5E6RB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
459
structure length
454
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-L
total genus 118
structure length 454
sequence length 459
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6rB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6rB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6rB03
3EOAI 3ZE0B 3HXOA 1RD4A 3PPYA 2VDMB 3EG9B 1NA5A 3PPVA 4HQNA 1ATZA 3IJEA 3BQNB 3OL2A 1PD0A 4IGIA 5HGJA 5KYNA 3K6SB 3IJEB 3FCSA 2XWJI 1IJKA 3EG9A 4HQFA 4MMXA 5KYWB 3NIGB 2VDPB 1TYEB 1JEQA 1JV2B 1PD1A 4JX0A 2VDKB 2VDRB 3F74A 1XDDA 4A0QA 4NENA 5E6RB 5E6SB 2X5NA 1M1XA 3ZDXB 5HDBB 1T0PA 4PN7A 3AL8A 3TVYA 3FCUB 4C2AA 1L5GA 2M32A 4CN9A 3AL8B 3EH2A 3K71B 1RTKA 1SSLA 1SHUX 3TCXB 1JEQB 4G1EB 1IDN1 1M1UA 3M6FA 3ZE2B 5KYXB 3IBSA 3TXAA 2VC2B 1CQPA 2NUTB 2XGGA 3K6SA 2NVOA 4HQOA 3K72B 4O3UB 3V4PB 1XDGA 4WJKB 1FE8A 3EGDB 3ZDZB 5KYYB 3VI3B 1YVRA 1MF7A 1M2VB 3Q3GE 4MMYA 3TW0A 4F1KA 3EGDA 3T3PB 3GXBA 1IDOA 4XW2A 4O02A 4K3JB 4UM8B 1IJBA 2B2XA 4BJ3A 3BQMB 3NIDB 2NUTA 3RAGA 4MMXB 1V7PC 4G1EA 3EGXB 1BHO1 3QA3E 4IXDA 3OKWA 4F1JA 1U8CA 2VDQB 1QC5A 2ICAA 5KYUA 1PT6A 4FWWA 3EGXA 5KYXA 1DGQA 4UM9D 1MQAA 4WK4B 3E2MA 3OKYB 4WFQA 1AUQA 5E6UA 4O02B 1M1XB 2P26A 1AO3A 3K71A 1FNSA 5E6SA 2NUPB 5E6UB 1M10A 4FX5A 1OLZA 1QCYA 3N2NA 4GZ8A 2ODQA 1MJNA 1SHTX 4JDUA 5KYWA 4C29A 2ODPA 4NENB 5E6RA 3FCSB 3HXQA 2IUEA 5ES4B 2I6QA 1MQ8B 3AFCA 2XWBF 1MHPA 2QTVA 5KYUB 1YUKA 4G1MA 1DZIA 4HQLA 4UM9B 4M76B 1SHYB 5LN1A 2WW8A 3EH1A 1M2VA 4IHKA 4CNBA 4NEHB 1L5GB 3AL9A 2I91A 4MMZA 1SQ0A 1N3YA 1PCXA 1ZONA 2ADFA 2P28A 1ZOOA 1RRKA 4MMYB 1U0OC 3T3MB 4DMUB 1JV2A 1BHQ1 4Z7QB 2O7NA 4Z7NB 1ZOPA 3EOBI 3ZQKA 3EFOA 1QC5B 2NUPA 1JLMA 1U8CB 3K72A 3HI6A 2UZYB 3ZE1B 4WK2B 4Z7OB 3BN3A 1JEYB 3ZDYB 1N9ZA 1Q0PA 3EFOB 3VI4B 4CN8A 3F78A 2VDLB 2WINI 1JEYA 3V4VB 1U0NA 3NIFB 1CK4A 1MQ9A 2I6SA 1M2OA 4C2BA 5BV8A 3PPXA 4O3TB 2VDOB 1AOXA 3NVQA 5HJ2A 1OAKA 5KYYA 4WK0B 1LFAA 4HQKA 1T6BY 1UEXC 2VDNB 1RS0A 3OL2B 1YVPA 3PPWA 4G1MB 4MMZB 1XUOA
chains in the Genus database with same CATH superfamily
3FVQA 2IO5A 3TLYA 3TZEA 4CSSA 1TLTA 4DPLA 4M37A 3TE7A 4CMKA 1FN4A 1N4XL 3GSVA 3KJ4B 2IPKB 3TV3H 4JD5A 1OD9A 1H8NA 1RZJH 1NRWA 4QLWA 1T5IA 4YCJA 3B6SA 4HH8A 3DZDA 1V47A 2FEAA 3HKEB 5EJ8A 4FA7B 1PEAA 4NR0A 4YV2A 4OXNA 2OKCA 4OZFA 5EIEA 2GBFA 1JYWA 1EWTA 1XD2B 1RZUA 5IM7A 5FO9B 3STXA 3OKFA 5IIEB 3NIDB 1R5WA 4CQJA 3B9RA 2OG2A 1VCHA 4F2HA 2Q2NA 3OVMA 3OTQA 5ALMA 1I9IL 4YMUA 3B9PA 3HOGA 2H3EA 1Y8CA 4X4XB 4BLUA 5CNHA 4EY4A 2MH4A 1QIJA 2C29D 4RMGA 3BEDA 4UTAL 4FJZA 1P1JA 1I3NA 3X2FA 3LCJA 3V7MA 5GGVH 3LP5A 1A69A 4NPCA 4NT6B 5C07D 1XZ0B 3FUKA 4MZDA 4HBQA 1DTWA 3KIPA 4QXTB 5CFRA 5HPOA 4E9SA 3OLCX 4ITVA 3GHBL 5DF1A 3T3DA 3KEOA 4FNMA 2VZOA 2YA0A 1KMGA 2P8JA 3VGAC 3RGBA 4O29A 1P9MC 3IVKA 5M29A 2I34A 3A9SA 4GKNB 2GM3A 2DL9A 4RV5A 3V42A 2YUVA 1VKRA 4KBGA 3HKBB 4OYLA 3OPXA 1NAHA 3QOFA 4JUIA 3P9IA 3BVTA 4U3SB 2CFTA 5CUQA 3QEHB 2AJXL 1KSRA 2Q46A 3INNA 2WLIA 4L4JA 5E3JA 3FONB 3QS2A 1CUUA 4LY0A 4EVIA 4C2AA 1WPXA 3WYNA 3HUJA 3D51A 1HURA 3P9NA 2KI5A 5JAUA 1K3UB 4WI7A 3TQFA 2WM0A 1NBOA 4DLYA 4JZYA 1H1LB 4B44A 4MPTA 1KO7A 2YJNA 4YFVA 4LDNA 4PG8A 4CKBB 5JPMC 3FB4A 1XCLA 5FWQA 3IB3A 2EL7A 4JGGA 1SB8A 1A4RA 4F2ME 1TTTA 2G40A 2H7CA 1VBKA 2X40A 4YK4C 4KCGA 1MV8A 5LUMA 5CBPB 2W59A 2YOGA 2WB2A 1Q1JH 3HR4A 4LHUB 3G3EA 4KXXA 4PJ8C 1VRSA 3BKJH 1UT1A 4MZ3A 1QHPA 3FU3A 5GOTA 4MW4A 1SOQA 3IJ5A 3L7NA 2C7VA 2X41A 1M3IA 1O5TA 1A2KC 1PS8A 3HC7A 3CZPA 1KTDA 2Q7OE 5B1JC 3U44B 5DHUA 1HHGB 2VP0A 2J0UB 4M1ZA 3O9ZA 1G6HA 4AIIA 4K9OA 2E46A 2Q3BA 4X99A 4GMFA 1QU3A 3VFSB 2JK0A 3UVEA 4TPRH 4EB6B 5I9IA 4TS9A 5L2KE 2XXBA 1N6QH 1G8YA 5EWMB 3GMQA 2F7RA 1KCLA 2A83A 1E43A 4MQ4A 1G3MA 3LOWA 4YJHA 3UGJA 1PNRA 4DPKA 3QRGL 2XZZA 1UMDA 2X4LA 3OQMA 3BXNB 4FFZL 2VRQA 3HCVA 3OKDB 4CXMA 1OC4A 3LS2A 4OF4A 2AOUA 1OAYL 2O1AA 4KKAD 1A4KB 3JTEA 8FABB 3SDDC 2ZOSA 2VP5A 3DZKA 4TTVA 1X7WA 3UZVB 2HAEA 3H3PL 1CVRA 2P6PA 1IUOA 4YONB 4YXWA 4LCIH 2JB5H 2EEZA 3BEOA 3LSYA 3MTAA 5CXUA 3BWUF 4ITRC 3AETB 4P9HH 5K4GA 5FWAA 4HEPG 1U65A 1G43A 4DKTA 1KPRB 4KI1A 1I3OA 4ZDJA 3ROOB 4ZYUA 3RWCB 3Q15C 3A25A 1Q44A 5CIQA 3H1EA 2ZYDA 3Q6NA 1SQMA 3N07A 4MVWA 4J1UA 1BE0A 2NY7L 5L3QA 3Q85A 3HYCA 4J03A 2C5BA 3SDDA 1L8AA 3LPDA 4JB8A 3OETA 2JASA 1C50A 4JPQA 2FGZA 3H65A 5AXDA 3ZNNA 1B9KA 2H7WA 1MKFA 5AKYA 4M38A 4BHUA 2V8BA 3P9WB 5CJQL 2LVBA 2QV4A 4UU0A 1OPOA 2ZSWA 3GNSA 1CQKA 5SZKB 2IDJA 2QP9X 3WNIA 4KO3S 4UBDC 4ENQA 2FUQA 1KC5L 3IQFA 2EEXA 3VKHA 1X5YA 2E9GA 3FTZA 1B8OA 5F1OA 2VP9A 5BYAA 2AG1A 1R6XA 3QXCA 3EJCA 4YPOA 1PL6A 5EOCH 2XT9A 2D13A 4TV9A 4PJEF 5K0SA 1LV7A 1DQQB 2GN2A 2H1RA 1NZDA 3EIWA 2ZETA 4Q89A 4WTXA 4EAEA 1JSLA 3AR3A 5KJ1A 1OXXK 1AGNA 2PUVA 3NHFA 1MJ7H 1CU1A 3QXGA 5HCIA 1S7UB 1YCSA 3A6GA 3NNSA 3UAJA 5DYOB 1C4KA 4CNQA 1H5BC 3FW6A 4XZ3A 3KYDB 4WZ6A 2ZX6A 3O9VA 3A6CH 1BTOA 4R83A 2CLVA 4P2QA 2PKEA 1MF2H 3MRMA 2AJUH 1Q2UA 3CSFA 3HY6A 3GH3A 4PHCA 1NGZA 2MQ0A 2ZBUA 4CVXA 2CXSA 3BQUA 3ESAA 2JGDA 3IJSA 1YFJA 1EVEA 5I0VA 2EDJA 3IMEA 1LSJA 