 4IIQB 5MERA 3AREB 2JIXD 1L7IH 5C0DB 4YAQA 4KRPD 3D1MC 3LKSB 3NIDF 1LO3H 5AYUL 5SX4I 5F7KC 1IAIL 4XNYH 4EIZC 2YD2A 1A7OL 4QF1B 4HKJB 5IVXE 5IG7A 3H3BC 4E41A 3VXNB 2R56L 3GMPA 3GMNB 4JFDA 4Z0BL 2G9HB 2BVUA 2E3VA 4PS4H 1EXUB 1RZ8B 3PV7A 3ARDA 4EIGB 1MCFA 3MLZH 1IM9B 4U6HB 4XC1H 3TNMB 4XPBH 3VXOB 5EH1A 4OZ4A 5KSAD 3MV8D 1IL1B 1OTUC 5MHSE 3SN6N 4YGVA 1FGVH 3T0XA 3L95A 1ZGLB 1JL8A 4WVRA 5E00A 1KCVL 5C0EB 1NGZB 4U31A 4M4PA 1NFIA 1SJHA 2VXSH 1AY1L 1QFWM 4M7KH 4YO0A 2B1HL 1F58L 3MFFA 3OPZL 4HFUL 2ZKHH 3KYNA 1CFNA 3T4AB 4IJ3B 4N8VB 5HI5D 4MX7A 4Y4KC 3PWVB 3VFSA 2QADC 3BKYH 5IMLB 4KWUA 5ACZA 1NDMA 4WY7H 5E2JA 1EA9C 4EN3D 3HI6L 4KFZC 5GHWL 5BO1L 1QFWI 4PB9L 4FP8H 5FM5M 4M1CC 4JY4A 1T5XB 1OM3H 5IQ9A 4TUJA 2XFXB 5D6CA 6FABL 4I3RH 3MV11 2AJYH 4TVPH 4LLVB 4WO4C 3I3DA 3KDMB 1U3HA 2IFGA 1YJDH 1JPTL 5ANME 1MY5A 3EHBD 3IJYB 4ACPA 3WEXB 4OB5L 4L3CB 3TO4B 2WUBH 4QHMB 4ORGA 4ELMA 5IKCB 3WUWA 2OTWB 2Z31B 5M94B 2GFBB 3QPXL 1FAKT 4P9HC 4OCRH 4PJAF 4YHIB 4JY6A 5EOTA 3T8XB 1EPFA 4LCUA 4Y2DC 1A7PL 1S7QA 3RY6C 1LO4H 3L7FA 3QDGB 3DJ9A 1JTTA 4GRLB 1WCQA 1P4IL 3QIUD 2X5PA 4JQXA 2AKRA 4HS8L 1B2WL 3HNTL 3WJJC 4EXPX 3QA3B 4HWUA 4FQXA 2GAZB 4L3EB 2L4OA 4ZDHA 1KN4L 1C7TA 5GGRY 1U8QA 1KCGC 1QYGL 3B5GA 4QRPD 4RCAA 1ZLSH 4ZXBD 3TPUE 2DJSA 4NO3A 3GMRA 3BQUD 2XOTA 2G2RA 5IBLD 1XIWA 4Z18A 2VDMH 5F88B 1FQ9C 1AC6A 2AJXL 4DKDC 4OM1H 1NFDA 4WW2B 1JYVA 3QDME 3WSQL 4PUBH 2Z8SA 1L7TH 3KJ6L 5EUOF 5HD8C 4M6MH 5FA4B 5FAAA 4FFVD 5I8CB 4ZXBA 4LMQE 1JZ6A 3BEWA 1OF2B 3FT4A 5SWQB 4IOIB 1HZHH 2D7TH 1T1YA 4OGAD 3QQNA 4FABL 3TH2T 3QXVA 4JKPH 4HJ0C 4RISH 5E2UL 4CVXA 4ELKB 2ARWA 3DI3B 4XAKE 3SDCB 