5E6IC

Crystal structure of tcr pf8 in complex with flu mp(58-66) epitope presented by hla-a2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
258
Chain Sequence
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWDTELVETRPAGDGTFQKWAAVVVPSTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TCR PF8 in complex with flu MP(58-66) epitope presented by HLA-A2
rcsb
molecule keywords TCR alpha chain,Human nkt tcr alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 38
structure length 258
sequence length 273
chains with identical sequence I, M, R
ec nomenclature
pdb deposition date 2015-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e6iC02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e6iC01
1BZ7B 5E8EB 2FX9L 3OMZA 1LK2B 5I9QB 1U95A 2AABL 5C0DB 5GGRA 3DGGB 4I77H 4HH8A 4LCIL 3C08L 3QIBD 3P9LA 1G9NC 4L1HA 4FQXD 5F6HJ 1SM3L 1UA6L 3C6LB 3QNZA 2DM3A 3I2CH 1FZKB 2AXGA 2R2BA 5FYJL 1FL3A 3O6FC 3O0RL 4QRRD 5E0QA 4OZHB 1UM6H 1YQVH 2ZUQB 2PNDA 5F21B 3D3VD 3JWOC 5J12C 4WV1B 1VGKB 2ERJC 1G0DA 4MAYC 4UI2A 3CLFH 4RGOH 4IRSA 4P57A 1TTUA 1QR1B 4Y19E 1Z3GL 2FO4B 2FGZA 3IFPB 1GAFL 4WHTB 3NTCL 3C5ZD 1EO5A 5EOTA 4DWHA 3QWOB 1AJ7H 5ACZB 5D6CB 4KDVA 3HE6A 1FZOB 3KYOB 3MBXH 3OKNA 1G7QA 3IXTA 4JFQB 2XQYK 5I0ZA 2RFXB 4JFYA 4WO4A 4RGMC 4KZDL 4YC2B 5D7SL 1K4DB 1RIUL 3KPLB 3KPRA 1M7DB 2VJXA 3V79C 2IG2L 1SVZA 4NWTL 5CILH 5EZLA 4KRNA 5HYIA 1VB9A 1CG9B 4G8IB 2NY0B 3W82A 2M2DA 4L29A 1WK0A 3L5WB 5DQJB 2GHWB 3TCXA 4NZRL 4OAWA 1ULVA 2FSEA 3BZFA 2N56A 3IFNL 3WV0A 2V2TA 1A2YA 1V7NL 3DVFA 1NDGB 1AE6L 5IMOA 4YPGA 4N0FA 4L8SA 2IADB 5CZXD 3LV3B 2VLKE 5IVXF 4KJQC 1BD2B 2AVGA 2EYTB 4YHIA 4LLDA 4AEEA 5A3ID 1UZ8B 4LARL 3FQWA 3KPNA 5IG7A 1T6VN 3IJHA 1RZFH 1G7LB 4UILH 5LCVH 1A8JH 4MDIB 4NQEA 4HS6B 1WZKA 5I71B 2BOBB 4Y16B 3VFGH 2A0LD 1UJ3A 3AS0A 1F58H 3ARGD 2DQFA 1I9RH 2PXYC 1RZGA 4LIQH 2BC4A 2CLZB 5DS8B 3U46A 2HVKB 3LRSB 3RIAF 5IQ9B 3QQ4A 3D87B 2E6PA 2KKQA 5CP7A 5LBSL 3QHZL 1MJ8L 1H15B 2EH7L 4NJ9H 1HIMH 1MY5A 1D5XB 1QBBA 2IANB 4MLSA 4FFWD 3E0GA 4W6YB 4MJ6B 4LCUA 2NZ9C 3ILPA 3WDIA 3MOBH 4W4NA 1B6UA 3HZVA 2CK2A 1I1AB 3GUTA 5DRXB 4ENEC 3RVTD 1HH6B 2VSCA 1OY3B 2IPKB 4N90E 3P0GB 1DBKL 2VL5A 2BSTA 4M7KH 5KOVC 5EC2B 3B5TA 3DPBA 2HFFB 1UWXH 2FCBA 2FR4A 1ADQA 4P46A 1CF8L 5ACLA 3WS3B 4MA7H 2WIIA 3G9VA 2ZCHH 3LB6D 4PJFE 1XF5B 1GGTA 4RAUB 2OTWB 1SJEB 3BPOC 5D2LB 1BIIA 1U8MA 1EFXB 5DR5H 5CUSL 4R4BB 1CL7H 3P3YA 4LVEA 4R4FL 1J05A 1C5CH 4LDLB 4Z78A 3UTTB 1JI2A 3EFFB 2DQUH 5TPWL 2H1PL 2KBGA 1QBML 3JV6A 3ULUC 2GJJA 4PY7B 4PB9L 1JF5A 1FPTL 4JFFB 3AREB 1MI5B 4KHTL 1KTDB 3H42H 4BZ2L 4MQXD 3C09B 3QH3A 4ODWB 3RBGA 1RULL 4FTVB 1UXWB 1R5VA 4KMLB 3H0TB 1A0QL 1EXUA 1MRDH 2R0ZL 5KSVA 4TYUA 3F8UB 2P4AB 3RDTD 5DQ9B 4HKZA 1LO5A 4GQ9H 5D1QA 3U30C 4D0DA 3HI1B 3L9RA 2N7AA 4NNXA 2A6IB 5IVXA 3PABB 2AK1H 4GRWE 3K2MC 1JGEA 2X4UB 4F7EA 4AIOA 3BSZL 3DV6A 3RNKB 2R69H 1CLYH 5KVGH 4ERSL 2XWJA 4HG4J 5DHYA 4OZGF 1MFBL 3CFDB 5IT2L 1T0PB 4AEFA 4L9DA 4FOMA 3TVMB 2EE3A 4A2LA 4E5XB 1DQTA 3HE7A 1CK0L 3U0PA 4OF3A 2J8UA 3S9DB 4PLKC 4WFGE 3MUGA 3LEVL 4JZJA 3HNTH 5C0NC 1RUQH 1TJHL 1EJOH 2NTFA 1YN7A 2W0PA 1UC6A 2ICWA 5MP6H 2AGJL 1A7QH 4XNXH 5BOPA 1ZTXH 4LL9A 2APBA 3O41A 1UCBL 4WI8A 5MEND 1R3KB 4KMTL 3KWWB 3V8CA 3GMQB 2VLRA 1M71B 1MAML 4CDHA 4YBHA 5BS0B 1VKXB 1FL5A 2W60A 2ZG1A 4YIQB 3PWPD 4RWYL 4NRYA 3PWVB 2OX5A 3QZWB 3RPKA 4NPYA 1CN4A 5JUEL 1OWRM 4XPAH 4XX1E 1F11A 3DECA 4ALAL 4KVNL 5HHOA 2UZIL 1D5MA 4IRSC 3BKMH 5IFAH 4WCYL 3GGWB 5T3XH 2AJVL 3CFBB 1D9KA 3HE6C 2F8OA 3T2OA 1I8KB 1YNKL 3MCKB 4ZAKD 5T1MA 5EOCJ 5T1KB 1K8DB 1VFBB 4WO4C 1A1MA 3I6KA 3ULVD 4R90L 4UTBH 3G6JE 1FV1A 3ZDXE 2D7OA 3BQUA 3MA7B 4K7PH 2DD8H 1RJZA 4RGNE 4YXKH 4Q9QL 4OV5B 3WXWH 1XAUA 3SDCD 4QGTA 4W6WB 4N0UA 1IAKA 4HUWB 5EBLB 5FA3A 5DHVA 3VGAB 2VITA 3GMPB 4LSTH 2ZUUA 3UBXA 3VDBA 5AAMA 4HS3B 3CLEL 5IESL 4JFHD 5FM4A 2DQDL 2OTUB 3KYMA 3SJVD 3DURA 3P4OA 5JZ7D 3SDAB 2IBZY 2IQAA 4L8SC 1QRNB 3TO2A 5GJSL 4CN4A 1EJ6A 4YX2L 4UMGA 3EDFA 4NDMA 1X5HA 2F53B 4EDWH 1XF4A 5DTFA 2GI7A 3I3EA 2JJWA 1T2XA 1JPTH 4G7YL 1TPXB 2LVCA 1IAII 4CUCA 2FBJH 4F8QA 3OKLB 4NQCA 1UJ3C 4L4TA 3WJLA 4C58B 1N64H 1JHLL 2YPLE 4WUUE 1JPSL 3DRQA 1L6XA 3V5DA 2YD4A 2CKBL 2DWEB 2XZAL 5J6GB 1WWWX 4OZGA 3T4AA 1LWRA 3U9PH 5A16A 1WV7T 4KROC 1VEOA 4TVPL 2YK1H 3UX9B 3OL2A 5T5FL 3FMGL 4HT1L 2QQKH 2WBKA 1PX3A 4HK3N 4AQ1B 4YR6B 3R06B 4G9FB 1D5IL 1JZ3A 2W0FB 1WIUA 3QCVL 5JMRA 3QAZC 5DT1H 3RGVA 4TUJB 5CD3B 1G6RL 1NCCH 2A9NH 1ZA3B 2B7DT 3BKJH 4OD3L 1ZLWH 2ZUXA 5C0BB 1B90A 3FQRB 5LGHH 5CS7A 4LCYA 4U1GB 3F12B 1HHJA 1S7TA 4JHWH 5CINH 2CK0L 3NA9L 4MD5B 3MRGA 4P46C 3CCHB 3TIEB 1Y6MR 3MLWL 4U33A 2AXFB 2GIYA 3W9DB 1OQXA 5KSAD 2C3HA 5D7IE 4OI8A 2VZ3A 5DJXA 3JZ7A 1UEYA 3MGTA 4BKLB 4HW6A 3MO1A 3H3PL 3ALWA 4XNYH 3WYRA 4DGIL 3UTSA 1FLTX 3CZJA 2JJUA 3CFEB 3W0WD 2IF7A 4M5ZH 4X7SL 1L7IH 1NEZA 1F6LL 3V4VH 1NPUA 2QJDA 1MLCB 3SPVA 3TA3D 4NHUA 1T03L 4IOIB 1BQLL 3VD7A 3FB8B 3BUYA 3QUXB 5HI4C 1CE1H 3ZKMD 3QJHA 4ZS7H 3TC9A 5CD5C 5B22A 4JG1L 3S34L 4K71C 4NKDA 2DLGA 5B39G 2G2RA 2Q6WB 4ZSOB 1L9MA 4QRRE 5EFIB 1SY6H 3FONB 2DYPB 1NLBL 1KOAA 4HS8L 4P3WA 