2AI1A 2Y71A 3L0SA 3RPKA 5DYNA 4KQ2A 1SBNE 2RC6A 1GTL1 1UJ2A 1PYDA 3GD7A 3OXSB 3L4EA 3L6RA 3NJJA 1TZKA 5HJDA 3D3VE 4PVBA 2VTDA 4Q1DA 3QEUA 4L3EE 4CTKA 2IS1A 3UNXA 4Q05A 3TLMA 3OZGA 2UZYA 4W1SA 4WTZA 2E55A 5EE1A 1EJ8A 1SC1A 4I4TF 3H7IA 5L2KA 1OMOA 1S2EA 2AJZB 3BN9D 4PJXA 1M0TA 2AN3A 4C04A 1NAMH 3G2HA 5IUNC 3WU1A 3HI6L 4OFWA 4NNPA 3K0CA 3R0ZA 3IETA 1IXRC 5F9JB 1BD2A 3D4NA 5EWLA 3BULA 5DWUL 1PFKA 1KGSA 2O2CA 4KTVE 3UJIL 3LWBA 1WO2A 3QYAA 3KQNA 4RNCA 4DW2L 1A3LL 5PGMA 3GLDA 4P98A 3NWBA 1AE6H 4HWUA 2VDUE 1MXGA 1BYNA 3JTBA 2HSJA 4J29A 1GQOA 3T9CA 4S1RL 3N6RA 3MNZB 1GPH1 1UWXH 4CKEA 3QDGE 5IVNA 4IBWA 3RRZA 3LPPA 2IOHA 3W9UA 1SXNA 5I82A 2QSYA 1AX9A 3ULVE 4FMCB 3WBBA 3GLQA 4CRWB 1RLBA 1U9JA 1F2TA 2E4ZA 4IP0A 3O11B 3QWQB 3V9CA 2KLTA 3KJFA 4ZTZB 5EP3A 4RX4A 5A3ID 1XFDA 2P3SA 4GX5A 4AUNA 1CFTB 3FB5B 5KVVA 1FB5A 4MA4A 1U63A 4L3CA 1UBMS 1J18A 5ESAB 25C8H 2VDJA 5IW6B 1YC7A 5KSBB 4F9EA 3T04D 3GRCA 1BF2A 2BMFA 3PP4L 1MHEB 4QBIA 5H59A 3BWMA 2WJGA 2BC4A 2QSUA 1N5KA 1NAML 3FQ2A 4UJ5A 1K7FB 1D3AA 4XUDA 1NAKL 2OO7A 4BWFB 5L8LB 3TJMA 2H52A 5I1DB 4P2OA 4CUJA 4OAQA 4U1GB 3PPYA 2BNQD 3ECSA 2ZAIA 2Q5HA 4LL1A 1ZTXE 5AYQA 4J94A 4RNDB 3SJAA 1EVKA 1HU8A 3IAGC 2A5JA 3VMMA 5I7SA 2IU3A 2EYTA 5DZPA 4H13C 4Y1FA 4N90D 4RFNB 2AR9A 5IDQA 1VGRA 5D2LB 1F8UA 1HKLL 4X6FA 3ZE0E 2PZJA 1OWRM 3T8MA 2HBRA 1URZA 1LTHR 2UY6A 1FFRA 2Q6WB 1ZWKA 3WJJA 5AK3A 3ZSTA 4MDJA 3TWOA 4GMKA 3WNKA 1BFDA 4AC4A 3VR2D 1UA6H 4W4OA 3RF7A 3JZYA 3FTPA 4FDWA 4R84A 2DR0A 2LLNA 4MD0B 1AXEA 3BPNC 2QKIA 4K6KA 3I28A 1SH7A 4RH1A 5GOZA 1KE1A 1MJUH 1KI4A 1IVYA 1JHOA 1V7MH 2NTFA 5DVOA 1OW0C 4MEBA 1Q84A 2UVPA 3PJDA 1TAGA 3UUEA 1FX1A 3MJWA 1MHCA 1FL6A 5C09A 1YJDH 2AW5A 2G5TA 4ZCTA 3WLWD 2A7BA 1FNGA 4OY3A 1OTUC 4NWTH 5DHEA 3S96A 3G2MA 4R69A 1RQ2A 5IXYA 1F2TB 1JIBA 2NT0A 3ZQKA 1X13A 1DE0A 3ZW8A 1VBFA 2CGRL 4KZEH 4MR7A 2CKBL 1PJ3A 2O8CB 3S2ZA 4LF4B 5GGYA 3ZXYA 1NKVA 4BLRA 4C6TB 4LJRA 2FO1A 2OSYA 1JLRA 4C4ZA 4PYGA 3ZU6A 5CJJA 3F5WB 2QRLA 5J4KA 4NDMB 3K8LA 1PIGA 4JLVA 3TB6A 2V6IA 2WSBA 1S7TA 4G41A 2ZRPA 3VMOA 4JMLA 3ZZUA 2MCAA 1UZ6E 2WUCH 3G04B 5IULC 1XH3B 3E2HC 2AQNA 3VHXA 4XCYA 4Z3HA 5TT0A 3WIHL 2ADMA 1WX1A 2HBYA 1E1DA 3GDCA 4YHNA 1CGXA 3H2KA 1OJ7A 3LN9A 5JEDA 4MCYB 1VTKA 2Q21A 2JLXA 3ZY6A 4ORZC 3VJ6A 3F46A 5PNTA 4RVNA 2ST1A 4V2BA 2VSYA 4X6DF 3UGKA 3K91A 4J16C 12E8L 1ZJ5A 4YLBA 3EVDA 1XTKA 3V1UA 3PS6A 1E2FA 1KKUA 1SXJC 1NBZA 3F9RA 1WBZA 4HEHA 4MJIB 3TE6A 5HS4A 2WUEA 1ED3B 3ZJ4A 3ZVLA 4MA7L 4JK3A 2W6JD 2SCUB 1VFBA 3FQTA 5HGAA 3I2HA 2J08A 4WSOA 5IMLB 3BGIA 2PYEB 4KKQA 1EUDA 2H1IA 2C96A 3WLJA 2VPQA 2RHEA 3OFSA 4E5YA 3L4KA 4BECA 5E9AA 2DQFB 5JSZB 2CSPA 3V8CA 1J88A 1BDYA 5M7EA 4BZ1H 1NQXA 5K20A 3EOAA 2UVFA 4OX9B 4PHHA 1XCQB 5FFFA 4M1DL 5DM0A 1T91A 3QNXB 1RRFA 3KAJA 1GVIA 3ZHYA 3DL0A 5DGCA 1C3JA 2D0OB 2GTZB 4N68A 3A6HA 3HCRA 4MUGA 2I33A 4L73A 1EDOA 3QFSA 2VAVA 4GH5A 4ZU3A 3MV7D 4FJYA 1GTFA 2WIIB 2X1MA 3V0WH 4FADA 3O4VA 1Z66A 1ORRA 4NZZA 1TDQA 2EX4A 3FYCA 2CUMA 2YHSA 3B6SB 1Z38A 1QSFD 3RAPR 4OLUH 1U3GA 3B3IA 5JZMA 1JF1A 3EXLA 2AC7A 3RAGA 4MMXB 3QE9Y 2J3EA 5D5PA 1NCWL 4Y1AB 4V2UA 2XUQA 1A6UL 2ISCA 1MCCA 4WXRA 3VR5A 1G7QB 1A9TA 3ORFA 1W5EA 5FFLA 1T2XA 3IO5A 1V5WA 2F9LA 4DR4B 5JDCC 2CJSA 4LPTA 3RVVC 4JEMA 3MCYA 3RJ5A 4UUJA 4X7FC 5JHDA 3WV4A 2Z9TA 4JVMA 4WCYL 2BSBA 4IOJA 3EDEA 2X2IA 3R7BA 2CKDA 3GCDA 4ICIA 3GUUA 1WNFA 1TUGA 3JASA 4Q3CA 2YEVB 3FU7B 2WM3A 3FF8A 4JN2B 5LPNA 3M3PA 4X7CC 3JQ7B 4J2XA 2C59A 5FUWA 1KJ3H 5KYVA 3RKSA 4Y19B 2W0SA 2WO3B 1MFUA 1VGKB 4MWBA 3EVEA 1MVYA 1UWGH 1OWMA 2WJZB 5BWMA 3OEEA 5IHPA 1P1KA 3MRLB 4XBEL 3B9VA 2YW9A 2F64A 2HG5B 2Q1SA 4Z7UB 4HG4J 4KLNA 3ZHVA 2YH2A 3HB5X 2QMQA 1GMEA 5AW1A 1FL5A 4ETNA 1TQ8A 3ASOB 3U0TB 5KINB 3ELUA 3ZZSA 2B94A 2YLHA 4A66A 3NB0A 3FKQA 4NM8L 1TETH 3KZ8A 2HJFA 4E5XB 2Z6UA 1L9QA 4RANA 1Y9DA 5JOFB 3E1F1 3SJVE 3KR2A 5B39B 5TGDA 5F9OL 3BUQA 5HDQL 3HO8A 5JAQA 3QE4A 3D8NA 4B8YA 3U4EA 5I1AA 5JO0A 2X0JA 4P84A 4O4YH 5FLUA 3UG6A 1LEGB 4WW1A 2PWBA 1KY6A 3PC8C 5C0AA 1NKSA 1AP2A 1G66A 1KC1A 3W6UA 1KS9A 2G09A 3RH0A 1CQWA 4X92A 8MHTA 4IGBD 1B4JH 7AT1A 1P2GA 4R7TA 3LKNB 2FWPA 2D74A 3ULVD 3ZDRA 4RA3A 1X4XA 4ZD6A 1X7XB 1IJFA 4DV6B 4WOPA 3WK4A 2ZG3A 4BSJA 4ANKA 3HFMH 3PNBA 4BJHB 2GBAA 1ETUA 3ZT6A 3LMJL 1TVHA 2BSCA 1IOVA 2NQTA 2CUTA 3EXEB 3ZTTA 2EOAA 3LRLA 1FXWA 1ONSA 1G7JB 2WT8A 2DQIH 2NPOA 3R75A 1XL6A 1CE8A 4PRLA 4LKXB 3STVA 2XQYA 3KYCB 2X10A 2R6DA 4LS3A 3LRHA 1V9LA 2DPKA 2BY1A 1DG9A 3N0RA 4YSQA 2FX3A 4TTQA 4C83B 4M60A 5H94B 2ZPAA 1ZK5A 3JQAB 2JJSA 3MJ4A 1OE1A 3OHXB 3HVHA 2V2WB 2JJTA 3MUJA 1C9JA 3ZDXF 1RD6A 4TKVB 5CVVA 3KM1A 4QRRE 2NX5D 4O02H 2BNUB 3ZT5A 4BIKA 1WTAA 2G04A 5JT1A 3U2IA 4ALJA 1J2UA 2IYWA 4CTOA 3ILPB 5TIIA 1XF5A 3OI7A 2VQ1A 1WJ3A 1T8TA 3FCSB 1Q92A 5CTAA 6Q21A 4YFYA 3EFHA 4E22A 2NU7A 5JD6A 2FR8A 3UBHA 3TNDA 2QU8A 4KQGA 2OR3A 5CJPA 1A1OB 3UJ9A 5KSYA 2FZWA 1X9HA 2PSSA 1IKFH 2ZZMA 4C4KO 2WR8A 2RGXA 3I50L 2OMYA 3GPEA 5FA6A 1YFKA 2WQ7A 4ARZA 2HWKA 3PDOB 4U8HA 5BJTA 1JI2A 2ZVJA 3IR6A 2PQMA 5JIMA 5LD2C 2MR5A 4UAHA 3QDGA 1AGFA 3GY0A 1JS4A 1PZDA 2OQRA 4G42B 1XXHA 