5E6UB

Structures of leukocyte integrin alb2: the ai domain, the headpiece, and the pocket for the internal ligand
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
459
structure length
453
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRKVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-L
total genus 127
structure length 453
sequence length 459
ec nomenclature
pdb deposition date 2015-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 5e6uB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 5e6uB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5e6uB03
3FCSB 3F78A 3FCUB 4O02A 4BJ3A 4NENB 1JEQB 4Z7QB 3AL9A 4IGIA 4A0QA 4GZ8A 1AO3A 5KYNA 3ZDZB 4F1JA 3T3MB 2IUEA 5LN1A 4JX0A 1ZOOA 5KYWB 5HGJA 1XDDA 1MQAA 3TVYA 3HI6A 4HQOA 3BQNB 5HJ2A 3BQMB 2I6SA 3EH1A 2VDPB 1U8CB 5E6RB 5ES4B 2B2XA 4F1KA 3V4VB 1JV2A 3Q3GE 1LFAA 2NUPA 4HQFA 1PT6A 4CN9A 4MMZB 2XWJI 5KYYB 4CNBA 2VDQB 1M2VB 3NVQA 2VDKB 1IJKA 1IDN1 5KYYA 2M32A 1CK4A 4XW2A 4G1EB 1FE8A 4PN7A 1OAKA 2ODPA 1PD0A 1QC5B 3ZE2B 1RD4A 3K72A 3AL8A 1U8CA 4HQNA 4IHKA 4WK2B 4DMUB 1AOXA 5E6UA 4WK4B 1L5GB 1ZOPA 3IJEA 1M2OA 3PPWA 5KYXB 3HXQA 1TYEB 1SHTX 2NUPB 4UM8B 5BV8A 1SHYB 4MMXA 1M1XA 4O3UB 3EFOB 5E6RA 2VDLB 4O02B 4MMXB 1QCYA 2P28A 1T0PA 1YVRA 1YVPA 3GXBA 1IJBA 5E6SA 4G1EA 2UZYB 1SSLA 1M1UA 3EOAI 3AL8B 1DZIA 1MQ8B 3K72B 1U0OC 3E2MA 3NIFB 1M10A 4MMZA 1NA5A 2I6QA 3QA3E 1YUKA 4K3JB 4UM9D 1Q0PA 1BHQ1 2QTVA 1M1XB 1DGQA 4G1MB 3EOBI 4UM9B 3VI4B 1ZONA 3EG9B 4CN8A 1PCXA 2ODQA 3TCXB 1MF7A 5E6SB 1UEXC 3K71B 3K6SB 2VDMB 2O7NA 1T6BY 2P26A 1MQ9A 3K71A 1FNSA 5KYWA 3EGDA 3TW0A 3VI3B 5E6UB 4C2AA 3ZDYB 1XUOA 3IJEB 3IBSA 3OL2A 1N3YA 1M2VA 4FX5A 3EG9A 1IDOA 4MMYB 4G1MA 1CQPA 2WW8A 1JEYB 4JDUA 2VDRB 1N9ZA 2XGGA 2NUTA 4C2BA 4FWWA 2XWBF 2NUTB 3FCSA 5HDBB 4C29A 1JLMA 4M76B 3NIDB 3PPVA 3V4PB 3NIGB 3ZE0B 3OKWA 5KYXA 3EGDB 5KYUB 2I91A 4WJKB 3AFCA 2VDNB 1JV2B 4NENA 1JEQA 2VC2B 1SQ0A 3EFOA 3PPXA 4HQKA 3OL2B 1ATZA 5KYUA 1OLZA 3T3PB 4MMYA 1JEYA 1U0NA 1SHUX 3F74A 1MJNA 3BN3A 4O3TB 3TXAA 4HQLA 3OKYB 1RTKA 1BHO1 1RRKA 3ZDXB 2WINI 4IXDA 4WK0B 1AUQA 4WFQA 3HXOA 1RS0A 2ICAA 3K6SA 1PD1A 3ZQKA 2X5NA 4NEHB 4Z7OB 4Z7NB 3EGXB 3N2NA 3RAGA 1L5GA 2VDOB 3ZE1B 3EH2A 3PPYA 1MHPA 2NVOA 3M6FA 1V7PC 3EGXA 1QC5A 2ADFA 1XDGA
chains in the Genus database with same CATH superfamily
4IJVA 4MQTB 2RKBA 3K0KA 2E7ZA 3MV7D 4PQRA 3GI9H 5AW7B 4IUDS 2AN9A 5JDSB 5TPWH 4KK8C 3ULVD 3L3HA 1UBOS 4X83A 5FYKU 4BIIA 4ONFH 4Z2YA 1TPXC 3VWKC 5H4YA 2B4TO 4FLQA 1C1XA 2ZAOA 3QFCA 3IJRA 4PFSA 5JG7A 3HZRA 2DPGA 3T4XA 2K70A 1P0MA 1XKXA 4QEGA 4AN4A 5EC2A 3TEUA 1HA3A 2PYEE 4OHMA 4OHKA 5JIQA 1OSZB 3B9AA 5J2TB 4BMDA 5LXTA 2AF4C 3EZ7A 5AHWA 4ZRNA 3CLTC 4KKQA 2C5LA 4ODWB 2FZKA 2JFNA 2ZYAA 3UJIH 2VMDA 2R6JA 4J6RH 2ANBA 4M9SA 4HWBL 3MCAA 5JMRA 1CXZA 2R4UA 1W96A 1UJ3C 3MINA 1JJ7A 1BD2A 5AHKA 3SCMB 4UDXX 4FZ3A 3RWCA 4NATA 2R8SH 2B1AL 4BXOB 4L4VA 2FO1A 1LDNA 3GR6A 4M1KA 4O0LA 3MRVA 3DX6A 4JFYA 4FGSA 4UINH 3AF6A 4UTAA 5KYKA 1WDMA 3O11B 4X9YA 4G9FE 3SQRA 5DYOA 3VXTA 3OZKA 4OQTH 3KLHC 3G5VA 1C50A 2VKQA 2C2WA 4UASA 4X8JA 3UBFA 2V37A 1N7MH 1K63A 2VSYA 1X9RA 2JHFA 1C3OA 4FC3E 2ZI4A 2BHSA 2OK0H 4I1VA 4WFED 3ABGA 4C6SA 2LBPA 