5J56B 4Y2DD 1JNLH 4WIQA 3D3VE 4OZ4B 4NHCH 4MMXC 3VW3H 4X6DE 1X4ZA 5DMJB 1GH7A 2OQJB 3VU2A 5BQ7B 3P73A 5GZND 1B0RB 3TESA 4ZUUB 3Q1SH 2C7UA 3VD5A 5B8CA 2VXUH 5D1QC 3OR7B 4MJID 4PJAB 5DD6B 2HN7B 4NM4H 5KJRH 1BFOB 3N9GL 2O5XL 3FJTA 1U2CA 3HZMB 4GKOA 1ETZA 5IVNA 1A7OL 1E4WH 2W38A 5CGYD 3RL2A 3F5WA 4DZ8B 3KXFD 4OZIF 1HSAA 2P5EB 5I8KL 3PIQA 3ZYZA 3JV5A 3ARRA 3ECBB 3GIVB 1KENL 2B1HH 4E9LA 3SKJH 2CRYA 4XHJC 1U3HB 3HE7C 3QJFB 3O11A 3MODL 3O8XA 3M17B 5F9JB 3WKML 5JOFA 1FH5L 5HVFB 1P7HL 4GBXD 4JKKA 3VFNA 1KF9B 1JWMA 4JZJC 4ZPTB 3H9SA 3WFDL 3S3PA 5D7JB 5I16B 1HHKB 3BEVA 4PREA 3OG6B 4RDQG 3QCTH 3OAUL 1ZAGA 1U8KB 2ESVA 1JPGB 5ALCL 1E28B 1UCTA 2VR9A 3CUPA 4D3CL 4Y2OA 1FIGH 1FL6B 1EIBA 2D7MA 3ES6A 3AY4A 1JRHH 3NH7H 4NQDA 2BY3A 4PJBF 2CPCA 1X5LA 3EYUL 1PG7H 2A83A 3GO1L 4K3EL 4GW4A 1NBVL 2NY6B 4WHCA 1IFHL 1FN4B 4JHAL 2F54D 1CL7I 4JGMA 3HMWH 1AR1C 5FO8A 2ZCLL 1A6TA 1DFBH 3BPCA 4FS0A 5A2LH 5E00B 1D9KC 5J06A 3SE9L 5HJ3B 1BZ9B 5H8DA 4K7PX 1W2KT 3LQMA 2RB8A 4E0RB 5SWQB 1FCCA 1QHPA 4YHMH 1MCBA 3OHXB 4H1LG 1CLZL 3BQUC 4OLZH 1LO3H 1KJ2A 2APXA 1NC4A 2CDGB 5ERWA 4TNWK 1JNNL 3RTQA 2VIRB 1A3QA 4ORGB 1TITA 4PJ5D 1X5GA 3SE3A 3RVWD 2VDOL 2NX5B 3P9MB 1Z9OA 25C8L 1NC2A 2GJZA 2FWOB 4LLQB 2VR5A 2X5PA 1WBZB 3D69B 5E2TL 4HWBA 3FB5A 3WNNA 5D8JL 1CCZA 5TF0A 2DQCL 4OB5H 1E4XL 4ZXBA 3NCYP 5C0CD 3K46A 4LLUB 1OQOA 5F96L 3OG4B 4Z7OF 3G08A 2VDNH 4JE4B 3CFJA 3MBEA 4KDWA 1QVOA 2B0SL 3MRKB 3WJLC 4RISH 3JTSB 1FC1A 2I25N 1QLRA 2PKDA 2VDKH 4PV8B 4XP9L 5ILTH 4OZIA 3KPPB 3IXAB 1W0VB 4G8GD 1YMMB 2XY2A 4LLAA 3BYYA 3TBWA 3PXJA 1T5XA 3L3JB 4BH7B 4TTDD 3MACH 3F7YB 2R39A 2AK4A 1XF2B 4P2QD 1F2QA 3V4PH 3RGHA 1IGJA 2B2XL 5GSVA 1BF8A 1C5DB 4L3EE 2BJML 3WIIL 4DOHE 3BO8A 5I2IA 3ZKXB 1WF5A 3FTGB 1C7SA 1VPOL 1XFPA 4H1LH 1WISA 4HFWB 5JQ6H 3AVEA 2G5BB 4UIKL 2LV4A 1I4FA 3KAAA 4TULH 3RGVC 5BW7A 4EUPA 3HC3L 1FBIH 4ZUWB 2ED9A 4OGXL 5T1DH 5DO2D 2DI7A 5MEOB 4WW1B 3IS1X 4R3SB 1DUYA 3RWCB 3S37L 4KI5D 4J1UA 4NUJB 2A9ML 3NFPA 1SEBB 4M03A 3SKMB 5DJ0B 2NW2B 1Q72L 3KG5A 4LPCA 4PJBA 1IAIM 4Q6IA 4AIZA 3MXVH 4H5SA 5D7KD 5I73C 4K3HA 2E3VA 4L8DB 5DD3L 1P4LB 4NKIL 5I1HH 3DJ9A 4Z7WB 3ROLB 4FZ8L 2ZSWB 1IE5A 5IKCA 1CI5A 2ORBH 4L5FL 4PGBB 5K59E 1LEIB 1D6EA 5E4EB 5MENE 2JIXA 4K7FB 2WNGA 2PTTB 4ELKB 3GMMA 5SWZA 4UTAL 5EUOA 5FUZH 4HJGA 3NCJL 4XBGB 3P77B 4I4WB 1I3RA 5A2JH 3BAEH 2EKSB 2Y5EA 4BH8B 2F19L 3V6ZB 2FO1A 3GSOB 1AFVH 4LSSH 5HYEA 4Y5XB 5EBWA 2ZOLA 4PJIE 2BY1A 4NRZA 1NGQH 4HK3J 5TDPA 5KAQG 4JO3H 5FCUL 3V7MA 4NKOA 5IHZB 1DN2A 1J1XL 1W8OA 3WO4C 4JJHA 1Z5LB 1K4CA 3IT8D 3H3BC 2VISB 4Z5RA 4OSUH 3N1FC 5B8CC 1GGYA 3L3GA 3P11L 3PWNB 4OCWL 3QUMA 4KRPC 3RL1B 5KW9H 3DYPA 3ULVE 3E2HA 2QV2A 5FV1L 4R0LB 2OSLA 4XPBL 2C1PB 1FVCB 1W8NA 1JNHB 1QZ1A 3G6AB 4KKAD 1ZSDB 4ELMB 4JVPA 5GRJH 3RUGE 3TCLB 1J11A 4NQXA 2PO6D 1T0NB 1QO3A 4DEPC 1B4JL 3IFLH 5T1LA 3SO3C 1NMBH 5E8DH 4JFHE 4QXWA 4L4VA 5FEBA 3O8XC 5C09A 3SQBA 3SJVE 1A22B 3O4LA 4RZCB 1F6FB 2E7LA 1CTOA 3AUVA 4HFUL 3A6CH 2Q8AL 4JM4L 4JRXB 4KKCC 3MNZB 5IJVB 3LHPL 1KTLA 1Q9WB 4NZUL 3O45B 5H2BA 1VGEL 4QHKJ 3MLPA 1U8OA 2HLFD 1QSZA 3ARUA 2FJHB 2YBRB 1PG7X 4O51B 2FD6H 4HUXB 2CDFA 4K3DH 4PRID 2VXTL 4AENB 4OGAC 3MNWA 3AY4C 2NZIA 4OQTA 4JANB 2BVYA 4P4KD 4ZTOL 2HG5A 1QRKA 2EZ0C 1JYNA 2OJEB 2X4QA 2GY5A 3IU4H 5EU6B 5B3NA 3K8MA 3TBYB 5IB1B 4WVRA 4XX1G 2Y6SC 3U9UA 2CD0A 4I0KA 4XMPH 1ZHNA 2XT1B 4OJFL 4ODVH 5TF1L 1HI6A 3RVUD 3QEHB 3OWEA 4GRWH 4JO1L 4XPHH 3BGMB 5C0EA 4PR5A 3VXRD 1BJMA 4G42A 3F62A 4C56B 4OCSH 4AEIH 2MMXA 3MRHA 2X4TB 3M07A 4P23B 4DFHA 5JHDD 5B39B 3QFJA 2DQJH 5EULV 4M1GL 3DO7B 3QDMB 4YDKL 1PZUB 4ODUB 4YDVB 3HPLA 1XCTA 2BNQB 1JGDB 3RTQC 3WEXA 2Y36H 4PJEB 5IB3A 3SE3C 3QRFM 1DUZA 4Y4HB 2YC1B 5EIQA 4JGJA 2QBWA 2DTML 1PQZA 4IS6B 3PF2A 5E8OB 4X6EA 3T0ED 1RJCA 1PY9A 3ZSSA 2EDHA 5IMKB 1IAIL 3CSPA 4KJPC 4NO5A 3TBTB 5JTWA 5I76B 4N9OB 4ZXBC 4R8WH 1RZKL 1S7UA 3C5JA 5HYQA 1A5FH 3JTTB 4FABL 1RZ7L 2LE9A 3MBEC 2H2PC 3IYLW 5D7LB 3BW9B 2D9CA 5I18L 3BH9B 3FB6B 4HC1A 4XNMB 3GMRB 3PHQB 2R1XA 1X5XA 2AAVA 4IRJB 5C92A 3GKZA 4I77L 3G6DH 3MOQA 1CZ8H 3ALXA 4PGEB 3WHE0 4GAYB 4Z7QE 2B39A 3ZMRA 3V7AE 1XF1A 3P0VH 1BREA 1U8IB 5T33H 3FQXB 3I2CL 3T0WA 2Y7QB 4NCDA 4OM1H 1FYTB 3QIUA 5F6IC 1I3GH 1YMHB 2CGRH 4MJIE 1U91B 2K3TA 5CLWA 5DZNA 1RD6A 1FFNB 3LVEA 2A74B 2XOTA 2R29H 5E1AB 1UM6L 1YQVL 4NQVB 2YD6A 3ARFD 1I7RB 1MLBB 5BW7C 1TXKA 1IL1A 2FBOJ 2EDKA 3CLFL 3KXFE 4RGOL 1PD6A 5TGBB 2HRLA 3D25B 1MCOH 4XCNA 1CDCA 5CIPA 1T4KA 1P6FA 3P9WB 2Q86B 5L9DH 1VADA 4JCLA 2P5WA 3F58H 2B1AH 4M6OH 5K9OA 3BEWA 1AJ7L 1VENA 3MBXL 1HNFA 2F8VA 1A4KA 1KJMA 2GCYB 2CDEA 4KXZH 3BPNB 4Q6IC 4LRNH 5DC4B 5IVOA 3OQ3B 4NBYB 1CFQA 2VLLA 2R1YA 1SYVA 1NUGA 3GBNH 3T0BA 4PJ7E 5CILL 3SE8H 1E4KA 5LKNA 1EEYB 1IM3A 4I0CC 4DKEH 3C9NA 1IAOB 5FK9B 3WDHA 2JLLA 1XZ0B 1JN6A 3DETC 4KJQD 1CD8A 5GGTH 2XQYG 3GSNH 4H1LB 2VDRL 3CFCH 3S5LB 3MLXH 4NBXB 2CIKA 4WJ5A 1TZHB 3EIFA 5GGSY 3FOMA 5FOBA 2AJ3A 2MJWA 3K3QA 3E1F1 2PXYD 1RZFL 5AD0A 4UILL 5ACMA 5LCVL 2AQ1A 2F54E 5KS9F 4ZFFA 1W72H 1FO0A 3L3HA 1G0YR 5FUCC 2XFXA 5DC0A 3VFGL 1G1YA 5DJZA 1PW3A 1F58L 1I9RL 1A7BA 4X5XB 3RPIA 3GRWA 3VH8G 4PJGB 1UB5A 5I8EB 