4EHKA 3VSUA 1TCMA 2XFGB 1E99A 3AOEA 1FZMB 4G0PA 4B17A 1GHTA 4MNTA 3OTGA 4XPAH 5HSFA 1X9LA 1M3JA 1ZD2P 4CIBA 2GKSA 1C0IA 1V3UA 1U1IA 3HUTA 1HHKB 2ENYA 4GKNA 3RT1A 4J3OF 3VD4A 5AL0A 5HRAA 1WCIB 1E5VA 3IAAA 4EOGA 3ILYA 4OIMA 5DQDH 3GMDA 3OQIB 1OAXL 2DWEB 4H0CA 4FLOA 1KG0A 3S2IA 3BIAX 3KKEA 4UNUA 1HTBA 4QGHA 1QFPA 4RZSA 2NPFA 3JVEA 2W98A 1BAGA 3GEGA 1R0AH 4QIHA 1CKEA 2X86A 2X0RA 3OKEA 3DC2A 3AG1B 3VXRE 1IY2A 1QFJA 3RWDB 1YUMA 3N04A 3GQVA 5IEKA 5FR1A 4DNQA 1U0QA 3CFKA 1OQOA 3UERA 2I7CA 4KN6A 1J10A 2VOJA 4Q9NA 3IFNL 3EYUH 5KSAC 5JZBA 5TGTA 4RRPG 3VXPA 4JKIA 3VR1A 5C8JB 4N8EA 1O1YA 3SJCA 2ENUA 2ARJA 2FR4B 4G56A 3SZLA 2A1UB 4O2AF 5HHQA 2R7NA 3AVYA 1ZMTA 4LCWA 2UYLB 2E8ZA 1VKHA 2BGMA 3G88A 4G3XA 5ENZA 4FM9A 3KT8A 5DHTA 3LT4A 5MEND 1KMHA 2DQKA 5I6OA 4CVNA 4B3DA 2WDPA 3ZHCA 1SMKA 5CYFA 4NXSA 2PM8A 1ZD4A 4BU0A 2N01B 5LJLA 4F7DA 1EHXA 4WINA 4GAJL 4FCCA 2VZTA 1Z6JT 1ICEA 3P9CA 2RK6A 3EG9B 4OM1L 2CVHA 4TZ6A 2Z6VA 3WLKX 2YD6A 4HVAA 3PP3K 2Y6TE 5CSBA 4WOCA 4GL4A 2OBYA 1ZOSA 3ZGNA 1E4KA 3WEAA 1BS2A 3SHQA 5HKLA 2O0HA 4YHOH 4JGMA 3AKCA 5I5GA 3FMPB 1REQA 4FDMA 4ZEOA 1WT5A 3FRJA 5AD1A 5DJ6B 3A3YB 1M34A 3ZOAA 1T4DA 1IPFA 2SICE 1AG9A 1WZLA 1NVDA 1NIDA 3VR4A 5HVGB 4ENSA 2BSQA 1YR9A 1QYXA 5F7AA 1IV8A 1UR5A 3OT1B 2BUAA 3FFAA 1X1AA 2Q4RA 4JFED 4DCGA 2XF8A 2NZYA 2QBWA 3TZVC 2GIXA 4PYJA 3F04A 3FQUB 4GFTB 3IDOA 3SKOB 1Z0KA 1G1AA 1PLLA 1TLMA 3HRPA 3A4YA 1T5SA 4CV3A 3OKKB 3G9UA 1K92A 4YMLA 4M76B 4FCWA 1PZCA 2HWYA 2O54A 5K93A 3GBMH 5LYJB 3EEQA 3T0DA 2Q4DA 4RMSA 3THOA 3KSMA 2RHLA 3U81A 1GQQA 1JT2A 5JPNC 4TN1A 5I3ZA 2A9QA 2C31A 1PS9A 2WXQA 3KQWA 1T3LA 5AI0A 4YXKH 1A71A 1BYIA 2X2FA 1J7VR 4JP3A 3POCA 3NHYA 1ZSVA 3QQDB 3O94A 1FRGL 2JIPA 4FNRA 2NAPA 3IP5A 1C4WA 4JMXA 4AL4A 2NY3B 1W4RA 1QI5A 5GZND 5E6ID 2QL9A 4KH9A 2DHRA 4GYKA 4PFEA 4BKUA 2RJ3A 1ZXLA 1T9GR 4JENA 2P49B 3MGTA 1QHSA 3QIBD 2X6BA 3Q5EA 4D4IA 1JK8B 5JW6A 4DKEL 2DF3A 1QEWA 4LLMB 5LOVA 3W6PA 4IRMA 4JB3A 3GC6A 2YGOA 4BTLA 1MG3C 3B7YA 4UQIM 4F12A 3N1UA 2Y72A 3D12B 5A9SA 1YA8A 3D6NB 5AOVA 5CGBA 2EDAA 3CUTA 5KYWA 4HNAA 3WG7B 2Y67A 4N20A 4IKLA 1ZS8A 3I6GA 1N77A 4NECA 5SY4A 2BSTA 3MCKB 1OAAA 3B48A 3RRYA 2E4AA 5TQ2A 1U5BB 4BQ6A 3AOGA 3MT7A 5DJXB 5EZYB 4LOUD 2LU4A 2AD1A 5A7HA 3WENA 5U4QA 1CD0A 1YVUA 1IMOA 3RQ3A 3RARA 5KDDA 1ZOPA 2JHPA 3BPLB 4KNUA 1TT5A 3MNVA 4JP2A 1SYVA 4GRWH 3RUFA 3NUZA 2GIMA 3K1DA 5DUPH 2YA1A 3NIFB 1CK4A 3NJGA 5JNWA 5A9RA 3G7NA 2VDLL 1KJVA 1E3XA 4DWJA 4DJMA 4B4OA 4RA9A 3W5DA 2Z9DA 2AAAA 1KJMA 3IPFA 5HHOA 4ZX3A 5L8JB 3HR5B 2O2HA 1CTMA 4C58B 3IV7A 4PHGA 5HK9A 1FC0A 3P2MA 4EO9A 2R4SH 4AJ2A 2RHMA 3TIDA 3QV1A 3HYTA 1HZHH 4WY7L 4JR1A 2I0FA 2ADFL 1RKUA 3D2AA 4L08A 1U3NA 2NUTB 2ZJ3A 3NVDA 3KLHD 5D7IB 2VSQA 4LL4A 2ZWLT 1QYWA 4NQCB 4O02A 1MJ7L 4JZOB 2D73A 3H42L 3SDAD 3U4CA 4ZAKB 1D6EA 1F13A 4N47A 5J2UB 3EN0A 3REOA 3ADDA 4P3DB 3U0BA 5AW5A 1MF2L 5FBKA 2JKNA 5ETUA 1OH5A 3IKKA 2O5ZH 5ILOA 4EFLA 1MJGA 3Q2NA 2QTVA 5DP1A 4TQUS 4YCSA 3T0XA 1Z47A 3QNWA 2IVFC 4U1IB 3AR7A 2ATKA 3AW5A 3WY3A 4F92B 1XMEB 4QICA 5ICYB 1ZY2A 1JTOA 5EWJA 4IILA 2DQFA 4EQZA 3TN0B 1IE3A 2BFVL 1D2OA 2NIPA 2HA2A 4HAUA 3KTDA 2F19H 4C4TA 2PT7A 4C83A 4K26A 1JZ5A 1GTSA 3WA7A 3MREA 3RG1C 2VXVH 3H2WA 4G1MB 1QSVA 3PWKA 5DK3A 2XVZA 3OAAD 5I1HL 2VJBA 2MPAL 2V7BA 5EH1A 4G4SP 1R0ZA 4M7OA 2RFXA 3DWGA 1JL3A 4KVZA 1AHHA 3MG9A 3HS9A 1CJCA 2CUKA 3UIZA 2NR6A 1NFFA 1ZJBA 2C9ZA 1BX1A 3TMYA 3QK0A 4I2VA 1BG9A 3QBEA 4JJ7A 7REQB 4LGYA 4WFFE 1C7EA 5E8NB 4F80A 1L5VA 3IDUA 5IROD 4G8CA 4AJYV 2MR6A 3AF5A 3OCWA 4D9GA 3QIBB 3JY6A 4RQUA 4XNMB 5CYPA 1R8QA 5J12C 4L8LA 4J49A 3EGSB 3QYFA 2YFQA 1TAUA 4FXTA 1HEIA 4QNPE 3EZXA 1Y42X 2VR4A 2CHDA 5E6SA 3VFMB 3HDGA 2H1VA 4R8SA 3P0HA 3UXMA 1GQYA 4XWGA 3EIEA 4WSGA 4F04A 3W37A 4NKMA 4NMMA 5T3ZD 5KVGH 1W19A 2LIVA 1G6VK 3GHBH 2AJVH 2QPUA 4I36A 3NN8B 3QYCA 3I2KA 2QSJA 4D82A 3CU7A 5FEUA 4HUXA 2VLJE 2IX3A 1U3TA 1TA0A 5AUQA 5TPWB 4TQGA 2D5LA 1HL4A 1S7SA 3E6FA 4PNEA 1S8OA 3WKEA 1AKPA 1PJCA 1PWEA 4BB0A 2R8OA 2HO5A 1IBLB 1GIGL 3RX5A 2OK7A 2XUGA 3L3JB 5C71A 4BRZA 4OIIH 3U30C 4F2MB 2XITA 2WKRA 1LO3L 3V4LA 4LSRH 5FULA 1IQWH 4GKZB 1IM5A 2ZS9A 1I85C 4IGBC 2NNLD 5DC0A 4TS6A 2X09A 3ZU8A 3L3HA 4R7LA 3EDRA 1N5JA 1NNI1 3UFXA 2ERCA 4NMWA 1JIJA 3LZCA 1Z5LA 1D4FA 1NMQA 1JPSL 5C1DA 3PLAE 3U83A 1ECLA 3I9V1 4FXKB 2W9XA 3OKPA 4WGWB 2VNIA 4HWPA 1CEQA 2VJCA 5KS9A 1VDMA 3BTSA 1SIWA 3QP9A 2DDQH 3P77B 1WD5A 3MMPA 3QCTH 4YSCA 1EXWA 3SD7A 3LDAA 3VU3A 2XKBA 2I7TA 4E30A 1DAEA 3ZNOA 4D57A 4UOW1 5KVGL 5D4HA 5FLXA 3WMEA 1VCNA 4OQEA 5L2KB 4R90H 3AK4A 2C5LA 2HIAA 3LKBA 5F4BA 5FWXA 1CF4A 4LIPD 5AALA 3WB0A 4UVHA 2J3IA 1PU0A 1Z5NA 3LL7A 4I66A 3PHLA 4HJTA 3N58A 2CK3A 4S1DC 4NE7A 4AJVA 1H5UA 3VRJB 1E98A 2R5WA 4OSUH 2CWDA 4HFNA 1O6VA 5JWRA 4KXFB 1A50B 2AHIA 3PGMA 3LFHA 1HFUA 1O8CA 3WJAA 3DIVA 2QQQA 3UK2A 2FK9A 1VDZA 4XBGB 3INYA 4DESA 4Y4FD 4U7WA 1BQHB 5CH3A 3PB3A 1KT2A 1SXQA 4LCBA 1ZSDB 4PAGA 5JANA 3TASA 2H7YA 3BSSA 3D6VA 2HVJB 4WU5A 4UHEA 1KB5A 3SB3A 4KY2A 1IILE 4XP1L 1ZU5A 1CG9B 2O6DA 4AK1A 5E24E 4FBMA 4OZGB 3UENA 2UU9B 2HJRA 2XF2A 3QCTL 4HT1L 3WXWL 3HCBA 