32C2A 1C5KA 2HHCA 2CDEA 3T0EC 1NVVQ 3MB5A 1SN7A 2FYYA 4ZPTB 1IC5L 3OZDA 5JMPA 1IDN1 3LDFA 3FMOB 2IQ9H 4OM1L 4Q9QH 1JPTL 4IRSB 3OUZA 3VFPA 5F51A 3V4VL 5JJCA 4MMXA 2VLBA 2YCLA 5B21A 4EI6A 5AVSA 5LIPA 4GO8A 1NUDA 3O8XC 1CYGA 3UM9A 3NVDA 5AI0A 4M02A 5DHPA 1C0LA 4P5SA 1IBDA 1FBTA 4EGSA 3DM9B 2CA3A 3RNOA 2WO2B 3B1FA 4NU0A 4EAEA 1M0WA 3PC3A 1A7PL 3VYSB 2GI4A 1H3NA 4IIHA 5HCUA 2H5IA 2WJIA 3G0HA 1P69B 2Y93A 3DIDA 5J1AA 4KMSA 3EH3B 2HV9A 3TMKA 3QPAA 3LF2A 3KPQA 2Y5TB 2G9QA 1GZHB 4Z7VF 3K1AA 2JB6B 4MR9A 4ZPVB 3Q2NA 4JV5B 2OM2A 2UZXB 1GH7A 3LN4B 4MWTA 3HZYB 4NCC2 2OAEA 4TSAH 4DK5A 2XNHA 4HFUL 2B14A 4WI7A 3F7VA 4KX9A 1XO8A 1HC1A 3KYOA 3GM8A 3ZBUA 5E99L 4JKIA 1WTCA 4OCNC 1BXUA 1SUCA 3NJKA 3WKEA 3BKJL 1Z4OA 1NUFA 2F17A 2OZLB 2DCMA 2P5EE 1SURA 2BCMA 1Z13A 4OR1A 2PUHA 1LX7A 4FR0A 2E4AA 4UILH 2LTQC 4IBVA 1Q90A 5H4HA 4OUOA 1RLWA 2P27A 4QDTA 3SZGA 1IVNA 4XZ3A 3H5WA 3QORB 3P2OA 2ZRJA 3FB5B 3WKYA 4F9GA 1O96A 1IJBA 3L4BA 4WUUE 3OGOE 1VCNA 4TS9A 5T8KA 4L4TD 4G1MB 2WC7A 5LB1A 3BD9A 4TUKH 3N70A 3CZSA 2R1WA 5IBTH 4UBOA 4GZLA 3LDBB 3L8EA 4BZQA 4BASA 4AUKA 3FXAA 3IJEB 1U8QB 1GQRA 3SBOA 3B3IA 3KHKA 3UZEA 4EKIA 1NQXA 2L0XA 3ZU8A 2NZ8A 4BCYA 2NUTB 3OQIA 3IQDB 2PD4A 4E15A 1HGXA 4K3VA 2RHDA 5GIRB 4ZVTA 5FV2A 2X4GA 3A0UA 1EEYB 3CXHK 1V3VA 1P53A 3DVIA 1H6CA 3FU7B 4RD1A 5CGQB 1LKZA 3PPEA 1NC4D 4PJGB 2EDCA 2ZU0C 5E4JA 4N7BA 4PJCB 3EPRA 2C4MA 2H32H 4BE6A 3ARBA 2VR7A 1P2BA 2G70A 3V4PA 4Y5XA 3PGXA 3GEHA 4NECA 1PGQA 3QXCA 3IDSA 1G3MA 3CE1A 4R71A 3C7TA 5LN4A 3UGTA 1TLFA 2CB0A 5TMBA 3I75A 2RQEA 1HL3A 1M5UA 3W3AA 4PLJD 4FXGB 1SHJA 4HCRL 2EO1A 4K7PX 1JLHA 2B92A 3ZHUA 3GSRA 3TBYB 5CFAA 3KO8A 4U1NB 1I2DA 4C3OB 3GA5A 3UMCA 4F7CA 1A6AA 1LE9B 4GIBA 1GOGA 2QLVB 1MJGA 1PJ4A 3SDXA 3UAJC 5IMKB 4X99B 4MB0A 3V9AA 4TVBA 1ZLDA 1K06A 3TJHD 3FVTA 2CZQA 1Q74A 4C0SA 4TYUA 3N41F 5AW2A 1D9KD 2FYVA 2FDRA 5IJBC 4TXJA 3WGZA 2YD8A 2RI6A 4Y9UA 1QYRA 2W22A 1DQJB 4GEKA 2Z6AA 2DQMA 3CKLA 4LPSA 4NHCL 1KXTB 1ZXXA 3EIFA 2G6TA 4INJA 1PLGL 3BL6A 3LZRA 3NABL 4N01A 5DBIA 3X12B 5BVHA 4YDSA 4YO0B 2Y7MA 4F0JA 4PJBB 3SC3A 4LLUB 2O2IA 4C83A 1QATA 1GPYA 3RWHB 3EH1A 1R4MA 1US8A 1YB6A 3TAHA 1EXGA 4GXVL 5CP7B 4LJAA 1KZ9A 1OAQL 3G04B 3NHAA 3FO1A 1Y1DA 4I8XA 1B93A 1OZFA 4WK4B 1ZJZA 2JAXA 3CVOA 4NTZA 3W8NA 3TKLA 3A67H 3WDMA 3NJIA 5AHXA 1A7PH 1CP3A 2XADA 4V11A 1OZTG 4RIIA 4X4KA 4WCFC 5ABZA 2JJWA 1UCTA 3L3JB 3E2MA 5DEIA 5KHAA 4QATA 4B09A 2YRPA 2EKJA 3PRHA 1ICIA 4WY8A 1PEYA 2QRVB 1A4KB 1F1GA 4Y19D 3TBVB 2UX7A 5BMVA 2LQRA 2D00A 1OP5K 1NGYB 2J0UA 1S7VA 3WHKA 5AAWC 4FJZA 1LPSA 4NPYB 3Q5GA 5KOIA 4RFSB 4X50A 1XH1A 1EHAA 1WFIA 3SOBL 1ZTXE 4PC7A 4UNTA 4FW9A 3RIFK 1NTDA 2EILB 1HDOA 2X6TA 1MCKA 1F17A 4HVLA 3OCJA 4XXCC 4HUUA 1U2EA 3GBPA 4MNGB 3B7TA 3OM9A 1SNYA 1DJHA 3ET9F 3LDUA 4ZOAA 4H26B 2H2IA 1K5WA 3EDDA 1GARA 4HRYA 1QNIA 2VNHA 1ZTXH 3ZL4H 3VPAA 3T4PA 3R74A 3V8NA 4IIZA 5ADPH 4HGZA 1II9A 4QXUL 5JNLA 3BDXA 2O1AA 3JD4A 3OEEA 3PFQA 2EDAA 3ZYJA 5BRZB 1ZFNA 5FPTA 4YUWA 2JLUA 3VMFA 2C88A 4YOKA 4GBXB 4Y6RA 4RV9A 4OD3H 2Y05A 1DJZA 1LK2B 5LJLA 4KPUB 1UBCA 4C83B 2JCGA 2WV7A 2YOHA 2O2YA 3HRZC 3NLLA 1OXBB 1Q0SA 4PGDB 1ZN9A 2A74B 1G16A 4CDGA 4YAIA 5IVIA 1V1JA 1AKJA 2X9VA 3TTWA 1H8ED 2D4DA 