1Y6KR 4LPYA 4ZUSB 2K1MA 5L7XH 4G6FD 3O4OC 4UNTA 4F7CB 3HMWL 4KJPD 4OQTL 4AIZB 3P4MA 2X1OA 5IB1B 4C83A 4G7YH 3U7WH 3ILQD 1B6UA 3KHQA 5F7DA 1JPGB 4DVBB 4QT5B 2D2OA 1JGEA 4JZNB 2X4UA 2R4SH 5HHME 5CKGA 3GMQA 5F9AC 1JZ7A 1BQHB 4PRAB 4KV5F 4KMQA 1M6OB 1ZA3A 1LO2L 1P5UA 3HI5L 1VADB 4K3JL 1NAMB 3VFRB 2KZ1B 3C6LC 4LAJH 4PJBE 4Q9QH 3KYNB 2NX5D 3UC0L 3KPTA 3MNWA 2P5ED 4H1LA 1ADQL 1U8MB 1QR1B 5DI8A 2A6DA 4GMTL 3CIQA 3O4OB 4JRXB 1I3GL 1FL5B 5C0FA 1EEYA 1KJMB 4G7YL 1FFNB 3ARPA 4PJ5E 3QWOA 1UB5A 3GSNB 1I8MB 1U8NB 4K8RC 4PR5B 5ACZB 1SBSH 1YEKH 4LKCA 4LLDB 3NGBB 3M17B 3V4VH 1DFBH 1JP5A 1PGRB 4AG4H 1A1MB 3T4AA 3B8SA 2AV1B 2O5ZL 1XAUA 2H2SD 1U8LB 4J1UB 3S36X 1FFOA 4N0RA 1E4KC 4UQ3B 1FFOB 2A6JB 4JO1L 1PJ9A 1U8LA 3BIKB 4BFIB 1FLRL 2JK5A 3NPSC 4GSDH 3B2UC 4HK3J 1MFEH 1SJXA 5ALCH 4TOYH 5BV7L 1QRNE 4KHXL 1HSBB 4QHUB 4KUZL 1K2DA 4ZO7A 1BVZA 3QXDA 2P1YA 4JFOA 3PQYD 2R9HD 3NPSB 3RWFB 4KKBC 5IBTL 4HDIB 4ZOBA 5JW5B 1QO3A 3KXFD 3KPOA 1Q9WA 1S7VB 5IHUH 1U3JA 4X9HA 5B3JF 1T7XA 3MRPB 1JHTB 3WDHA 2ADJB 1MCEA 2X2YA 2PTTA 2R4RH 1CFVH 2DLHA 5H2BB 1QR4A 3OKEA 5HYQB 4N5ED 3QIUC 1DBKH 3I2CL 5JMRA 4S1QL 3PJSA 3EOTH 4OCYH 1EO5A 5EN2A 4P59L 2XQBH 1GGCL 3VRLF 4Q0XH 2ICEB 5MENA 2XWBB 2OZ4H 4X98A 5I19L 1N3NA 2UYLB 1JRHH 3D0LA 3B9DA 3IT8D 5I17B 3ESUF 5EFIA 3N9GH 5IEKB 3CAFA 4R4FH 3FAWA 5GGTA 4P2YA 2DLIA 1M7IA 3G5XA 5D1QB 4KU1A 1J05A 1WIPA 2V5TA 4G3YH 5GPRA 4NZRH 3BMWA 5JIKA 3GSXA 3P11H 3VFMA 4K3EH 3CFKB 2H8PB 4OZIA 5FDWA 2AJZA 3FO0H 4LP4A 2WAHA 5IMMA 5SWQA 1MHPL 4HW6A 5KSVB 5DO2C 2I5YH 2Y5TA 4D9RD 3WIHL 3RWHB 3SE8H 4H26A 3T08A 3ULUF 3VD4A 4Y4KD 3SE3A 3VXSB 5DVOA 1GGTA 4MNGA 4LNRB 