3KQPA 4JJFA 4HYEA 4RHUA 3I45A 4PG2A 1TCUA 4W8HA 4JKLA 2X4TB 1EJ0A 4ER5A 3SYRA 4MD5B 3Q05A 3PUVA 1EUYA 5BXYA 1NKGA 2XUFA 2BZCA 1U93B 3STTA 1P69B 1B3JA 4ODHH 1TTAA 1CUXA 3MCLH 3B6MA 4HDMA 4Y2DB 2WTPA 2X4SA 5AW7A 3CFKB 4WXEA 4TMKA 3ZU4A 3IUPA 3AS0A 5DVMA 4QRUB 4PAOA 3FROA 1CCZA 3FN9A 4F2FA 4YDMA 1P53A 4R9SA 4LJAA 2LUOA 2UUCB 3PDUA 4Q7MB 4CBVA 1TTBA 2CV0A 1C5KA 2C4XA 1G4RA 4RTOA 5SWZB 2C83A 3RZCB 1E0DA 2HLPA 1R74A 3H75A 1L1EA 3CB2A 1MQ9A 4B9YA 3UCQA 3RQSA 1D9ZA 3GDBA 4E9WA 3OO1A 4QHPA 1XCPA 1E1CA 3KPSB 3COSA 4KAFA 1X14A 1ZK1A 2BCKA 2VTBA 3RBSA 3DYIA 1JERA 2IWHA 1XSIA 4NESA 2I80A 4IDGA 4E0BA 3ZDZF 4FEIA 2EP7A 3JVGC 1PL3A 4G42A 1XXHB 2WVSA 4AK9A 4MIOA 1N6PA 4GSUA 4MR8A 2YYZA 3RTQD 1KK1A 1WAAA 1R5OA 4RAVB 1YNLL 3CVHH 3OPVA 2H32B 1VYVA 2HX7A 3T71A 3O45A 4PP2B 2AEIT 4H6PA 3B2XA 4WBNA 4OOEA 2BP3A 1GZUA 4XFKA 4TNFA 1IAII 2WLYA 2HTEA 3EUEA 5EVCA 5M2QA 4HXBH 5EPMA 4QD3A 5JMTA 3K0HA 3UF0A 4L29A 2JIZD 4HYQA 4MHTA 2VJPA 2XNHA 2ICAA 4UU9B 4XB6B 1ORQB 3L54A 3PWPB 1QQDB 2YPLB 4M7ZC 4QUGA 3VSAA 4RHXA 1V3MA 3QIVA 2X2YA 4FN0A 1BKSB 1JGUL 4JO4L 4PGBA 1HYGA 2XXGA 3MBXH 4HHAB 1SY7A 4RDIA 1Z62A 4DR2B 1ZYUA 1ST2A 2D6FA 1B0PA 1HHIB 3WN5C 3VCLA 4PRHE 4QKXB 521PA 5L3QB 2WFZA 4HW6A 1DAGA 3HG1D 2NNRA 1E8XA 4LFCB 2KWIA 3WS6A 1QRSA 5FAXA 5HJ3B 2XPZA 1NBYB 1SY6L 4QJ3A 5CDTA 2ZR9A 3EFOB 3IURA 1WLSA 3HI6H 2ZJZA 1Y8QB 3KJEA 3IJRA 3QEQA 4I4TA 3CJRA 5HJ2A 2GC7C 3O4OB 2Y6UA 5JAMA 1WM1A 1E9OB 1ND5A 1TQDA 4PR0A 1VCAA 2PKQO 2HIHA 3G5VA 3OE1A 1U94A 1D5CA 1U2SA 5FUZH 4B6EA 3B4NA 1OX4A 1B1AA 5KQLA 5T3XD 1Q6YA 1IZKA 3VPCA 1UDWA 4MB2A 4W1PA 4HSEA 3RIEA 4BXOB 1D9KA 2BGIA 3NORA 3LZPA 5ADPL 2IJGX 2OUKA 1R46A 4QXVA 2N3ZA 5ITFB 3HS3A 3A67H 1EX0A 2PGJA 2A0KA 4DM3A 2N7AA 3T3PB 2AXGA 3ZMRA 2F1AA 4P58A 2DV6A 2FO8A 1TTPB 2YQ3A 1J0DA 4HCIA 2VDML 1E3WB 4OQYA 4ED9A 2QMEA 5DJZB 1TJPB 3KPLA 1D2HA 3TBTA 3CUVA 2XC8A 3DKVA 1UQTA 5HDQH 2CFSA 5I23A 3IAFA 3WD5H 2GKOA 1ZCBA 3II3A 4Z7WA 2PGNA 4YY3B 2HF8A 5IVPA 4FFTA 3HS8A 1LQ2A 3TO4C 1IHYA 3O0TA 1I24A 3LVQE 2HW8A 3CZKA 2GI0A 1S9WA 2FR8C 4MCHA 4L6AA 4WD3A 2TMYA 2AYXA 5EEVA 4YROA 1JE0A 1G0YR 1QUPA 1I6WA 4K2AA 5DURB 3B82A 1AGBA 3H84A 4YNYA 3R24A 2HVKB 4B2PA 1G8FA 1XZPA 2BIFA 3PIQB 3CUWA 5TRTA 1ECZA 2GHWB 4MYSA 2H17A 3WOVA 4ZYXA 4G4IA 1S78C 3BGFB 4JM2C 3I42A 4FLQA 1JR3E 2JJ1A 3EKCA 3CURA 3FSGA 3HH8A 3ROXA 3D85D 1QOZA 4IIGA 3TH5A 2XQYK 3I9AA 2QMOA 4KKLD 3CFQA 4HLZH 2CBXA 4CEJB 1N25A 4UHCA 2WLJA 4WHCA 1JAEA 1T03H 2O4CA 1IIKA 2MSDB 3HKCA 3SQDA 2EFCB 4MWGA 2XODA 3UTTD 1CX9B 1KXVA 1GPUA 1U8FO 2CNDA 3RWHA 5KO2A 4DLPA 3NALA 3DI2B 2A7QA 4QPCA 3M6WA 5EVJA 2G3YA 4RMVA 3QAZC 2YVKA 1QF6A 2HXAA 4F6LA 3H3XA 4YAKA 1EE9A 3LFUA 1VP9A 5FLEX 2HV9A 3VXRA 4O02L 4ER3A 4F9PC 5JECA 3GEPA 2WY2D 3GPSA 1V55B 4KJPC 2P9TA 1SEPA 4PZEA 1C5DB 2DB8A 4FP8H 5CU7A 1A9YA 1A7PH 1HLGA 3QDGD 3FSWA 5F0PB 4HATA 5D87A 5LDDC 4HOXA 1INDL 2V2XA 4PINA 4RCAA 1B2WH 3GSNL 4JBWA 3WIVA 1IGMH 1JYVA 3V0IA 1I2CA 1T7WA 1V8FA 4B2YA 1PGQA 4KJWD 1M05B 4O2BA 3G17A 1YJ8A 1ET7A 2ZXBA 2D62A 2XVYA 4N3AA 1X7XA 3RV3A 4Y6GB 1ZK4A 1HH4A 3DDNA 2PUBA 2VLKA 4ZQKB 1V0JA 5EMNA 3U9SA 1XTPA 5HZKA 3ZWCA 1LE5B 4BJ1A 1WHTB 3LQRA 3D7RA 5KS9B 4GBGA 1RSZA 4CDRA 3LZLA 1W8EA 3ZDXE 4H6XA 4TSRA 2OW7A 6NULA 3W5VA 1AO7D 3DHYA 3CDYA 3S88L 1VL8A 4KDCA 4ENPA 1E3FA 4AQAA 4HIJB 2NXCA 2XTNA 3QLJA 2YN5A 2L7JA 2Q2QA 5IOPB 2RG7A 3PWNB 1Q3KA 4JYPA 4YP1A 2CFIA 3TQTA 1K3FA 4BP3A 3P2DA 4HWRA 2C1OA 3TQIA 2XIBA 4BQ8A 2CO2A 2JHGA 3L49A 4Q4HA 1DFGA 1WUIS 4AYDC 4WUKH 4HNUA 5CEXB 1SOWA 5DQDL 5J3HC 1II8B 4K94H 3E3NA 2XYVA 4OVUA 2WBXA 2VDPL 3RG2A 1K0UA 4NQCA 1WWCA 4O02B 3KJZA 2X1WL 2H4HA 2OMTB 1FA4A 2ZUCA 5FUCE 1BX2B 1E9EA 3Q87B 4S1DD 4BBWA 1DVRA 1KY7A 2BISA 2XV6B 2UZIH 2NY1B 4D0RA 1KK2A 3JAKB 3C97A 2YKGA 3S3CB 1N8NA 4A8JC 4P34A 4ESKA 2QLJA 3KVYA 4MMYB 2Z8YA 2JH8A 1JV2A 3RIGA 1VFUA 1HQCA 1GXEA 3MXVL 3TA3A 4FNLL 3P5BA 3ERXA 4B3IA 4PJHB 2G4CA 1PNTA 5F4ZA 3WNCA 3EMKA 4Z3FA 5HGBA 5AW3B 5D1XA 2QV2A 1J12A 1JCVA 3PNKA 4GM4A 3SC2A 3AHJA 2C5FA 1T8YA 4W5RA 5DC4B 1F4AA 2I60L 4X3CA 3GJRA 3DLHA 3K9QO 4IGEA 1E4KC 1H3TA 1H23A 2IXQB 3V0WL 4K6CA 4UHFA 4OM1H 4NKDA 4JLUA 1S3GA 2YMMA 3LNEA 4MSWA 3JD1A 3ZI7A 2OR9L 4OVKA 5IMMA 4GBJA 2PNFA 1UBGA 3V5NA 2W11A 2FK7A 4UTZA 3NQ41 2AK4A 2CKBB 2NU8A 3G08B 1E67A 1RHMA 1A9SA 4EJSC 3GXBA 1EH5A 5DMHA 3W9BA 4BO4A 4F60A 2NXWA 1ZH4A 4UD2A 3DGGB 1Q2XA 1WSAA 4HFUH 1L0BA 4L0YA 2XG5A 1BEYH 2Z8VC 4N0PA 4HMOA 4JSRA 4B3VA 5TX7A 1HQRA 4UT7H 2KBFA 2BNQB 2XUIA 2A6JB 1E28B 4M6AA 2BP7B 4NN5B 2OO5C 4BE5A 2ZKIA 3H1AA 1XGUA 2LAGB 1V43A 3MRXA 3B9KB 3AG6A 2IDSA 2SODB 4WV1C 4HN2A 1C1XA 1TC2A 5DMKA 3QBVA 3E6FB 1HEYA 2JLYA 2VHUA 5A3RA 2Q2OA 1P4LA 2JE8A 3QUSA 4EARA 4J0QA 1KAGA 1PFVA 1EUDB 1WEHA 4XCQA 4INOA 4YXFA 4MTMA 1WXGA 2YAEA 4F37K 3US0A 3PDIB 4YXKL 4UAVA 3GJZA 4WE3A 1A7BA 1LD9B 5LA6B 3GF4A 4D92A 2X2EA 2VH2A 3NWOA 3Q8FA 3C09C 2XCSB 3AY4C 1CXHA 3D6AA 1X2BA 4UQAA 1XQ6A 1ZLYA 1DCLA 3MCWA 5EEWA 1JGEB 3D3EA 1PNDA 3TECE 1NDQA 1J0KA 2DQHL 1PK7A 1G63A 4B0MB 1IEQA 1GSMA 3PE4A 4UQ3B 5BV7L 4MKGA 1E96A 4BLTA 2J32A 4J2TA 4TTDC 4HKXA 3QZNA 1CZNA 2DH2A 