4N6GA 2MMXA 2IYXA 2VB5A 4J2TA 1CBVH 2DIEA 2ZIGA 5IVXB 4NJEA 1NPDA 4AM8A 3OVMA 3P26A 5HRUA 5EV7A 3GDOA 4URXR 5D2NE 4YXWA 3SJVD 2DKUA 4JT8A 5IJ0A 2ZX7A 3W1EA 4W9NC 3P19A 2QKSA 4DKEL 3MMPA 1B4JL 3L8MA 4KDTA 2QSUA 1KI2A 1X4YA 1L6RA 1AKEA 3TJMA 1AGCB 1L5HB 3IA7A 4G0PA 1HXHA 3KJ4B 3OOJA 4W1QA 1U95B 2D7MA 3N41B 1GVNB 2IG2H 3UJJH 2CE7A 4R68A 3HN6A 3VFWA 2A0KA 1CLYL 3GVPA 3K0WA 4WW2F 3HFJA 3INYA 5BOZG 3T1TA 5TE4L 2JKIS 1AT1A 3BFKA 5MP6H 4NZJA 2ZSEA 3W0WA 4HP5A 3AU1B 3RX8A 3CH4B 3AR6A 1XDUA 4NHOA 1UJ6A 3DBLB 4U7FA 3LQMA 1L7BA 2RHWA 2E55A 4NNPA 1GPOL 4LCCB 1JF1A 4D0BB 2N42A 5EYPA 3THSA 4M5YL 1UOLA 3FHEA 1CGTA 3TG2A 3ALPA 2XN9A 3IVRA 4HZ1A 4LHZA 3CISA 1ZA6B 3UTTA 1RYFA 3KYNA 1RR6A 5B4VA 4CGUB 4ZVUA 4FEIA 3HBJA 3U4QB 3NQ41 3TD2A 2O59A 4PGGA 3VDXA 3H6GA 1EX0A 4M5TA 4N3GA 1FA9A 5AFSA 4PYKA 1LEGA 3QZNA 3SDAA 4WLCA 2W60B 1JR6A 4KTEL 5IM7A 3WGTA 1A9YA 4XM2A 1SZNA 3IGAB 2CGRH 3QXHA 1CFVL 1P44A 4PJGA 1UT8A 1FW6A 4KOCA 5JCXA 1P7KA 1N4XL 1QBBA 1ZDMA 2CT8A 2VCEA 3WLFA 2PF6A 5C0RH 5DBGA 1YQWA 3QO0B 5AKIA 4LA4A 4LL4A 2ZXAA 4WN9A 1GGFA 2VXQH 4G85A 1JMXA 3T9EA 4PIRF 4OHCA 3E5RA 1OH5A 2XODA 3AQXA 3P30H 2BFFA 5B55A 1GLGA 2DLIA 3HCVB 4DCQA 2PKYX 3M3HA 4NYMR 3MXWL 2ERJB 4J2XA 4N8VA 4ESEA 2AR7A 2JD2A 2PX6A 1KYUA 1R5IB 1OF1A 3F6PA 3KWWB 1J2YA 2KERA 1K6XA 2M2DA 3QY0A 3CF2A 1URZA 4EPTA 4DP4X 4KFSA 4WI9A 2AL7A 3GI1A 5K3CA 2C78A 3G2QA 4XWYA 3G6DH 2AN1A 2DYPB 3OHMB 5BXFB 2X5OA 1AXTL 2OMVB 5DDHB 3GBSA 1WVMA 1JVNA 1NKGA 2HFTA 4W9IC 4A66A 2PWFA 1CC3A 4DFHA 4KKZA 2YAPA 3FQNA 4A4DA 3U2IA 3CLRD 3RBZA 2E0IA 4RTMA 4R1PA 1JPSH 2Z35B 1IBHA 4YCMA 4EUEA 1U0EA 2MINB 5BMVB 1DL7H 2GI0A 1WP4A 1OAZH 3HLYA 4OXXA 5MENE 1HV8A 5BUPA 1QR6A 5JZOA 3MAJA 5AOBA 4I36A 5K9OB 1BE0A 1UB6B 5UKDA 1E2FA 2D7PA 1U3DA 3A31A 4J49A 3U4HA 2Y7OA 1IZZA 4I2XB 1QA9B 3O4JA 1W6WA 2EJCA 4NWTL 2QSJA 4L29A 4I1IA 4Q6IB 1Z0AA 1G9XA 4GX2A 2J25A 5B4UA 2HIGA 1N5YH 3FQWA 4NOBA 2EYUA 3O93A 2PVSA 1PS8A 2BIIA 2HU7A 3O8LA 2CHQA 3QO0A 1K97A 5PCYA 4W63A 4Q58C 4J1TC 1KWKA 3FH0A 3RWOA 4DLNA 3MN1A 2N01B 4QE3A 3ZKNC 3EAQA 4KQ1A 3QWRA 1P0CA 3FTDA 3ILDA 3VRLF 1A2OA 1NQTA 1TADA 2RHHA 4G0MA 3O9VA 2N46A 4X71A 1U0FA 1AJEA 4GOKA 5JDJA 3AWEA 1EZZA 1U02A 3WK9A 3H1BA 1J0EA 2B7DT 4HHEA 3A6JA 4MW6A 2UY6B 4A0GA 2IELA 4NSKA 4UPVA 2B9AA 4KFMA 1WDKA 1CCWA 1FL5A 3DVNB 5H94B 3FZGA 3SBXA 3RRBA 2O2EA 4YHKH 4WDIB 3EUFA 1JZJA 3CH1B 3HMXH 3CPSA 1JQLB 4UZEA 2B0JA 3P3RA 3PGJA 3WJ2A 3W5AA 1T2FA 3K9NA 4APXB 5B38B 4OK3A 5FA5A 1PWXA 1ZMXA 3I53A 4B76A 4XNUH 1F0KA 2X1HA 4WTZG 4JO3L 3AMLA 4JU9A 4HT1L 5IBLD 3BAKA 4JBWA 4NPAA 4YJKA 5ALWA 3V00A 4X65B 1G20E 1C08B 3WRXA 2FJFA 4ZMSA 1T25A 2DCUA 4Q3OA 3ESMA 4YIQB 3GYGA 5KNDH 3L1OH 5AJWA 2Y6UA 4CL0A 3L4TA 2JIZA 1TTCA 1J11A 1CXFA 1JJUA 4QHLB 3IXTA 3GLIB 4J0DA 1XH0A 4ZIRA 1UM4H 2H1PH 2AS0A 5GRYA 3HKDA 4AL4A 2W2VA 3W0LB 2D5IA 3TA3A 2OTWB 5FOUA 1UXKA 1ZVJA 2GZ1A 4FILA 4R1TA 4MUNA 4DP2X 3VFUB 1G0NA 5KREA 3MUEA 1SBYA 4OREX 4HH1A 3V4FA 2ZYSA 2XNKA 1O4VA 3PUYA 3CVVA 4EN3B 3OPYB 3ZEAA 1YMVA 4LYFA 4OXYA 2PZGA 3L1GA 2HA2A 2YN3A 1A66A 4HS8L 3A3KA 4YR6A 1YS9A 1J9CT 2OLJA 4HKXB 5TDPB 2CEKA 4RFOL 2QMJA 4RAUB 3S1LA 4KRYA 1SLVA 2X86A 1YWGO 2ZJ6A 3MBWA 3QU9A 3S8MA 2VRBA 1M6EX 4EQZA 