5E6UB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
453
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-L
total genus 127
structure length 453
sequence length 459
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6uB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6uB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6uB03
1MF7A 3BN3A 4O3UB 1XDGA 5KYUB 1M10A 2VDPB 2QTVA 1IDOA 4O02B 3V4VB 3K6SB 3AL9A 4HQOA 2ADFA 3NVQA 1U0OC 4FWWA 2NUTA 3HXOA 5E6UB 1CK4A 4WK2B 5KYNA 1OLZA 3NIFB 2WW8A 1ZOOA 1M2VB 1SHYB 4PN7A 5KYWA 1BHQ1 4HQKA 2NUTB 2NUPA 1PT6A 2M32A 4MMXB 4MMYB 1FNSA 1M1XA 4F1KA 3V4PB 4G1EB 2I6QA 1ATZA 3PPYA 1SQ0A 5E6RA 2XWJI 1JV2A 3F78A 2ODPA 2I91A 4HQNA 3EG9B 5KYYB 1YUKA 3VI3B 4G1EA 1JEQB 3PPVA 4C29A 1MHPA 3RAGA 3EH2A 5E6RB 5KYXB 2VDNB 4JDUA 2ODQA 3IBSA 4G1MB 3EGDB 3F74A 3ZDXB 2WINI 4IGIA 3HXQA 3QA3E 4MMXA 4Z7OB 5KYUA 2UZYB 1BHO1 2VDQB 4O3TB 1AUQA 3N2NA 3OL2A 3ZDZB 1PCXA 3EGXA 3Q3GE 5E6SA 4O02A 1JLMA 4GZ8A 3K71A 4HQFA 1YVRA 4Z7QB 1QC5B 1MQ9A 1IJKA 3AFCA 1ZONA 3TXAA 4IXDA 5BV8A 3IJEB 1IJBA 4WK4B 4A0QA 1L5GA 3ZDYB 3K71B 4UM8B 1M2OA 2IUEA 1AO3A 1Q0PA 2NUPB 5HJ2A 1MJNA 1LFAA 3AL8B 3FCUB 4M76B 1MQAA 1RTKA 3GXBA 3ZE1B 2B2XA 3BQNB 3EH1A 1JV2B 4WJKB 3PPXA 3T3MB 1RD4A 2XWBF 1RS0A 1RRKA 3EOAI 1JEQA 3NIDB 3ZQKA 5ES4B 1DZIA 2VDLB 1M1XB 2P26A 3ZE2B 4NEHB 1JEYB 3IJEA 1QCYA 1FE8A 1M1UA 5HGJA 4MMZB 4CN8A 1U0NA 3TW0A 2O7NA 3EFOB 4DMUB 3OL2B 3EGXB 4C2AA 5E6SB 3K72B 3TVYA 1DGQA 4BJ3A 4HQLA 1PD0A 1N3YA 1QC5A 2P28A 3EGDA 3HI6A 1T0PA 2VDMB 4NENA 4IHKA 3K72A 5E6UA 4CNBA 1OAKA 1JEYA 2VC2B 1UEXC 1M2VA 1MQ8B 1V7PC 5LN1A 3E2MA 3BQMB 4MMZA 4C2BA 3AL8A 4K3JB 1T6BY 1U8CA 1TYEB 3OKWA 1SHTX 3OKYB 2X5NA 3EFOA 2XGGA 1YVPA 4XW2A 5HDBB 4CN9A 1L5GB 4JX0A 4UM9B 4Z7NB 1U8CB 5KYWB 3FCSA 3T3PB 1PD1A 1AOXA 4NENB 4UM9D 2I6SA 3M6FA 4MMYA 4F1JA 1N9ZA 2VDOB 5KYXA 1SSLA 1SHUX 3PPWA 3K6SA 2VDRB 3NIGB 1CQPA 3ZE0B 3EG9A 5KYYA 2ICAA 4FX5A 4WFQA 3EOBI 4WK0B 1XDDA 3TCXB 2VDKB 1IDN1 2NVOA 4G1MA 1NA5A 1XUOA 3FCSB 1ZOPA 3VI4B
chains in the Genus database with same CATH superfamily
2IMMA 2V0GA 3WV0A 4G0WA 2AQNA 4HUXA 2FPGA 2SCUA 1SKUA 3MRLB 3ZWWA 1UMBB 3IBTA 3JRWA 4J4PA 5K4HA 4ODXA 5IG7A 2PO7A 4Q74A 1A6PA 4BH7A 2OHOA 4UU7A 3COVA 1OAOA 4AECA 2HTLC 1GADO 1VCHA 3WWYA 3B8HA 5CH5A 1IMHC 1OL0A 3SD5A 1D9KB 4QZVA 1SQGA 5F3BB 1P5VA 5IOKA 4Z9AA 1QG4A 5D1QA 4GX1A 2RAFA 2DV6A 4Q89A 2FATH 5CJXA 4GI2A 3O4LE 4KHPB 3LRLA 1UASA 4RVBA 4AWXA 1V95A 3WU1A 1T35A 4WBNF 2X2FA 4XVJH 3ORSA 3SKMB 3IEAA 3K53A 2DKUA 3ACBA 5J1AA 4NEQA 5DLYA 5ADWA 4N18A 4DC1A 1D04A 5BY2A 3X13B 4YDSA 2GZRA 1LZLA 5FECB 5IDWA 2P45B 5G5DB 4Q15A 1FUNA 1E27A 4HJJL 2YDYA 1E8DA 4C9BA 4OCWL 4G2NA 1I3GH 1K4KA 3FWHA 3CDGA 3KPLA 2TSYB 3PK0A 4AJ9A 1IBRA 3AVYA 4G2AA 4D0CA 3F83A 4H6XA 6ABPA 4O5OA 1CFQB 1E4WH 3M6XA 2OV0A 1HHGB 1VIMA 1GLGA 4M93B 3VRJA 5SYAA 4XAKE 3VXMB 5EMYA 4A2HA 4LNUB 3ROGA 3ULUE 3U4KA 1HE8B 3AUYA 2QM0A 3V4PA 5HIAA 3TQSA 3KP1A 3T4UA 5E8PB 5DMKA 4BK8A 2OTUB 2MCG1 2BBTA 2A9NL 5C31A 1FEZA 1I4OA 2HFGH 4F7EA 5SV3A 4HS4A 1I3OA 1Q3KA 4Q9DA 3RB7A 5IANA 2VPQA 3RHZA 5HY9B 1Y4AE 3T0EA 4OZHA 2Y1DA 4QXVA 1NBEA 4LSSH 1FHGA 3PKZA 4I2VA 1TUIA 5AW7A 1UUSA 2IPXA 2C1OB 1JTOA 3IFOA 2X3YA 3VISA 4Y1EA 1ZWIA 1DBQA 1U90A 2D2FA 2R8YA 5H9WA 3G9TA 1YB5A 3LAFA 1YMQA 1NDQA 2R2BA 2W2OA 3IV7A 4X24A 3MOBL 2IYWA 5IBTH 2CBGA 5D1QE 4Q48A 4PWYA 3NACH 4WW1B 2JFZA 4UUNA 3I32A 4QOHA 1G6HA 3H5WA 1OCOB 3O6KH 1T36A 4Q4AB 4JPVH 3LVBA 2UY7A 4EDHA 2K3HA 1UMDB 3H65A 1RZGB 2RGXA 4IRZH 5IMMB 2BBOA 4RGND 2Q8AL 1T7WA 3IQEA 2EDEA 1JZ8A 5KYWB 2KLSA 5FKAB 2W6MA 2J25A 2D3WA 2G9RA 3KFLA 5JSZB 1OMOA 4LAJH 1KIUB 1OV6A 4GAAA 2P0EA 3L5WA 4AT6B 3FGPA 4OQXA 1G18A 3GEWB 3SC6A 3U0TA 1YBHA 4MGYR 5EFIB 1J0CA 5EEZA 2F54D 1C5DB 2I29A 5CKAA 3VZSA 4XD7A 2A14A 2ARJQ 3MYRA 2PBLA 3ASNB 4KZ0A 3P11H 4R6WA 1OK0A 3JYQA 3S36H 3LHAA 2I91A 3FHJA 4R96A 3GLFA 1G1AA 3KE9A 2GBGA 5GZ6A 1OGPA 3RTQC 4NCXA 1JK9A 4DSOA 4M6NH 1R12A 3CFTA 3V2HA 2ZBPA 3H5RA 2VN6A 3GHEH 1JLMA 3ZGZA 2FLVA 2FX7H 2GAFA 1A0QL 4D8UA 6PFKA 3KPSA 3AM8A 3EIQA 1ITCA 3G0OA 3QV2A 2PMZA 4GOOD 5H37A 5KEZA 4HCRA 4KQIA 1J88A 4LLAA 3T7EA 4JZOA 2WXQA 4JOCA 1R3DA 3HJAA 4JLRB 3OQIA 3SFZA 2H06A 4Y1AE 3SHWA 2HTLD 5HGDB 1PKQA 2ALWA 1Y6JA 4CFYA 3KM0A 4UT9H 1K6QL 3OKFA 1JYWA 1MC1A 2X8AA 4R0LB 1KO4A 2OQ2A 2QGFA 2I9KA 1B3JA 1G6RB 3HGTA 2VUOA 1G7MA 2Y76A 4PZEA 3HZVA 5CM8B 1TOXA 4Z9FA 2A9MH 4HJSA 1UEMA 4DCGA 5EHFA 3QFDA 2EDQA 4GUPA 4JREB 4M0DA 1OZGA 4FT4A 1C16B 1OSZB 3O6KL 4F84A 2QELA 1E4VA 3P4UA 3D31A 2XBMA 3E8UL 2CUMA 5FADA 1H8HD 4ZQTA 1W0CA 1CUXA 2BSEA 4XNZB 3I2HA 2TECE 3ARWA 3W9EB 3EULA 2CIKA 3O2VL 5I71B 2PTUA 4DGUA 2O1SA 3VDXA 2P47B 2CL7X 2VLRB 2J0EA 3U0WH 4RIFA 1QK4A 3UJBA 5KTKA 4IZOA 4JG1H 2V7VA 1NSNH 1TPXC 3UTSA 1RWWA 1MAAA 1G7LB 1P33A 2Q8NA 1XCLA 4B3BA 3IS0X 4ZQKA 3K6OA 3N8KA 1GGJA 4IIQB 3O1JC 2W22A 2PWGA 2Y5TA 3OFSA 2W65A 2DHCA 3GT0A 4NRYB 3T4AB 4LZLA 3QHTC 3TBVA 4DEYA 4ZRNA 3BXNB 1WHTB 5EMLA 5DXJA 4ZUVB 4DZRA 3C6QA 3L8EA 1UUNA 4XCNB 4DFIA 1YMHB 4BUZA 5DWVA 4MJIB 3F5WA 4I3RL 4ODVL 2OV4A 4OYRA 3C6MA 5CEEA 