1BEYL 5F5XA 4MKMA 3ABGA 1DVYA 3PWVB 1AR2A 2EXWC 2Y6SD 4DE5A 3V7UA 3B43A 3CX4A 1T0BA 4HAGA 4IL5A 3IXTB 2WOBA 2PEYA 1RZKH 1P7QB 1TIBA 3A24A 2V65A 2GAOA 4HGWA 1OVMA 5ES3A 2IH1B 2ATKB 1OFGA 1A6AA 2RMNA 3P5SA 3QBJA 2I27N 5E4FA 1RPUA 1G8MA 3NXKA 1HRDA 3JAWB 3WS3A 1F17A 1SKBA 4Z7IA 43C9A 1JPEA 4NBSA 3X1KA 3LZDA 2QX6A 2GHQA 1OLXB 3PRJA 3V0FA 1BPVA 4JRXD 4EG8A 4WHMA 3P0GB 2VA8A 2D2OA 5BN3A 3CE6A 1E0OB 1MEXL 3SBEA 5D1XE 1MW2A 3G6AA 4DYHA 4ZYTA 4Y5VA 2R8XA 1NANI 3CBGA 3MCZA 1R0YA 2ZB3A 5EUBA 1SJ9A 3LA8A 3VM7A 2UVPB 3EPJA 2E9JA 4G7YH 3D39B 1O58A 2OORC 3SO3B 1MUJA 4MROA 2FATH 3P94A 3NSJA 3UO8B 4NNPH 4MQEA 4QXMA 5DN6A 4A2EA 3O4OC 5ENVA 4PFJA 4BGEA 1IEXA 2XCMC 1Z0UA 3B6ZA 1SUBA 4Q1CA 4QRPB 1A4XA 4YB8A 5DZJA 2F53B 3IDSA 4TRMA 2FYTA 1RERA 4HAZA 3O95A 3WV0A 4LAQH 3LSOA 3E7WA 3NP4A 3UATA 4FFDA 2FJSA 3ET9F 4UNQA 2FZGA 2BTEA 4WKNA 3A4MA 4M6OL 4AG4L 5JDCA 2I8CA 4OM8A 3Q5OA 2JH2A 2F8OA 2F3PA 4TLEA 1U8JB 3GSXB 1GZ6A 3C85A 1GW6A 4ZOLA 1ODTC 4QVIA 5LDUA 3LRMA 2HK9A 6LDHA 3V2UA 1CF2O 3GRUA 3VI4F 4FC7A 2G70A 3CRW1 3NKFA 1J21A 4P80A 3NFYA 1XGYL 4FQHB 2GT9B 3ROTA 3F7YB 1RZIA 1XQ9A 3H2QA 4GG1A 3KE0A 4KX8A 3HCOA 1L4UA 4V38A 3DKIA 3MJCA 4MVJP 5GGVL 2IWGA 2Z98A 1KCUL 1QIIA 3OECA 1PY0A 5FF9A 5C0GA 1EAPB 3Q9SA 2VF4X 3L4WA 2FR0A 1IBYA 3AEZA 4W4TA 4AQ1B 5DN9A 1HH6B 2R1TA 2QX9A 5IROC 1JYXA 4D79A 4L5CA 3FB8B 1GCGA 1WCWA 1ILWA 4N5UA 3NCMA 4Y2LA 2CAKA 1U4EA 4KZDH 1OAKH 4Q9AA 4R2GB 3NCYS 4N0CC 4B75A 4HSAC 3S2AA 3KPOA 4MITA 4LX8A 5JZ9A 5HYFA 4M8LA 5BOSA 3F84A 3C15C 2HJKA 2PP8A 4WV1A 5IM5A 3DNPA 3OZXA 2WWKT 4M4PA 5IXSA 1Z4MA 2MIIA 3BOSA 2X7LB 5EO1A 5TDOB 2N75A 3D2UA 2A5DA 5CA0B 2CLZA 1JDTA 2QU7A 4DSUA 5T1LA 2X19A 3GGCA 4UCWA 5HI5D 5CD3A 3PGJA 2GFBA 3ESMA 2LGJA 2R6R1 3ER6A 2AP2A 4N2KA 4CG2A 2ZF8A 3W5UA 4PNPA 4D8YA 3T65A 1A6TA 3ARUA 1CUSA 3NGXA 3U7FB 4M5YH 2G7ZA 3U4GA 2F3RA 3GGJA 2XZLA 4J3WA 1YY8A 2I22A 1EFTA 2ODQA 3KYKL 1DFXA 4HAKA 2FBJH 5KNBH 3SOBL 3OIDA 4A2DA 2BEWA 3LDUA 2Q2LA 4K9EL 3C24A 2ORBH 1CE6B 4CM5A 5K0CA 3S97C 5JORA 3RTAA 2P3YA 2DS4A 5DPMA 2MNUA 1MVOA 3GRRA 1VKJA 1BH2A 1G2PA 3LIZA 1XKLA 1WWAX 5JJ5A 1OAKL 1GZDA 2PVSA 5ECWA 2NN3C 1TZIB 4L0ZA 1IBSA 3H9ZA 2HG5A 1GTZA 1OAUL 2GIYA 3L1FA 1KEPA 1NV8A 1HZKA 3SM3A 4E9TA 5ILQA 1O0CA 1JG1A 1KYFA 1IU9A 2IGBA 3CZAA 2YBGA 3FQXB 3GJ0A 1PSKL 3I6LD 4HAFA 1E9OA 1JS1X 1E89A 1PF3A 4MV8A 2X6MA 1ZJ6A 3H9HA 3H17A 2H26A 1WUKS 2AF3C 2PL9A 1O95A 4LSRL 4J4TA 1AT1A 3EBGA 4AX3A 1YEGH 4GMHA 1P5UC 1K8IB 2BNRA 3MRSA 4J3FA 3M81A 4NP9A 4B7XA 4LSQL 4ZJPA 4YJ2A 4QNPF 3BIKB 1NMZA 4XCEB 2F1RA 1Q83A 1JGVL 4C4PA 5DJ2B 1HLDA 2QROA 3DV4A 3UM9A 3QVVA 2OO5A 1QBKC 1A4BA 3TBVB 2W0MA 2X4PB 4XNZB 4LCIL 4UAJA 1XRLA 1AS0A 2ZWIA 3TR0A 5IB1A 3AACA 1IONA 3FU6A 2APJA 4U3CA 2WWOA 3HE7C 2YHBA 1N0VC 3UCEA 2IKSA 3C6XA 1FL5B 1TUBB 3VFOB 1IGFL 1RPNA 3SY8A 4OLVH 5KUKA 4KTDL 1T4CB 1T1YA 5K9OB 2XXJA 3DO8A 2MPVA 4Z9XA 4HLNA 2X77A 2XYGA 1N1EA 3MLAA 5KVMC 4G86A 2QSQA 3IKCB 4FXKC 4B6FA 3LK7A 3V0VA 6FABL 2ZVDA 1C4XA 2MJLA 2HUPA 3GXFA 1OWPA 4LPUA 4X5WA 1YCFA 3TEMA 3U1BA 5J2TA 3OPZH 5DT1H 3CC5A 4P3NA 3BDBA 2DKUA 1Y3DE 4MAYA 3V7AE 1UM8A 2P47B 5G4KA 2CDRA 5FYDA 2F15A 2Q1UA 5IK3A 4B6GA 5E6SB 5JY6A 1MI5D 1YMQA 1VHWA 3RKDD 1Z29A 3HXPA 2G72A 1QACA 4S2UA 3VPDA 3TX2A 1FLVA 4NATA 4UASA 4XMPH 1UM5H 3JARB 2ADGA 5C51B 3FRPB 3NBYC 4DP8X 3OVUB 2PT5A 3T4XA 3ZG6A 1OT2A 4JFOB 4XBGA 4K9PA 1OLUB 1S9YA 2VG8A 5HOQA 1TKWA 4LHZA 4XBMA 1JN6B 5HI4C 2DM4A 4GRWE 2ZNWA 3IVXA 2CK2A 3PC2A 5EIIB 1NIEA 1MHPL 4BNWA 3PUHA 4IW3B 1E4XH 1JKIA 4MW2A 3MRDA 3DBRA 3ROLA 1SHJA 1K9VF 2YOHA 3SICE 4OCRL 2K6YA 3CXFA 3GUYA 1JHYA 4MAYC 4RMHA 4CR6A 2Z2KA 5I75C 1K68A 4ZKDA 4MRSA 1XCXA 1L9PA 4OTZA 4EY5A 5T7BA 3P19A 5JAIA 3AVWA 4CW1B 3ATEA 5FYKD 2DI7A 5CXPA 5JD3A 5FCDA 3VG9C 1GS6X 1HINH 3M86A 3FYUB 4GQBA 2D7DA 4JL1A 2BFNA 2R1XA 1F0PA 2L7EA 5DGDA 5JLZB 2WNWA 2RCNA 4HTAA 1U21A 2K7PA 1U95B 1TJGL 4GW1A 3Q2OA 4G8GD 2WKSA 4LY3A 4HX2A 4WI3A 5MI0C 4PJ8D 2NX5B 2CRIA 3TIEB 3WYRA 2ZONA 1JIIA 3ORQA 4HX1A 3EA5A 4BKLB 4F7EB 4CN9A 4PWEA 2CZCA 3UJIH 1R24B 3VXOB 1QIEA 2J9GA 1W15A 1ID8A 2WGNB 4F46A 4HWSA 4O4HF 2DWUA 1RHKA 4YAGA 1W72L 5I6KA 3TN0C 4PGDB 4P9HL 1JH8A 2ZNXA 2YYSA 1JP7A 2IIJA 4MUHA 2WKPA 3P3RA 3GDGA 3BCSA 1QUNB 1GYVA 4KQ6A 4N2LA 4TVPH 2BOCA 3JQ6A 4HXBL 5EOTA 3B6KA 2CNKA 2ATPA 3SE8L 1YY9C 2FSPA 1OF2B 1ANKA 3GARA 1LMIA 2J9RA 4HG4K 4F96A 1MWOA 3VX1A 4GNKB 1FTSA 3ZQJA 4KKCD 3F7PC 3O4GA 3WWOA 3NJIA 1FSKC 3C5VA 3QNFA 2XRMA 4ZAKC 5JHLA 2R7EA 1I1AA 3OAAA 4EW2A 3O7MA 3KPLB 1K6JA 2Y2YA 1YMMA 3W0WB 3LOQA 4QI3A 1LC3A 4WKZB 4DUPA 4PJHA 4RELA 2MDTA 3BTVA 2Q8NA 2DHQA 1EBAA 4KRNA 1CDGA 1T0UA 1O6ZA 3C7KA 3OHMA 5EE5B 5E8NA 3MMZA 1RWWA 5DLLA 2GEQA 5HVWA 1AKNA 5E94A 4A1RA 2J1YA 1TJGH 1BZ8A 2V9RA 2EJWA 2CXQA 3HVJA 1P2TA 1XGPA 1KN4H 2DFKB 4KJYB 4G70B 1LDGA 4MARA 2D1QA 1DTSA 5E5MB 3TEWA 3TBCA 1L7TH 1M34B 3A3YA 3DPIA 5M3BA 3NATA 1EHYA 1U9CA 3BP5B 3LYHA 4KOAA 1FDVA 2DWQA 2HT6A 2WA2A 3DMFA 4XP6H 4ISBA 4RHFA 3GIDA 3L3DA 1O2DA 1TZHB 4K7PX 1L4MA 1S8DA 4YTEA 3AXHA 5KDLA 2GWHA 3GS0A 5BRPA 2W6QA 5EUQB 3E9YA 1EQ2A 2GW5A 3RIAK 5ECGC 1E7WA 3RASA 