1RP9A 4GZMA 2O8NA 5KNLA 1VYHA 2HPOA 1WBXA 2HJLB 5DK6A 1SHTX 3OI7A 4XA8A 3ARUA 1MCOH 2HLDA 5IMOB 5HX7A 1FX0A 4DJMA 3DCYA 2XSZD 5E6SA 1KXVC 1OU0A 2DUUA 2V9PA 1M10A 2NM0A 4C04A 3ROFA 1GL9B 1JDSA 2QYHA 3CG4A 4B7LA 4TL5A 4D56A 5C0CA 1UDAA 4WH0A 3VVMA 3A5VA 3JQGA 2MR6A 2J6EL 1NE7A 5C0FA 1E7VA 1GKEA 1RWBA 4YR9A 3S44A 4RA9A 3DX9A 2HJVA 5KJ4A 2P8MA 2CO6B 3GTNA 3B8SA 5JE8A 1EUCA 3W6NA 4CLRB 4G7RB 1HLGA 2BP8A 5IHLB 1Q3HA 2DY1A 5T1LD 5IF0B 5DVLA 4CC0A 3DMNA 4ONHA 5DCCA 4NM4L 1M05A 1RV6X 1DADA 2I2FA 1TZKA 4P7JA 3MEQA 2PKCA 4MP6A 3SVTA 1A1SA 1YO6A 3QGVA 1R17A 4PXAA 3MX0A 2NW3B 4IO1A 4N2DA 4MHOA 3Q12A 3ZW3A 3N2NA 3FNRA 2FMTA 1XCOA 5EU6D 3S2EA 1BG6A 3AREA 4HY3A 2FATH 1FFXA 4FI8A 1WHPA 3ZWCA 3JQQA 2FK9A 5D6CB 2VXUH 1JYFA 4E5PA 3RE0A 5DHVA 4K9NA 5L9AA 3VXSA 2FZLA 3TX6A 4NOLA 1KCBA 1J7VR 1VADA 3P0YH 3PP3K 4RTLA 3X1FA 5JC8A 4B2YA 4XGKA 1WD8A 4PG2C 2IF7A 1V8FA 2VQUA 4RE6A 4R9HA 4DUGA 2ZCHL 2AI3A 3G17A 2RGWA 4IMKA 4BZ1A 4TMYA 4XDZA 1U6JA 1ZITA 3L48A 4PR0A 3CU1A 3BXPA 4PSAA 1LDSA 2QVCA 4W5OA 3PVCA 4L08A 4LOKA 3D4OA 4F5CA 4XI9A 2J8HA 1U8UA 4PFQA 1TVEA 1MLDA 4Z9XA 4M38A 2ODIA 1J07A 1PDVA 4H8UA 4ZG1A 3DJFA 3LH9A 5A3SA 2XDWA 1ZLVH 3ENEA 3LTNC 1NZJA 2BFWA 3MS4A 4C76A 1BEZA 2WW8A 2FLBT 1IWPB 2XBTA 2LOEA 3U3DA 2XFXA 1S7UB 4X9GA 2F74A 1DPGA 1VMKA 2C3WA 2Q7DA 1JOIA 1JAEA 3VI3F 1M2EA 5E99H 1U2YA 3BK7A 1DEDA 4TXVB 5C07D 1KMHA 1QYGL 4LTDA 3KYCB 4W9EC 5B1AB 4EMZA 4JQXA 5CFMA 3HAEH 2FPMA 2ATEA 3E2HB 2K4MA 4PHCA 4HS8H 4WY7H 1MD9A 1LE5A 4LHUD 4D9QD 4LB8A 4BJ3A 1KULA 4FMFA 4HJRA 3HVUA 2I66A 4QDKA 1LQ2A 5BYBA 2WJYA 2YZ8A 3V52L 1BAFH 4GLLA 1X9QA 4ZOCA 3A25A 3KDPA 4PLYA 4G6ML 4HPWA 3AREB 1SBCA 4B83A 1OXYA 4DEPB 2XUPA 1VCOA 1AE6L 6PAZA 2AXHA 4JJEA 3F3KA 1C0IA 3KD4A 3OTIA 2QHRH 4MRNA 1IY9A 3SY6A 1OZUA 1KMNA 1S3GA 3BF8A 4RCYA 3D3VD 2X0RA 1JXDA 1BMFA 3L1OL 4XO9A 1NVVR 3OTGA 1KVRA 4RD2A 1F2DA 1Z5ZA 1JE0A 2ZWAA 3II2A 5HPYB 3ZQWA 3COOA 5ABAA 4LSMA 4PY7B 3B2MA 4GLRH 3SP1A 5F7YC 2KZKA 4IOFD 4AZ8B 4S2SB 1K4DB 4R8LA 1XL4A 5FR3A 2H17A 1KERA 3BDIA 5ID0A 5EN2B 4ODVL 4GY4A 3D0RA 4GFXA 4G5XA 1OGYA 1H6AA 4HSEA 3TW0A 1OGIA 3V6OE 1RFDH 1ULZA 4D45A 4BKOA 3NEPX 4BMXA 3KYMA 2GN6A 2WNSA 2NXZD 2NY6D 1CUJA 3A2NA 5KYXA 2XIJA 2IOMA 4X92A 5DEJA 5KJRH 3FMPB 4XAWL 2JIXA 4MQLA 1NPYA 1HH9B 4FZEH 1TXGA 1O8CA 2ICAA 2J88H 2FECI 1PLJA 3IBGA 3JQPA 3S7ZA 4H7VA 3TZQA 4B3EA 3OE7D 1W72A 1F3LA 3OKMB 2W1NA 3W90A 1KPRA 1UMKA 3AKEA 2PABA 4WZBE 2D0FA 3U0VA 4M8UA 2OLDA 4BX3A 4PW0A 3SIPA 4YP0A 3D52A 5DTIA 1E5ZA 5HGAB 2H7WA 3WEAA 1T7WA 2AK1L 4Z7WA 1N10A 3UAZA 3EQ8A 4RVDA 4TYWA 4Q7JB 1B8UA 4XPIA 1IGYA 1XZAA 2CALA 4J1TA 2HO5A 3ECVA 1PKQB 2POQX 4G7VL 4IG9A 1YB5A 3VGHA 3KB1A 4MMZA 4OV6B 2GFBB 1R9FA 3ANYB 4F72A 3GPBA 2AXJA 4EN2A 4N6RA 1WMSA 5CBAB 2XN9E 5CPFA 3CHPA 4L6AA 3OCZA 3TCXB 2A30A 3PL1A 1ORDA 4EJ6A 3DUHA 4HF7A 1IAIH 3FU5A 1EZVY 5BXYA 3T4EA 2PZEA 1PZBA 3QEQB 5JW5B 5I71B 5DX8A 5CU9A 3AM5A 3IDNA 1LF0A 1D5BA 2DM2A 4KJPC 2DM3A 3OC0A 1OB5A 4G2AA 2HYMA 3N1MC 1QGAA 1TFUA 4KXBA 1JLLB 2QXTA 4D9GA 2DWXA 2PX5A 4OLWH 4MA8L 5BUSA 1KJIA 5D7JB 5C2BL 1Z0UA 5ERYA 4V2IA 3ZK0A 3S2YA 421PA 5HRAA 2EDEA 1HWGB 3OUTA 4CN1A 5HJGA 2X5NA 1HILA 2ZTLA 3Q6IA 4N0UE 1WRFA 1SWWA 3FZYA 1ICEA 4G6MH 