3LNCA 3WIIL 1INDH 2ZVQX 2HA7A 2P9TA 2QRUA 2VDRH 2H31A 3O4GA 5CURA 3Q8KA 1XZPA 4D9LH 1GGMA 4TV9F 3BJEA 5A2KH 1DJZA 3LMJH 1KCVL 2Q9UA 5C0CD 1F0LA 2VLJB 3L3OB 2ZYSA 3FJYA 2EADA 4OJYA 4AJYV 4D9CA 2GI0A 1OGAD 1RR6A 1TEYA 3WICA 2QKIB 3P20A 3UPAA 4XGIA 1PNRA 4UU0A 1KIRB 1Q21A 1I6LA 4D9QD 4N7BA 4TZTA 4E0BA 4UM9A 2PUJA 4ETMA 3O8CA 1HE1C 1J0BA 2FWAA 2PU5A 5A5FA 1L4KA 1WXFA 2MR5A 3GJ0A 1LX7A 1HDZA 2QTEA 5A7BA 4BH8A 3JYPA 3T65A 1NCIA 5MERA 4TYUA 4G8CA 3TYFB 4LVNA 2JF0A 2IDMA 4BCCA 1PQWA 3TYXA 2OZVA 1KCKA 4R3SA 2N01B 2W6NA 4BFNA 4YXLL 1L5ZA 2WABA 4PGDB 5ADVA 1JPJA 4Y16A 2C9AA 3IKCB 5E6SA 1SBZA 3KQHA 1M0EA 1EQ2A 5LZ4A 2OVFA 3DEYX 4M1CC 4NQXA 2EHDA 4FQCL 1VLZA 4CMHB 1OLXA 3AM3A 2HLFD 1MQAA 4C7JA 2DYRB 4N20A 4XMWA 4XMKL 4C56E 3G1TA 1MI5A 4JYCA 3SZUA 4Y3UA 2V7UA 3DAYA 1KEKA 4C3OB 3BPLC 1MEEA 2WN3A 5D1HA 3L48A 3CUWA 3ED1A 4C43A 4GO8A 3UZQA 3A6ZA 1AQUA 3ZHUA 5CEXA 2CKBL 2M2DA 3LOUA 5CLWA 3V52L 2PLNA 3UAAA 3IAEA 3V1YA 2E6JA 1EGHA 3ZTCC 1EMDA 3TVMC 2QD5A 4AURA 4K88A 3WO1A 1HI9A 1JUFA 3UB4A 2WHXA 3L0IB 5F2FA 3M70A 1ID5I 4AIXA 2NSYA 4K6GA 4PY8I 1C9NA 1TM4E 3DOSA 3DLCA 5ENWB 3ZBUA 5A0FA 2PVSA 5IQ9B 4ERXA 4IYJA 3QW4B 4TYYA 3ZWOA 4Z95L 4YFEA 4HS8H 1BBJB 3CFKA 1MSPA 1OD7A 3S2IA 4EW3A 2FJGB 3OIUA 2QGEA 5GRJL 2Q2OA 1WFMA 1LLCA 2HK7A 3STVA 4HAIA 4N5EC 3AB8A 5EUOA 2FZEA 3ARPA 4GG8B 1NAKL 2PA0A 5AK4A 1CGYA 1PCXA 1XF5B 1KGUA 1DBVO 1H5NA 3RIYA 3PWJB 1T5TA 4FEMA 4U2DA 3OAUL 3DZJA 3K6KA 2PA3A 3PNBA 2VKTA 1DC5A 4N2OA 4HEJA 1U6JA 3AM8C 3HZKA 1U3UA 2PBFA 3OOWA 1MO6A 1F00I 3IEUA 2ED9A 1ETA1 3D33A 2QTHA 5KBLA 3Q6IA 3WGGA 2FMIA 1U0NA 4GAJL 4F93B 5L3QA 3ZKAA 4JBGA 1S9YA 3R5FA 1CBVH 1U9IA 4K8RH 2IPMA 3WYFA 2CT8A 1WSAA 3VNRA 4UV7H 3D4OA 1FDVA 4YMGA 4RIEA 1OWLA 4KXMA 1GHFH 2Y72A 1WS6A 4RANA 2P6UA 2PCPB 4Z7NB 3M1BB 3MTRA 5ISZB 1R2QA 3PHJA 5SWQA 1OIOA 5JAIA 1C8KA 2H0JA 3K7UA 3QDHA 3HVRA 4QJBA 3EUUA 3PQFA 2C3OA 4MVJF 5F3DA 4K15A 3MHTA 5LGKA 3WLBA 2EYQA 1AYRA 1ZA6A 4KXZH 4D8YA 5FGSA 2GK6A 4BLTA 4M6OL 4FEYA 1SWVA 3GYRA 1MCQA 1XU7A 3CT4A 1LBEA 1FZOA 5FA5A 1RHMA 3AINA 2ZD0A 3JQ7B 4LLDA 2X4RA 4RZ2A 4HUNB 1PUJA 1K27A 2FW0A 1IFRA 2DKFA 1Y9DA 2WWRA 3DVSX 1LD9B 5FTWA 4OFVA 3R40A 2WFZA 5LQMA 3UJCA 5DJ0B 4FPXA 3CX2A 3QEBZ 1ZMRA 1D2GA 4M5SA 3MKKA 2EDLA 3R8FA 2P2CA 4OGZA 1AK1A 1HX0A 3VM7A 2VH5H 5JYMA 4HJGB 1KBZA 4HLJA 3OZAA 4G56A 4DVRH 3MOIA 2R4RL 1H8NA 5FRDA 3K6NA 3LQQA 4M48L 3N7UA 1CGSH 3O4VA 2P5WA 2VKXA 1QUFA 4MNHA 3HI6A 4IMLB 5BN3A 3M6AA 1YPZE 2UV3A 4U63A 2BSXA 3AFOA 2WCPA 3E7XA 1U02A 2AHOA 3IURA 2PX0A 3JWNH 1H6TA 4LE2A 5B6JA 1WZNA 2Y92A 3TQFA 4U7WA 3BT7A 2UXCB 1FFCA 3GMMA 4BN4A 4X60A 3HVNA 5E9NA 5DMGD 3TZVD 1WXIA 3ET5A 1YEGL 4GECA 4AYID 1IBZA 5SY6A 4X5QA 3FQXB 3DGFC 3QX7A 1PBNA 3MYJB 1LK5A 4AUUA 2ETXA 2QEJA 1BH6A 3WP0A 3P52A 1KYWA 5D85A 3MEQA 4X7SL 2RD2A 4NFCA 1VL1A 5D1ZB 4F04A 3CFIC 3CE6A 2UUOA 3BW9A 1BHQ1 5CDUA 5TT1A 1T0JB 5DRZA 1F6AB 3MLSH 3AU1A 2YW9A 1P4IH 1DQLH 1JPNA 4X1OA 4R3WA 1VG9B 1F2UB 2XYCA 1QLEL 2PXYB 1ZJ6A 4Y2TA 3EWNA 4QPJC 3KR3H 3TWOA 1U8KA 4TVKA 1P69B 1N34B 2OQJA 1WNTA 4LLVB 1TTGA 4PLOB 3TD2A 2FZKA 5IVXB 4FGKA 5KI6A 1UDXA 4BKLB 5JXIA 2ZXBA 3U0WL 1R5BA 3DZCA 5SZKB 4R7GA 1FYHB 1JDUA 5KNLA 3FUJA 3MJ6A 3SC2A 1T29A 1L7TL 2E7DA 5CBEB 3WDHA 2EVIA 1SAYA 4RQBA 3MA0A 2DBJA 3OB0K 1ET5A 1NPTO 3ESVF 3VI4F 1JPGA 1MLBA 2P30A 4H7DA 1FTGA 4JJ7A 2AZMA 3RNKB 1JCVA 1OCWL 1QGUA 1K5DA 3EFOA 1LNZA 3S37H 4K9SA 3FN4A 1X87A 4M0UA 2HSWA 4GX2A 3M6FA 3NEJA 1WFUA 1H0KA 3EVZA 1ABBA 1T04A 2WTBA 5TQVA 3FUMA 4N8CL 3WHE0 4AV5A 4Z77B 2W9EL 2MH4A 4KFMA 4YREA 3KG2A 1BX0A 1NIEA 2VC2H 2WYUA 4D9HA 2YRLA 1FVXA 4KDRA 3F8SA 5FOBA 3ARYA 4L8CB 5DI9A 3GQFA 4FE3A 3B1FA 3E7DA 1OC2A 4AY6A 3H4HA 1N2GA 5D6DA 3T0WA 4LSTH 2VERA 1CJKC 4QA9A 4ZVVA 4AN1A 1I1AC 3CSSA 2ICWI 3H5VA 1MJGA 3FTEA 4Y2QA 1EWTA 5L8VA 3CUYA 5KVEL 4CXMA 1BMDA 4CG3A 1DBRA 4WJZA 3ARGC 2CHNA 2W2KA 1DDGA 3OZRA 4G67A 4IDBA 4R1QA 5KOJA 5IUCA 2V9RA 3CUSA 3VVCA 1VKHA 4JSTA 1Y6RA 3GMTA 3RSHA 1TCBA 3UWSA 1SU4A 2CH8A 4NP4H 3QFRA 2FGWL 5A43C 3GBSA 1A96A 3RTEA 2WJPA 4KIWA 1FFAA 3PQ4A 4AZ0A 3QEQD 2B5VA 4ZXPA 4F11A 5F7OA 2WKOA 5KU1A 4QGAA 2AD5A 1TIPA 3WO3B 1GXSA 1U63A 4F24A 4J2OA 3AS2A 2D3JA 3IDIA 1MREH 2JI1A 2Q5JA 5J3HC 1P9MA 3S5UA 3TBSB 5E8JA 3H9SD 3WL4A 1V45E 3LI2A 3WJJC 2ZI6A 3SJAA 1V3VA 3B6SB 3G2OA 3ITNA 4LBWA 4MS8C 4Q14A 3IJ8A 1HOCB 1ACYL 4M5ZH 3RZCC 3I1YA 3GFBA 2VC2L 3JD0A 4HWEL 3ZT6A 2JH8A 1SLXA 1JZ4A 2AI0H 1LLDA 2MSPA 5IFJA 3EF3A 2CBTA 2HZBA 1FUYB 1IU1A 5AOIA 3AIMA 1LS6A 2AOUA 1YKSA 4NR0A 4PRIB 4XMKH 3T0EC 4N6NA 4OMFG 1MG0A 2QPSA 4TSKA 4BO6A 3EUDA 3G59A 2YAMA 5HE8A 1BD3A 1AS6A 2WJYA 1MRDL 1HYSC 5JOFB 1A6ZA 4UFOA 5DK6A 2XQYK 4Z53A 2FZLA 4NHOA 4DHLA 3NDYE 4LSGA 2BP7A 2JLBA 3H5IA 5B1EA 3BUIA 3MJ8A 1QTRA 2VOEA 2RHOA 3B37A 4B3TB 4ZT6A 3AG1B 4LGPB 4G5RA 1K3UB 4XWOC 3TTTA 1Q6ZA 1JQLB 4YT4A 3LUJA 1THGA 1C8LA 3R7FA 3NOIA 1ANKA 1LXMA 2PS1A 3L6EA 1O97D 2PTHA 4ODWB 3L5KA 1OARL 4LIPD 1TZBA 3P0JA 3M6VA 4GRLD 2YXMA 4JK0D 3G5LA 3O1LA 1JPUA 3S2GA 4MR7A 3GBLA 2G60L 3PDDA 1OZFA 1U0JA 1CUZA 4HK3N 5LQBL 1D0IA 1PN3A 1BBDL 4IH9A 3RTLA 4HLQB 4OCXL 1OVZA 