4LIQL 3B2VH 1I7UB 2BVQB 4LVOB 2NZ9D 1H5BB 4UT9H 5FKPA 1LILA 1HEZA 1T1ZA 1XIWA 4NJ9L 1FIEA 3E2HC 1HIML 5GRZA 2IFGA 3VFVA 2FZ3B 4MNGA 3LIZH 4KK9C 4O2CA 4AT6A 2BX5A 3MOBL 4PJ5E 4NZJA 2M8XA 2PCPA 5TQ2H 2R1WA 2VZOA 5EU5B 3LN4A 3RKPA 1INDH 5HHMB 3P0YH 3RAJH 1CLCA 4M7KL 2C1OB 4YGVA 2Q1EA 1F6AB 4NRXA 3PGCA 5AG9A 4K8RH 1S9VA 3B8SA 1PAMA 2AV1A 2X4OA 4MA7L 4P2OB 3GJEB 5AYUH 5C0CE 2ZCHL 1OT1A 2NY2D 4XZUB 4QRUB 2FL5B 4ONHB 3HZKA 1NFKA 4X4MA 4WI4A 4BQBA 1NFIA 1AGEA 5C0RH 1VA9A 5DR5L 1BVZA 2DF3A 3WNLA 4QHUB 4JFED 1K9TA 5JHLH 5C07D 3QDJA 1CL7L 4G8GE 4X8JA 3FQUA 4MB5A 5DC9B 2XN9B 1DE4B 3MROB 4PJFB 4G8FA 3BX7C 5EU7E 3P30H 2ICES 1C5CL 3MCG1 3DYMA 4P2QE 4ZOAA 2DQUL 8FABB 1MJUH 3OAYH 1JYXA 5EUKA 4V3EB 3G04A 3H42L 4L3AA 4YHNA 2IMMA 5HYJB 4UBDC 1ZLUK 1MCDA 3L7EB 1UWGH 4C54A 4P3DB 4B5EA 3KYKH 1MRDL 3IDUA 4URTB 1RAMA 3MRDB 4KI5E 5IBUG 4KK6C 3V52H 3C8KA 4GQ9L 4C83A 2FX7H 5E9DA 3CSBA 3N1PC 2NR6C 2EECA 3MJ6A 3T1FA 2AK1L 3GB7B 3WKNA 5ETUB 5D7KE 4HLZG 4XRCB 3RWJB 4WENB 5KS9A 4F8TA 2R69L 2Z8SA 1BLNA 1EV2E 1M05B 3A6BH 3OZ9H 4Z7VB 1HQ4A 4XVJL 1HCVA 1Q9LB 1A9BA 5C0ND 4HGMA 1H3XA 4GRWB 1A02N 5E03A 4QRQB 5C0GB 5ITFB 1X7QB 2MQ0A 1CS6A 4KMQA 1N6UA 3FQTB 2ARJA 2DLEA 3HNTL 4OT1H 2V5SA 4XP5H 4HV8A 1RUQL 2YRZA 3ARDD 5IV2A 2JCCF 4KKNA 5MP6L 5IFJB 1HH9B 2DJSA 1A7QL 4FXKB 4XNXL 2LQRA 1HE7A 1ZTXL 3B3IA 4Y88A 1WWAX 3QNXB 4G80B 1P84K 4PLJC 1MCNA 2MOVA 4QY8A 4Y1AE 3CJJA 2A77H 3QG7H 3C2SA 5IB2B 5L7XH 3LPWA 1IQDA 3QIUC 4E41B 1XF3A 2EDNA 4LAQH 4O00A 5LGKA 1WZMA 1LE9B 3CSYB 3P4NB 1EUUA 3D18A 5GSRB 3ELAT 2O5ZH 3V6FA 3CH8A 1SVCP 5JQHC 4XPAL 2WMPA 1HINH 2WM0A 1OD7A 2EDQA 4HIEA 4WO4D 5GS1B 3BKML 5IFAL 4OF6A 1ZHBB 1FZJB 2NY1C 2IALA 5HVHB 3MJ7A 5C6PB 1F2XK 2D0GA 2VH5H 3C5SB 4P5TB 4YDJB 4QHNA 5DYOB 5DURD 1ZT1B 3SGDH 5IJKA 4U7SA 1FORH 1X5FA 4UTBL 5EH1A 4UT6H 1E4KC 3FFCA 3LS4H 4UUJA 4K7PL 2DD8L 4YXKL 3WXWL 1RZ8A 3T09A 1E6JH 3OR6B 1TVHB 2AJUH 4AZ8A 3D39A 5IHUH 5CFHA 2FLBT 3NIDE 3ARQA 5I1LB 4LSTL 4YDIH 2UZXB 3MJ8B 2JTDA 4DGYH 1QUNA 5LGJB 5IP4A 3ROOB 3OKDA 4LLVA 4X9HA 5ADOH 4G7VH 2Z31A 4KJYA 4S1QH 3QO0B 5F7EH 2YHGA 5A2IH 5ICXB 3EJYD 1MHCA 4MA1B 4WTWA 4Y19A 4KHXH 4EDWL 5IBTH 3OJVC 2WBJD 4K3GA 1KJ3H 4BSVA 1JPTL 5DJ2B 3VXSA 3S97C 5C7XH 2XKNA 2FBJL 4O5LH 3MOAH 1A1OB 5SWSA 3M1BB 1N64L 5FDWB 1E27B 2ATPB 4GAJH 3IDNB 1YYMH 1DQJA 1HYSC 3N85H 3RHWF 5C0JB 3K74B 1WIOA 2UVFA 2MCG1 1WBXB 3VXRE 3BD4A 2BVOA 5MHSE 3U9PL 1DSFH 4LDOB 4AEHH 2C4FT 3QUKB 1XIWC 3G9AB 5JHDE 1RI8A 2YPLB 3U79A 1VFMA 2QQKL 1UVQA 5BRZA 4MVBA 1DCLA 2NLJA 3LKRB 4NJAH 5F97E 1DQDH 2FIRT 3PDDA 2JCCA 1HXMA 3QHFL 3FT3B 5DT1L 4NO2A 2A9NL 1NCCL 3Q2CA 4YHYB 3FRPA 1IKFH 1MFDH 1ZGLM 1W72B 3T0EE 1D3CA 3BKJL 4NKMB 1MHEA 3MRLB 3SKOA 4AG4H 4O2FA 5LGHL 2IBZX 2V9QA 4QLRA 4Y7MA 4DVBA 3I6GB 4JHWL 5CINL 1BVLA 3U82B 1UZ6E 1WJ3A 5C1MB 4HXAH 1IGTB 3QISA 3ZYIA 2FYYA 5FGRA 1TQBB 1G7IB 3KR3H 2VTFA 1TZIA 4Q2ZA 1UADC 1UG9A 4RMRA 5DEGA 4A6YH 2F8XC 3D2UA 3IDYC 3WO3B 4NCC1 3PGDB 3V5HB 5JW5A 1JYVA 5GZOC 1OTSC 2YEZB 4M5ZL 4N5ED 1JZ5A 4I8DA 5HI4D 2CRZA 3QUYD 3R4DA 5TDOA 1AHWB 4KXZI 5DK0A 5E70A 1L7IL 1YEIH 3O6MH 3V4VL 4Z9KB 1TMCB 1WLHA 1DLHB 4YH6A 3WUWG 2BMKA 3KS0H 3MLRH 2NY5C 1D5ZB 2YS4A 3FFDA 2D3VA 4JY6A 3OTTA 3VE0A 3IRPX 1JGLH 5D96C 4F9PA 1CE1L 4CMHB 4ZPVB 4ZS7L 2H6PA 1JUFA 4R7DA 5DFVD 3L3IA 5CHNA 3MRMA 3X17A 4J4PA 1SY6L 4MSWA 2VXQH 4Y5VB 4APQB 2PYFA 5D1QD 5IIEB 5FO9A 1JNLL 2DWDB 4MDJA 4NHCL 5CP3A 2VZTA 3VW3L 5I17A 5EBMB 3BIKB 3MRJA 4OKVA 2SEBB 1EAJA 1Q8MA 32C2B 3Q1SL 2VXUL 3N0PB 4NOBA 1SBBA 1MIEH 4NM4L 5KJRL 5E6IB 5J13C 1FNHA 1E4WL 5KG9B 4N8VA 4XHJD 43CAB 3VH8B 3HE7D 4MXVF 1NBYB 5BCAA 1R5WB 5HGAB 4YO0A 3RX7A 2B1HL 1G7HA 4EI5B 5KVDL 3SKJL 1EA9C 2X4SB 2YD5A 3U4AA 1KXVC 3X14B 1QSEA 3REVB 2VLRD 1WZ1H 4Z0BH 5JR1H 2D7QA 1AP2B 3E6FA 2YD8A 4HJJH 3D5OF 5D2LF 3QCTL 1G7JB 2L7UA 1VGKA 1GGBH 2FEDC 3SY0A 4PJ9A 3S7GA 1I9JH 1QR1A 1OAYH 2MHAA 3GSUA 3H9HA 4WHTA 3BVNA 3EYOB 2HMID 1FIGL 2AEPH 3MLSH 5F70A 3RIAK 4X80H 1JRHL 2EDLA 4R2GC 3NH7L 1AR1D 4JFQA 1PG7L 3QIWB 3UYPA 2ILLA 5CSGA 1M7DA 5HHVH 4JFOB 2IPUG 1S9WA 1BBJB 4X0KB 1CG9A 3HMWL 3Q3GA 1A7PH 1DFBL 4LKXA 1IC5H 2ZUVA 3L5WA 1NUDA 1Y18B 5AWNH 5HYSA 3GJFK 4GMTH 4JRYB 5KOMC 1EUTA 1FDLH 3BQUD 4Q7DA 4YHZH 5HGBB 4X6BB 3RZWA 1RY7B 4LSRH 4NZDA 4H0GA 5E8NA 5IJKC 1U0QA 2FDBP 3MJ9H 3QXUA 4YHML 2IADA 2VAJA 4U1MB 4X6CE 1BD2A 5BZWA 2KH2B 3RA7H 4HIIA 2EYTA 3VDCA 4OLZL 1LO3L 2X4RA 2Z35B 1B4RA 5J1TC 2ED7A 3QPQC 5HHNB 3BDXA 4OUUA 4PBXA 4HS6A 4X4YB 2CLRA 5D7IF 5CLTA 5IBUB 2X10A 5IVZB 4XBPB 1OSPH 2EIZA 3HUJF 4P59H 1NDMB 1F02I 5F1SA 5HTSA 2Z31C 5B38B 4HWUA 3H9ZA 5C07E 4OIBA 3AB0C 3G5ZB 2P48B 3O2VH 2NNAB 2NYYC 4OB5L 3QDGB 5GRUH 3GHEH 3KJ6H 4KU1A 2VDNL 2JJSA 3EYVA 4MJ6A 2VDKL 5ILTL 1PSKH 3A67H 4WEMB 1HHIB 3V0AC 3QEUB 1HH6A 2IPKA 4U7MA 3MACL 4H25B 1NQBA 3V4PL 4MNQD 1W0WB 2VABB 3RGVD 4BSWA 2HFFA 2E7CA 1A3RH 3HR5A 4WTZG 2NW3B 3BH8B 4X7TB 4PRHB 4MVBC 4WNQB 1CLOL 4XAWH 5L6YH 1EMTL 1XF5A 1V8HA 2L0DA 3VRLE 5JQ6L 1SJEA 5D6DA 3WNMA 1H3WM 4TULL 5D1ZD 4S0UC 1EFXA 1FBIL 1NEUA 4LVNC 1PZ5A 5T1DL 3PNWB 1OM3H 2X40A 4L3EB 4R4BA 4IM8A 4DOHB 3KPMB 1SHMA 2YN3A 4RFEB 3UTSD 4Y8AA 1EFQA 1DTUA 