1ZS8A 2BJML 1XFPA 3R1GH 4LOUC 2GJ6E 2B8OT 4Q2ZB 2VSCA 1JGLH 4GRWB 2DQFA 5E6ZA 1A9BB 1DLFL 2APXA 5D7IF 1WITA 2AJYL 3BP5B 1FO0A 1LDSA 2NX5B 3GRWH 2ESVA 3CGTA 4LLWB 2AJ3A 3VI4E 5HJ3B 3U46B 2BVTA 3VD5A 2CMRL 2AJVL 1NCCH 2GK0A 3NZ8A 1Q94B 2EICA 3RAJH 3QCUL 5EBWB 2DBJA 2GHWB 3EOTL 2Q8BL 3L7EB 1IQDB 3L5JA 2PF6A 4JN2B 5C6PB 5A16B 3VXQB 3DX9A 2QR0B 5MEOA 4PTTA 1ZOXA 4QOKA 4S0SD 4GS7C 3M1BB 4XMKH 5SX5H 3TZVD 1JGUH 2FJFA 4KK6C 1EV2E 4GO6B 2DQDH 2EKSA 4HG4K 4CKVX 2JJUA 5CILH 1T21A 5IOPB 4X99B 5CCKH 4F8TA 3MREA 2YXFA 3MXWH 1FL3A 5T33H 4M8VA 1JK8A 2Y7QA 4PV9A 2UWEE 4PJXE 3TBYA 4F3FA 4KI1A 4NBZB 3ARGB 3QIBB 4RA0C 5E99L 1X5JA 1JNHB 4RFOL 5FYLL 1ZXQA 2W1NA 4ODUB 1XGRA 2FRGP 1RULL 5C0IA 1T66D 5FKAB 2D9QB 5CWSB 3N0PB 5D5MB 4CUCA 3O4LB 3MUHL 1P4BH 3KPLB 2MKWA 3M07A 1HKFA 4HCRL 3T2NH 4JQIH 1J11A 1SY6L 1HQ4B 1TMCB 5DRNA 1UQSA 1NL0H 2XWTA 2VLKA 2QV2A 1MCWW 3O9WC 1A6AB 4QXUL 4KJYB 5F1IB 4F58H 1MQ8A 5T3XH 1DQLH 5IEKA 5ENWA 5DRXB 1Q9LA 4X6DE 4ONGL 4JRYB 1CGUA 4ETQA 1NBVH 2AEPL 3PL6D 4GQ9H 4MLIA 3TZVC 3ZDZE 4AH2A 5C0EA 3BKMH 5LGJA 3CXDL 3EFDL 4PJCA 4L9LB 1DBBL 5FCUH 5E8PB 3DUSB 2DOCA 3CFJB 4I48A 5GS1B 2X89D 3EFFB 4KMTH 1IM3B 1G9MC 1P7QB 4U1SA 2PTTB 4IS6A 1P7KA 4FABH 2B1AL 2A6KA 3A6CH 1DVFC 3QUXA 4NNPL 3U30C 2JIXB 2HMID 3C8KB 3S34L 1I8IB 5C70A 1Q9WB 5GGRA 1UYWL 3DMMD 3WDJA 5DJXB 1W72H 1T66C 2VXTL 5D9SA 1ZANL 4HT1H 3TFKD 3IFOB 5JIPA 3O3EB 5CJXC 2FJHA 4KI5C 4FQPA 4KRPC 2VXVL 2RGSA 4QY8B 2R29L 4R4BB 4X4MA 5IMOB 5I1IL 4XH2B 5ANMB 1BFVL 3V4PL 4QHUA 4GS7B 1MHPH 1IKFL 1A64A 3GUTB 3AC0A 1M4KA 2Z91A 2D9CA 5IBLC 4NQCA 5KSAB 3VGAC 3O9WD 4CDHA 3I02B 1BVKB 3MACH 3RTQA 5E6IA 