2W6JA 5JYDA 1GM5A 3CAFA 3TT1H 2C84A 3UO8B 2PCXA 4WTWA 2BH0A 4OZ4A 4PV8A 1XH1A 3GGDA 2Z4TA 4ACPA 3BDAA 3JU3A 1IHUA 2CQVA 2CLSA 1ZGLM 2IADB 4HQQL 3O2DH 1AKJD 4U1KB 2UVQA 4PN7A 4DMFA 4EKEA 5BMFL 1NGYA 3VX4A 1G7TA 4L8SC 5TQ0H 3C6ZA 3QNYB 3LN4B 3PRYA 3KOOA 3ZR4B 2GUGA 5KOVC 4Q4DA 4EKGA 3VBEA 1A7PL 2Z8YA 1DAMA 1ZAKA 2X1QA 32C2A 2B9VA 5SX4I 2UWEF 1VMDA 1QHNA 3WE1A 3FCUB 4ZYUA 5LUAA 3BHBA 1GPOL 1B0RA 1S7WA 1HRKA 3W2GA 3BTOA 2EEXA 1MCWW 3ABKB 4R26L 2LLNA 2H9GB 1U2PA 4MMZB 1IUKA 3SSNA 3WQQA 4C0LA 5JJIA 4XMLH 1G87A 2OX5A 5HJEA 2H2AA 3Q3EA 4UUMA 5DHAA 1E9PA 1A2OA 5TF1H 3AQIA 4ROSA 2JWGA 4RCVA 1VI6A 3ZUGA 1ZUIA 2DX7A 2IE8A 3II1A 2E49A 1H19A 2IXTA 2AWNA 3Q0EA 4HLNA 4BX0A 1J22A 1WDWB 4KN8A 4BSVA 1QS0A 1FVCA 4Y2DD 3M1OA 2PUDA 5DDIP 4DRXA 1WUHS 3WGUA 3IKMB 4XGRA 4DABA 2JFCA 5E1MA 5HIIA 1A5AB 1AFVL 5IESH 4CF4A 5JMOC 4TVBA 3KLMX 3FPGA 4MEBA 1N2XA 4AO7A 3DLPX 2P44B 1NC4A 1LDYA 1P72A 3HB9A 1R18A 3CC5B 1OFTA 3TQIA 4N3UA 2QRGA 1A4KA 3CURA 1HYSD 1JPEA 4UJ3A 5A2QA 3DDZX 5HP4A 2JF1A 4CSTA 3VWJD 1FFGA 1BS2A 5K01A 3CR3C 4I18B 4MAYB 4NWTL 1YS4A 3IKJA 3URMA 1ESCA 1X80A 3E3LA 1P1HA 4UTAA 5FXCH 1TM7E 1ACMA 2HHLA 1P3Y1 3A2LA 3OT1A 4F97A 2Z2ZA 1ID2A 3C41J 2HT4D 1QA9A 3ZZ0A 1P5UC 1XSEA 4OHMA 3R41A 3VKFA 3FQWA 3NHPA 3GA0A 4RA3A 3U4QA 5DZ9A 3HFML 1TIKA 2JIQA 5J9FA 5FC9A 5CFQA 3QIBC 1XD9A 4ONHB 1DXHA 4CI0B 5J6HB 1VPWA 3PJGA 3FCAA 3W82A 3TJEH 3TT3L 3VE0A 4Z7UE 1BVLB 1QG0A 3KETA 4KKQA 1NUGA 1Z38A 4E13A 4NQZA 2IBBA 3LQAL 3AQZA 1VFAB 5BZDA 2B16A 2O5CA 3KS0H 2ECKA 4IOMA 1EJ0A 5KQPA 3RU8L 2OV1A 3BSHA 2Z8XA 4XYEA 5J1TC 2JJ1D 1S3GA 4GOND 2GETA 1EEYB 4F5DA 1RM0A 5DC2A 4E12A 1EXNA 4MVWA 5C0AE 4WKBA 5FPTA 1RXYA 3UATA 4PSAA 2ZIZA 1VACB 3AUVA 4FX5A 2OFXA 4WCVA 4X7TA 4IIJB 2WWMC 3KBEA 5TTRA 2PSSA 3GSVB 3S5ZA 4EMBA 1RUPL 2AJDA 3WNVA 4E68A 4MQXD 3A4FA 4I1IA 2OQVA 2DYSB 3OIFA 5LBSL 4RFVA 3PPIA 3O6FD 1M3IA 4YRJA 3ET4A 4QHMA 2QGDA 4GMTH 4U1MA 1MVLA 3BC9A 2VN8A 5M7EA 2TAAA 1QGDA 4ZYZA 3I0NA 2CK3D 1NVVR 1XCJA 2Y5EA 1U2RA 3UWPA 2XT1B 4M8RA 5DNDA 2HX1A 1A14H 3AC0A 4RQTA 1C8VB 1R5WA 2XWBA 4LSUH 2E9BA 2JIXB 3TVTA 2VR9A 5DGQA 5DK2B 1JF5A 4YK4B 4F8LA 2EQAA 3SGEI 3RVWD 1YRAA 2PUWA 2BNQA 4PREA 2OWEA 3DHWC 3U9UB 3RDTB 4Z7JA 2GZ1A 3OZWA 5IW3A 3T4YB 4PG5A 1NCCH 4YFLF 2K3TA 1N6QL 3C3MA 1MQ8A 4MNGE 2EDWA 1NP6A 2EGGA 1H3PL 4YFDB 1I7PA 1V7PC 1AQDA 4M61B 3PDWA 3ELBA 1W8EA 3RIFF 4M1TA 4F9LC 4FUTA 4PRHD 3HZMB 3DYBA 5FI1B 5EERA 1A7AA 3ROXA 5DZPA 5BNTA 4YBZA 3BC1A 2XVBA 2HA0A 1MXDA 4L4TB 3TE7A 4B74A 5C5CA 1BOFA 3TURA 2X6UA 4WNQA 3JSXA 3NGXA 3MN8A 4HQOA 4JKYA 2BSCA 3QFSA 3ARBA 3MBEA 4EZLA 5LB1A 4MQLA 3WEAA 3KYCB 5AZEH 1VYTA 3G2KA 4FMCB 2YMOA 2X4OA 1I7TB 1N59B 5CSZB 3RVXC 3E6FA 1YUKA 1FPTL 2PXHA 4PLYA 1KZHA 1OALA 1R33A 4UVGA 2WO2B 3F6SA 1YB4A 1PFWA 2QG6A 3KU4A 3F5MA 1CQZA 5FA8A 1E2MA 3D39E 2R23B 3FPXA 2IS4A 2NY0D 2JQZA 1IBLB 4DNFA 1AUPA 2JLRA 3LPWA 3HNTH 1ZD6A 3GNTA 3V5DB 4ANUA 4XYBA 3VJKA 2O52A 4NGHH 3WISA 4YA6A 4U3SB 2ZOLB 1KIQA 2PWYA 4CL7A 4O2AB 4HEMA 3D34A 1MJHA 1A7KA 1DTEA 4QOEA 4B41A 1CXZA 4C6RA 3WEXB 1A76A 4TMTA 5I75B 1L7VC 3CK0H 5B1CA 3RGHA 5CJOH 3K96A 4AUKA 5BS0D 3FFCE 1GGCL 1D6VL 3BD6A 4D4KA 5JFGA 4TTSA 1OAYL 3U9WA 5J0BA 3RKUA 3PUZA 4M6MH 2C8JA 4ECNA 5LR6A 3V0WL 3BDXA 1TCRB 3QE3A 4JL2A 2I6GA 4QXGL 2C4TA 4F33A 2JDIA 4MVJG 5JY6A 3KVDD 3C74A 3UAEA 4F7MB 3HU2A 2JIDA 4NHUA 5E70A 3I52A 1M2VB 1BMFD 5HPOA 3KCPA 3WE6A 2WYWA 1KLFA 1QQ5A 1XFAA 3OXRB 3FRIA 1ZD3A 3FX2A 3R3WA 1OFGA 4O2EA 3GZTB 4JP5A 4J3OG 1A4XA 3T7TA 4QRAA 3WO4B 1E6KA 1L3NA 4UANA 5HYSB 7REQA 5C08A 3VXPA 4Z8FH 2ACEA 3DD1A 3DPDA 2ZKMX 1KR5A 3MROA 2GNOA 3HYLA 4DO5A 4YRZA 3SZRA 4JI4B 1NLFA 4N48A 1MG5A 5GQSA 4ENPA 1BN6A 3DO5A 3HDTA 4NL4H 3BJ91 2ATXA 2FUG6 3EVFA 1XZLA 4X92A 3UGKA 2N1BA 2WAQA 1DBBH 4HHEA 2C2GA 3ZHTA 1U93A 3NH7L 3H2KA 5EJ2A 4QBKA 4S2EA 3FBTA 4CLRB 5EIOA 4B3CA 3RS0A 3TRIA 1CICA 1L5HB 2NZVG 4L5YA 2WAMA 3QQDB 1IM9A 2AR0A 2A73A 5F7ZA 4LBEB 3UJTH 4CQLB 1L4LA 2ODNA 1T2CA 4RGMC 1ELOA 1K0FA 1K08A 3HCNA 3K70C 1JKXA 3M6IA 5F7FA 5F8QC 1GHTA 3H8SA 1ZSHA 5F96L 4O5LH 4GM1A 4MRMB 1XDUA 2J9RA 4Y9SA 3GUTA 3SMVA 1NBCA 4GKOA 2VERN 2EWVA 3HABA 2FUCA 2O8FB 1KZGB 2DJIA 3NSXA 2WYIA 1VJDA 5JTWA 3A9WA 1FFPA 2UZ3A 4ZD3L 1BMTA 3LWNA 2SEBA 3RVLA 3OCWA 5TE7H 5EUOF 3VG0L 1JKJA 3GO4A 3VR5A 4PJ5E 5ACZA 4FQ1H 3UKJA 1YHPA 2GJSA 3O9VA 4EWLA 2ZUQC 2I6UA 2OC9A 4UE6A 1Q1JL 1WW8A 1VLVA 1IIKA 4G01B 5AM0A 4GRMB 1QLRB 1T43A 1OLSB 1N8ZB 2DLCX 1W0YT 1TO5A 3GLVA 2E5WA 2EIBA 4FCAA 2G9NA 4I1NB 1WJ3A 4JS0A 3O8QA 3F6PA 4DEXA 4PJFF 3BWUF 3MOBH 1V8OA 3ICCA 5DO9A 3W2DL 1M6OA 2OMWA 3U6XA 5HGBA 4JJ5B 4NPJA 3RJ9A 4Z5RB 3MLUL 4WI1A 1FLNA 1GQOA 2HI0A 3FT3B 2BF7A 4N5IX 3S36X 5AHOA 2YYYA 4G80A 4HPWA 2H4WA 5AI8A 2ZBGA 5BQPA 4OJEH 5EEHA 2XCQA 4GUQA 5F6IC 4KH9A 1ZC4A 1PSZA 3DVGA 4C7OA 1JIJA 5DUPL 2MRYA 3ILQC 1HLPA 2GI4A 1B6UA 4HB0A 4DDMA 4XO5A 1D9XA 1G7JA 1SGKA 2D03H 5CZKA 2Z91A 1JVNA 3P9NA 1H8OA 2GZAA 2F53B 3NJGA 3B6EA 3PF8A 4BO4A 4AP9A 4DSUA 2LU7A 3FB5A 2C2YA 4E9XA 4TMKA 1MAVA 5EUKB 3L92A 1P9OA 3HFGA 4GICA 4PV9B 2EAUA 3T9BA 3HBMA 3CLKA 4D6YA 3THXA 3B3QA 5SX5H 