4WUUA 2WZPD 5JPMB 4HULB 1OGTB 3MXVL 4PD4J 3ULSB 4O58H 4Y4KA 4JFFA 3AREA 3ZE1E 1KTDA 1I1RA 1OCWH 5GHWH 5I1HL 1FVDA 3HC0B 3QO1A 3HZYA 1NJ9A 3LRGA 2ORBL 3SGDI 5MI0C 1PEZA 1MAJA 3IU3A 4NO0D 2WUCH 3V5KB 2X2YA 1E4JA 1AKJD 5FUZL 1MRFH 4F9PC 2P7TA 3BAEL 3MNVA 3MRPB 3QEQB 1A14H 3HI1A 1AFVL 2DM7A 4Z0XB 4LSSL 3O9WA 3L6FA 4CVZB 4U0RC 5GXBB 4J4PC 4ZUVB 5GIRB 1NGQL 3PP4L 4YK4B 2GK0B 5K33A 3AAZA 1F3DJ 4JO3L 1UQSA 2J6EH 5EZJA 4DQOH 5CJ5A 2OZ4L 3DHJA 2AJZA 4U31A 3EJZD 4UQ2A 5FF6B 5IMLA 2NXYB 5D7IA 2Q3AA 4A6YB 4KRLB 4OSUL 3HUJA 1L7TH 5GRVL 1A6VH 2ZCKH 2DIBA 4PJIB 1R3IH 4E5XA 5HI3C 5EA0H 5L0QC 3NAAH 5C9KA 5KW9L 5L88H 3FRUA 4YXLH 5L8KB 1CFTB 3VXUB 2Z4QA 1X5IA 3J8F7 2PYEB 5HHQB 1DZBA 5C86A 3O3DB 1NBQA 3FZUC 3O8XD 5C6WH 5H35B 2RGSA 4RAVB 3VJ6B 2YSSB 4FQXA 5GRJL 3SDDB 3IFLL 4JM2B 4KKCD 1MCWM 1NMBL 4KK5C 3GMQA 5E8DL 4MA3B 3O3EB 1M71A 5L2JB 3VMOA 1UKTA 5FFLA 4HIHA 3SDXB 5I75B 2ESVD 4OFDA 4ZS6C 4CW1B 1TTGA 3A6CL 4QRSB 2X44D 3OKKB 4GKSB 4I0PD 1Z9SA 3RUGB 1T66C 4JN2A 2AERT 5FKAB 2ZUQC 2QADB 1C8PA 4LCWA 3U4BH 4NQDD 3C5ZA 4M7ZB 4HCRA 4PJ9C 3S98A 1KCUH 1H8OA 2EZ0D 3CFBA 4K3DL 2IH3B 3RY4A 4GOSA 5DDHB 5FYLH 3BP4B 2B20A 5B21A 4YC2C 5JDJA 1KJVA 4IJ3B 4AQOA 2GJ6D 1B6DA 1SBSH 2H9GB 4X9GA 2NY0C 4HZAA 5EBLA 3W11D 4M9PA 4FFEX 4XMPL 3WUWB 4ODVL 3VFOA 3AMKA 3DX6B 1FP5A 1YPZE 3GMPA 3MYJA 5HHPA 5FIEA 5GS0H 2EYRB 2XQBH 4Y0GA 4HS3A 5KVEH 4NQSB 3TYGH 3MRBA 4LP5A 1QSFB 2OTUA 4AEIL 3SCMB 1X5YA 2EDWA 4D0CB 4GKZA 4KPHH 2QQNH 4RBPK 1P7QB 1QRNA 2DQJL 3BISA 2UWEF 1QPXA 2X1XR 3HS0A 5JOEA 1NC2D 3AMLA 5CCKH 1JZ4A 5CJOH 5ESAA 4E42A 5BZDA 2Y36L 2YZ1A 5E1HB 5I1GH 1J7VR 3LDBB 3IAQA 4XNZC 3OKLA 5F1NB 5A1AA 1EBPA 2UUDK 5DJDB 2YPVH 4M02A 2ITDA 5EIIA 4D0BA 2YR3A 5E6ZA 4RFOL 5EZIH 3MBED 1K8IA 2EDYA 3HCVB 2H2PD 4DVRH 3DVIA 5J6GA 1OAQH 2DLHA 3D85B 4R8WL 5K59F 3I6LD 1XGUA 1A5FL 4U3CA 4P49A 2XTJD 3BMWA 3HAEH 2JJSC 3U0TA 3QP3A 1R5IB 3EFDH 4JLRA 1CGUA 1TZGH 4QT5B 4GRLB 3CXDH 2BHYA 3G6DL 1CZ8L 1MCSA 4KC3B 4TUJA 3JXAA 3TWCH 3IDIA 4CNIA 1ZA3A 3U1SH 5IVXE 4QO1A 4M61A 3P0VL 5T33L 4BQ6A 5BMFH 3C8DA 1Q1JL 5ADPH 4OM1L 4MD5A 3REWB 1WFOA 2Q8BH 1I3GL 2AXFA 2CGRL 3D0LB 3CU7A 1EVTC 1RHFA 4PRDA 2R29L 1AXSA 4BKLA 4FQQB 5D6DC 2Y72A 3PG2A 3K2UH 5I0DA 2C26A 3MRIB 4HWEH 1LP9E 1AGFB 1MCOL 3ULVF 4MXQA 2EDFA 5L9DL 5CEXB 4M6OL 3F58L 2B1AL 3EGSB 3RY6C 1RZJC 1MLCA 4G6MH 1NCWH 3FB8A 3NZ8A 3GSRA 5I1KH 4EXPX 3QUXA 4CRPA 1JPST 4LRNL 5JW4M 5DGRA 3GIZH 2PR4H 4Y4KC 3VFSB 3AREC 3GBNL 1JZ6A 1G7MB 2ZUSA 3SE8L 1FJ1A 4B0MM 2EYSA 2VLRE 1HHGB 5FM5O 2Q6WA 4B7IA 4DKEL 3C09C 1KYOK 4P99A 4LLWA 1T2JA 3RDTA 5E2WH 2IAMD 4AY0A 5GGTL 2OQJA 3ALPA 3QI9B 4JEGB 1A6ZB 4ZUUA 3JWDC 3TO4D 2V7HB 1F3DH 3MLXL 5HHOE 1J0YA 1RUMH 5DD6A 1JBJA 2EO1A 2EXWC 1ZA6B 3O9WC 3VGBA 2UWEA 3HZMA 3OPZH 3A0OA 2P24A 1Y6KR 1W72L 3QULB 3HNVH 1QLFA 3BXNA 2P5EA 5IQ7H 1S5IH 3KJ4C 4KKBC 4YBLB 3IDXL 5CSBA 5HDLA 1T22A 3UJJH 3PWUB 3U2SA 3B2VL 1R3LA 2OR8A 4N0UE 3O3AB 35C8H 4UT9L 3M17A 2QR0A 5DUPH 1IM9B 1KIQA 3INUH 4JDZA 3VFPA 5DJYA 5K9QG 1B2WH 3HLAB 4XCEB 2LVEA 1U58B 1JWUA 2DRUA 3BUTA 4ZPTA 1P84J 5MENA 3JV4B 5C09D 3LIZL 1L0XA 3LKSB 4PUBH 2MTPA 3QG6B 1DQQA 1JPGA 5IR1A 4I48B 1U93B 3RIFK 5TQ2L 3PWPA 3IFOB 1YNTA 4LPWA 5FO7B 3HC4L 2DQHH 1G9NH 3PP3K 1FL6A 1INDL 1RJYA 1L4IA 2ID5A 2RCSH 2WANA 3PJSB 3P0YL 3RAJL 3MMEA 3V8OA 4MQTB 1IEBA 3IVKB 4K8RL 4L4TE 4PJXF 1U8JA 4X4XB 2EIEA 5AYUL 2D7NA 4Z7WF 4JKMA 3C5ZC 3JWOH 3I84A 3TNMB 2FLRT 4WW2B 3U83A 5INDB 4HAFA 5C0RL 3WHE1 4XMKH 3O2WL 4EEEA 5GGQH 5HJ3A 5JHLL 1WAAE 5J11C 2ICCA 3FN3A 4FQPA 4PTTA 5FYJD 3STZB 5EU4A 3VXNA 1MHPH 2YRPA 3P30L 4NUGH 3SDCA 4BK5A 1KN2H 4Z7QF 4UBDD 3G5VB 3DRTA 2QQLH 4MNQE 1MCRA 2OM5A 1MJUL 1PLGH 1MREH 3NIGF 5C2BH 1OVZA 4I3GA 3VGAC 1XGQA 5B4MD 3HI5H 3UDWA 3QFJD 3SJVA 3ZDYF 4CVXA 4OFPA 2GQHA 2NY3D 1KPRB 2NR6D 1UWGL 4CU6A 1KFAH 4F33B 2BVPB 3KYKL 1MHHA 4UV4L 1CWVA 2A6JB 1S5HA 4PGCB 43C9B 3V52L 5GGSB 5I1CH 3K4AA 1OGAB 2FX7L 4W81A 3UTSE 1BX2B 1CFBA 1NGYB 2W07A 3LQZB 4XP1L 2KQNA 3TM6A 1U8HB 5ABDE 1HNGA 1XR9B 4F7PB 4ELMF 2GTWB 4OCRH 4A2MA 4EN3B 2WAHA 1II4E 3OZ9L 4WFHD 1W0VA 3KPQB 1PYWB 5KSBE 3GMOA 4GW1A 5CBAB 2Y5TA 5EG6C 4F3FA 4ZFOB 4FFWC 1BWWA 1UYWH 1JYWA 2R2CA 2XACC 3TBSB 2EE9A 3O2DH 5AUMB 2AV7B 5D70H 1ZVSB 4PLJD 1SYSB 4XMLH 2HYMA 3NN8A 2BCKB 3BWUC 3TV3H 1F3JB 4OT1L 4U1JA 4XP5L 2LU4A 3RVTC 3LN9A 3FTGA 5I8OH 2R0WL 3VFTA 4TNWF 3ERYA 5D5MB 1S9KC 3BKYH 1YEGH 3O3UN 2FGWH 1M1SA 4JFXA 5M94B 4MS8D 2P8PA 2D7PA 1AGBB 2I60H 3V6OA 4OFYD 2A77L 3EBAA 2AKRB 3RWCA 5CZKA 4NUJA 1JP5A 3QG7L 3SGEH 5L7XL 3RWDB 2PW1A 3SKMA 4MZ2A 3NCMA 3WLBB 1DP0A 4LAQL 1DVFB 3EO0A 3W0WA 2HLAA 2BOCA 3CC5B 2O5ZL 3ILQC 4PJXA 3TNNB 5F9WC 4Y1AB 1S8DB 4L8DA 4OM0H 1F4YH 1HINL 2ZOKB 4Z7WA 1I8MB 1HZHH 1GVIA 3FCTA 3TA3A 4UNUA 4MXQC 3HAEB 3O4OB 4W68A 4UB0H 5E56A 1P2CB 4HJ0D 3HRZA 3R1GH 1KELH 4S10A 1LEIA 1KG0B 1WTLA 2FJFA 3H9SE 2VH5L 4I5BB 1GC1H 4OLEA 3QUXC 2BNRD 2ESVE 1N5YH 4BH8A 1FORL 3MGOB 4UT6L 3ULUH 3E6HB 4F15B 4PJEF 4BM7A 4Z6AT 3LS4L 3RNQA 4Y5XA 5E08H 4TN9A 3AROA 3MV7B 1E6JL 1ZANH 2AJUL 4WI5A 5IHUL 5DJ6B 4R4ND 4NQDE 5BVJB 2IFFH 3MUHL 1J8HB 4FP8H 5IHZA 1CGVA 4I18A 5TE4H 1FAIH 4MJIA 5ITBH 1K2DA 