4N8UA 2A88A 4JM2D 3H85A 3BHJA 1J0BA 1PQ4A 4JM4H 3L06A 1QF7A 2OT3B 4FE3A 1O96A 1LJUA 1DQLL 4G8AC 3L5WB 5HD8C 3PEEA 1SFHA 2JDID 1U9IA 4EGQA 4BFXA 3NG5A 1S89A 3SE3C 3GO4A 3DYBA 4E5XG 4NZ9A 2H6UA 2XGMA 1PFWA 1RYBA 2QW1A 1NUQA 1T5XB 2CCGA 3BGSA 4BVKA 2R29H 3IAS6 3DLCA 4G6AD 2WKOA 2IYVA 4FOMA 1UODA 4G67A 2E4XA 3PA6A 4NBVA 4K86A 4MQ5A 2Y1OA 4LDJA 4CCYA 3EYVA 3SIKA 1G41A 5AICA 3RZCD 1ZM3A 3GBNH 3UBGA 1U4OA 5FV7A 1LY1A 4XJSA 4ZUVB 4CIAA 5JS8A 3FRUB 1Y3CE 1OZTG 3GCWA 1IJKA 1QQTA 1AFVH 4LZLA 1JV2B 2WAXA 2CNZA 3ST7A 1SYSA 2UZ1B 5I17B 4I9WD 5LNK1 4OOFA 4BO8A 2MSLA 4DOMA 1K8DB 2HLHA 4PYIA 4CKWB 1RI2A 4N0RA 3GSQA 1JGEA 3VTKA 3G1UA 4S04A 4TLSA 1GZHA 3PFIA 5K9OA 1A14L 2QVLA 3DVIA 4NIMA 2OLEA 1JQLB 3SPXA 1ZOIA 4NQUA 4LXGA 5HP5A 3R9XA 4GT7A 5TTRA 5JH7A 1AUXA 4M99A 4XWTA 4O3FA 1VIVA 1CLZH 3CISA 1JU4A 3PYXA 4IRUB 4P8RA 1J0CA 3LQZB 3K8QA 4FE9A 4QHMA 2CR6A 3GI9H 4LVNC 2V9QA 1JMKC 5CAEB 3K20A 3QXTA 2AJDA 7ADHA 1U8OA 4A82A 2IH1A 1EP2B 1Q12A 4JUSA 4G8FA 3S8WA 4OF3A 3AVVA 4DKFL 2FOXA 4ZYKB 5ERXA 2X53A 3LY7A 2CXGA 3OV6A 3JPYA 4N82A 4ACAA 2Q8AH 1DJPA 3P52A 2AXGB 1A7QL 4XYEA 1IBKB 4IOIA 4K46A 4R9UC 3X3FH 3G5YA 4KLAA 5AKSA 2YHAA 2C42A 3UK7A 4OU4A 2I03A 4XEUA 1P6XA 3BRGC 3IALA 5I16A 4GI6A 2XZCL 4GP4B 4MYPA 1JEAA 3I8XA 3LLSA 5C0CD 2E85A 4XWGH 3ZIUA 5TQ0L 4A39A 4E2WA 4Q0XH 4NXKA 1IN4A 1JD9A 4U1LA 1IAOB 3SG0A 1ZM7A 1OSEA 4WVLA 1WMEA 3T52A 4F3FB 4J2HA 1X1QA 3MCLL 2JTDA 4LNAA 1EGHA 1V3TA 2GYWA 3EK2A 4XN9A 1B4RA 1HEZB 3PGDB 2AVDA 5KSAB 3NBFA 2IOFK 2F7IA 3RWHB 5FA5A 3MGOB 4P5MA 3K94A 5HYVA 1CXLA 5FYLH 3O41A 3PQ3A 2NAFA 1WHPA 3GTNA 2N1BA 1XXDC 4ZVMA 1N0UA 1WB5A 2VN7A 2GILA 2P69A 5DNEA 1VPOH 3TIXB 5ANHA 5J1TC 1TADA 3I1IA 2OZLB 3UEZA 4PLYA 3RSGA 1KERA 2NT4A 1JHKH 4ZZ0A 3NU1A 4HU8A 4A6DA 5LGYA 5L6MB 5JMPA 4OY9A 1DQZA 2Q5FA 1R34A 5DD5H 4GXRA 4FNLH 2C9OA 1VE1A 4MDJB 5DD0H 4H1HA 1OW3B 4CKQA 2D0FA 4PJHF 4QDJA 4AKIA 3AKDA 1NKTA 2G60L 1F4WH 4AK2A 1UBOS 1XVIA 5T1LB 2AJBA 5CFLA 2CHFA 4FQJL 2OCKA 5B1SA 1T0HB 3MV01 2X6QA 3TD9A 2C7QA 3HCWA 4BXVA 5I6DA 1I7SB 3FPKA 4NGHH 5D1HA 3QMVA 4DPRA 4XWAA 2MQCA 3EYOB 2X0KA 1MN4A 1GPBA 4X6EB 3EXJA 4WIQA 1LO4L 1PX4A 2R6AA 1MELA 4RCVA 1X7QB 4GZ8A 3V0DA 2CF6A 5CIPH 1SKUA 1W2WB 5CT5A 3NDBB 1US8A 1J8HB 1T5LA 4HNSA 3KOWA 1NBIA 1N6KA 3W1VA 1U28C 3FLBA 1G7PB 4QRUA 2CLLB 4Q7EA 5I1IH 3PL5A 2F48A 2YR3A 1SHKA 1NY5A 3SHVA 5DQJA 4HUWA 1PUXA 3LJ3A 4WY8A 3S48A 3PHCA 3U3XA 1OGSA 3UABA 1AGYA 2HHHB 5I7VA 2UZ4A 3BZFB 2VAWA 3DZ8A 5I74B 4MMXC 5IBLD 1WGOA 2Q4BA 1OWLA 2D2IA 3AI3A 1BEUB 5EF3A 3QFFA 4RV9A 4BQCA 3S3DB 2QVFB 4Y9SA 5J57B 4PQXA 1QKJA 2HRZA 2P3LA 4IICA 5F7OA 1PR1A 2R65A 3TZQA 1YQEA 2J6CA 2R62A 4NBNA 2BD0A 1HKFA 3UK0A 5L9DH 3JQRA 2Z4QB 2XWBA 2XLBA 3L0ZA 1X3DA 1KCVL 3L5JA 1VRVA 4JY6A 1W87A 2DEUA 4Z95H 5B3JA 1MCHA 4N5MA 1DDHA 3T8VA 3L1VA 4KE9A 1IGCH 3L95B 3L4ZA 4U33A 2APFA 2ICES 4JO5A 3OKMB 1B7GO 3U0TA 3V0VB 1PR0A 2RIRA 3CIAA 4LU5L 3KQTA 5BV7H 3A3NA 2PYEE 5LZ5A 4PJIF 3OMXA 2MCPL 5JO5B 5FO8B 5CN3A 2O5VA 4UQEA 4FX5A 1A9RA 1WD8A 1CQZA 5H16A 2FX7L 1H6CA 2WE7A 2RE8A 2Z83A 3QRLA 1GGIH 1A7NL 1N70A 2ZSWB 2XWDA 1O4VA 4WWKA 4HLCA 4TN9A 3NKVA 3TTUA 4AECA 5T3ZL 3AKYA 4J12A 4RIFA 4LHVA 5AW5B 2DTEA 1WSBA 3WSWA 4J3TA 3TKLA 4TKWA 1D0IA 4HKXB 1WMAA 1DAFA 1TJNA 3OD3A 4O5AA 2CLFB 1TQ6A 4NRZA 4XNQA 1YB4A 3A6LA 3H7LA 1MB4A 5JXEC 3N75A 4BMZA 1SDYA 2IY8A 1LMKA 4LP8A 3RBAA 3DGCR 5ED4A 5IT2L 1Z9SB 4RV4A 1OTHA 1I1FA 3EY9A 4HUKB 1P7QD 1ECBA 3I5XA 1BCIA 3WUWA 2O8EB 5M5BA 2Q6TA 2FD6L 3GMNA 4UHDA 2CNOA 4OH7A 4DFIA 4Z49A 3SCMD 2VN3A 1G94A 5FJIA 1NCGA 5B1YA 2INGX 1CQIB 3U7QB 4FFVA 1KGWA 2XTJA 3DYOA 3QR1A 4N9GB 2PU7A 1OZ0A 4RZ3A 1KJWA 2YL2A 1T36B 4HK4A 2KQUA 5IEHA 1YS1X 2BEUA 3MGCA 1A8ZA 4ZZFA 1QHHA 3O0RL 4U1JB 1IM9B 1DO5A 2RB5A 5DGHA 3PNOA 5EE9A 2GTZA 1MB9A 1LDNA 1QPBA 2COUA 3I23A 5FLYA 2EP8A 2JCCE 1P7CA 1FDLH 1HQ4A 4DL9A 1LSUA 4EKEA 4NO2A 1TTCA 2AEMA 4MUAA 1RPAA 4TL5A 4XPTL 2WHPB 5FW7A 2BJVA 2X1OA 3QVOA 7FABH 1J1UA 2VK8A 1K4MA 1ZDMA 3FWPA 2F90A 1D5XA 1PZFA 3MA0A 1CUHA 2ERYA 4CMEA 4GHWA 1QPPA 1FNEB 4JXJA 4JKPL 2FUKA 2VQFB 3IQWA 3WL7A 5FHQA 1G3UA 4LSUL 1RM5A 4EG3A 2JWGA 1KP9A 1F51E 4WH0A 2VB5A 5FOBB 4D9FA 1SNRA 1AC6A 2AW2A 1N2CE 5DVKA 4V02A 1DXQA 5EPUA 4F5YA 1DJOA 1HPLA 3PWZA 4RE5A 1FZQA 4IOFD 5FUBA 5DOZA 1IJEA 3U1SL 2WXFA 5DHPA 2ZJ4A 3IF1A 1KVTA 3BXNA 4US2R 5AYUL 5E8EA 5DRXA 4RK1A 2CU9A 5LYYA 4BZPA 4MMYA 2HLFD 3CHSA 4EDFA 1NZFA 5TE9A 1WEJL 4R8WL 5IAGA 1JHXA 4BFWA 1XP5A 1NBMA 4D9RD 2ZSVA 2I3ZA 5JZOA 2VTBB 1V8PA 1MWAB 2O5CA 2OCAA 3DT6A 4L75A 2AMLA 3P4UA 3V79C 3VSVA 2P8MA 3VUAA 1RXIA 3UMBA 2VZVA 4RIGA 3DC0A 1IGTA 4F3RA 4ZT5A 4IV8A 1C29B 2AEPL 3CGGA 2FY8A 5C1IA 3O6KL 4PZ9A 5JBNA 4KYVA 1BZEA 3SKNB 1MHEA 3FPJA 4KK5C 5ABDE 5CJXA 2XKUA 1RJEA 3TTTA 2GZ2A 1ORDA 1Y3FE 5GONF 2HUEA 3M6AA 2EH7L 1S4MA 2JLCA 4H7FA 2Q2VA 5IU6A 2VHVA 2P46B 5KN5B 3E2HB 2J9XB 2P1YA 1ZEJA 4UAUA 3G5VB 5L7TA 1BCSB 2NZ9C 4ZOLF 4OQNA 6REQA 1LUAA 4BHTA 1YA4A 3BFJA 2PW1A 5DX8A 1E9SA 1AQYA 1KJJA 4NBXB 2F74A 3GT3A 1WK0A 5DM70 4QPJC 1EDQA 3VV2A 1N10A 1PT8A 1ACYL 5CB4F 2A3RA 1QSFA 2H2IA 5J5CA 2ZYUX 3S5LG 5TH2A 