1PJBA 1DWOA 2ID9A 4GL4A 4CYMA 5I6XB 2JK1A 3MIZA 3DTXA 3PSHA 4HDIA 4O3UB 3N6VA 2ZRPA 2H4ZA 3CLFH 1TKRA 1ORQA 1AO7D 3QJFB 1Q1JH 3QYAA 4MMXB 2XT9A 3NIFF 1T3FB 1OM3H 3DUSA 4O02L 2XGJA 5A5GA 4RK0A 2HMSA 2GA9A 1JDSA 1F12A 1FX1A 1ACYH 5DCLA 4LL9A 1X7GA 2G7ZA 4LTNA 4YONB 1A9SA 1NONA 3HR5A 3AEKB 1W87A 1IGFH 4F2GA 3QJVB 2HK6A 2K6GA 2VK8A 1Q5PA 3A4LA 6AT1A 2F3PA 3P0IA 5JH7A 2YJ6A 3LKRB 1UA3A 4LWZA 3RSOA 4EG5A 5JANA 3U6BA 2BDTA 4MASA 5TSDA 2D13A 4PRBA 3FB8B 2FT7A 3U2SA 3LS5L 3BRWA 4PJEE 2F43B 1U3VA 3UJTL 3S8GB 1KXJA 3K9QO 3KXKA 4U3JB 3V7MA 4WWNA 1EUUA 4Z4QA 1T6BY 4I4TA 2Q07A 4TOYH 1CLOH 8PAZA 1KTVA 1VB5A 1K6MA 3HC4H 3W3BA 1DFGA 12E8H 2OLDA 4MOWA 3ULUH 2FUQA 4DK6A 1U8JA 3WRYA 3KTAA 4QVKA 3TPZA 1RIVL 1NCAL 4MD4A 1T9BA 1TD1A 4ABWA 2BNRE 5EEYA 3KYKH 3GMSA 3PCRB 4P2OC 2IH4A 4KKVA 2NXZB 3GRAA 4C1BA 4P4KA 3K70D 1YNLL 1KJIA 4GB9A 4LYJA 4P35A 1AZZC 5DRWA 3VA7A 1IBCA 4PSCA 4MPJA 5CMLA 4P3DB 3CS3A 2WVSA 5DYTA 2Z2JA 1QVRA 2DD8H 4NNOA 3ZK7A 2QSVA 3O8XA 2NY6D 3SPIA 1TXGA 1VFUA 4QY8A 1EX1A 1PV2A 1Z8NA 3FVRA 3M9XA 3DKIA 3HAEB 5D4HA 4PJ5D 3JATB 1TE2A 5JOQA 1WA2X 4PHFA 1HT2E 1DVZA 4PJHB 5KVFE 4WHMA 4N9OB 1XJQA 3R6TA 3B53X 4MPTA 4LSQH 3QF7A 1ERNA 5DT1H 3UJAA 1HKUA 2IZOA 2IV3A 4ZZ0A 2RH0A 2XWSA 4XBGA 3FT0A 2PYFA 1R50A 4QXTB 2ZX9A 1NATA 3PC3A 1DBKL 2QTWB 4LRNH 2BUBA 3QKUA 4KI5C 5AQEA 2WA2A 1ITZA 2A2QT 2PCJA 3JT0A 3H99A 1N5YH 2XB2A 1GZDA 3MRCA 3KMDA 3QWRA 4AQ1C 1FFRA 2I4IA 3O4LA 1VI2A 3QULB 5GMOA 3OTQA 3AVWA 3MRDA 4EY4A 4D3SA 3TKAA 1OD9A 3FU3A 4PBRA 5G0VA 4PCSA 1SCUB 3GMQB 3Q8FA 1U3HC 3FKJA 1A1SA 1Z5ZA 2WBJC 4DM3A 3MC0A 1T25A 1VBNA 4U2ZA 3I9IA 3EIEA 1QRAA 1W5EA 1XMIA 2QAIA 4NC1E 4AZ3B 1GJRA 3MYZA 5BYJA 1FORL 5LP6F 2FE1A 2AEPH 5EJ5A 3AJEA 3CFEA 4UAHA 2XICA 1VADB 1BPLB 3A1EA 1L7DA 3OKCA 3HG2A 5JDSB 1J99A 3K7EA 2O8EB 2HRPL 1ZL2A 3CK0L 4Y6GB 1NGZA 2DYPB 2YGVA 3HS9A 3WGHA 1V54B 3KB6A 4DXHA 3KJGA 2PDAA 5FFLA 3DM9B 1QCCA 2L7UA 2FLKA 4NCKA 4B81A 3QEHB 4P9MH 5DYYA 4LCYA 1XTZA 2CUTA 3B5GA 1VBFA 5GS3A 4PB0H 1KI6B 2VABA 1G2OA 1XEWX 1U3TA 1ICEA 1HQ4A 5HGGS 1K9SA 1IAOB 2G3XA 1TQHA 4MJ2A 5FW6A 3VRIB 3W06A 2VL5A 4DJFC 1VHJA 5IVHA 2FQXA 4PIPA 3OPZH 3VUAA 2V9QA 1TYRA 1M2HA 4OM1H 1NOJA 4GYYA 4U4BA 2H41A 4YV0A 1NBZA 4NFSA 4R7XA 4JQSA 4PW3A 3CFJB 1WAPA 2KI5A 4JJ6A 4GZ3A 1HH9B 1NXTA 3BE6A 4P38A 2EZ0C 3VGAC 3AERA 4RXUA 3X2FA 2SKCA 5GGTA 1LILA 2BLNA 3IUEA 4A6YH 4IKEA 2AKAB 1LQUA 5TY0A 3UQZA 3O91A 2XZLA 5IX8A 1BOGA 2J5BA 4JM0A 3HGMA 2J6IA 5DC9B 1NBQA 1KQFA 5FPKA 3V0HA 1R0WA 2HJWA 1U3CA 2F1IA 2F67A 1QVOB 2CXOA 4EN3D 3OEHD 2P8MB 2AQ8A 1DJWA 2A6DA 2COQA 4E7PA 4ETWA 2PL9A 1IONA 2XGSA 1VG8A 1VTKA 2A58A 4DR5B 5DYWA 1I82A 2ZWKA 3TW8B 3QZWB 3KXDA 2YXBA 1DNPA 2HPVA 3MNZB 4MKRA 5LBSA 4MVJD 4XCXA 4X6DF 4X6EB 2R2HA 2Z31D 1FNSH 2F62A 2APWA 2W6ID 4YT2A 4F9EA 4XD2A 3H4IA 4FZEL 1L3WA 4YYEA 2LU4A 2ZREA 3NTLA 3Q3VA 4JFHD 4FNLL 5K59F 2JSFA 4MB1A 2QUAA 1T6WA 2AQSA 2GD6A 3CDYA 1RK1A 1RRCA 4KNWA 2QJDA 3P3UA 4OI8A 1EWHA 2XKUA 4NI5A 3H4MA 2QDVA 2JCCF 1ZMOA 1GU0A 3H7BB 3ESYA 4N0YH 2YPKA 2G28A 1DQJB 3V4SA 1X9GA 4AP6A 2BZDA 4TSFD 3A6GA 3IDGA 1PX0A 4GNRA 2MINB 2DPGA 3EDMA 3MRJB 1PD0A 2KUTA 4RLQA 2P28A 5F77A 4M7LH 3LQ2A 3Q1SL 2CLRB 5IFHL 5FPPA 5FOVA 2QMEA 5EKTA 2WFLA 4CLDA 4QAMB 3DX3A 4RE6A 5IB3A 4QBIA 4PGJA 4LDEB 3QA9A 4YAIA 1BGXH 4BVAA 3CRRA 1J42A 3CXHK 2C98A 4I4TF 3UHPA 1WO8A 2DYPD 4BZ2H 4PIBA 5E2IA 1ZEJA 4ZCMA 3ASZA 3KAJA 1N2SA 2ROYA 4UU1A 3JZIA 4A66A 2HUPA 1MG3C 3GMOB 2VIRA 5EIVA 4M1EA 1S2DA 1ZVHA 2HUHA 2NOYA 2H2DA 1NXPA 3DVAB 3EMBA 2F15A 4XP4H 5D1XD 5AD0B 3BK1A 3F5DA 3SHQA 2ZWMA 4IHBA 3GEPA 2C9QA 4GBED 1CF2O 2ENUA 3COYA 4P7FA 3H42B 1ZVQA 3E9CA 1JF1B 1NCTA 4P54A 1A4AA 2OXCA 3BAFA 3QR1A 1D5BA 3F6RA 1QDUA 2D0PB 1DAEA 4Y4KB 2GIYA 4DGQA 1ZGLB 4L0QA 1ORRA 3WFCH 5J6GB 3Q5EA 4NYJQ 3FHQA 3BK7A 5MENA 3F05A 1CSEE 3PXLA 2VTDA 2UVDA 3CPLA 4L76A 4XH9B 3MCLL 1GA1A 3T04D 4PSDA 1VZIA 1YEIH 3R5KA 1A6UL 3WK4A 3CXDH 1EQUA 2P4AB 4PZ9A 1PG0A 4XX0B 1L4BA 4ZTEA 3REVB 4L08A 2X0RA 1JQ5A 4FQ2H 4RGVA 2BZ0A 1V48A 1BD2A 3LK7A 621PA 4G0VA 1WGOA 1V1MA 3BFXA 3ULKA 4WXPA 4ZFZB 2B0SH 1M33A 4WBNB 3OZFA 2QX8A 4J29A 1ZQ1A 3VAZA 4PLJD 5INCA 3D5OF 2VR5A 1RM4A 1DIHA 1KPVB 3BG5A 2B5IB 1WYJA 1KBKA 1OY1A 2XNDD 4J23A 3IR6A 1IQDB 1DSWA 5EQTA 4PFKA 1CC1S 4WN9B 2GAJA 2ADJA 2PYED 3GFOA 4ZTUB 4MYCA 2NY5H 2RHTA 3G0GA 1UWLA 5KYNA 4QRTB 5IW6B 1NGXB 4OU3A 5K5EA 4R1PA 5SV2A 2R1TB 4I9NA 4ROTA 2IWRA 2V8LA 5EI5A 4NH0A 1ODTC 3T8MA 1YOVB 3KHSA 2NLOA 4HC4A 4HQNA 4W4OA 3QWFA 5E8OB 2CKDA 4E1VA 4A8TA 3EE6A 4YJFB 1IFHH 2BZ7A 3MI6A 4ANKA 3OIGA 5C0ND 5LBVA 2LZ0A 3UV3A 1PZ5A 1C1EH 4NF2A 5JISA 2E55A 3ATBA 3Q13A 1O1YA 1S4IA 1XMOB 4OCXH 1UGNA 1FFNA 3EF0A 3AM1A 4NXKA 2HA3A 4L5FE 4ZFFA 4A0HA 2ARJA 3DTUB 3MU3A 3NT0A 4R97C 4TNWF 1BXGA 2GT1A 4G1UC 1UXSB 1T83A 3JAWB 1GZQA 5I1AB 5LGJB 1NIBA 1EV2E 3IDXH 1PJ8A 4LYAA 4MQEA 1DLHB 4WDIA 4JB9L 1Y7PA 1X2BA 2FP4B 1SXJE 3UTDA 3ROPA 5DLLA 2GJ6B 2WK2A 3E6HB 4WJ5A 3V5NA 1KCLA 2JKWA 2PCFB 3L7IA 4MLPA 2HRDA 3O31A 4RLFA 2CD7A 2V7QA 3HUJF 4LMQE 4QYMA 2JK5A 5DJ2B 4PNHA 2VHXA 5AOJA 4JNXA 5AHWA 1HGXA 1T9ZA 4PHCA 3RADC 5F9WB 