2P8MA 3WS6A 4DGYL 2RAMA 3MUJA 1JTPA 1EEZB 5ADOL 2DBJA 4S1QL 1U6AH 1XGYH 5F7EL 1UB6B 3KXFA 1BF2A 4OZFA 2IMNA 4EI6A 3WFHB 4KHXL 1KT2B 3B9KD 1RFDH 2GJ6E 1KJ3L 2C1PA 3DI2B 1FVCA 5C7XL 5FA4B 4YHPB 4ODTH 3MFGB 3G6AA 4O5LL 3MOAL 4ELMA 1GZPA 3PWJB 1XIWD 3LH2H 3QUZB 4GAJL 2VQ1B 1YYML 2HT4D 3N85L 1JPFB 4GBXA 4EXKA 4P4KB 4L8BA 4UU9B 1JCKA 1DSFL 4U6YB 4AEHL 4RZCA 5SX5K 4JRXA 5ESQA 1ONQA 5IJVA 1Q9WA 2HJLA 3Q6FB 3I50H 1N59A 3O45A 1PKQB 1M6OA 1QEWB 5LAXA 5I1IH 1DBMH 4NJAL 1K5NA 4O02H 2FJHA 3DUHA 2G60H 5DRWA 2HJKB 2ENSA 1MFDL 2ICWJ 4JANA 4F37K 4AG4L 4EKXA 3S96B 3LEXA 4X6FB 1G9EA 4KVCH 1GHFH 3DTXB 3RZCB 1OTSD 2NY6C 1GL4B 4HXAL 4PFEA 3DX9A 5T3ZE 2Q76B 5JA9A 2PF6A 4S2SB 4G43B 3QDJD 3I6LE 3IDMB 2X1QA 3TZVB 3KYNB 3VGFA 3KR3L 1H3PH 1GZQA 2XTJE 2R4SH 3FL7A 3VXQB 5CWSA 1P6AB 2OI9B 4LKCB 4A6YL 2AK4E 1IEAA 3UPAA 5J1AA 3ULVC 5I66A 3NCFB 1YEIL 3O6ML 3UAJD 5HDQL 4RMQA 3H7BB 2I9TB 2X4TA 3MLRL 3SDCC 3OJDA 4QYOA 4NYLB 1JGLL 5CSZA 3DO7A 1T0MA 5DMKA 3ARBD 2BNQA 3FT2B 4L9LA 4GKNA 2D0FA 4PG9B 4IMLB 3UDWC 4AIXA 3O6KH 4XXDA 2YC1A 2VXQL 3O6FB 5E9DD 1YDPB 4IS6A 1RK0B 4ACPA 5J12B 4PJGF 4PJBE 2ERJB 1DBJH 4U1NA 1GSMA 5C0CA 4MAYB 1CT8B 2VLJD 5KN5A 3LKOA 4OGYH 1LEKA 2Q7YB 1TQCB 2J88H 3CNKA 2XZZA 5I76A 1BM3H 1YEJH 5ISZB 4EDXB 1MIEL 5CJXA 1Z2KA 2M1KA 2B8OT 3JTTA 4HUUA 4G8GA 5BO1H 4RGMB 3DUUB 3GI9L 3Q5OA 4J8RA 1TVBB 5SWZE 2IPTH 3FT4B 2R2EB 3HPJA 4IRJA 3OV6A 1N3NB 3VXTB 1AQDB 2I9LB 2R0KH 3TYFB 4P2QA 1KN4H 4GAYA 4N1CA 4LHUG 1J0ZA 3DROA 5DUBB 1ZGLA 3QWQB 1NL0H 2GTZB 1XCQB 3UTZA 1IGFH 1WIPA 2DMCA 3NIDF 5HYFA 4IDJH 1AGCA 3DX7B 4BSJA 5IGXH 2FEDD 1FYTA 3OBAA 3GSQB 1JZ8A 3LQAC 1YMHA 5JO5B 1U91A 1WZ1L 4Z0BL 5IB5B 5JR1L 3R8QA 3EO1A 1FFNA 1ZLSH 2EDXA 2A74A 3U0WH 3U7YH 2J8OA 2R0LH 3QWRA 4LLMA 4HJJL 5KSUA 3WD5H 5J7CC 4QCIB 2VL4A 2EIBA 1MLBA 1GGBL 3EZ8A 4R2GD 3MV8D 5F1KC 5HSFA 1I9JL 4DN3H 1OAYL 3V6OC 3CH1A 4WU5B 1W0YT 1P1ZA 4KDTA 4TVPD 1ZHKA 2AEPL 4UNTA 3MLSL 3X11B 1H3GA 4X80L 2QSCH 4MYWB 5C0AB 2XNAB 4Z7OE 3PL6D 5J89A 1ADQH 2PXYB 2WINB 3L1OH 3M45A 4MWFA 1AD0A 1IGYA 2P8LB 3VG9C 4LPTA 1TTFA 4OBSA 2QKIB 4RNRB 3OKOA 3OX8A 1EEYA 1IGIH 4M7LH 3TA3C 4M5YH 4QRPB 4L4VE 3NIFF 1A7PL 3IDJA 5C09E 1IC5L 3L95B 2GITA 1IC1A 3FO0H 4GMTL 5E4EC 3ZKMC 1K6QL 3FFCD 4YHZL 1FDLL 3WXVH 4CAGA 5DI8B 12E8H 1ZWIA 4BFBD 4LSRL 1OP3H 3QPQD 4YFDB 1HHHB 3S5LA 5I8CB 3D39D 1VACB 4FMKA 1YY8B 1YEKH 3KPSD 2YUXA 1JK8A 2Y07H 1X5AA 3MJ9L 3PQYD 4Y5YA 5GGUB 1U8QB 1JF1A 1TZHA 1KLUB 3RA7L 5HHXH 2NQCA 4Y5XC 1YN6A 3LKQA 1EHAA 1S78D 4ZYKA 2GSIB 3DVNB 4NN6B 5INCB 5IOPA 5HPOA 5ICYA 5DVNA 3B6SA 1XT5A 3CZFA 2BRQA 4Z7VF 4I18C 4JFDB 4JREC 5TH2A 3VRIB 3WS6C 3PDOB 3AU1B 3MQIA 3NVQA 4X6CB 4P59L 3VXSD 4OD2A 3UP1A 15C8H 5I8EA 1I7UA 5CGYC 5DRNA 3EO9H 5FYJE 2UVEA 5SWSD 3O2VL 2WQRA 5IWLA 3S4SA 4YFLI 4R7NA 5GRUL 4XNQB 4AM0B 3GHEL 3KJ6L 4M7JH 2PO6A 3EOAB 1MNUH 4NO3B 3X12B 4OCXH 2FZ3A 2WUBH 3VFWB 5FB8B 3G5XB 3VI4E 4JDVA 3DBXA 3DNKA 4LF3B 3QFJE 1TDQA 5C0FB 5LXGH 3A67L 4GBXC 3FO9A 5BRZD 2R23A 2AW2A 4XC1L 5EO9A 4MVBD 4AK1A 2CH8A 2H2SC 3FAXA 1F4HA 1S9YB 4WWKD 2OZ4A 5IMMB 1BEYH 2EEAA 5BXFB 1F6AA 4TPRH 1A3RL 5L8LB 3BGAA 3GSVB 4PJ8D 3UBXG 1KV3A 4XAWL 5L6YL 4QOKD 4QRUA 3WIHA 2FL5A 4ONHA 2X9XA 3U30B 4PRIA 4G9DA 4Q0XH 3VXMD 5F88B 1CICD 3SGEI 1MPAH 3FHAA 1M7IB 3UZVB 1XMWA 3GMLA 1UKQA 1RJLA 1F4AA 1OM3L 1AO7B 3CSGA 3MRFA 4WFHE 3PV6B 2XN9A 4M4PA 3W5MA 4FXLA 1ORSA 3D2UD 3K1KC 3NMEA 2W0LA 1DR9A 4V2BA 5MEPB 5D2NA 1F4WH 1L6ZA 5KZCD 3TFKA 3T77B 4O58L 4LNVA 3VXRA 3MR9A 2H26A 4HSQA 1OCWL 1ORQB 1M4KA 3MCLH 5GHWL 2APTA 4Z7UB 3UZEA 3ARVA 4RIRA 2EC9U 5JHDA 1OF2A 1JV5A 1QD0A 4ZO6A 1U95B 1QNZH 4X7DC 2WUCL 5FGBA 5I1EH 4LBEA 4J4PD 5HVWA 1MRFL 4OF8A 3RVWC 2EEDA 2JJTA 3U6RB 2W65B 1A14L 2P42B 1ZXQA 4L9LC 3CGTA 2AXGB 1FL3B 3GB7A 3T0EA 5DHVH 3VFRB 4WFFE 2P5WE 5DMYA 1T1WA 1HK6A 4XRCA 5F7YC 1V3JA 2J6EL 4DQOL 1F13A 4OCLC 4Z7VA 1J9CT 4IRSB 4P57B 3RQ3A 2XYCA 5IROA 1L7TL 2I5YH 3BGFC 1A6VL 2ZCKL 4KUCD 1T5WA 4QRQA 5C0GA 3W2DH 4PGDB 1R3IL 3HE6B 5CJXC 5EA0L 4ZG1A 3IKKA 4AYFA 3NAAL 3OKNB 1IGCH 5D1XB 5L88L 1G7QB 4YXLL 3IXTB 1MQ8A 3R0NA 4KK5D 4Y4FB 4LCCA 5ALBH 4IHOB 3KPRB 2CO6B 3C6LD 4IRJC 5EU7C 4TTDC 2F5BL 1HH9A 2ICEA 4FXKA 4J3UA 5E7BA 5EZLB 1IILE 4ZS6D 1KSRA 3TIDB 3GK8H 4XVUC 4L29B 1T1XB 1CVSC 3ARPA 4OAWB 4LPVA 2O5YH 2RBLA 1LEGA 4PTUB 5GPRA 3ZE2E 2V2TB 1R24A 5JXED 1A2YB 1ZLVK 4E41A 3ARFA 5FECB 1MCLA 4RQQA 4YPGB 4N0FB 5GSRA 5E94A 2VKXA 1CQYA 3EDDA 4XAKD 4YHIB 3U4BL 4LLDB 3QSKB 3FQWB 5J6HB 1FGVH 1KCUL 5GS1A 5CJ8A 2XA8H 4NN7B 3PXHA 1QA9A 3MV11 4NQEB 2AEQH 1F5WA 4KDTC 3K8KA 1UJ3B 5FM5M 5FYLL 1MH5A 3SN6N 2NY0D 2F74A 3C5SA 4P5TA 1PBYA 1ZT4A 3QQNA 5DA0B 4M6MH 4XI5C 3UROR 4WEBH 5DVMA 1ZT1A 1KYOJ 3BPNC 1RZGB 2BC4B 3HG1B 3U46B 4NC0B 3QQ4B 5CP7B 1SBSL 4KROB 2DQIH 4EBQH 1BWMA 3GHBH 5ID0A 2E6QA 3JVGA 3OR6A 1TVHA 4OIIH 1KB9K 1N8ZA 4ZFOL 1BD2D 4QGYA 5I1LA 5GS0L 2XQBL 4U1SA 5KVEL 3ILPB 1S7SB 3TYGL 4YGAB 3HZVB 1FSKB 3QAZB 3GUTB 3ROOA 5FM8A 4Y5YC 4HUVA 3K1DA 4KPHL 2QQNL 3IJYB 3VA6A 4Y16D 4X4ME 5C08B 1T83A 5EZOH 2X05A 2VL5B 2BSTB 5CCKL 5CJOL 5IEKB 4PPTA 3TH4T 4X9BA 1S7RA 2FR4B 1VFAA 1PVHA 4HIJA 3QDJE 4P46B 2WIIB 4XCFL 5SX4H 1IQWH 