2XDAA 2Q86B 3OO0A 3VO2A 1VLJA 1GGBL 4BKSC 1ILEA 2VPIA 5FAKA 4N5EC 2JFYA 3B2MA 5T8IA 1QANA 3PXHA 1YI8A 1FFOA 2WDZA 3W3AH 3AU9A 1NMBL 4ACTA 1WSDA 3SSOA 4UVDA 4MNQA 2OCPA 3VYOA 1TC1A 1X3SA 2XV0A 1EIZA 3WLEA 4XE0A 1MFAH 2FG6C 4CLOB 4LSTH 4JG1H 4EG6A 4APXA 4LHUG 3ITEA 2EECA 3CV3A 1NLBL 4BMCA 1OLZA 5E8DL 3FDZA 3NTLA 1MU0A 1LZLA 3VXKA 1NGZB 3EDDA 4QMEA 1Q0ZA 3NNNA 5GMOA 4J3XA 1GYCA 1FSKB 4NNOA 5CEYB 3S7GA 1M2VA 1BRMA 1N0IA 1O96B 4ES9A 1CG6A 2F3QA 3FZEA 2WY3B 5BO1H 3GSNB 4QY8A 2A0WA 2UY7B 4N3GA 2Q7YA 2JJWA 3AJ7A 3ZDYB 1CT8A 1NCDL 3BH0A 4O4LB 2XZAH 4EGJA 1C9DB 3B3JA 1PIFA 3GFPA 4QXUL 4Q3KA 3IEPA 4R2XA 2RH0A 2UXVA 1AACA 3RYCB 4ZUVA 4MJ3A 1OCRB 2Y1GA 1JPFA 3STWA 1A25A 5MEOA 3ORYA 4UDXX 1QYGL 3THSA 3CZRA 2RACA 2YRLA 3KTAA 2UUDK 3TBHA 4G0YA 1T0PA 1T4CA 3P0IA 3I02B 5ITBH 3H8SA 4ZT3A 4TYMA 4YWJA 1UBTS 5BRAA 4FWTA 1SG0A 1HNGA 4G1EB 3FT3B 3VXQA 1ZY9A 3A1CA 5JHGB 5DK2B 3V4VL 3D69A 2WTXA 3GL9A 4G80A 3CC8A 3CH1B 3QNMA 3EYQD 1W8IA 5EC2A 3ZWOA 4I0PA 2ZWNA 4I48B 3NACH 4ARSA 2NOYA 1OB2A 2H85A 2K5UA 2Y3NA 3ETLA 3E2MA 3MSCA 4YDSA 5KOMC 3W5SA 4FQLH 2I3BA 3TVMA 1SELA 1AK1A 2NYKA 2ID7A 4A2CA 1ODFA 5GP1A 5BSHA 2C58A 4OJAA 1QK5A 2EILB 4WTZG 1CNFA 3PHHA 4N1AA 3IOCA 1BU5A 2VHZA 2WZ6A 2HRBA 1FFBA 2XYBA 1KI9A 1BF5A 5EEZA 2C7PA 3PE9A 3L8ZA 3BCDA 3TC9A 2C95A 1JBQA 3EYWA 2GCIA 1IMHC 2II6A 2RDMA 4OD1H 1RQXA 4UV7L 4Q7KA 1GSAA 4ROTA 4F4HA 3R1GL 3FUUA 5H5JA 4ALIA 4I0PC 2PRJA 5K8UA 2YIMA 2ZCLH 3HVIA 4XSVA 2X4QB 2C1EA 1MCRA 4U0JA 1QW9A 2FT8A 2NY0B 1QO0D 3L8MA 2HDHA 4PBDA 3PNVA 3ZTNL 2ZUEA 1EMTL 3RUCA 3U3MA 4AWBA 2WF7A 1EUCB 3TCXA 1SULA 4U4BA 221PA 1NU8A 4O9HH 1XTBA 1AZTA 4BZWA 2X2OA 1P2DA 2VLME 3ECQA 4I8IA 3DXAB 1FSZA 2ITEA 3VR2A 4F91B 5EIVA 1R4NB 3G9ZA 4Z5XA 5DO2D 4H8QA 5D85A 3U7AA 3MWEA 2DLNA 3W39B 5I1DA 1JHMA 2NZXA 1QI4A 2GJ6E 5FA8A 2GN1A 3U7RA 2B3TA 2C9XA 4WW1B 2D4HA 3GJ4A 2VK4A 4DLBA 2XYQA 1KP2A 2LOEA 5FWXB 1KQFA 4QHNA 3RDTB 4K2UH 4OI7A 2R1ZA 4RMUA 5A2IH 4C3ZA 2G5GX 4PM1A 2NY4D 3VV3A 5AAMC 1HRKA 1XEAA 4LDAA 4TV9B 3WJ7A 4LLMA 3NJMA 1HFWA 4EUPA 2MCFA 3P26A 2F1KA 3M34A 2J6EH 1GLGA 4YDVB 4NKQB 2QFPA 5AXAA 4AVJA 3LEXB 3NTRA 4IJUA 5LZ9A 4NG4A 3CLWA 2X4DA 1CK0L 1EYZA 5CKGA 3W9EB 2PZFA 2HOQA 4GPTA 5M95B 3W4JA 1SVUA 3WWDA 1P18A 3MA9H 3MLWH 1A5AB 4XVCA 2J5BA 1VLMA 4PS7A 3Q5YA 1INQB 4GRMB 3AEYA 43C9B 5E2UH 1HWWA 2DQDH 5EBGA 1ZLSH 4C1NA 4YE4L 4Y4KC 4DGVH 1V9CA 4TLCA 5TEVA 1YVPA 3H87A 2AQ1A 1P5JA 2ODIA 4PREB 3W7BA 1E9VA 4ZREA 1F60A 5T1DL 1V8OA 4BE9A 2FQ1A 3OX2A 1KJ2B 1DBWA 4OF7A 3B9AA 4NQXB 1MO4A 4D0GA 2P67A 3ZKQD 5LYJA 1IXKA 4ICXA 1UF9A 1YASA 4GGOA 2CO4A 1FFNA 2ECQA 3GIWA 1I7ZB 3GXTA 5L7XL 4HXGA 2VJXA 3UTSA 4IU3B 1H3NA 2GTWA 1QGAA 4XXHA 2DBJA 3MWGA 5HWSA 2CK0H 4AENB 1NUNB 4ZJZA 4CEIB 3I30X 1J5HA 5JQGB 4LRUA 3UUGA 5C3LD 3U9PH 3M1LA 1HAUA 5B21A 3HMXL 4XVOA 5BYJA 3YASA 4LZNA 4D9QD 3EGSA 1IAMA 4EIBA 5J89A 5IVKA 1EBUA 1HEJC 2X8AA 2VYND 1HHJB 2NPLX 1QUEA 1HDEA 5GPBA 3IWUA 4WI8A 5M34A 2GT9A 3SGEH 3NHSA 4JY7A 3ZYCA 2A99A 4DIDA 5HYIA 2YEZA 2GPAA 1X44A 3C9NB 1GPMA 1V5JA 4KMMA 3PPIA 1UD4A 1BWWA 2K9FB 2IYSA 2BH2A 2OXGB 4HDIA 2KZBA 2L17A 3RUHA 1U0LA 2XRYA 3E9MA 2RHHA 1NSFA 5HKOA 3U30B 2HB6A 1BE6A 4WW2A 8OHMA 1QMGA 4JFXA 4U9HS 2NW3A 5DMYA 3OQ1A 1LK2B 2E47A 2WI8A 3ATBA 1AMUA 1RC8A 2HWZL 3KOMA 2YWBA 4DCCA 5CW1A 1FPTH 5J2UA 4OKVA 3S37X 5EOQL 4J0JA 3BYTA 5E7MA 4QKTA 1MDTA 1ZPDA 2GTPA 3GLSA 3QORD 4WO4B 3TUJC 2FZ4A 1ISIA 2NY0C 3DK0A 1F8YA 4B9EA 1C9YA 2L42A 3VXMD 5CN1A 1U2TA 4KKVA 2DIJA 5HGHA 3TVDA 4LLVB 3HA7A 4YBQD 3PNSA 2X15A 1EKXA 3DPSA 2CBQA 1CDBA 2JGLA 1J86A 3GBLA 5T3ZE 1QNFA 4RA0C 1RLUA 3C08H 3HA2A 3AY6A 2F9BT 1BP3B 5GADl 3MNWA 4QHSA 5K0FA 2IELA 3H56A 3WRYC 3FL7A 1VI5A 3SPVB 1YYMH 4LXXA 4BUZA 3FTUA 1LYQA 3KR9A 2F7QA 4BHUI 1QTSA 4DQUA 3B6IA 3QVTA 1LPAB 2VM3A 1V7CA 5EIQA 4TMFA 5U4XA 2YFNA 1M1YB 3KHOA 2RQEA 3IA7A 2PUTA 5LAXB 1B6RA 4I1RA 3RODA 5HQTA 4EPWA 4EB8A 3WL5A 3AREC 4QFCA 4LKXA 1TEXA 4KVGA 3BN3B 4CTMA 4PRHB 1TPYA 3M1YA 3GP8A 3HNVH 5AVVB 5IMBA 1I8IA 2O8DA 5JW4Q 4Q9BA 5ALFA 2WAYA 1T5KA 2K8QA 2SKDA 5E2VL 4KXWA 1A97A 1LE9A 3QEGH 2A6IA 1R5BA 1DB3A 4LPVA 2VZ1A 5LYJF 1A64A 3M5CA 4XWGL 3M6VA 1JEJA 4BUCA 1GP2A 3CSSA 1H05A 2EQDA 4B31A 4D5GA 1F4YH 3C6QA 5BPHA 1G7CA 4D9IA 4TRPL 2C82A 5SV4A 1E4EB 1KFGA 2DYSB 4NC1C 2PA3A 1YDPB 4Y16C 1DQJA 3C08L 4XQ0A 1B3BA 2JCXA 1X7DA 1E2NA 4LZZA 3DO7B 4C4XA 1A0QL 1PNOA 5EORL 2FUCA 2P26A 1G1MA 4YRLA 1TVCA 4QWWD 4LRIA 4QAQA 4G9FA 4M53A 4Y2PA 4LGPB 4YBZA 3KPJA 3TL5A 2G7MC 3QQ9D 1JU3A 4QYIB 1VLQA 2YAFA 2GEUA 4Q3AA 3AFCA 1ISGA 3UJ6A 4J4BA 2IEYA 4OI4A 5L45A 4LCWB 2XTMA 5KWVA 2AEFA 4PV1C 1PFOA 4HULB 3WKMH 3L5XH 4URFA 4QOKE 1DEOA 2LDXA 1W8DA 1FY2A 3DEFA 3X1GA 4HH1A 1QMPA 1KWKA 4Y88A 1JNLL 4M0LA 3GJFB 4RVDA 1NXQA 1E5UI 1PMYA 3GF8A 2FQDA 3D9AH 4XQEA 3M0EA 3X13A 3ROKA 1FCCA 3SHTA 3FB6A 2ZGVA 4UHJA 2KH2B 2QMZA 3VO9A 1GU7A 4I5FA 1UYWL 3C8KB 5BMVA 4J3OG 1K9TA 5F1KA 5IMOA 1UM6L 1BAFH 1YG9A 5GZNC 2YN3A 1EERB 3QE3A 2ZT5A 2Z91B 1M6OA 4O2BF 1XZ8A 3VZBA 1YNOA 3H1GA 4ZMNA 3EB9A 3WQHA 1R5JA 1CGSH 4PGDA 3UOAB 4UEWA 2QVZX 4QCIB 3TYFA 2QYOA 3M49A 1SVIA 2Q41A 1SZJG 5AHRA 