3AY3A 4GBXD 5HJ5A 3TGXA 4OUDB 2QSCL 1YI1A 5E5RB 2R4SH 3WLEA 1RJZB 3FSWA 3OFKA 2LTQB 4O5AA 3STUA 3KQTA 3DBXB 2JLYA 1XK7A 4DG9A 3LX9A 1PZ2A 1AN0A 5EBLA 5JXWA 2YH2A 3IAPA 1SFDA 2RGRA 4G0YA 2M83A 3QJ5A 4HT1L 1JDBC 1OGAA 3A70A 4A26A 4TVPL 2GCGA 3HCBA 1RWQA 5IFAH 4TF4A 2BHFA 2UY6B 4B73A 1KS2A 2OMVB 3P9ZA 2OMNA 4RMGA 1TFRA 4FQ1L 1FN4A 2DBLL 4NX0A 1J2TA 1DKOA 1E6LA 5HILA 1W0VB 3ICQB 3P4YA 3R8QA 5J7CC 4NSNA 2CCWA 4FFMA 5HCNA 4OAQA 2HT3D 4AJEA 3HU3A 2J6WA 1C7SA 5HK9A 1FFDA 3GBML 3S3DB 1S02A 1YZUA 1X5JA 1X6VA 3E5NA 2HMTA 2KB0A 3ZOKA 2QYSA 3I04A 4DCSA 5BRAA 2WTPA 5H5JA 3NP4A 4DLRA 4WESB 1MFBH 1N3YA 2ODIA 3F47A 1SYSA 3TMYA 3N40P 1DVUA 5E3IA 2J7KA 1R37A 3EOAB 2V5RA 5K9KA 3USES 3BZFA 2VHEA 4UHKA 4KE7A 1F1GA 2MSCB 5HJ7A 2H4EA 3ESMA 4E9RA 1Z26A 2QORA 2G40A 2OXHA 3G8BA 5FNZA 5IBQA 3SK0A 1KSJA 5L4NA 5FUWA 2E1RA 5T3XE 3TNMB 3ZKQD 4CNIB 1CR6A 2O5NA 2QQ5A 2AV1A 5I74C 2W88A 3F04A 4KGVA 4L8FA 3K92A 4ME6A 3ETTA 4K3DH 1PFGA 3QO0B 1RZ3A 1UBFA 1CDJA 1Z37A 1BSVA 4HEPA 1J56A 1V41E 5JIQA 5BUPA 2WZBA 2A67A 1AX9A 2NZ9C 4GSDH 1ZIAA 1YPZF 4DIFA 2UZIL 2VO5A 2W37A 1GW6A 1NVFA 2XOXA 3S68A 1D5MA 1PFQA 4J03A 2OHVA 2DGDA 4A04A 2IPUG 1RT9A 4RJJA 2FIKB 2JLLA 3IQXA 3MA9H 1SBSH 3FH7A 3HKDA 1WD7A 4P59H 2JTYA 4YHNA 1GIGH 5D2NA 3L4CA 5LP6B 3EZFA 3TAUA 4DHEA 1MV8A 1YI0A 3OEHA 3RREA 2OBFA 5E1AA 5HNKA 4FP9A 1H0SA 2PO6D 1COZA 2GN8A 3HUJB 1TEGA 3GNSA 3CMGA 3L3JB 5ICXA 2AHRA 1JHXA 3N6YA 4FQLL 4FQXA 5CJQH 3STZA 1HDRA 1NJ2A 3BMOA 3BE8A 1OGTB 3D85B 1Z5LA 4LSSL 4JPSA 2FYYA 4UFNA 4NNJA 4EJSB 3WTUA 2PYIA 1F4VA 2FHFA 3D4NA 3K9GA 2N46A 5K8TA 1N19A 2E9IA 2IY8A 5EJGA 4WV3A 1KGSA 3GEDA 4EXKA 1L4EA 5CHYA 3TV3H 2H92A 2H17A 4TZ0A 3C8KB 2X44D 4NBVA 3DSNA 3AEUB 2F54E 1BZ8A 1CUWA 3CA8A 3VH8G 2NY2C 4EY8A 1OB5A 3ZKMD 1FVEB 1MN6A 3QIBA 1LP9F 4W99A 4DXAA 1OT1A 5E2TH 1GL4B 1K2DB 4MQSB 5I71C 4L4VD 3PT5A 4DP9X 2IYNA 3KSBC 2ANCA 3KPUA 4RL6A 4AGPA 3VNVA 3FSJX 4FXKC 3AJ9A 4ZPXA 1DQIA 5E2VL 4G09A 2BI8A 4ARSA 5BOPA 2ID5A 4EIZC 4HFNA 3SD7A 3KAQA 5DD3L 4HLZH 2PU7A 1RPKA 1Q15A 3OX8A 4O4LA 4TXMA 1N5RA 2DWPA 2BSAA 4J0CA 1TLLA 4G0OA 1TUPA 5B7EA 2Y77A 3QVKA 4NOLA 1PYOA 4C7KA 4RIIA 1AGCB 5FTKA 1KTCA 1W72H 3GRYA 4KZCA 1W52X 2HB0A 3LZFH 1NGPL 2EP5A 2O2EA 2MYPA 1GTG1 4YPOA 5JZ7C 3MLAA 3AY2A 1CS4C 2H52A 1EWKA 2Q3MA 1NZJA 4NUMA 3ULUC 5FJJA 1PYWA 1G8HA 1NRJB 5FL7A 4XWAA 1OPGL 2EDHA 1T2VA 3THWA 4YNYB 3TTSA 2QIPA 1X3LA 4RDIA 1NFQA 3NHUA 2ZUYA 3F9CA 4LYEA 2JLSA 3F7YA 3HR8A 1XF4A 4XPGL 5CGQB 2NSHA 3RNQB 4TNEA 1NBWB 3D1VA 3JQAB 2QZPA 5FEBA 4NIYE 1OZ0A 1Y1SA 3AGPA 4A2EA 4TKMA 4L2IA 1LBTA 2B2NA 1GZ7A 3BAJA 2YRFA 1BGWA 4DQOL 2R5WA 1J8VA 2G3MA 4DUWA 3UXMA 4P5KB 1WLYA 7ABPA 2KI6A 4KOAA 2CMDA 3K91A 3LT1A 3T0XA 2UX6A 4B40A 1S4MA 4PU0A 2BNRB 1IXSB 2X6RA 2O23A 1RK7A 2O3QA 1QP4A 3GHBL 1KXZA 1X8LA 3L5HA 2QPUA 1RWXA 4L3EA 2XN9A 3PFWO 5CA0F 2VDMH 4L8SA 5IMLB 2B4AA 5EOCJ 1KVSA 3L84A 1NMEA 1L0XA 3QO1B 3ENWA 4AG6A 3GJEA 5A0VA 4LHUG 2OD7A 3C60C 3WNKA 5ESXA 2J5LC 1X7XA 4UV7L 1U8ZA 5AW6B 1OYVA 2HJFA 1FP4A 4BV8A 1XPRA 1GPBA 1FGNL 1U8XX 4LXXA 5ADOH 1Q0RA 2YINC 2P68A 2GBFA 1E8WA 2F1HA 4IOIB 3W5SA 2O61A 5REQA 1USIA 3NJLA 5E9DB 2P49B 2Q2EB 2O50A 3S8EA 2R79A 2WLJA 4GI9A 2WB4A 3SDXE 5GGRB 3ZTDC 3HJCA 4RZSA 1KO8A 2UVPB 5IDXA 2EH8H 3V0AC 4UVDA 5HBGA 1NT2A 4OO3A 2VDWA 1KNOA 1FL3B 3HEBA 4PXAA 2CZCA 2ZOOA 3FO1A 4F7TA 2AJ3A 3AW5A 3SLGA 4IJTA 4E9LA 3D7MA 4WZBA 3UKDA 1OHHA 1KJMB 4X6BA 1CY6A 3G9QA 2HFFA 1UBLS 5A16A 2QLJA 2R0LL 3DFFA 2Q0SA 2OL3A 1ETZA 5F0PB 5GTDA 4QXUL 4NN6C 3DTVD 1E1QD 4OF5A 3DW1X 3FRPB 2NP7A 1ES9A 3TIDA 3TR5A 1I36A 3LGXA 5CZVL 3I9NA 4L7QA 1YPZA 2UZYB 1JI2A 3GCDA 2XXAA 4ZI7B 1FIGL 3EA0A 3QNUA 1P5RA 1PQPA 4R2GC 1QIJA 5AZ2L 4AJNA 3TLXA 3LL4A 4PRID 2WYOA 4C1NA 1KTLB 1WOMA 4XEUA 2DSNA 3UAOA 3IQDB 1AXSA 4U1JA 3PQ7A 4N8DA 3ZJUA 2JFNA 2ZCLL 4PPGA 3NM6B 1AUVA 1DG1G 5CR9A 5JPDA 3TIFA 2VEDA 5JS8A 3QJUB 2O5YL 2VITB 1IKOP 4HTAA 4JFHE 5C51B 1SM4A 4ZDKA 3PHOA 4B4WA 1DU4A 5HDQL 1Z4LA 2VAXA 3VW3L 3C2AL 1J5CA 5I8KL 2CGRL 3S88L 3BYTA 2EJVA 5EIBD 2P5WE 3K16A 2WVUA 3NCEB 2KJQA 2WKQA 3QHAA 1NAHA 1N3NB 1IEBB 4R4FL 2ICCA 15C8L 1EHLL 3EVGA 3HY3A 4RA6B 5H02A 3RM3A 3T9AA 1PR0A 4GBMA 2CCJA 2W4QA 3UBTA 3VPGA 1G7SA 2PKCA 3VKVA 5HQ3B 3ISWA 3GSWB 4HUUB 4GYBA 3IXAB 1RUQL 1X7ZA 1UBHS 4QOJA 1TT5B 3ILQD 3BIXA 3IMCA 2BMKB 4IIGA 1T0MA 4S1DC 5FYLL 4LRTB 4KHZA 1D6VH 2CJPA 1OXKB 1BX3A 1WG8A 4BWUA 3MMEA 5FOSA 3EDDA 3M0EA 2VG8A 1ZJ4A 4PR0A 2HYMA 4L05A 3EO1B 5AZEL 1XAGA 1FFOA 4YI5A 5CU5A 4BQCA 4UQ9A 1L8AA 3OAYK 4JX9A 3IM1A 4MV8A 3MGOA 4MWCA 2YN2A 1M7UA 3ZDYF 3DYMA 3GLFE 3OKEB 3OY7A 3RWHB 5HBBA 4N9WA 5ESRA 1NMBH 5D6CA 2GD2A 4L1HA 1OI2A 2O72A 4PLGA 3F84A 4IJVA 3OC0A 3ZY3A 1XXDC 3ANYB 2EJTA 4GEGA 1WZLA 2DM2A 4YUEL 2XZDA 2NACA 3NESA 2BDNH 4JX0A 3AH8A 4F4CA 3LP5A 5CIYA 3AUWB 1YA8A 1IQ0A 4NRXA 2GM4A 4JKNA 3B1JA 4H35A 2R6GA 4LVHB 1ECJA 3F7OA 4MVYA 4NT6B 4MHTA 1U4NA 3A4YA 6FABH 1SPXA 4L29B 5T1KB 2Y3IA 2JCVA 2HLEB 4IBSA 4FWWA 2PS0A 2G3ZA 4Z3DA 1BGVA 3OTWA 1R5VB 4M1WA 4OTXH 5FTJA 2CHZA 4G1EB 1J8FA 1JH8A 4KCGA 2Z31C 1AO7E 3HS0C 4OVKA 2UXFA 2DN7A 4DANA 1G8KA 4HUJA 2XN0A 