5DEZA 5F1OB 2IAND 3MREA 2AQ3A 1RUAH 1BIIB 1U8MB 4U3XA 5CEZD 4XP6H 3RP1A 5EZIL 3VDAA 4DVRL 1OAQL 2VZUA 4CU7A 2XWBA 5IWLC 4JFPA 4KKAC 5C6TH 3QUKA 2YWYA 1I1AD 3CDFA 2K7PA 1J05B 3GZKA 2PO6C 4Z78B 3S88H 4LHUB 4X4ZA 2ZWLT 2MQCA 3EFDL 4LNRA 3JV6B 1I1YA 1TZGL 4PP1D 2J4WH 3CXDL 5GISH 3CVHA 3BP5B 5E9DE 3RWEA 3TWCL 3QH3B 1AD9B 5DHXB 3U1SL 5TQ0H 3RKDD 5J57B 3AS3A 2VLJE 2HLFC 4KQ3H 3CU1A 3O6LH 1UM4H 5BMFL 1EK3A 4TSAH 4JQVA 5ADPL 5KSVB 1EFXD 4CJ0A 2Q8BL 5KS9E 1U8PB 4HKZB 1LO5B 4S1DD 2HT2C 1J18A 5KANG 4D0DB 4JFEA 1KIRB 4LLYA 4LOUD 4NNXB 4ZOCA 5C07A 4FQ2H 3K2UL 2EDRA 4HWEL 3UTTD 1JGEB 2DTSA 3NCEB 4F7EB 1WWCA 2ADFH 4JCMA 4HKXA 4PYGA 5BV7B 1T2QH 2PW2B 3ARED 4JFFD 1Q94A 3QNYA 1MI5D 2XWJB 3CMOH 4GMSH 4G6ML 1NCWL 4V1DA 1FNFA 5I1KL 4JPWH 4FTVD 5D2NC 5F7MC 5F3HB 3RVUC 4NN5C 3TFKC 3GIZL 3HE7B 2PR4L 4M6AA 4GLRH 3U0PB 1UH4A 3STLA 4DK6A 2J8UB 4HIXH 3MUGB 2C3VB 1RURL 4JZJB 3AS2A 2VDLH 5DD0H 3DVGA 1YN7B 2ZNWA 2OXGA 5F9AC 5E2WL 5JPNB 5GQBA 1G9ML 2EXWD 4I2XE 3MV8E 5FGBC 2QL1A 2YMXH 3O41B 5DUMH 3VFMA 3BN9C 1QFWH 3QB7C 4QRTB 1EZVY 2VN4A 4MHHG 2JJTC 4TVPE 2WIMA 4NNPH 4PGZA 2DI8A 1RUML 4EQ2A 4EUPG 1KJ2H 2D0HA 1FL5B 2W60B 4RAHA 5E6IA 2V5YA 3GDBA 3OPZL 4ODHL 3BD5A 3TVMD 43CAA 3VH8A 4NPYB 1NBYA 4JY4B 1F11B 3TPUE 3HNVL 3LMJH 2HKHH 5HHOB 5IQ7L 1S5IL 4S1SH 4CJ1A 3S35H 1GGCH 4PY8J 1D5MB 1BJ1J 2E8ZA 3V4UH 3WN5A 3UJJL 4EI5A 4HWBH 5IROC 3FFCE 3QA3A 2X4SA 3I75A 1CDBA 1YPZF 1D9KB 4BK4A 5MERA 35C8L 3MJGX 3ARDA 5DUPL 3VWKB 3D39E 4ODXA 3INUL 5T1MB 1MCPH 3KPSE 1AXTH 1B2WL 1H8NA 3PQYE 4LCCC 5K9KA 4PRPB 3I6KB 1X9QA 3OGOE 4XWOD 1NGXA 5BS0D 1VEMA 3S37X 1URLA 2OCFD 1FV1B 4NM8H 5T3ZH 4JVWA 1RJZB 4KV5F 2N7BA 3C60B 3OXRB 1IAKB 3MV9B 5DHVB 3CDGA 5TJWK 2VITB 2DQHL 3EYOA 3UBXB 1G9NL 4LCWD 1AIFB 4NBZB 2RCSL 1CIUA 3VXSE 2QHRH 3SKNA 3ARFC 3DURB 3P4OB 3T8XA 1GOGA 2IQAB 3QIWA 5SWSE 1C16A 4WUKL 1OLZA 3TO2B 4JFOA 1G7PA 1BAFH 4KY1H 1L0YA 5T1KD 4X0KA 3JWOL 4EUPH 5LJYH 1XF4B 5DTFB 5GS1C 3SBWA 1WVZA 3ET9F 4POZD 1Y18A 5JLZB 4XMKL 1NCTA 5GGQL 4NQCB 4L4TB 3DRQB 2YWZA 5BRZE 3V5DB 4P5TC 4GT7A 4XGZB 5J4MA 3RWFB 4WI3A 1MHPL 1Y6NR 4D94A 4NUGL 1KN2L 4OZGB 5CGTA 3T4AB 2JCCE 4RCAA 5A16B 2QQLL 1U3JA 3EOBB 1J0IA 2IC2A 1LQSR 1PLGL 3KPOB 1MREL 3JVGC 2RHEA 3SDAD 5C2BL 3HI5L 4QOKE 2JB6B 1CD1A 1QRND 4X4YA 3MC0A 5FYKH 3VXME 2KZ1B 4GFTB 2F53D 3MA9H 4XBPA 1E4XI 4K94C 4LGSB 4OF7A 2VE6A 5B38A 1ND0A 1LP9F 2WBJA 4J3WA 1EGJH 4D9LH 3VFUB 4P9HL 1T83C 1B0GB 4MA1C 5I1CL 2NNAA 3UBXI 3B2UC 5FOJA 4LCYB 1HHJB 3FO2A 4IIQA 2CUHA 3MRCB 4H8WC 3MRGB 1O7SA 5JXAH 1YEFL 5CJQH 4OCRL 3TJHD 5DK2A 5DJXB 4JM2F 3MO1B 1L0QA 5CBEA 1HHIA 3IB4A 3UTSB 1XEDA 5B3JE 3SDXF 4G9FD 1N2RB 1LK3H 4F7TA 1R3JB 4H25A 2NPLX 1UYWL 1YECH 3QUMH 1GJIA 1L9NA 1W0WA 2VABA 3SPVB 1YPZA 4NHUB 3O2DL 5D70L 4WWID 3PHOB 2R15A 4XMLL 1G6VK 4X7TA 3TV3L 1PY4A 4OLWH 4WNQA 5AZEH 3L5XH 5I8OL 1A7NH 1DN0A 4HK0B 4X98A 4NKDB 4XC3H 1JGVL 2G2RB 3BKYL 1YEGL 2FGWL 1XR8A 2I60L 3V6BR 5F3BB 2LAAA 4PLOB 5TDNB 4NFCA 3KPTA 5F7KC 2B4CC 3ILQD 2NY2C 4RFEA 4G8EB 4LSQL 2GUOA 4XPFH 1FE8H 3WO4B 4JQVC 4YHLH 4OUOA 4MXQD 1T21A 1MWAH 4QF1A 5B8CB 4N5EA 3ULSA 3QUYA 1ODAA 4KRPB 3QCUH 4OM0L 3NGBC 2PUQT 1F4YL 3HC0A 3RU8H 5IK3A 1GGIH 3QUXD 4Z8FH 4UB0L 4WI9A 3L3OA 1T20B 3CDYA 3R1GL 1QSEE 1H3VA 3OKMB 5IHBA 4OQTH 1KELL 1HSAB 5AZ2H 4LCIH 3V5KA 2Q7NA 4OD1H 3VRJA 4DEPB 2DYPD 1GC1L 1MCFA 4MNHA 1MIMH 3SO3B 2ATKA 1NAKH 1UJTA 2UYLA 1N5YL 3MRPA 3QEQA 3IRZA 4R97C 4UOW0 3O11B 1SMAA 3ULUL 4Z0XA 5JOFB 3VMNA 5FYJH 4NT6A 2AI0H 4QTHB 3LD8C 5HGDA 5E08L 1JWMB 4PV9A 5GIRA 4APQC 1MCQA 1ZANL 4R6UA 3WHXA 3H9SB 4JPKH 1S7XA 4G6AD 4YHOH 3BEVB 5DJ8B 1HKLL 4PREB 2IFFL 1MFCH 2DDQH 4FP8L 5TE4L 1FAIL 3C2AH 5ITBL 1JHTB 5FF6A 4LVHC 1G84A 3CUPB 2HAZA 3QQ3A 1U6AL 2NCMA 1XGYL 3PUCA 1INQA 1A6AA 1LP9A 5KBNC 2P5ED 3ES6B 4UV7H 4NFBA 5E6IC 3AS1A 1WAAF 3I85A 4MD0B 5IM7B 1RFDL 2PYEA 2V17H 3DXAB 1CFVH 2YUVA 4ODTL 4XB7A 4N8PA 1P5UA 3LH2L 4U6HA 1J12A 4JM2A 4CMMB 5FO8B 3WN5C 4EI5C 1BD2E 3BPCB 5D7JD 1LNUA 4MA3A 2VZ1A 2HTKD 3WE6A 3SDXA 4KZEH 4FQHB 3GJFA 3ARDC 1JJUA 1ZVYA 4U6XA 1QFOA 4AL8H 5ANMB 4QRSA 1RZIA 1KGCE 1BQHA 1RK1A 3VWJB 3I50L 4RFNC 3ZKQD 4HC1H 1CGTA 4NCC2 4GG8B 2C3GA 4RX4A 1YJDC 5I1IL 1KJ2B 1DBML 1NC4B 4MD4A 5ERWB 4O02L 6FABH 3GFUA 5EO1B 3RTQB 2O61A 3NCBB 2NY6D 2G60L 4H20H 5DDHA 3BP4A 5CEZE 2GJZB 4JVUA 5J9PB 1JMZA 2YXMA 3WIFA 3EYQD 4KVCL 1GHFL 4FNLL 3QIWC 4HPYH 4X9IA 4IEFB 1NAMA 4JY5H 5KSBF 4ZD3H 3FB5B 1BOGB 2OYPA 4MXVE 3LPGA 4DUVA 2W59A 4ZXBB 2X42A 2R4SL 3V2AR 3SBWC 3K8LA 5CIPH 2YRLA 4MCZA 5GRYA 3KNBA 2EYRA 4HZLB 4NQSA 2OL3A 1QLRB 1QSFA 4OZIB 5DEFB 1YYLH 4GLRI 1NCNA 2YUWA 4N5UA 1T5XB 1H3UA 2NX5D 4OLXH 5D2LE 2A73A 3K81A 4U1HA 1WCBB 2AK4B 2V9RA 4C55A 3CFKA 3CDCA 1C7TA 1JMXA 2AXJA 2EXYC 3BO8B 5I2IB 2ZKHH 1QFWI 3EYSH 4F2MA 1I9IH 4P5MA 3EJYC 1I4FB 1MVUB 4W6XB 1X6LA 1DBJL 1DEEA 4EUPB 2WBJC 4OGYL 4G6JH 2E8YA 4JFFE 1MI5E 3D85A 2DKSA 4OLYH 1BM3L 1YEJL 2YPKA 4J1UB 1EVUA 4HGWA 3NFPB 1YMMD 4IIQC 3WSQH 1ZS8B 4FTVE 1WAAA 5BO1L 5TPWH 4PJBB 1FO0H 4U1IA 4Q6IB 5F7FA 4AIZB 3EKCA 2IPTL 4H5SB 3QFDB 1CXHA 3LN5B 1KN4L 3GRWH 4MNQA 3FOLB 1IGFL 4YWGL 4IDJL 4KJWC 2JIXB 5I15H 1FFPB 5SWZB 5IGXL 