3OOWA 2ZICA 5HGXA 1SEQH 4ZT6A 3RAJH 2AMYA 5FX3A 1DQQB 3ZIMA 2DQUL 1FJ2A 3VQTA 5A40E 4OGAC 3VE0B 1UH3A 5B8CB 1CFZA 3RHZA 5E7QA 2R8XA 2AFVA 1RUPL 1IZJA 3E9DA 2E7DA 4FD3A 4JJ7A 4B96A 4MO2A 4FIZA 3L6CA 1B6DA 1JZ8A 3ULVC 2JAUA 3INOA 1RZ8B 3VDQA 2ASVA 4GSXA 3TOVA 3ZV5A 5EXSA 4R26L 2REQB 3BPNB 2M83A 2H0EA 3OLCX 4UIMB 2HCFA 4RK1A 4U2DA 5JYDA 3F46A 1EIZA 5AOLA 3BWAA 5A6LA 2CLFB 3O3MB 1JWMA 3OQBA 3QJ5A 1K2DB 4HJ0C 1U3TA 4HK3N 3DNPA 4CW7A 3FCTB 2Y1DA 3EXHB 2JZCA 4ND8A 4Z7JA 1YIDA 4G4SO 5E1QA 2G5UA 1ND5A 3GBLA 2D0DA 3KQYA 5IC5A 1PEWA 5D5MB 5A7BA 1BXGA 4O4IB 3EGSB 4C2AA 4TVSA 5JOPD 2C97A 1LDYA 1N6NA 2P42B 3OXSA 4CGYA 4LRSB 3OT1A 4YEFA 4A8HA 3L7OA 4C7KA 4CIBA 1ID1A 4ZMPA 3F96A 5EZLA 4P48A 2GZHA 1Z9SB 4EF5A 4XXCA 2WIIA 2FSUA 2W2QA 2ATPB 3H11A 4JYCA 4JFXA 4KNQA 3IXMA 4N0DA 3UWMA 1TKWB 3ESAA 3HN2A 1UCBL 2E48A 2MDTA 1AQ8A 2Z43A 1EB9A 2P1YA 2PW1A 3U7QA 2WD9A 3PGVA 3VD7A 1HOTA 1NOKA 1T0JB 4O4LF 4EGJA 4Y0VA 4PRIB 1IGIL 1YA6A 3HJTA 1ZVNA 1V6SA 3GHPA 4FYQA 3KBHE 1MH1A 1NW8A 2HKHH 3X1YA 2BO0A 3MJ6A 3WRYC 3TOXA 4K7FA 1HQ4B 3ZO0A 1O87A 2XIBA 2IPLA 4ZTBA 1S7WB 1G2OA 1H6EA 1SCUB 2HSEA 4D8XA 4NUMA 1CK4A 3OAYK 4M1QA 1N2RA 5DO2D 1Y6KR 3T4UA 5GHWL 4J0FA 2NUPB 1T9HA 4HGRA 1JTVA 2XN2A 1M2FA 4Y1FA 4NDNE 2OXHB 4CQLB 1EUCB 3BFXA 5J57B 1P0FA 5DURD 4HIEB 3HVDA 5TDNB 4KU4A 1BHQ1 2BD0A 4ZALA 3H53A 3W78A 1BZOA 5LG6A 3L77A 5C2JB 2BOCB 5BSMA 4IIEA 4I0PD 1W29A 2VPXA 4JYMA 1SOSA 4PLVA 2CXTA 2HUEA 1XUOA 2XLCA 1DCKA 3GK8L 5IN4A 2Y36L 4RKYA 4M21A 3V33A 2ZQ5A 1EGQA 4XHJD 5BSTA 1RIVH 1R3HB 3EBHA 4MWBA 3FTPA 1DVUA 2EZ0C 2P1ZA 1VZGA 3SOTA 4RF3A 1ZX1A 3E3QC 4F4UA 4JDVB 3TBWA 3R44A 4NGHH 5JPMA 1B6SA 4YMSA 1Z0KA 2Y3IA 5DHFA 3K30A 4ERXA 3RVWD 4OATA 2QV4A 4JO2L 3D4CA 3DWTA 3G8BA 1CDCA 3BEWA 1LU9A 2DICA 5LJYH 4MKIA 1Q9LA 3T8VA 3QF4B 2OX5A 2OO7A 4QGTA 2JCYA 2IPOA 5HHNA 1SNRA 4B9FA 3I2CH 1SC6A 2H2PD 3GCWA 4R7DA 1VB3A 5CYOA 3B9DA 3T1NA 4FGJA 2QD1A 3QE5A 1NC2B 5EP4A 1M2NA 1OSNA 2X7JA 4PRBB 5EBGA 2C2KA 3QLUC 3W1WA 4U2CA 3STTA 3V6FB 1KPHA 3GJEB 2QR0B 4X94A 2R4RL 1QSFA 2EEBA 4AKOA 1AS3A 1OT1A 3O83A 1XO1A 4KQGA 4HUQA 4RELA 5HHMD 4XXDA 3RFRA 2WWTA 3HBFA 3FOAA 1OE1A 4E33A 3U3JA 2DI9A 4OFKA 3LS4L 4L5FL 1F1JA 1DKUA 4YHNB 3VR4A 3I5AA 4LVNC 4KR3A 4OZFB 4GL4A 4P06A 1WUJS 3P9SA 2IZ0A 2X38A 3MLSL 5G2OA 4Q97A 2VDPL 2IWRA 2WTXA 1P0PA 2JIQA 1V2HE 5HGBB 3GFQA 1FL6B 4XWOD 4ZDIA 4BLOA 4NZ8A 2H1VA 1TLMA 4IR7A 1UUNA 3T5MA 5CUSL 1Y1QA 4L7QA 1L3NA 1NLBL 1P7PA 1X7XA 4YV0A 1GOFA 4I2XA 1GYRA 3A26A 4ZU3A 1T04A 3QV1A 3Q3GA 1UJ3B 1VE6A 3FFCA 3VMNA 2G08A 1O58A 3BK2A 2WZBA 3VSTA 4YCCA 1WB6A 2DQTL 4G5YA 4LE1A 2FZVA 4PJFF 5C0BA 2D3JA 4YP6A 4PGCB 5EUOF 1ZCBA 2D31A 4NZFA 4Y2OA 3IMWA 4OHYA 2HUNA 4NOJA 3IU3B 8CGTA 5TQ2B 2ORYA 2V2XA 4MW9A 2XW6A 2F7RA 2ZJSH 2J9ZB 1PEDA 2YXPX 1Z9BA 1UKZA 4Q3CA 2TMYA 3AM4A 4GX0A 5AW0B 2PIDA 3ILYA 2EFYA 1EV2E 2DKSA 3ARYA 3AERA 2XEXA 3L6OO 4NSNA 3OJ0A 1L1FA 3NFNA 2D1TA 4OI7A 2IHVA 1GY1A 4Y4FD 4UEOA 2NR6C 1JEQA 3T8MA 4AY2A 1L7PA 2R7NA 3ZNQA 2P9QA 2JG3A 3VHLB 2OD9A 3IE0A 3MOAL 2BBSA 5EMJA 5DGTA 5F1OA 1XNQB 1N5KA 1FFPA 4YUXA 3DOEA 5IKPA 5CA1F 1JA9A 2M98A 2OMUB 4GMSL 1L5VA 3ZDEA 2EWMA 3V8PA 5LAXB 3B1VA 1M53A 5SX4I 1HETA 4XWOC 3L45A 5C0DB 3TJZA 5F7MC 