3N06B 1KTDB 1ZHLA 5H94A 5LAXA 5T1DH 5D2NB 2FX7L 3K3QA 1IAKB 2BJMH 4KTDL 1G7IB 1A4JB 4WV1A 1AGBB 3OGCA 1C16A 2BZDA 4TSBH 4GXUN 4NZDA 3IFLH 4ZG1A 5GZOD 1OP9A 4ALAL 1I7ZB 2OI9B 4PLJD 4MD4B 4DW2H 5I19H 4HS8H 2XYCA 2PCPB 3WLBB 1KGCE 1IGML 3IDXH 2HVJB 4MXVF 1FNGA 2OSLB 5ABDE 5IR1B 2FO1A 2A6DB 3WNLA 4RGNE 3VFVB 3NCCB 5D7JD 4OZHF 4G9FD 4LLYB 3T77A 4HHAA 1LEGB 4IOSD 3WS6A 5HYJD 2J8HA 5IVXA 2M2DA 5JPMA 1CZ8L 5DD1H 2WBJA 4UT6H 3MJ7B 1MHEB 4G6AC 2V9TA 1C5CL 1F90H 4WUUB 3MJ8B 1CD0A 1YMMA 4HJJL 4TNWF 1IAOA 4CMMB 5TQ0L 4O2EB 3Q6FA 5IFHH 2B7DT 5CJQL 5GRWA 3I2CH 1RIHL 4ZD3H 1F97A 3MJ6A 1J86A 1AJ7H 3P4LA 3QWQB 1FGNL 1OAQL 5FV1L 3MYZA 4HMDA 4P2RA 5KJRH 2VKWA 4HJGA 4QNPF 1HHHB 1FYTD 3T65B 3X17A 2UZXB 5SWSB 4JFDE 2VDPL 3MLUL 2FIRT 1AGEA 5J3HD 4TPRL 4JY5H 1MI5B 1MCIA 2HRPH 4TVPL 3SKNB 4ODXA 1CICA 5D7SH 4N0CA 4OZGA 3D39A 4BK4A 1PG7L 1FPTL 4PRIB 4EKXA 1V7NH 2FO4B 4OZGB 4JDTL 3V5DA 1F58H 1DVFA 3QUXC 3VD9A 1ORQB 4HF5L 3ECBA 5GS1A 3U0TA 1X5FA 3QAZC 4LSRL 1CF8H 2W0FA 3TIDB 4YBLB 4I4WB 5FKPB 3GI8H 4XNZB 4PJGF 4RMWA 1VGEH 1FVCA 1DN0B 4N8CH 4PBWD 2ATPA 2BOBB 3VU2A 3QDMB 1IGJB 2P8PA 1TCMA 5F3BB 5DZNA 4JM4L 4P3CL 3FTGB 3VFWB 1DBML 1FZMB 4I1NB 1L0XA 5FCUL 5DD6B 4P23C 4Z7UE 3LKRA 4PJIE 5A40E 1URLA 3UPRB 3K80A 4KUCD 1OAYH 2ZUQC 3ZKMD 3B9KD 5E2VL 4ZPVA 1UVQA 3HC4H 3O3DA 3A6CL 4NNPH 4Z0XB 3FONB 5IR1A 1G7LA 4NWTL 4UT9L 3WHXA 2FBJH 1G7PB 5AD0A 3VFPB 4NUGL 2AGJL 2XZAL 4DKEL 4U1HA 3SDCD 3GM0A 4YC2B 5J7CC 4KVNL 3GFUA 4CADA 3ULVL 2GFBA 3MV7E 3V5HB 5BV7H 1BVLA 1KFAH 4PJHE 1U9KA 3H9ZA 3TBWB 4MQSB 4TVSa 2NY5L 2L7UA 2LVCA 4C4KT 2YD5A 3IJYA 2JELL 2VXQL 4EN3C 4ONFH 5E1AA 5JXEA 3DUUB 