5EUOB 1OSZB 3NFNB 1I3RB 5D1ZA 4XPGH 2HJFB 5CGMA 2V7NA 4WW2F 1ZLSL 3U0WL 3U7YL 2R0LL 3WD5L 3GMNA 3HUJE 3NOIA 1DQMH 1AGFA 2ZOLB 5DJAA 5TDPB 2X1WL 4JO2H 4DN3L 1Q9OA 2ZSVA 3BSZH 2X70A 4I9WD 5CEXA 3MTRA 1JZ7A 4NKOB 4MHHI 4C59B 4UDTA 1V7MH 1LO4H 1K4CB 2QSCL 3NABH 3ZL4L 5GGVH 3BHBA 1ADQL 4Z5RB 3L1OL 4N5EC 2VYRE 1N0XH 5KSBA 3QUYC 3L3GB 1T1YA 2XTLA 3VFSA 2HWZH 3QUMB 1G7MA 1IGIL 1HILA 4NO0A 4WU7A 4M7LL 1NGWB 3E2HB 4M5YL 2OSLB 3B5GA 1AKJA 2ADGB 1X3DA 3MRRA 4XTRD 2H3NA 4KTEH 1Q0XH 3FO0L 4Z77A 2FRGP 3WXVL 1XH3B 12E8L 1ZV5A 1CXFA 1UCBH 4NQXB 5DFVC 4LEXH 2NY5H 4L1DA 4CDGC 5DJCA 5T1LB 5A43C 2X4NB 4LCWE 1YEKL 3HN3A 2Y07L 4P2RA 4L4VB 4M3JA 3O4LB 4RMWA 2FHCA 5HHXL 5DD1H 4M9OA 1KTLB 4YK4C 1MWAB 1DANU 4ZUTB 5JIPA 3QULA 5H2BB 4GG6B 1U8OB 2Z93A 3H3KA 4F58H 4H0IA 3OXSA 1CD9B 4QXTA 4WCYH 3PWUA 15C8L 4QHMA 3EO9L 1ZLWK 1LHZA 4JDTH 3H7LA 5E95B 3HLAA 2A6KB 2FEEI 4M7JL 3LZFH 1HDMB 1OAZH 3F65A 1MNUL 4HWZA 3JV4A 4OCXL 2WUBL 5GS2H 2H2SD 2X4QB 1FG2A 2GAZA 2XG5A 1K3IA 5D5MF 2BNUB 2J5LB 5BV7L 4PRAB 3BRDA 4I48A 4JRXD 4Q9BA 4JM2C 3U9UB 2WWMC 1QRNE 5LXGL 1OP9A 1ZHNB 3IFOA 2ZPKH 2DLFH 4I0PA 3SO5A 2VDPL 4OLVH 4G42B 4GXUM 3HMXA 1BEYL 1L8JA 3MRHB 4TPRL 3WUZA 2H32A 1FNEA 3QFJB 2BFVL 2D9QB 4X4XA 1XCTB 4YX2H 3ZYOA 4M7ZC 3FQNB 2HMIC 4Q0XL 4WW2A 5EOCH 1UKSA 4PS4H 1MPAL 4PJDB 5IB3B 5IFHL 5IB4A 1DUZB 2GFBA 5EU6D 4ODSH 2GJ6A 3P40A 4X6EB 3STZA 3I02A 4QWWC 4G9FE 2OMNA 4HWNA 3W9EA 3EHBD 1XGPA 5AYQA 1AY1H 1C5BH 4JHBA 4DUWA 5I1JH 1KB9J 4NO5B 3AXLA 1F4WL 4C56D 2WWKO 4Q97A 4R96A 4S1RH 1S7UB 2HT3C 2YA0A 5HBBA 3C5JB 4HG4K 5T5FH 3MCLL 2ENYA 2I07B 4TQEH 3KYAA 1A7RH 3QDMD 1KB5H 4WFED 1F90H 1S3KH 3KLAB 1QNZL 2BNQD 2R1XB 3BZ4A 1I7ZB 1KPRA 1EEUA 1SJHB 4BJLA 1JFMA 4LIQE 2YZ8A 5FCSH 3RIFF 4MQ7A 5I1EL 3QHTC 4Y4HD 5HGGS 2X1OA 5GGSA 4X8XA 1OB1B 5J0BA 4TRPH 4WHDA 3L3DB 2DN7A 4O4YH 3G5YA 3FRPG 3QIUB 3LDBC 2GTWA 1IRAY 4UINL 3CIQA 4DTGH 4ETYA 4FQCH 5C9JA 3BI9X 1HWGB 1D5BB 3KPQA 1IL1B 1FZMB 4GO6B 3AC0A 4XCNB 5CIPB 1ZEAH 1T4KB 4ZFOA 3NPSC 2NY1B 2I5YL 1SEQH 1VADB 4IRJD 3W2DL 4ZSOE 1B0WA 2P5WB 5K9OB 5JNYB 3BEWB 3ZE0F 1CFNA 1IC4H 3TBSA 5F6HI 5AUMA 1IGCL 2AV7A 2YD1A 3TT1H 1KJMB 1ZVSA 3GSWB 3EOTH 3LSOA 4HPOH 4XVUD 4HBCH 5E99H 3U48A 2C5DC 5ALBL 2CDEB 4LK4A 2A6DA 4HXBH 2VLLB 2D03L 4BFGA 2R1YB 1SYVB 2C3WA 1FYTD 2E9WA 1IM3B 1ZT7B 2CJUH 3C9NB 3GK8L 1NCBH 3PGFH 1AGBA 4XT1C 2KQMA 4PDCE 1OOAA 2UWEE 1JN6B 3QWRD 5D9SA 5F72S 5F8RC 1A6UH 4YE4H 3VCLA 4PRNA 3BJLA 1FNSH 5D1ZC 2P5EE 2CIKB 1QFWM 3FOMB 5FOBB 1S8DA 1I1FB 4MJ5A 4P4RA 2ED8A 2XG4A 1I8MA 2BSRB 4XI5D 2JELH 1VDGA 1FGVL 3HAEA 5AD0B 4FQ1H 4ZFFB 3L3HB 1FO0B 2E7BA 2XFXB 3WFCH 3OF6D 4LGPB 5DJZB 1RIVH 3VI4F 4N8VG 3RPIB 4M6ML 4EQ3A 4EZMA 4WEBL 5JW4R 1CVRA 1UB5B 3NZHH 3MGOA 5FKPB 3PWPE 3QDAA 4EBQL 1HEZB 1XIWB 2DQIL 2IAMA 3GHBL 2CXKA 3VFVB 3WFDH 4OIIL 1TCRA 4MNGB 3TO4A 1NMCB 4O2CB 1J8HA 4AT6B 4JJ5A 4NNYA 3ZLQC 5ALCH 1QBLH 2D4DA 4MQSB 1KPVB 2FH6A 4WTXA 1ZGLP 2PCPB 2R1WB 2RQ8A 4I3RL 5JOPD 2XWTB 2HVJB 1P9MA 5EZOL 4HKJA 4YGVB 3GSXB 4X5WA 2VUYA 4NRXB 3PGCB 3EJZC 1S9VB 3FO1B 4FFYH 2X4OB 4YHPA 4XCYB 5DRZA 5CP3H 2PTVA 2LABA 3E3QA 3RWGA 4V3DB 1RUAL 4FG6D 5BVPH 1Q9KA 1AGEB 3IDYB 3LKNA 3OAZH 1KTKE 1GPOH 5F9DC 4PB0L 4X8JB 3P4MB 5C6TL 4FQJH 4G8FB 4LMQI 4X99A 1DBAL 5HYSG 4LPYA 3QXTA 3SE4A 5JW4Q 4LSPH 3W81A 3S88L 3OKEB 5HHMD 1PKQA 4POYA 5D96B 2J4WL 5EUKB 1EPFA 4JRWA 5GISL 3T65A 1A1NB 1WEJH 1HSBA 1I9EA 2X4PB 3CFIC 1OP5H 4YHNB 4P2OD 4YFLF 3WFEH 4I0PC 2HJKA 4UIMB 2HT2D 5TQ0L 1P7KB 4J3SA 3K80A 3S96A 3LEYH 3ZHKA 4KQ3L 3O6LL 5E2JA 1UM4L 3DTXA 3RZCA 4M43H 5JIHA 4WHYG 4S2SA 5ID1B 3KYNA 2XN9D 3U36A 4WW2C 3VXQA 4FQ2L 4GAFB 3T1FB 5J13B 4YNYB 4ZQKB 4FFZH 2ADFL 1FNGA 4KQ4H 3TFKD 4OI9A 4J3XA 5KS9B 1T2QL 3DIFA 3OB0H 1BLNB 2WK2A 2VAAB 3UC0H 1HQ4B 4GMSL 4U6VH 3W11C 5HYJD 1A9BB 2DS4A 4Z76A 4JPWL 5GRVK 4NYLA 1OARH 5EB9A 1T3FA 4K9EH 4QNPF 3FT2A 4J12A 3V6OE 4G3YH 4PG9A 4HIXL 3ZE2F 3BN9D 2ARJB 1RUKH 2VDLL 4HV8B 5DD0L 5IV2B 1VPOH 2APWA 1RK0A 3B3IB 2YMXL 1J5OH 5DUML 3W0WE 1CT8A 2EIDA 4U1LA 4I9WE 4PJXE 1QFWL 4IRZH 4Z7WE 4NNPL 2MFNA 4F37F 4LP4A 5F71A 2R9HC 3L7FA 1KJ2L 2D2OA 4ETQA 1OLLA 4R2GB 1XF3B 4EN3C 5F7DB 4KGJA 3DO3A 4WHYH 5C8JA 1TVBA 3D18B 3UTQA 1FGNH 2R2EA 4WGWB 3V6FB 1UENA 3VXTA 3LMJL 2HKHL 4GRMA 3RY5A 4S1SL 2DL2A 1GGCL 2DLTA 4HDIA 3V4UL 4KI1A 2XTJC 4JB9H 2GTZA 3IDGA 2YUZA 4HWBL 2IALB 3MJ7B 4LHQB 1YY9C 1MUJB 1KB5B 2V2XA 3DX7A 3NIGE 3MSPA 1AXTL 3GSQA 1SQ2N 5CEZH 3ZDYE 3EZJB 1F8TH 4MS8A 1P4IH 2XPGB 4NM8L 4OFYA 5T3ZL 3UPRA 3EAKA 1AI1H 4E41D 1IARB 1RZ8B 4FA8A 1JRHI 4PJCF 4YZFF 1KIPA 1XGTB 4N0CA 4WU5A 1YUHA 1QQDB 4Q6YA 3TH2T 3X11A 5C3LD 1S7WA 2KDGA 5C0AA 2QHRL 1EZVX 2ZUTA 4LLVB 1FVEA 4LASH 4ELME 2Z31B 3OGCA 4KJYB 5M95B 1C1EH 2P8LA 4P9MH 3P11H 1KNOB 4OCWH 5E24E 1ZHLB 1BAFL 4GUPA 1MHCB 4GSDH 4KY1L 4Y19B 2W9EH 4P5TD 4Z7UF 1WC7A 5F7UA 4QRPA 3KLHC 4BSVB 3L95A 1A4JA 2VC2H 2XKNB 2BNRA 3CMGA 5DVLA 4H88H 3DMMB 1N5AA 4JRXE 5SWSB 5DI8A 1RZJH 2OS7A 1DQJB 1LVEA 2BY2A 3BE1H 2F9BT 2AJYH 1BFSA 5GGUA 1RV6X 2BVOB 1KLUA 2JB5H 2B5IB 4JFZH 5IEHA 2IAMC 5EPMB 1IVLA 2GSIA 2YOCA 2QSTA 1C12A 1U8NA 2N1KA 2VNCA 3TO4C 3S8WA 5FYKL 5CAYB 4JFDA 3HNSH 2JF1A 