4D44A 4FEAA 3OXSB 2OCLA 3P0HA 4FL4C 3BXEA 3QHFL 2BGIA 1A88A 2JJVA 4XX1A 4UOW1 1H2EA 1TPZA 5K1JA 5GRVK 4RISL 1R5JA 1DJGA 3RWJB 3JD1A 3W2DL 5H2BA 1LNZA 5IFJB 1PR1A 2WZPD 3O4OB 1XTRA 1UCFA 1WSWA 4NV3A 4GSDH 4P5DA 4FEEA 2XXFA 5E2UL 2HDNB 2OP4H 5AFAA 2QPAA 2RHOA 1VKXB 2B1JA 2WF9A 5EI5A 4HH4A 5JUWA 1L7RA 3AHIA 5LOVA 4N26A 2W43A 2WLJA 1XTZA 5EH1A 2RJ3A 4POAA 4UF7C 1YMMB 3H1AA 1NI3A 1NR7A 3KYMB 3ZPXA 3MQFA 1XL1A 4B3RB 3HC2A 4KY2A 4WI0A 1BU5A 5GGQL 3HE6D 3R3JA 4ZOQI 4MBOA 5HHOA 1NAMH 4OCRL 1GZ5A 4BQNA 4LZPA 5I1EH 3GBVA 4RK4A 2BSTB 1HINH 3FFOA 3WHXB 5HHQB 4GX5A 4I1SA 2EXSA 3K5HA 1NWCA 2GK6A 4MV9A 5D1QB 2XOKA 1QP1A 1YQ9A 4ZFOL 3I02A 1RE1A 2X1WL 3C3KA 3ZVMA 1LZLA 3FPYA 1A2KC 5J23A 1UK8A 1W5BA 1NKSA 2WAMA 4IDFA 2EJBA 3O91A 4X5WA 1G60A 3KNZA 3CNOA 4AZ0A 1YDFA 5IBRA 3WYEA 4QREA 3BZFB 4XBGA 3EYOA 3U48A 3LPCA 4Q4AA 2DUWA 3R5XA 2RD2A 6REQA 1M6WA 4GPTA 3WE6A 4Q12A 3US0A 4H3HB 3VNYA 4I5GA 4LSPL 3IMFA 1QFPA 3HC0A 3CHOA 3MV8E 2M32A 2NV0A 10MHA 1EUDB 3Q2KA 4YH1A 4DLPA 3V5HA 2P1RA 4OGXL 3QVXA 5CBAA 3NPAA 2K3HA 3NCXA 1F8YA 1D6VH 3PE3A 4ODHH 4G5ZL 1Q2UA 2VLKD 1UFQA 2PN1A 4BWFB 2Q4BA 3M6WA 2DWDA 4N0YH 3VFGH 3THYB 2IPNA 4QX6A 4FTVD 2YQBA 5JQGF 1MAAA 2AKAB 1XZIA 2ZYHA 2FR8A 5ALDA 3LT2A 5I6DA 3H4IA 5JBNA 4XFJA 5FA6A 1Y33E 2QNBA 3VI3B 5L4NA 1ZOSA 4ZVSA 1KENH 3LN5A 1SR8A 5JJLA 3NC0C 3MGAA 2DFPA 1Q9WB 2G9ZA 1XPOA 3NIBA 4UFPA 1B2LA 4KPEC 4KKLD 4XXHA 5I4KA 3V4LA 3DZKA 5E4FA 3W06A 1X5HA 4R3UC 2PV7A 5D7LB 4OXNA 1RULH 2FSHA 5IG7B 3EOAB 4ZS7H 4IIDA 1J1PL 4YWGL 3RSCA 3FWZA 3ML1A 4LYEA 3JVUA 2IDZA 2R0LH 3WL7A 5AG9A 3W3ZB 3FNEA 2X0EA 4OZFH 1WAPA 4TVKA 2XJ9A 5B7QA 5BN5B 2E7BA 1R3UA 4ODSL 4NFBA 2HX8A 4HVAA 1W8IA 1OM3L 4NZ9A 1I8KB 1PLBA 1EQUA 1KGWA 4JB0A 4FNAA 1BVLA 2WMOB 3STYA 3GKZA 2GEFA 5EU3B 3QCTL 1ZGJA 4L5JA 3AT0A 3EWIA 4IJQA 1H15B 2GHRA 1HS6A 3DURA 5T6BA 4CW1A 3CFUA 1HMPA 4OLXH 4ALJA 2BWQA 1BLNA 4F4DA 2FETA 3DE5X 2W8ZA 1HK7A 1LX6A 1GZHC 1W2GA 4C7MA 2Y27A 2XIIA 3ADDA 4QY8B 5T3XD 1KQGA 1QTYT 4MDEA 2H26B 2OV2A 1NFQA 2BW0A 1GFZA 3C3CA 4B6EA 4RACA 1INEH 1A9XB 4HRAA 1OHHA 4O3FA 3SF0A 1DLHA 3VA6A 2BEWA 2EQBA 2QRGA 1CUUA 4TXHA 2R11A 2XOKD 1FNBA 4JM2B 5KAQG 2QW1A 4A1RA 3VZPA 1AC5A 2AD1A 1ZM3A 1A9ZA 5GJVC 1NCIA 1FZJB 3P8ZA 1RRKA 2MYTA 4URVR 2CKBL 4XVHA 2YMMA 1A1OA 2BP3A 3UG7A 4ZOLA 3WTSA 2DWEA 4NJAL 3N8NA 4PHZA 4Q6BA 4I3RL 5AVZB 2AN4A 4DNQA 5F0LB 1JZ5A 2BZSA 3NJ8A 2RA1A 4C4TA 1KLFA 1GL3A 1ADQA 1SCAA 3X1WA 4YRBA 3Q0TA 4WZAA 1O0BA 1QRUA 4ARSA 1DC8A 5IFAH 1MY7A 3D85A 3R0NA 5FLYA 1QIFA 3V1MA 1W47A 5L7XL 4TSRA 2H5LA 1NIDA 3EBIA 1IFGA 3O6LH 4PZLA 5DYWA 1J0DA 3HYTA 4NKQB 4BV8A 3H3PL 4Y5YC 1Q0XL 5EQTA 5KS9E 4PEVA 4KQMA 3PV0A 4OCRH 1Z7EA 4G1EA 3WUWA 3VR6D 5IZ4A 3CBGA 2ZEJA 3G2NA 2HSIA 5T4BA 3BIKA 1GPKA 3L9WA 2Q4TA 3DV4A 1SCKA 1I8IA 2X09A 3NABH 1GW0A 1JGUL 1HZKA 3DEAA 4OY3A 1DHRA 1HK6A 3GPSA 1JZQA 3LD8C 3GX1A 4LF3B 4WGVB 2ZJZA 1A97A 5FADA 1JIBA 1Y6ZA 5JNTA 5B1CA 1V11B 4JX9A 1RZJL 4HCJA 1P5FA 4Y4HA 4KGZA 4MD0B 3B6ZA 3QVWA 3D08A 3C85A 4CADB 5B3AA 1AP2A 1MNUL 4ZW5A 3F6SA 1FNLA 1PU0A 1JQ5A 2IXGA 5DV9A 1CEEA 4BJ5A 3FU3A 4EUNA 1QDEA 4BFNA 4H8WC 2WP0A 1LO4L 4NT6A 3DWFA 3HHMA 2GFIA 1NI4A 4XRRA 4LBEB 5GISL 2YEZA 1T1SA 2VO8A 1WLHA 4YVUA 4M8SA 