4CMHB 3V6OE 3G6JF 4JDVB 5ETUA 3DYMA 3UTTE 1R3HA 3BIBX 3VDAA 5DJ0A 4FQXC 2YUXA 4W70A 4DKEH 5FECA 1OSPL 1MI5A 4R4ND 4Q58C 3IFNH 5MEPB 3T65A 1KELH 2Z8RA 4F7PA 4OTXH 2FLBT 3FMGH 4LBEB 5KN5A 4MDIB 5AZEH 2NXYD 1B4JH 4YZFF 2BDNH 1OAYL 4NSKB 4XBPB 2O5YL 2YA2A 4WFGD 4TQEL 4PJIF 5KVDL 3BN9D 3RL2B 4G5ZL 3R4DA 2P24A 3QJFA 2D7OA 1P7QA 4KMLB 1U8HB 3QHZH 1TZGH 4R2GB 4PJFF 1F13A 1MCRA 4JFDD 2YZ8A 4RISL 1OARL 3IVKB 1W0WB 1YEGL 3CFJA 4H8WH 5DSCB 1JTOA 1QSFD 3S37L 3D87B 3BVNB 4L29B 3OXSB 3QH3A 3D9AL 4NJAL 2ZOLB 3S35X 2OSLA 2ICWA 4IRZL 4XC3H 5E8OB 1T0PB 3WKML 3MRQB 4L9DA 3KYOB 3OGOE 3GSXB 3JZ7A 1WBYA 4F33A 2IANA 5BV7B 3VCLB 4OCNC 2R23B 3B5HA 4K3GA 1MCPH 4XCYA 3ARRA 1ONQB 3L3DB 2VOTA 2K7QA 1S5HA 2ZUWA 5C0BE 1UWEL 4P3DA 2IGFL 2L7JA 1KXVC 3QPXH 1X6LA 2ARJQ 5J3HC 3QUXD 3KJ6H 4HD9A 4YC2C 3R1GL 4Y5YB 4U7MA 2X4NB 1Z5LB 3C6SB 1V7NL 4M6OH 3QEGH 5ITBL 3NCYP 1CFBA 4L1HA 1IGJA 5I9QC 4P4KA 1MLBA 3QUZB 3TA3C 1G6RH 3CFBA 3V52H 2FH8A 1NC2A 1BQHG 3O6FA 3K0WA 4QGYA 3WN5A 5KZCB 4GRMA 3WL9B 1YY9C 2HKHL 2OMBA 1EVUA 4BH8B 1I7RB 2ADGB 3U9UA 1S7RB 3NAAH 4GLRH 2JCCE 3KPOB 2Q86A 1LD9B 4NDMB 1DTUA 1NLBL 1B4RA 5K33A 1E27B 1MIMH 1AJ7L 4P4RB 2QJDA 1I3UA 3MXVH 2NMSA 5L88H 5IP4A 3O81A 4GFTB 1P7KB 3NGBC 2IALB 5FF6A 2HJFB 5MEOB 4R6UA 5ITFB 4FFYH 3MV8B 1T2XA 4K8RL 3EFFA 3WIHH 4IOFD 3DUHA 1JGVL 3E8UL 3O11B 5HGAB 5C0BA 3LQAL 3LV3A 3VE0A 5EUKB 2ID5A 2GK0B 5EB9A 1G1YA 1BBJA 4U33A 3L9RB 1EO8H 4K7FB 1I9IH 2YD6A 1BD2A 3LRHA 4D0DA 1JYXA 1V3LA 4DGIH 4JFYB 2AV1A 4G43A 1KIQA 4XPFL 4WCYL 3MACL 2D7PA 1HQ4A 3ARGD 1JPTH 3QIBD 1EGJH 2ADIA 1RD6A 2IAMC 1R5VB 1YYLL 1JRHI 3ZDZF 5JW4N 4ZFZA 2YRLA 4JO3H 2FWOA 3KPMA 