5IHWA 3GZPA 4S3MA 2YUVA 3OQ1A 2JXMB 4XP9H 4ZJ9A 4LLYB 4NNYA 4CEHB 2NSDA 1IM5A 1VPLA 4ENVA 3HVJA 4XIGS 3MRVA 5T4BA 2G7MC 2B3IA 1O6SA 3CJRA 1NAMH 5SY9A 2MPAL 3CZ4A 4B7LA 1H6DA 1SEPA 2NO1A 1QFOA 2FD6L 3R7DA 4QD3A 4XUCA 5F98A 1SJEB 1BN7A 1SRQA 5CVVA 3L82B 2VF8A 2CLLB 5JNWA 2BIHA 2VE6B 4PRYA 5BOVA 2MFNA 5D55A 2ATAA 1JEYA 2WG2A 3JY6A 2C4XA 1ULSA 1CQXA 3MWLA 3LV3A 1JDVA 2YYSA 1Q2XA 5IW1B 3C2AH 5GAJA 5AW3B 1WEHA 1SKAA 3HE7B 4LY0A 2WGNB 2WWIA 5HVHC 3CVBA 1ODUA 4OGXH 4ON9A 5AKXA 1Z4NA 4BNTA 3L01A 1XGQB 2DWYA 4RBNA 2I8LA 1QG3A 5AYTA 1WEKA 1JYNA 5T41A 2DTEA 3OZCA 1TNNA 5IQOA 5HZMA 1RVFH 1JK8B 2EACA 2G9UA 1PSKL 1EH9A 4RMVA 5EZLA 1B4JL 1ONSA 4MQFB 2FG5A 1DQNA 4Q1AA 3ARGD 4ESEA 3H9SB 2QQ0A 2O4EA 3ARGB 3NRBA 5FPSA 2IWFA 1QR6A 4GINA 1DEKA 1URIA 1T1RA 3RWCB 2D1RA 2XMSA 3TS1A 1AT1A 1EJ8A 3CZ9A 2H4XA 2Y0PA 5EP3A 4NONA 1YXMA 5JTTA 4HXYA 1DC6A 4ZUSB 4V38A 4DMUB 4WI4A 2Y9PB 3KTFA 3RJ5A 3LKPB 2H1CA 1T7ZA 2WJ4A 4HIXH 3LU1A 3FCGA 2AXQA 4KI1A 2BD0A 5HUHA 1DJOA 4KXYA 4LLMA 1J9EA 1NCNA 3VFGH 2WQUA 3QRGH 2Q4TA 3OLDA 2PJRA 4JFXB 3Q6FA 1N7GA 3BXXA 2FWOA 4EBQL 3TTWA 4CU8A 3TLMA 4AMUA 1JR3D 5DEGA 4KQMA 3PNQA 4YOKA 3G49A 3FDXA 3GX1A 4FE4A 3GN2A 1JHRA 3A6CL 1IM3B 3ABLB 3GXTA 1JBJA 3QQPA 4BFXA 1P6AB 3FYUB 3WCYA 1W4LA 3FCSB 5I5IA 4ZXFA 3N43F 2VP2A 4NI3A 4KTVE 3V9AA 3O6ML 2DQTL 3RE1A 3VNAA 3SDSA 3IGFA 1NAML 2E1PA 4RY0A 5BSMA 2CXSA 4KGDA 1WD5A 5D1XA 1JWMA 3QDGA 4RSRA 4OK5A 5FYJE 4M5TA 2AJSL 4OD3L 4QAWA 5KYXB 3LKNA 1WA1X 2WUWE 3RJMA 4O51A 3PR3A 4B9AA 3TO4D 1W16A 3AUAA 1R0CA 5EMNA 4FFOA 2BX5A 3PWVB 1RQPA 3A3PA 1OSNA 1BOYA 1PL3A 2JAPA 2W92A 3HEAA 1DV1A 5A62A 4OCNC 2VQFB 1OHZA 2QSQA 1P29A 1IBMB 4JFFA 4B60A 1JS4A 5FCUH 1ZLSH 1KB9K 4JQVC 2YY6A 5KNBA 2P4EA 4E9SA 2O7VA 3LLMA 1T7XA 5BZXA 1B8NA 3QDMB 3MWKA 2NW3A 1Y3DE 2VQ1B 3OL2B 1G8PA 9ATCA 1YC7A 5TK4A 1ZICA 5IB1A 3K1YA 4CKEA 3N8HA 3RAFC 4OB5L 1FE8L 1C3VA 2VN5A 2ZR9A 4IHKA 5HOQA 4MSWA 4P4LA 1KORA 2C59A 5ITBH 2VQDA 1O03A 2HIAA 3DX7A 1U8MB 5JHDA 1SEBA 1CQPA 1IMJA 3KJIA 3PC8A 3REFA 3A4EA 2ZTUA 4QPPA 4OCMC 1G9XA 1UM5H 4PJIE 4OAWB 4MSUA 2M6LA 4BFOA 1XZ0B 1SN7A 4YCBA 4LEOA 5CB8A 2EYSA 3OJ2C 3NBAA 3JYBA 3VXUB 5C5DA 4U6YA 3V6OA 1S9XA 3SDAD 4ZA2A 4LJ5A 5BS0E 3K0HA 2DTML 2C8NA 5KPJA 3EDFA 1DP4A 5I1GH 5CLXA 2WR8A 5CWSB 2EP8A 3EUFA 2C3HA 3C6LA 3NK3A 3D4BA 1VSUA 1N8SA 3LQAC 4ZARA 4APQD 2X4SB 1Y4SA 4XVTL 3SQOH 3V7AE 1AXGA 1G0DA 4MKTA 1RAGA 1U1IA 3PC4A 1F1JA 2FGJA 4XCVA 4YH6A 1J8HB 2AMFA 4DUGA 2JFOA 1WPQA 4GKZA 3QRFM 5KTEH 1XCQA 2VK1A 1JLLA 1HH4A 4PAWA 3FI0A 4URKA 3NRQA 3SN6N 4HULB 1XBRA 3R0MA 2EJ1A 5GZND 1Y0BA 4BB6A 2OD2A 4KYUA 2OC4A 1RUAH 3UJ9A 4OF3A 3P2BA 2ONCA 5B7PA 1G291 1ULAA 1V7ZA 4MV0A 3H0TB 4MMYA 3N43B 1NVMB 5F70A 4NS1A 4WEEA 4PJDA 3RK0A 4KO7A 2VXQA 4PS1A 4M6OH 3B36A 2FFRA 1T4GA 2JAWA 3EYVA 5AKZA 2FZ3B 1O8CA 4M1GH 5C0FB 1CG9B 2R85A 4R9RA 3B1VA 2BFWA 3WL6A 5AW9A 3SG0A 1FBIL 3X1JA 4EECA 4G7VH 1Q11A 4DWJA 3GSXA 3HLKA 3C16C 5F7DA 5CP7A 3H1ZA 1DSFL 5FV1L 1XH3A 3H6AA 4UOJA 5PNTA 5HKBA 3KYOB 2QHXA 5FYDA 1IM2A 4F2MA 1X1SA 4S2SA 5HIJA 2F18A 5CJXC 5I7EA 4QTTB 4OLZH 5D1QC 3WLPA 1NANI 1ZAYA 3U37A 1GYCA 4WH0A 3GO1H 1KDZA 2RHRA 5E00A 1E60A 1DJLA 1XQXA 1GCYA 1VA9A 1TZMA 1CR0A 5T1JA 1SM3L 1CKEA 3C24A 3CFQA 2FW7A 4P3PA 5DTJA 1HLFA 2V55B 4N82A 2C99A 4R5XA 3R24A 2XOKD 1C5KA 1O7JA 3KZCA 1YNKH 4J6FA 3I2FA 1Y3HA 3DTVB 3HDHA 3V6ZA 4GY4A 3LFUA 4QYXA 1W9HA 3ZTTA 3L4XA 2RHEA 1BW8A 3M5WA 1XGUA 4D9MA 1N7IA 3MLZH 2CMRL 2PT9A 2R5FA 3H2ZA 3ZQ6A 4ZV4A 4DP6X 2ZR0A 1D2AA 1FH5L 3LVEA 4NZRL 3QXVA 3K20A 4KC0A 2KPOA 5H81A 3BUQA 4CODB 3JWNG 5JO0A 4K03A 2YBGA 2PV7A 3VDMA 3GMPA 3LZLA 4G6MH 1KLGB 2ZQYA 3KZ1E 4AG5A 3PHSA 1V05A 2ISDA 3DOHA 1Q0HA 4FHCA 2ICES 1JMZA 1CU4L 2NY3B 2ODAA 1FGNH 1E9VA 5BRZB 5C6TH 5ADOL 1A8QA 3EYWA 2Y1EA 3NSJA 4RD3A 2E56A 4HISA 1TU3A 1Q1ZA 2WYZA 2GBTA 4HSQA 1EFRD 1UBOS 2J9ZB 4OQZA 4OYYA 3KEFA 5E1OA 4LC0A 3ALPA 3KIPA 4IKIA 1U28A 4BK5C 3MHZA 2I78A 3GFPA 4TV9B 1HTBA 3T3EA 2YZ7A 3VZCA 4MS1B 4JWKA 4YCNA 4Z0NA 2IBZY 3HG1B 4M7LT 3EGVA 3NP7A 3AGQA 1KTKE 1Y3AA 2EZUA 4JKOA 4PCTA 1QGOA 2UUBB 1HE3A 1D7FA 1TMOA 2ZJZA 4PJIF 2PRZA 4ZIRB 2KYIA 2K78A 4XP9L 3OAZH 2PANA 3OHPA 5T5NG 3JWDC 3IULA 3NT5A 3AY7A 1A7QL 2PYEE 4DYVA 4ANWA 1DUVG 2C4FU 5C37A 2PYEB 4B3EA 5AVOA 1P7CA 1J1OH 2XA8H 1GAJA 2HA4A 1FLVA 1IZYA 2EJUA 1MFAL 3BHMA 3ZV7A 4PYJA 5EPOA 2JTDA 2LDBA 1TYEB 1I51A 1K6XA 2F5BL 1A27A 3OMNB 2IXGA 5CIWA 3G8DA 4CBZA 1CZNA 3S4SG 4EIGB 3X44A 1JA9A 4BSWB 2UUAB 1E7RA 2J4WL 2D0OB 4F1JA 5D7JD 4Q3EA 2BW0A 1KS9A 2PS9A 1J1ZA 3QJYA 5LP1A 3GEIA 4JFUA 3KOMA 3SOTA 4K6HA 4X4ME 1M6NA 3PJNA 4UNIA 5JQIB 1VLMA 1HZHL 1JPSH 3DGCR 5GWXA 1JHYA 1JZJA 4MNGB 1TA9A 2WU1A 2XIJA 4AEIL 2XG5A 1TLFA 4O02B 1TT7A 1CUEA 3ZE8A 2NMSA 4XBEL 4HIJB 1LDBA 3N58A 1N2CB 2E89A 2IOQA 1SJHA 3OUZA 1R5NA 2XN2A 3LTEA 1X1QA 2NY6C 2WF9A 4MDEA 4WEBH 2C7BA 4IS2A 4RGYA 2GHZA 4LPXA 1KR2A 1TQTA 4NULA 2O6HA 4Y2VA 1SOKA 1ODCA 1OHHD 1VL0A 2EEFA 1V7MH 5K20A 5JQGA 5FO9A 3HMXL 1OC4A 5IM7B 2NIPA 4OLXL 4FI3F 1A7UA 4OKIA 3IA2A 3SO3C 4UU8A 2V1XA 1PYDA 4HMDA 4XP1L 3MJTA 4MRSA 3DZHA 3FJ1A 4K5MA 2GN1A 1OZAA 4QNNA 