3VXRD 1B23P 3KQSA 3SE3C 1LEKB 5FBRB 3JSXA 2NPFA 3OLQA 1TTTA 4IXNA 2O8FB 4G8BA 2NY5L 5J12B 4RVCA 2CNWA 2EL9A 2I62A 5BN1A 1Q38A 1KTDA 1V3QE 3QO1A 3OKEB 3HZHA 1OSZA 3A3PA 3GD5A 5I6XB 4G56A 3J07A 2V3EA 3V4UL 5D1XE 5JIHA 3FMVA 2L42A 1SCDA 4C4XA 1GL6A 2G8NA 4CC1A 3QZPA 1NJ9A 1OASA 1YZUA 1NGZB 1B2RA 4XRCA 5DGCA 2QTGA 1UADC 2AQPA 3IKJA 2QQQA 1I5RA 4TSBH 3VOAA 2H2WA 4C0AC 4BLVA 5BV0A 2PYED 1PFOA 2RMNA 1Y6NR 2OCCB 3ZZ1A 3BIBX 3S8GB 3NG1A 4XWOA 1GYUA 4MVJE 1A7NH 1IBMB 5EA0L 3T94A 3P9CA 3VSEA 2I6TA 1IQDB 4K3EL 2X58A 1RULL 5JNYA 2WVUA 1S9VB 2R9HD 2IYUA 5I66B 5AWNH 3KJXA 5KVDH 3RPIA 4F57L 1CE1H 5AAPA 3F1KA 2PL1A 3H8JA 2C9UA 3RHTA 2VOEA 3EXIA 2OXRA 1U21A 2QGBA 2G75B 4URWR 5U4XA 2XACC 3O6FB 4CMEC 4XYEA 3WEMA 1ABFA 4QHYA 3TLEA 3UW3A 1XR9B 2ESVB 1GEEA 2MCFA 3X1KA 3I1FA 5BY2A 1HLPA 3D9QX 4RMTA 2ARWA 3AUTA 1JPFA 1EE1A 3K9HA 1OX5A 3K2UH 4HRVA 4K87A 3DIFB 3QRGH 2E86A 2ZOKA 2YC2C 1G84A 4Y2OB 4DVBB 2XVLA 2WKOA 1GRNA 4NO3A 5C31A 3CVHB 5L3SA 3NWJA 1DO6A 3OCWA 1GPLA 4A6XA 1KELH 2W9EL 2XBUA 3LT4A 1AGRA 3M3DA 1MFAL 4PANA 1QRSA 5B22A 4IUCS 5EJ7A 1JKIA 5E95A 4R1QA 4W1SA 3VHXB 2FPRA 3D7LA 1IQPA 3CHQA 4I9XA 4OV5B 3MODH 5IQ9B 3HP1A 1AKJB 3FMGA 2XRZA 3GBNL 1AZSC 1MFUA 1KPVB 4AKQA 4F1WA 3F05A 1WMDA 2JGMA 3K0HA 4DP8X 2WGXA 3D02A 5KJFA 5LGYA 5EMMA 4EFMA 3MXVH 1G4AE 1A6UH 4KHTL 4RVOA 3B38A 4OIFA 1EJ2A 1MO2A 5FPIA 1Z07A 3TASA 2CB9A 4Z49A 2VXSL 3D5OF 3HDVA 1FK8A 5BMOA 1TFHA 3QFFA 2B7LA 1ZD6A 5K01A 3PWSA 3UV6A 1TU4A 3PTLA 4L15A 4YAWA 1YNLL 1NFIB 1M3JA 5IR1A 4ONHB 3ZUCA 1DJOA 1MVYA 3E9TA 2QAGC 3WG7B 2GN0A 1FAIH 5AJHA 4FG6C 3VH2A 3FHTA 1BZ8A 4U7DA 3CXDH 1ML4A 4Y16B 4X6CE 3HP4A 3QUZB 1EGAA 1R18A 2OFQA 3AOEA 4MFHA 2R2EA 4O51B 5D5HA 4JL1A 1Q0LA 4KIFA 1QBMH 3PFHA 4IMPA 4DUZB 1KOGA 3FVRA 2JK5B 4OOFA 4PBRA 5GHWH 2E76C 3EDCA 1ZT1A 3DULA 3R7AA 2O2ZA 3PC7A 1KTCA 2UZPA 3JX9A 4QU0A 2AOXA 1ZHLA 1Q44A 1LYQA 1B76A 4I1UA 1JKMA 2ZF9A 2O7VA 3UTTE 4ZCQA 1E5XA 1CXLA 4ZFFA 1Y18B 5HHPA 3D8RA 1IM3B 1I85C 2GZMA 3A9VA 4P31A 4AD8A 1D9KA 1WSDA 4QTZA 1MOPA 4I50A 2VLRA 5FPQA 3OC6A 5K33A 4AKEA 4NB7A 4EVSA 3VFNB 3ZQ4A 3DEKA 2CDBA 3ZBTA 3M1YA 4PLCA 4DPAX 3HN8A 2P3LA 4ALIA 3QCTH 2LFEA 2PVCA 4LCVA 3HMXA 2PY6A 3AUSA 4S11A 2J5RA 1P80A 5I75B 3B1XA 1F1BA 5GGTH 1CE6B 1H2HA 3QDHA 1Z2KA 1ZHHA 3RK4A 4YMUA 3W38A 3HLTA 5F3HB 1W4LA 4L37A 2HTLC 2DR0A 3FLBA 2H4YA 4NESA 3DC7A 3T3PB 4YDVA 1TCRB 1IWBB 1XWFA 4FP8H 4AYTA 2CK0L 5ALEA 3Q3HA 3KE9A 5G4NA 4EJMA 3SMVA 1WPXA 2GN2A 3T4AC 1VENA 3F8TA 2GB2A 3ULUL 2JC3A 1BYPA 4IGAA 3JQFC 4QOEA 3NJGA 3GMLB 3T34A 1NP3A 2JFCA 4IIQC 3LLUA 2WIKA 4KODA 1R3HA 2Q2NA 4ABTA 2VH5H 2QRQA 1GZ3A 2FSVA 2ZUBA 3JWNE 3D25A 4OZIB 4GAJH 3W5MA 2Z98A 3CFJA 3WKPA 5JIBA 3OQOA 1SU8A 3JYNA 1Y8ZA 2VP4A 4L4ZA 3M1IA 2PUJA 5JALA 4MB1A 1ZCZA 1T0UA 4PSCA 1TUEA 1OW0C 5CXXA 4FMCF 3T61A 1QLEH 1MIOA 1O5IA 2Z2JA 5FH9A 4UBLA 2O3UA 4B3XA 1U8KA 5IEHB 1KYIA 1X7WB 4YT2A 4BFIA 1HE8B 4GQPH 5CIWA 1JK8A 1WS6A 5HZHA 3WUWG 3L01A 4OJQA 5EZIL 1CF9A 5ITWA 1TJ4A 4MYHA 5EUCA 2SHKA 5D4QA 4L29B 4GUAA 1FP4A 1BRTA 2E74C 4NCHA 3ZI7A 2XVZA 1CFTA 2NSJA 3SDAD 3I8XA 2PYFA 2EJ1A 5JOEA 1MIEL 3TMAA 2VNJA 3E1KA 4E5SA 4LW8A 2B4KA 2V7GA 4A9AA 3AW8A 1DC3A 2FKNA 4XYBA 4XC3H 3FFDB 4K9EL 3AETA 3SVLA 