5EZJA 3CFYA 1QHIA 4RWYL 3P4YA 3D7PA 2WABA 1BNCA 1XMXA 3S36L 1DXHA 1R3LB 1SA0B 2ZIAA 3C5XA 2YLKA 4KZKA 2FLVA 2QE7D 2YZ8A 3TLJA 3C5ZC 4E3ZA 4W9JC 3H0TB 2DFVA 4ZSOA 4NN5C 4FZ3A 4LOLA 1JR6A 4JQSA 1C1EL 4Y9UA 1ENZA 4WNAA 1P7QA 1E3TA 1J0JA 4BFGA 1DRVA 3QPQD 4BNMA 3FO2A 4AJHA 1A7OL 4PJAA 2QRQA 4A2PA 2E7MA 1Z83A 1G8KA 2D54A 1ESNA 2I7XA 1XIVA 4QO8A 1JPUA 3VXUA 4LEIA 4NU6A 1C3VA 2PX5A 3EO1B 4HPYH 5ADOL 3HZVB 5IB2A 1KJ3L 2KHAA 1DN0B 2Z58A 3FVWA 3M6MD 4QHLB 3H5RA 2H6PB 2BN4A 5BN3B 1YB6A 5KSAA 4NQVB 1L8OA 1JHZA 3NA9L 2GSIB 1ZHLA 1YQDA 1PZ3A 3KP1A 4ZAKD 1N5IA 2AMVA 4BFBD 1K75A 4K9RA 4UIKH 2WKLA 4XP5H 4QOEA 4QIRA 2HFFA 3MK31 5FO0A 1SCUA 3E48A 2VCHA 3IEKA 2FWRA 2PBRA 3IUSA 2WD0A 1H3UA 1YRWA 2WKQA 1JGUH 4JO4H 1Z88A 2R0WL 4MLZA 1B2LA 1EXMA 1CD1B 5IK2D 3LSOB 3V8MA 1U3DA 5L3VA 4G9FE 2V58A 1OFUA 3QIAA 2M98A 3IQXA 4M9ZA 4L51A 4DYDA 3AI7A 2Y1CA 4V1CI 4FYMA 3AAZB 3MLXH 3G5ZA 1S1CA 4IY1A 4XGKA 2BONA 2WJ5A 2HA3A 1SY6A 2W9LA 3EMDA 1ZOOA 4JJEA 4DMCA 4KL8S 1BYPA 3G2JA 5FHBH 1UOOA 4G0ZA 2NU6B 3L6FB 2HB0A 4GC5A 5E7FA 1B2WL 4I13B 3PX7A 2GK7A 2X4IA 2GPWA 1U6AH 1A95A 2EUVA 3KSDO 4ND5A 3IMVA 4GS7C 1FFXA 3I6YA 2ASEA 2FPPA 5G4LA 4O2AA 5EUCA 3VCLB 5T3XH 1DCKA 4TLUA 3GNTA 2OCDA 4XCXA 3Q88A 3NOQA 3B5TA 4E08A 4Q56A 4AYBA 4W9RA 2V7HB 1IEVA 1ZTXL 1G6RL 5C0DA 4UTPA 3FWNA 3KYIB 1F2QA 4IUCS 2WTMA 1KENH 1YCGA 1A88A 2VO8A 3VKVA 2BFCB 7PCYA 4L27A 2QRVA 4O1IA 5BT9A 3AQXA 1DI0A 2A9FA 2WP3O 2P1ZA 2OXCA 5ALEA 3E1ZA 3P4LA 2XUOA 2Y0SA 2ZLBA 4A37A 3IB4A 4RRPA 4S1NA 4FCAA 3WNNA 3D8BA 3FPSA 4QYOA 4DRZA 5L88L 3UXEA 2FNBA 3OAYK 1RZ8B 4R5MA 1IC0A 1G3RA 4HAXA 3WNJA 5FTNA 3AQYA 1AQDA 3B5HA 4A1OA 1O87A 5G4NA 4R8RA 2GYYA 3G49A 4TTTS 4U1RA 2X88A 2YUWA 4E42B 3HBMA 4GKJB 4APQB 2A77H 5KYUB 5AVQB 4BTVA 5ALIA 5JALA 1K6EA 5EMHA 4INZA 4IMKC 1NQAO 1E32A 5L3SA 4LPSA 1W5SA 5E56A 4ISVB 2ZWAA 3B8EA 2GD1O 2EDHA 2F9MA 3RSOA 1MORA 2QMHA 3IMBA 4NP4H 1U41A 2YQ4A 4LGMA 4DV1B 3LKOA 4TUJA 2Z04A 4L85A 1EEZB 5DS8A 1T7VA 4RX4D 1YVEI 4M1KA 4ODBD 2H1WA 1E3SA 4KDFA 1BBJB 3TFWA 3RG8A 4RO0A 2DQGL 2I07B 4WZ9A 2HNAA 3IUBA 2JLSA 3EJQA 3U4QB 1J05B 3O4HA 1EFPB 2CT8A 3T41A 4NCC2 4UU7A 1T1SA 3OQRA 4ND4A 1XIWD 1JIKA 1MJJB 3OQVA 3RVPA 3RUGA 3SKUD 1Z82A 1JSXA 3PJNA 1Z8NA 3BQUD 3DD1A 3A6CL 3GGWB 2DH5A 5TDHA 3DARA 2JEZA 3REVA 1V3QE 4F4IA 3I4CA 4E07A 3U5ZB 4YHYB 1GJWA 4KK5D 3SJVB 1JK8A 4E03A 5KREA 2FGKA 5CJOH 3IAXA 3C74A 5DCLA 2AV1B 3BE1L 4L2IA 5FPSA 2YMXH 4NC0B 1IULA 3TPUB 3OLQA 4ZRNA 2DLTA 2A4ZA 3P30H 5GS2D 2G71A 2W90A 2PPFA 3ZE7A 2DMCA 2WU4A 5JNYB 1R0AL 3ZV4A 3H5WA 3HRHA 4HGNA 1M7DB 4L8BB 3FT0A 1G8AA 1G3QA 1YEDB 4TTAA 1EK1A 2G06A 3R5FA 1AOZA 1KZ7B 1GTVA 4FYQA 1CUWA 3WL6A 3DAOA 2O14A 4EX6A 5F1SA 1J11A 4ENEC 2H54A 5AM0A 1N36B 2OBNA 2CMKA 1QZXA 5B1CA 2VF2A 1AGEA 4XVSL 1KTRL 1FVCA 1JR4A 4Z9AA 1QTYT 3MRNB 5BWCA 3K0YA 5AWNL 4AY2A 4JHAH 4MYWB 3NHMA 3E53A 4KI5E 4L15A 4OUOA 3NWPA 1P9MA 1P4AA 3UMSA 5DZAA 1AD9B 3RVTC 1AE6L 2MMGA 3NH6A 3USZA 4UB0H 1HZZC 1PLGH 4UQ2A 3EH2A 3ZS8A 3UP6A 2XWCA 1OZUA 3MWLA 5DJDA 3B7UX 1MMFB 2NVUA 1E2GA 4RA9B 4JLRB 3ET4A 2DGDA 4YQYA 1BJKA 1XHLA 2PH7A 3AVPA 1MF7A 3RT7A 1UXKA 4HDMB 1LPSA 4MV9A 3RRXA 1BCSA 2NXYB 1AGRA 4XODA 5D4IA 4C6HA 1LO4H 4WZZA 2VEDA 2VVTA 3SYLA 5TV2A 1SEQH 4GVLA 3L4CA 1U91B 4XHQA 1P1CA 1KGUA 5CCHE 1QTNA 4XA8A 3MLYL 5GGTH 1F0NA 3U46A 1JT9A 4H7DA 3O4LA 4L4TE 1NY6A 3PJEA 3DB2A 4OHVA 4JG1L 2VTEA 3FYHA 1TYJA 2J2ZA 3WEXA 5I1IL 4PJ5B 1HTTA 5LLTA 1NLBH 3BWAB 1XLWA 2FUG6 3RWFA 4Y1RB 3U0WL 4N8VB 3FOAA 4IFIA 2EIHA 4IXTA 3FTXA 3Q6GH 1ZV5A 2CG9X 5KS9F 3PF9A 4Q9QL 2YJGA 1MAUA 2VK1A 1BM7A 3RO7A 3WWZA 2VJQA 1NYRA 4GWGA 5IUSA 1NVKA 2VN4A 1CY4A 3HBGA 1UJMA 3M07A 4PJDF 2H8PA 1SOVA 3ETSA 4U3HA 4FCHA 5EYPA 5K0NA 5LZ8A 2NZUG 3EA4A 1Z1WA 1OGYA 3IAQA 4CODB 1BQ4A 1I0ZA 1BZ7A 3BVDB 1S2OA 3GEEA 3DTXA 1Z2AA 3NHRA 2KT6A 2XZAL 3GLIA 4JK0D 3HN2A 2BK8A 3D4GA 2ZREA 3CMGA 4QXUH 1NBQA 3ZSSA 3D4CA 3IJEB 1XTMA 1E8NA 3O3EB 4F9LC 1KB5B 1Y6FA 2B2NA 1RCTE 3D0LB 2P8MB 1WXFA 3PUYA 2Z08A 2CR3A 4BDTA 1P91A 1PV1A 4PCTA 2AWNA 5AJZA 1V1MA 5BVGA 1BYUA 5F7HA 1T5OA 4REQB 5IG7A 3PBKA 3MMEA 2MFNA 2XNCA 1FCGA 1BQHA 5C0EA 1XNHA 2QVBA 2ZRIA 4KV9A 4ZOAA 3H9BA 3ZBPA 3BSHA 2I2DA 3MQFA 4YSEA 1VLHA 2VDNH 4MWTA 3R3SA 3T3GA 1YMVA 3HB9A 3NQKA 1EVIA 4OZFH 1MCPL 4X91A 2EICA 2J6HA 2Q3FA 2VKXA 1AR1D 4KI5F 1IVLA 2WHVA 4MI1A 1NYTA 4NWTL 5L2JA 4C56E 1LWRA 1CE1L 2XRFA 2W07A 5CRIA 4ZYLA 4G81A 5IV2A 5CK5A 4DO5A 2B2CA 1QMUA 3IVCA 4EMZA 1M6WA 1RWMA 4Y2DC 4DMFA 3U62A 1JXQA 2MMCA 3DT8A 2BI4A 4YJZL 2W71A 1IC4H 2EGGA 4O08A 3QXDB 3DFZA 3AHCA 2DU8A 3EPPA 4JFDE 4URXR 3BAYA 4U49A 4F8JA 3SOPA 1K85A 1DXOA 5AKRA 5JFOA 2IEIA 2CZGA 4RZUA 3G08A 4WFHE 5TQ2H 1X5IA 2ZUUA 3UTTB 1CUFA 3ZH9B 3U9LA 3LQZA 5DFAA 2ZXEA 3ONDA 3A4IA 1KBWA 2DQHH 3DT9A 1QWSA 1IFRA 3I2YX 3TNMB 5BMFL 3PNRB 1SUWA 4PCUA 4QWWA 1LWHA 1CF8L 1ORQA 2GHTA 1M1UA 1M5TA 3L9WA 2R9HC 3KWTA 3NSDA 2QFRA 4FN4A 4MDHA 4OV6F 1UPXA 2ZIEA 4UILH 2Y99A 3AP2A 3FT2B 1CRLA 5KSWB 4DCOA 3DBHA 2B7BA 3LVEA 4FHBD 4YQZA 4P9NA 4CZ2A 2ZW9A 4OFZA 1FDLL 3R8FA 2HWXA 4XDGA 4R98A 4PP1C 1PTJA 5I1CL 1TVBA 5A7EA 4F6RB 2F2HA 3BW9A