2H2PC 2VZ3A 1YMHB 1W72B 2RBLA 5CWSA 4XMLL 4M6OL 5ITBH 2Y06H 2EH8L 2PO6D 3DV6A 3MV9D 4WTZG 1D9KB 5KAQF 32C2A 3IDJA 1M6OA 1ZA3B 1KGCD 4UMGA 3FT2A 3QIBA 3ARGA 3NABH 1U6AH 4TOYL 4WI3A 4JFHD 3BKYL 3OF6D 1QSZA 1A6VH 5F8QC 5E8EB 2O5YH 1OAZL 3UMTA 4NHCH 4U0RB 2AV7A 3FQRA 1BEYH 3OV6A 1YPZE 4UINH 5F7DB 4DVBA 3IU3B 5L2KE 5C09A 5EU7C 4C83B 2Q8AL 4KTYA 2Z8WC 1WIOA 2X4TA 2EDJA 3MRMA 1TZGL 5BZWA 1HHJA 4NHUE 3CXDH 2J6EH 2HN7B 4CRPA 2DAVA 1BVKA 3PGFH 3GBNH 2V5MA 4KI5E 4NQED 5F7EL 4K94H 5TPWH 3MCKB 4CW1A 3F5WB 4UBDC 3SGKA 1KEGH 5TH2B 2FGWH 2VR5A 1ZTXH 4FFEX 2B1AH 4OGYH 4DN3L 5FYJE 1S9VA 5H2BA 3FFCD 2YWYA 5KOVC 1I1AA 3ZL4L 3OAYH 1HN1A 4Y4KA 3O3EA 1AE6H 1UH4A 3HFMH 4P5MA 4QGTA 3PWNA 1UXWA 1WJ3A 1VACA 2HTLD 4WI4A 1UM6L 4X5XA 4RX4A 3PGDA 3C5ZB 3BP5A 1YEIH 4WGWB 5TF0A 4KGLA 4EDWL 1I75A 3PXHA 4XHJD 3IS0X 4I9WE 1RUKH 1NFDB 4WW2A 5E2UH 4I0KA 4WEBH 2XI9A 2DQJH 1MH5B 1FRGL 4QXGL 4YHOL 1D5ZB 5DJ8A 2X4NA 3HPLB 1D6VH 1VGEL 1T1ZB 5JOFB 3UO1L 2BNQE 3OJ2C 1KSRA 1P4BL 1ULVA 3ULVH 1F5WA 3HE6A 3QCUH 2JB6A 4MA7H 5ESVA 1JI1A 4NO0B 5J57B 3FOLA 3L3KB 4MNHA 5K9QG 3QXUA 1NKRA 3QWRD 3GMOA 4G80B 2BSTA 2VC2H 1JGDA 1TJIH 1UWXH 5DK2A 1S9YA 1MJJA 1NFDF 2X9WA 2WUCL 3KLHD 2E27H 3R06B 2DQGL 3U30B 5FO7B 2ZOLA 1GL4B 2J2ZA 3FAXA 1DBAH 4RBPH 1Y6NR 1QVOB 5D5ME 2D0GA 2NY6C 4L29A 2CMRH 5T3XE 3MBXH 2DWEA 1YEDB 3U0WL 3PQYA 3UTZB 3IAQA 1JGVH 3E8UH 1NDGB 4D9LH 5BW7A 4PRAA 1RJYA 4NQDD 5GRZA 1T03H 2ICWJ 1RVFL 2VWEE 1BQLH 4PV9B 4K3EL 3DGCR 5KSAC 1MRFH 1JGEB 2BC4A 3BAEH 5FGCE 2Q7NA 3VGEA 4HKZA 1KPRB 2OI9C 3INUL 1VB9A 4DGIL 1FL6B 1D7FA 4LHUA 2DM7A 5DJAA 1B0WA 3Q1SH 1GYAA 2FEEL 5IOPA 5JOPD 4NZUL 5E56A