1UM6H 2F8TA 4DZBA 1ZM3A 1NUFA 4OYHA 3II2A 4QHYA 2ODEA 4UVIA 3QVXA 4FJ1A 3DFMA 1BFSA 2B8OT 5K9ZA 2DHDA 3TMKA 3RWIA 2JJQA 1JR6A 4MGZR 2IAMA 5TIIA 2NXCA 1POWA 3LLCA 5FUOL 1FDTA 1N0VC 3BCSA 3L9WA 3V97A 5J4KA 1DQTA 2IAMD 2HY7A 3TV8A 1F9AA 3Q48A 3VI4A 2QGCA 5T4HA 3A04A 3M4XA 2JBHA 3VXUE 5F2EA 3ACDA 1NVBA 1QVVA 5AKVA 2VZEA 1GQYA 2WHRA 2QRMA 4U6NA 2H9AA 2VDPB 2B4YA 4CCSA 2PABA 4RH3A 2IG2L 1INLA 1MTOA 3D4GA 2GR9A 1UQRA 2XNAB 3VRLF 4GEIA 4X4ZA 1G5AA 5T3ZE 3LGAA 5BW7A 2YEVB 2H2PD 1R0AH 3W0WD 3Q6MA 3DRTA 4BFZA 4HRYA 4JH0A 3RV4A 3GLAA 1KRXA 4K5QA 5I45A 3GP3A 1HG0A 5F33A 2W59A 4BVLA 3FPEA 4MKGA 1UPCA 4ZTBA 4XP6H 2R1YB 1G5QA 5HI4C 4RTKA 2GPYA 3LKOA 3DJZA 1MX5A 4MV1A 1UB5B 1GTZA 3OG4B 3FCBA 2AOTB 2IPLA 4APXB 3MGTA 4ZAKC 4QCIA 4WVLA 2GY5A 3W04A 3BCHA 3FHLA 2PUFA 4X8JA 2BXZA 3NPSC 4KNUA 4RZCB 3X43A 2R15A 1G55A 3X3HA 2WLIB 2LPMA 5C0RH 5AYQA 3O3BB 4MD0B 4XGZB 3JPWA 3TZVA 2Z64C 1Z83A 1YB1A 1VBKA 5F7JA 3TO2A 1Y8RA 3C3JA 5I17A 1FAIH 2RFXB 2J3HA 3EHBC 3RAJA 5FGBA 2JELH 5E1QA 1SB9A 2WXOA 1CFSA 1PD1A 1OH8A 4Q6KA 2WXGA 5HZHA 4B3RB 4Y9GA 1I24A 3PC2A 2EATA 2EC9U 1JT9A 3RUAA 3H85A 4GP9A 3HBZA 4Y9RA 1E6MA 3LEXB 5HUQA 3APNA 4Y2SA 2GFBB 3UOGA 3V0EA 1IYZA 3ZE9A 1KC3A 3ZHNA 4CRPA 1C29B 1A25A 4IDEA 2P4SA 3CSUA 5A3VA 4QHNB 1PT9A 5I1JL 4UEJA 5C0OE 3S4SA 3GOQA 4YRNA 1GFSA 2FLWA 4DV1B 1OV4A 2OI9C 4K94C 4IDNA 4ZNCD 2HWXA 3ZL4H 4GG6B 5CJ2A 3ERCA 4UOQA 1PRYA 2YZGA 1O9ZA 4CC0A 3L9BA 1M57B 2NO0A 3SC4A 5IQMA 4GLLA 3HPLB 5AOVA 5MN4A 1J0YA 4OZFG 4WK4B 1QDLB 4ZZ1A 5HGHA 2C0QA 4JO1H 4K7FA 1N77A 1XC7A 1EVYA 1NI4B 3L5IA 2SECE 2CUAA 1IAQA 4L4XA 1DINA 4LCCB 2BI7A 2Y71A 3QQ3B 3B34A 5JCOC 4LV5B 1YC5A 4TT3A 5T3UA 1ADQH 4IOLA 5G40A 3QVLA 3ENNA 3ENZA 4CBVA 2IP2A 2P2ZA 4OQYA 2H1PH 3ZMEA 5ICMA 5MEND 4KQJA 2O6PA 4CGTA 1Z6JT 4DQOH 4BMVA 3O3UN 1BE8A 3ER9A 3DHPA 1P4HA 4D3XA 4Q24A 4YHKH 2PZAA 3DAFA 2CBZA 1R3HB 2ZVJA 2NNFA 2ZCUA 4XR8C 1HQRA 2D3NA 1HFJA 5FM8A 4Q1BA 3MCKB 1DQQA 1Y6FA 3SPVB 1VKXB 4NPYA 4DRYA 1VFPA 4YX2L 3CTMA 3X1YA 4A2GA 4PS4L 4GE0A 2PJUA 2HSZA 3FNQA 1YWGO 4Z3TA 2FH5B 1OQAA 3LC0A 4B96A 3E3OA 3QDJB 3QLUC 4DY4A 3VFRB 3P1JA 3GDBA 4YMWA 1QK3A 3WS3A 2X0JA 4MP6A 4TMWA 3R8BB 4J39A 1SQ0A 1OXMA 5TXGA 1YTUA 5IK2D 2EUXA 5DMHA 2J4DA 4AQZA 3UW3A 1ZVYA 3VQTA 3O7MA 5EIIG 1BQ5A 1RHRA 4B53A 3DZKA 3A05A 1UT1A 1E67A 3ECSA 4CEIA 3GPEA 3GYGA 2P43B 2ZCKL 5CVJA 5K2OA 4E5XG 4U31A 4TS4A 2ZU0C 4C5CA 3LS4L 1BX2B 2EXSA 4JR0A 1WAEA 4RPGA 4MRCA 4F8JA 1HL5A 4TLLB 4POZD 4F3YA 5KC9A 5CLQA 2ZT9C 3C5JA 3ZYOA 1CL7L 2E74C 3OZTA 3QXXA 3U0BA 3TMAA 3S0JA 2JAQA 5EIHA 1T26A 4UDNA 3DS8A 1YN6A 2P91A 2KS0A 3WN5C 3T5DA 1EHKB 4ONFL 3CGGA 3GVCA 1QI3A 5EWMA 4LK3A 4BKTC 4YZWA 5JA9A 1JXKA 3UAYA 2JI4A 2CDEA 1FZMB 2EYUA 2FLRT 4ZQHA 2YOAA 1BHJA 2O5VA 4A2WA 1SVOA 2H2SD 1S2LA 5FHAH 1X9QA 1XCGB 2GAZA 3V3KA 3WA6A 1S5HA 3PGDA 1BZ9B 5DJ6A 2UZAA 2AXFB 3VI3F 1Q4NX 3VVBA 5EEWA 1PLKA 5TQ0A 3KNZA 3SC3A 5G1PA 2PRJA 1XA3A 1OX4A 2IHBA 2G04A 3GMDA 1U1EA 3QHZH 1LFDB 5HYVA 4Z0TA 2QU8A 5B39G 1MW9X 5C3TA 4HLEA 3BRFA 1H9AA 3C5SB 1I2AA 1CE8A 1Z5GA 2WM3A 8LDHA 5I1KH 5CNKA 2OSLB 3IAS6 3N0PB 1O2DA 2GVDC 2DIBA 4BFBD 5FLKA 1NF3A 1SO8A 2PP9A 2QADD 5FYQA 2GNAA 4M1SA 3PTLA 4P92A 4XNQB 2F0CA 5TB5A 5JIKA 1OTUD 4G63A 4NE9A 2VZ9A 2DI9A 1U81A 3OMIB 4GSYA 2WB7A 2J09A 4K73A 2HRHA 2WP8J 2WC7A 3N85H 1XCOA 3KR9A 1E1QA 3FS9A 2V5MA 1L9NA 2JAUA 4ZX5A 2AJXH 2AJYH 1XXHA 4FNOA 1KFKB 1PX3A 3GU3A 2YSSB 3ZK0A 5SX5K 2X1HA 4LFHG 3LCCA 3PHQB 3I58A 2ATIA 1RC0A 4NE7A 3OZXA 1FZJB 3DOEA 2Y1VA 3E1GA 3BJIC 2KBGA 4N24A 5E6ID 4D0DB 1N7JA 2WPGA 1D2HA 1UWKA 5AHKA 2X3AA 1KC1A 2A9VA 1YS1X 3AL3A 3EG9A 4K3VA 3FU6A 2K7ZA 3MS2A 2RH9B 1AGDB 1E4OA 4PJCF 4R16A 1VC2A 1SUCA 1QG2A 1WTLA 4P23D 1SBYA 1QRDA 1NPNA 2ADFH 1P1ZA 1W29A 2VP0A 4LHUB 1AGYA 1M7HA 2ZE5A 4U4AA 3WGYA 3NFYA 1X3DA 5J9PA 1E9CA 3V6MA 4JFDE 2PT7A 3QR0A 1RZ8A 2C58A 3MREA 2QD2A 2V7WA 3D6FA 3V8QA 3C60B 4AM0A 3FCTA 5EORL 3I85A 4QRRE 2WLTA 2RAMA 3AX6A 4LYHA 2NYYC 3BGMB 1ECZA 2R8SL 3LS4H 1XRNA 4Q0XH 2V17L 4BHUI 3VQ1C 1L1QA 3SFTA 4APQA 5CDFA 1YEGH 1K06A 2RE8A 1M1NA 2RJ3A 4MVJI 3L0CA 5DNWA 2YQ4A 4KKZA 1NKTA 4NB7A 1U7XA 1CC3A 3ATFA 5E7MA 2AVFA 4G9FB 3R74A 4ZHQA 2XV2A 4QG3A 1IL1A 3H2BA 2FR4A 3WWOA 3LTVA 2BY3A 1LTXA 4BE9A 5HVNA 3VPSA 1VYUA 6YASA 3E35A 2VNIA 5B3AA 3WBKA 2OPBA 3U82B 1H8LA 1WJGA 2H1SA 3FB7B 4POZC 3HB1A 4BHTA 1HHIA 4PRHE 2PD4A 3GLIB 4XH2B 5A3IC 2FW6A 1WDTA 4NO2B 3IWUA 2DIJA 1XDDA 4EK9A 4HOYA 4Y2OB 1H4VB 3CZQA 1D07A 5C09A 1DAGA 2OXGA 3SQDA 2AEMA 3HN2A 3ADPA 2XLCA 2YN0A 2NUBA 2O2SA 3KYDB 1E3WB 1FG2A 1FMCA 2IVZA 3WR5A 1IHXA 1MB9A 5C1MB 3DEAA 3TCTA 721PA 4JDZA 3L49A 4LKCA 3TEMA 1RAFA 2JG3A 4PN6A 1GSKA 4CDNA 3ZE0E 2OCXA 1C4WA 4NKOB 5I8OH 1OOAA 1UC9A 1UACH 3VXKA 5FULA 2ZRAA 3JQFA 1UXWA 5FX2A 4EFMA 1DO6A 3APCA 2HH0H 1YYLH 3UYPA 3MO1B 1D4AA 4BMNA 2QMHA 3X1ZA 4G0PA 2D8MA 3FCCA 2R1WB 5I5RA 3A6DA 4JFWA 2Q3AA 4OKDA 3L5XL 2W0FB 5D2LB 1U1FA 1I1AD 2JBWA 1JAZA 3LB6D 3L8DA 3SPJA 5CLIA 2HMVA 4WV1A 3AQ4A 3EHDA 5LM3A 4E31A 4FZ3A 4M37A 2BOLA 1PJ9A 3LZDA 4OGKA 2ZVPX 2VH1A 5CPBA 2AEPL 2QV0A 1CJBA 4ONEA 5ALCL 3UTQA 3DV0B 1IATA 2Z5GA 