3B2UD 2NLJB 3MA9L 3WFBH 2JCCB 1HXMB 4GH7B 5EU6E 2VLKB 3UZQA 4YJZL 3B9KA 4NO2B 1P9MC 3JWDH 5A2KH 4LVNB 3H6JA 1EGJL 3JTCA 3DSFH 2J3SA 2VUOA 4LSUH 1BIHA 4AM0A 4DVBB 2E7MA 2OBGA 4PRBB 4C56E 5JXAL 2FYYB 4H26A 4IBLT 4KFZC 2C4FU 5L8JB 3E3QC 4OLUH 4HUNB 1H8SA 4D9RD 2FEEL 4Q2ZB 2YPLD 1HCFX 1MRCH 5DEGB 4WFEE 5JW5B 3BN3B 1MFEH 2BNQE 4PP2B 4CADB 2FX8H 4NC1C 1LK3L 5TDOB 2PETA 5MI0B 1G9MC 5DK0B 4G5ZH 4PJEE 1YECL 5LQBH 3QUML 3KLDA 4EIGB 5IMMA 2BDNH 2LTQC 1CXKA 2BMKB 4NQUA 3SE4C 3NCCB 1N26A 4JY6B 3JWNC 2EC9T 3VE0B 3RWHA 4OLWL 5AZEL 1WSST 3L5XL 1MCCA 3DX8B 3X13A 2H6PB 1JUFB 1OTTC 3WBDA 4R7DB 1A7NL 4TUOA 5F88A 1T04A 3L3IB 4XC3L 1QHOA 4EJ1C 4OQ1A 2V5TA 4MSWB 4QKXB 5F7HA 4F7MB 2PYFB 2HFEB 5J8OA 1AO7A 4MDJB 4PJCA 4ZOEA 3PV6A 2G9HA 4B53A 5I17B 4XPFL 1YEHH 1FE8L 4YHLL 3RZCC 3V0VB 4OKVB 3B9VA 1MWAL 1CGYA 4PIRF 4D9QD 5IBLC 5MEPA 2FNBA 3DYOA 2YD2A 4QHLA 3T77A 4HCRH 5L0QB 3QCUL 4V1DD 1Y0LB 3CX5K 1ORQA 3BYTA 3RU8L 1GGIL 2AJSH 4Z7UA 5HXMA 4Z8FL 1YZZA 4ZDHA 4N8VB 3PV7A 4J6RH 4G6FD 1FYTE 5E8PA 3HB3D 4OQTL 1U3ZA 5C0IA 1KLGA 5AZ2L 4OD1L 3ARBA 1EHNA 2V2WA 4K8RD 3MZTA 4YO0B 4APQD 1G7HB 1MIML 5B4MC 1NAKL 3U6RA 2W65A 1QFHA 2CRIA 2NY3C 1FFOA 2AI0L 3QBTB 1QSEB 2NXZB 3VFRA 3D0VA 5FYKU 3E6FB 2I26N 2VLJA 4JPKL 5I74B 3TN0B 4YHOL 3RI5K 1YEEH 1MFCL 2DDQL 5E6ID 5H37G 3FHQA 3C2AL 1YNLH 1CLYL 2FATH 3EYFA 5KVGL 3SY0B 4PJ9B 4DFIA 1TQCC 2CLVA 2MHAB 3GSUB 2GT9A 3H9HB 3BVNB 1EERB 3T0XA 4PGDA 2DQGH 4UV7L 5D1XA 3VD3A 3CXHK 3HTLX 4EI5D 4Y4FA 3IGAA 1T7ZA 2V17L 4IHOA 1CFVL 3IETA 1OTUC 1S9WB 1EJOL 5EC1A 2NY4B 4C4KO 3K0WA 5I1AB 3O3BA 5J3HD 1MCEA 3Q3GB 1EAPA 3TIDA 4ODBD 1BFTA 4LKXB 1T1XA 5HYSB 4KZEL 4PTUA 2AXHA 5JORA 1V3LA 4AL8L 5JOPE 2VDRH 4HX1A 3VXPA 5E8NB 5FECA 2AJXH 2CKBA 4I2XA 3MV8A 3VG0H 2I27N 4MS8C 4P9HC 3F7VA 1NFDF 1NKRA 4HC1L 4ONGH 2F5AH 5BZWB 4HIIB 2HTLD 3ME0A 4PJGE 3OAYK 4FXGB 4LU5H 2X4RB 5AEAA 6FABL 5J6HA 4MJ4A 3QIWD 1ZE3C 4GW5A 1JNJA 3PL6A 4DGVH 1HOCA 4OUUB 4N0CC 2BERA 4H20L 5T3XL 4XNZB 2XKSA 2CLRB 2UY6A 4HLZH 2VSDA 2RIKA 3J7HA 5HDBF 2EIZB 5H37H 3HR6A 4D8PB 4HPYL 3TPUA 4JY5L 3HG1A 3IF1A 4JRYD 4ZD3L 3CD4A 1G6RA 5B3JF 4LEOA 3O81A 4HJ0C 2J8UF 2ADJA 2L4OA 2G75A 5F89A 4YQXH 3LPFA 1NBZB 1X4YA 2FIKA 2IH1A 5H94A 3T2NH 5HHME 2P1YA 3EYVB 2EH8H 3KPSA 5HY9B 3PQYA 2CQVA 1S7SA 4LGRB 3BPLC 2WLZA 1OL0A 2XRAH 1NUFA 5EO0B 2GSGA 1YYLL 5E5MB 1E0OB 2EXYD 3G6JB 4PJHF 5EU3A 1OHQA 4PRIE 3IJYA 2YA2A 4RGNB 5C08A 5FYJU 5ICZB 4OLXL 4R4NC 4U4BA 5DVOA 5KVMC 5LWYH 5IEKA 2I24N 4NN6C 3FB7A 1SMOA 4BSWB 1NGZA 3HR5B 5DZLA 2XN9E 2ZKHL 2GYSA 4KUCF 5MEQA 3EYSL 3QDGD 1INEH 1I9IL 5CKGA 5ELIA 3ETBF 3PWLA 5D2NE 4TOYH 3MFFA 1CTNA 3B9KC 3T3MF 3T3PF 1PZ5B 4G6JL 3NA4A 1D6VH 1DL7H 4OLYL 1MCKA 2EICA 5D93B 4AH2A 5HYJE 4UOW1 1GC1C 2YK1L 3GSNB 3WSQL 3NIFE 2HT4C 4WUUB 3ZKNC 4OZHF 1EO8H 4LHUA 1FO0L 3M8OH 2Y4SA 1J0HA 5AG8A 1PX4A 4KJWD 1S7QA 4Y4KB 4CVWA 4WWKA 4W4OA 3QXAB 3BP5A 1FVDB 4M1DH 3GRWL 1BBDH 3QO1B 4M00A 5EIVA 3HZYB 4PRHD 4MCYA 1AD9A 1NJ9B 4N9GA 4PJ8A 4N1EA 1QBAA 3MLUH 3IU3B 4U49A 4YDLC 3C87A 1K3ZA 4QOKA 5I15L 1LE5A 5DGQA 3VXMA 1WFTA 1CICA 1U8PA 3U4EB 4L3ED 2P7TB 4XPGL 4Z7VE 3MNVB 3VGDA 2BSED 1LD9A 5E2UH 4UOJA 1KIRA 1NFDA 4TNVK 3O9WB 3L6FB 1AGDA 4X7CC 4XNYL 1DQML 1RHHA 4JO2L 1XGRB 4L3CB 3AAZB 1EEQA 3BP6B 5HGHA 3VXOA 5BJTA 1UQSB 2PW2A 5EZJB 5DLMH 2AJZB 4DN4H 5L2KA 4JPIB 4XVJH 4UQ2B 1V7ML 1LO4L 5IMLB 3KJ4B 3NABL 5D7IB 3TH3T 3T0DA 1UXSA 5GGVL 3HUJB 5F3HA 5IW6B 4M1CC 1N0XL 1A21A 2BSSA 2HWZL 4HH9A 5CKAA 1J10A 2HFGH 4MB4A 4RRPG 3UAJC 1R3HA 3FRUB 2C3VA 1QKZH 2Z4QB 5ENWB 4P2YA 3EOYG 3QEQD 3QIBB 3ULVH 4KTEL 1Q0XL 4WDIA 5JPNA 5F7WC 2APVA 4E41E 3ABZA 1R0AH 4FQXB 1BVKA 2K9UA 3ARBC 4LEXL 2NY5L 4QRTA 4PJHA 3MLYH 4HIHB 1UACH 4QRRB 3V95A 2NXYD 1KXTB 5DD1L 1RMFH 3D3VB 3W39A 1MFAH 2FJGA 4X6DB 2D31A 2ITCB 4JN2B 1BZ7A 5E8EA 5KVFH 1LK2A 1MJJB 4JY4A 5C0DA 3LS5H 1MSPA 2EO9A 4LCWB 3C5ZB 3DGGA 3VXUD 4F58L 2YD7A 2PYED 1KCKA 3ORJA 2H41A 4UAOB 1U3YA 1PDKA 3SGJA 4JDTL 5J11B 3C6LA 3VWKA 5D1XC 3ZTJG 3SDDD 4JM2D 1FZKA 2WWMD 1IC7H 4Y4FC 2C9AA 3AM8A 1KJVB 3LZFL 4PRPA 1OAZL 4FRWA 3HFMH 1F3RB 4OZHA 2Q87A 3FKUS 1B9ZA 4G59A 4QHKI 4WV1A 5DA4A 4Q9RH 3C60A 3OXRA 4D2NA 3MV9A 5JXEA 3VFOB 2FO4A 2DLFL 2ZPKL 3SQOH 3IFPA 2QADD 3MYJB 4IOFC 5HHPB 4RX4D 3V7AG 4OLVL 1AIFA 3RJDA 3MRBB 3QWOA 5ACZA 5D6CA 3WL9B 3OJMB 2BXZA 1FZOA 3KYOA 3PDGA 4XH2B 3LQAH 2RFXA 1FQ9C 4GKZB 5CEYB 1K4DA 3KPLA 3HS0B 4QWWD 5ESAB 4E42B 5EOCL 5BZDB 3ARGB 4G8IA 1CXIA 4PS4L 3PL6C 4NN7C 4OZFG 1KCLA 5JLZA 1X5ZA 2WW8A 1IZJA 5DQJA 3S3SA 4ODSL 4D9RE 2OJZH 2HT3D 1TNMA 2ITDB 5EIIB 5GGRY 4D0BB 4XGZA 1DQLH 2QSQA 3RWFA 1K8IB 1NDGA 1AY1L 1C5BL 5I1JL 3C6SB 3CPLB 3LV3A 1QSFD 3EOBA 4S1RL 3KPOA 3SCMD 1XGUB 2WV3A 1KCGC 2F15A 1UZ8A 1N6QH 3ZTJH 1UT9A 1P7QD 1G7LA 2JB6A 3U0TB 4TQEL 1A7RL 4MDIA 4P5KB 1KB5L 1F90L 1S3KL 4JLRB 2BOBA 4Y16A 4YUEH 4M93C 3KLSA 1FSKC 3QHFH 1S78C 3WFZA 2VXVH 1QFUH 3IDIB 4JFEE 4CNIB 5DS8A 2CLZA 3VFUA 2HVKA 1B0GA 1HQRB 3LRSA 2AEIT 4JO4H 4M61B 5IQ9A 4TRPL 3Q5TA 2C4XA 2Z8RA 4O4YL 1U8LB 2DBLH 1H15A 5HDOA 4D9QE 3MRCA 1D5XA 2IANA 4JKPH 5EORH 3BZEB 3D85D 4DTGL 3WCYA 4PRDB 4V1DE 4FQCL 1AXSB 4RISL 5F9WB 1QYGH 3QR2A 1X5JA