2A6PA 2RHHA 2OXRA 5J43A 3DQZA 1SIWA 5FPIA 4MLDA 4R71A 5ABZA 2VJMB 3HJRA 2N59A 1DLIA 3CEPB 2V7EA 2Z2KA 1BZYA 1YF3A 5A7HA 4DT2A 1E1CA 3GM8A 3BD7A 3JYHA 5CM1A 3VR4A 1R00A 1SYVB 4AYWA 5J89A 4BMYA 3KWJA 5IWAB 1OAZL 2E82A 3NYIA 1KGWA 3FSRA 3ZMNA 4HZLB 1HZKA 2H1RA 1QSEA 1OF2B 2NUTA 4REQA 4ZXBA 4QDUA 3E8XA 3TSAA 1XVIA 2A1TS 4D46A 3ZQWA 1C0PA 1XRMA 3DF9A 5I30L 4B79A 1II4E 3LXXA 3IR7A 2J6CA 1AANA 2GPJA 3V7YA 5JDCC 4MS4A 2MQ3A 2F1KA 1I1AB 4NIMA 3PS6A 3MKGA 5F6IB 1NVUQ 2PV0A 2ZPTX 4PEVA 5A03A 5MEQA 1Z5HA 2H6OA 2YJLA 1EX7A 3JBG7 1ORIA 3LZCA 3WTVA 2H45A 3EVEA 3PFQA 1VLHA 2JJUA 3DE6X 3DDOA 2EXXA 1M05A 2BP0A 3R7AA 1YY8A 1UWEL 1OGAE 1BD4A 3DP9A 2MIZA 3WL9A 4L51A 2G76A 4I85A 4TXNA 2XN9D 3MLYH 4MA8H 1MCKA 3VAEA 4NBUA 4AOFA 3Q6GH 3DMMC 4HUQB 5SX4H 2J21A 3OEWA 3TLGA 5I9NA 1GJIA 1CN4A 2Y1GA 1LI7A 3T4PA 5IEKB 4R9UC 2WFMA 1J49A 2FZVA 1SUAA 5CX4A 3TL2A 1OBVA 1N7ML 4HHAA 3KAKA 4OQLA 2FWNA 4CJXA 1NM5A 5GV8A 4L37B 1N18A 2A9QA 4OBRA 4IQGA 3QKTA 2X58A 4FSXA 1X5MA 3QXJA 2JFFA 4BZXA 2WHVA 2DLTA 4DBLE 3I6IA 1RCUA 3DCJA 3TBKA 3DJFA 4P46A 1YC2A 4Y98A 1DBIA 1RJLA 2LU5A 5ALWA 5CT5A 3ZUNC 1OSYA 1B2LA 4DW2H 1P3JA 2VR4A 2WU4A 2DJUA 5AM3A 1OAOC 5DQDL 1JI3A 4E41D 2ADYA 3A6FA 3GMIA 4OCZA 4DMRA 3IDYC 4JFPA 2VP6A 1IGFL 3PNRB 2VDNB 4FCHA 5CX1B 3R75A 1HF3A 4JY6A 3I5AA 3WK8A 4AEHL 4M38A 3A32A 2GK0B 1PL6A 3C3YA 3L3KB 5AVUA 2R87A 4FNLH 2C7PA 4LL1A 2EXYC 4LYFA 1AO7B 3S35X 1A3CA 3RS9A 3BVVA 1E5BA 4QXMA 2BC9A 1FDUA 3D7LA 4BA8A 3VU9B 5JXEC 1DIRA 3UC9A 3FN0H 1Y1QA 3F58H 1Z7JA 3V3TA 4TPKA 1LO5B 4WQOA 3BP7A 5BV0A 4J3OF 5AK3A 3VR5D 4FHDA 2O7RA 2ZONA 2QNIA 4WW2A 2NXZC 5IT9A 4JR9H 5SWZA 2QSZA 4AZUA 5I0WA 1JXJA 3HBAA 4Y1RA 3FONB 1KFEB 1GZ3A 5AI9A 3Q8WA 2V3DA 4JY7A 3OE1A 5LYJF 2WP3O 4DAGL 4WUKH 2IZ7A 2ZG1A 3A4NA 1JNHB 1N0WA 4BO0A 3RTQB 4FHKA 1QP7A 4HAGA 4E15A 1ZMBA 1XZBA 4D02A 4DVBA 2WW8A 4ACBA 1QFWI 3M45A 4G7YH 1OLOA 4JLWA 3QUZA 3GZNA 3KL4A 2I3DA 2R68A 3VHLB 3PG5A 5FUQA 1A4BA 2P52A 2QL6A 3CV3A 3DMGA 2WE8A 4W6XB 1KU6A 5EB9A 1O57A 4Z0BL 2DPYA 1TW2A 3GLTA 3WK7A 3RVQA 1VL2A 4QHLB 2C2OA 5IKOA 4ZEVA 4M8IA 5DLEA 5FA4B 2IUEA 2P9CA 1JWLA 4MDIA 2QLLA 1HTYA 1YRLA 1HI6B 3V9EA 2VDKL 3P96A 5H4ZA 4L8YA 3PJSA 5B7MA 3PWTA 4NP9A 4IBOA 3NG5A 5CNMA 4WACA 4QRFA 3U2QA 4RD0A 3SDAA 3EKCA 4OH2A 1FJ1A 1XELA 1FWXA 3D6VA 4KFZC 3QYJA 2ZP1A 2FI1A 2VYND 4XX5A 3K0SA 1DC4A 2B4QA 4HKJB 5DZNA 1GC1C 1R4XA 4YI3A 1BFTA 3L3HA 1ZCRA 2XZAH 1ACJA 4MAZA 3TV3L 1W46A 4CCYA 5KX5A 5F0MB 1IH8A 3GWJA 2AK4D 2WXPA 1LEIB 1UM4H 2R8XA 5GZ3A 5F9AC 4BQPA 5CFMA 4GX0A 2J41A 1M7BA 5BRNA 2FDRA 5J06A 3IUSA 3KYMA 5D4IA 4KE8A 4X50A 1T2FA 2VK4A 4M56A 4G4SO 3S5JA 2O06A 2F7RA 2M32A 1JHKL 3MJDA 2PKYX 4NLHA 3ECBB 1C3EA 1G9EA 4J8QA 2W2XA 1IAIH 1CJSA 3MQFA 3GARA 1KJ2A 3RUIA 1MCFA 5C4IA 4EG0A 3UBXI 1E5DA 4FYMA 2XKBA 1M8KA 3ZVLA 2G4CA 5F3HB 3BERA 4P0DA 5DDHB 1QK5A 4H3KB 1YUBA 2GDJA 5G2NA 1L5GA 2AOXA 3F6BX 4ZDJA 1KKLA 3NEOA 3OHMB 3PZBA 5F23A 5IMMA 5DH9A 3SYOA 1P2CA 1KLUA 2A1IA 1UZUA 5JSUA 4KRXA 2IANB 2PWHA 3UABA 3BKMH 1EFPA 2YQGA 5SV4A 2VDLH 1RJFA 3ZIUA 2XZCL 4N5UA 5LO7A 1NVTA 5DSXA 4AT6A 4Z1PA 5EFOA 1OFUA 3AVPA 1WQVT 1IUOA 3U0PA 4RH1A 3RFVA 3BM5A 5SZIA 2RKWA 5IMSA 1Y5MA 1TJYA 2JFXA 3RGVA 4FOOA 2QKSA 3TFOA 4DPBX 1H1LA 1XD1A 5GSRA 4R2IA 4Y4HA 3ZVVA 4GC9A 2QE6A 5F1PA 4M8LA 3UK0A 1A6TB 5JIHA 1R3LA 2DH3A 2HLAB 4IHJB 4FGMA 3D25B 4F7DA 3ETSA 5J1TB 3SBXA 3Q44A 2FG6C 4HBGA 1C12B 5LMCA 1TG8A 1KDYA 5JVDB 1D1QA 2ZBFA 1G5PA 2Y6SD 4RIGA 1QR1A 3QAZB 2VXOA 1QWNA 4EYGA 3GK8L 2NUPA 4X3OA 2JLUA 3F12A 4KROD 4WLEA 2GS9A 1JNXX 3WDKA 1UCTA 3BP4A 3LIIA 4M1ZA 3R2JA 4Y2YA 1VB3A 3N3AC 1DARA 1GO2A 5CGTA 5KJ7E 3R5TA 2LW7A 2D5BA 1KN2L 4KWUA 5AIBA 4WBSA 3P2KA 5JXJA 2RHBA 3R18A 1MB0A 2AEEA 2JLPA 1FVDB 5B39A 1JPFB 5K99A 4MQ7B 4O2CB 4OCWH 1XEDA 4U1IB 1DI0A 4EG8A 3HUUA 1DCLA 3K4DA 5FO8B 5LZ5A 4CT5A 4AUEA 3MRFA 1EUCA 1V8BA 2CUZA 5M34A 3HM9A 4JBXA 4UQCA 3NJKA 4DF9A 3DV2A 1O3YA 1RRGA 5JALA 4GKBA 2HYDA 1Y34E 1BFKA 1U8CA 2FY8A 3ATAA 1OEZW 2H29A 5K4AA 3L1IA 5FH9A 3BMCA 4XJVA 4MW7A 4W5RA 3NZEA 2YXFA 4ELDA 3KNBB 3MWEB 1Q38A 3G5XA 2KX7A 4DJDC 2AQTA 4NM4H 4TVPE 3O1HB 4YLQT 1M8GA 2A9FA 2FP3A 3TF4A 3NETA 2FPUA 1A3RH 3EPRA 1ZKAA 1N6OA 4OCSH 4M99A 2WTMA 4EDWH 3T5WA 4IXDA 4AW9A 1PT8A 4NZUL 4MJHA 1GEGA 4ZAZA 1KJVB 1XF2A 2OECA 2HDHA 2PQMA 3ANXA 4Y5YC 4EPWA 4FR0A 3N5CA 1QX3A 4DCNA 3AXLA 2E18A 5L4MA 4HS9A 2NTFA 4JY5H 3X1WA 4MITA 5GIOE 5K6AA 4DK5A 1SZDA 1WDAA 4NHCL 2DJMA 1A9EA 5L9DL 4H7HA 2W9XA 2Y0SA 2G75A 1I8LC 5HKKA 1MCJA 3KJ6H 3Q40A 3Q2IA 3O73A 1CI5A 4QNRA 2QLVB 2GZ3A 1A14L 5FBRB 5CU9A 1B6GA 2PNDA 1S7TA 1PDOA 3V4UL 4ODSL 5L4SA 3O81A 4YR9A 3EH1A 3E9ZA 3EEBA 4GOJA 4A8JA 4C0KA 1CDEA 2XTMA 3ZY2A 4J3OH 4ZVUA 2Y7QA 1QO0D 3BI9X 1CUGA 1ONPA 3EGXB 4RVSA 3T8XB 3OAYH 4IO1A 3D4YA 1Z34A 3A25A 4UHDA 4XLTA 3KLSA 1LLQA 4JQIL 2D2OA 2BFNA 1RQGA 4M5ZL 5AAMC 1TZ8A 1K4MA 4ZUTB 3U4HA 1V9SA 3P0EA 1IRXA 2I85A 2WOOA 1F7VA 1N9PA 2X4UB 3WNJA 3PA6A 4JRYB 1A95A 3D3VA 1P0CA 3SR0A 4MYWB 1N92A 5CB0A 1U7WA 2HMID 4EBQH 4BFYA 3RANA 2FBOJ 3FQTB 3BMQA 3NKVA 5JZ9A 1BP3B 4B6RA 1OLLA 1DJPA 2ZSAA 5MHSD 5EC2A 3DF7A 1P31A