4KO9A 2WG0A 4TS6A 2AV7A 5BVPL 3QIUC 4A2MA 1CJUC 1G5PA 3AVWA 1HEJC 4EIWA 2BNRE 4XCFH 3B5HA 4IOKA 3FLAA 1T1GA 4NUQA 1W2KT 4L27A 2QU7A 1JBKA 1XTIA 2QMHA 2HI0A 5AW8A 4EW1A 3OAYH 1KS2A 1U04A 5DFTA 1NINA 4EUHA 3DX6B 2OUIA 3RUFA 1TYZA 4EQ6B 2OTPA 4KRFA 2CHVA 4LLQA 4JY6B 1OWMA 1M7HA 2PEZA 1Z7YA 3BPSA 4F58H 4H8QA 4ENPA 5JS6A 1IAKB 4UNNA 2E9IA 1V9SA 3I1IA 4QASA 1YUMA 1PEZA 4I6EA 5IQ7H 2F7SA 1B73A 1V2GA 1R47A 4O3UB 2PSEA 4ZO8A 1ZV9A 4WF7A 4JFOB 3BXFA 5NLLA 3AG6A 4NNYB 2CL0X 2EEDA 5T1MA 5I9QB 2FDBP 2DH5A 4J23A 1N67A 2FN4A 2IW1A 2A86A 3ZV6A 3H99A 1VEPA 2O6EA 4F8TA 1A3LL 2YKGA 4BCXA 4TUYF 2WVHA 1JRLA 4PCUA 3K5SA 1ZYUA 3MW8A 3PUIA 4P99A 1J7JA 4GS5A 4D9RD 4QXTA 3KUKA 1ESCA 1H4QA 3WMXA 3I9NA 1Z0MA 4KSBA 3CLRC 2B59A 4YB8A 3DC2A 3IPXA 4J28A 1XVTA 5FYLL 5B8CC 3D0OA 4ZJYA 3WXVH 1D1SA 4PG9A 4TVPD 2VITA 4RZXA 3RY5A 4WFQA 1UXWB 4YT8A 3SOBH 3FVWA 2IWKA 4BWGA 1R0YA 5ADHA 3UHPA 4FKZA 5K0LA 2D7NA 2MTPA 4JUTA 3MOSA 3OJDA 3BKYH 2VDWB 1X5AA 1QR2A 1T4KB 1PPIA 1AMNA 3U7FB 5HE9A 4NVRA 4EY5A 4WXRA 1WXFA 2P80A 3EW3B 4F6LA 4Z3EA 3HDJA 1UADA 1M9SA 3KELA 5KYYA 2PMFA 2Y76A 3VPFA 4CVWA 3WN5A 4HKZB 4G4GA 3DKRA 2OI9C 4HWZA 3G59A 4JFZL 4WFEE 2KZ1B 4RA6B 1GQ2A 2FZ3A 5IASA 2CPUA 1NX9A 3V2HA 2NQDA 5LD2C 3DUSB 2HK6A 1QF6A 1F97A 1A7QH 3VQLA 4B35A 4P4LA 3NI2A 4BNVA 1PFCA 4M9PA 5PAZA 3VFPB 1SUJA 3F6IA 2V7PA 4CFZA 4ZQGA 1JXFA 5DOVA 4HJTA 4MWSA 5BWLA 4UNUA 5D6DA 1RQLA 3RKUA 3RT7A 2C5GA 3VXRA 1EA9C 1U1CA 2XWSA 4Q8BA 2XJLA 2XWTA 2IP2A 3ULVF 1K3ZA 1SIBE 2O3TA 3PPXA 1ISIA 4Z5RA 2DAVA 5FECA 1U3HA 4HAWA 1PE0A 4LMQE 5FYKH 3MRPB 4X7TA 2B08A 5ELMA 2OSVA 4GAGL 1EIBA 2CDCA 5DJ6B 4IJ5A 2DQGL 3SDYH 3PFKA 3DAPA 2AOTA 4KPUA 2NTVA 2H32A 1EFCA 2IOHA 2VTKA 2Z9TA 5AKTA 2RGUA 3KWUA 2C59A 2C94A 1S4QA 4JOCA 1CHNA 4PV8B 1KDYA 2EIKB 5E8PB 3V0WL 1B42A 4D9JA 2CLZA 4A0FA 4DQ0A 4A2CA 1SKUA 1R0AH 1BEYH 3KZOA 3T3HA 3ZCPA 1SRQA 4F3NA 5DD1H 2V8BA 3CSBA 2IXQA 1OXVA 1RYNA 5CXQA 4PRPB 1MCJA 3NBNA 4BQ9A 4DCVA 4OLVL 4BZXA 3WWOA 1R0SA 1T6XA 2R51A 3VJLA 5CZKA 1EFTA 4RKQA 1FNSL 3PQFA 3WNVA 4XB3A 4AQDA 1I1NA 2GESA 3MRGB 5ICCA 3OM1A 4FHKA 3O1JC 1OTUC 5IMSA 1SO8A 3D0AA 4W6XB 4GYYA 1ZH2A 3GNTA 2R79A 4RV4A 3K6OA 3GUTB 1Z6YA 4NO0B 2ARJA 3DSFH 1RRFA 3TO5A 2GMWA 3HE3A 1KBOA 1VYTA 4R1UA 1EFKA 1MFDH 4MQEB 1NMCB 3VPXA 1S7UA 1MW3A 1HDYA 3LQ1A 5FR1A 1FA4A 4CEIA 4QODA 2WIFA 3JPWA 1GCAA 3MJRA 4YS6A 1QVOB 4TZTA 1DP0A 1PNRA 4IHJF 4YREA 3QUXC 2F3UA 4WL0A 5I7SA 4EENA 3EO1B 3MBXL 5JVDF 1SB9A 3F04A 2GBFA 1JDPA 3OKOA 5E38A 2E4UA 2PAFA 3DVLA 4Q7KA 2I9PA 3W7AA 1AR1C 1JIXA 4Q34A 2I5YL 2NNAB 5CJXC 1PY9A 1UP4A 1KVSA 2NQCA 5I71C 2R86A 1D7BA 1PMYA 2NTYC 3TEZA 1NQBA 5DHYA 4NERA 3QG7H 3QBJA 4Z3KA 1RFDL 1NASA 4HCFA 4NN6C 2DUNA 2X6CA 4GPIB 1Z63A 2BFOA 1T0NA 1B2WL 4FXKC 2G28A 5TF1H 4HO1X 5E8NB 4ALAH 2ZJFA 1D7FA 3SZLA 2Z3FA 2R66A 1AUXA 2CD7A 2ZATA 4NDMB 5IJXA 4PJAE 1Y4SA 3H4VA 1JYEA 1FVCB 1RUKL 4JS0A 1I7QB 2WUCL 3O4LA 4GP4B 4G1UC 1NW3A 2A84A 1UWXK 4ZQKA 5HEKA 2PEYA 1ZHBA 3N75A 4M3JA 5HGGS 5C1MB 2CXHA 1PAMA 2VDJA 3FB7A 3HZMA 1ZMBA 3G1UA 5ERWB 1TZGL 2I3GA 1PYWB 4MV0A 1UDBA 3QQ4A 3MCWA 1JFSA 4Z78B 3BULA 3D1JA 2H07A 4MWGA 2QRPA 1NL3A 1G9ML 4REOA 2EAEA 4LSVL 2GTHA 2DFVA 1U0JA 3I9IA 4EYSA 4LLDA 5ID1B 3GT0A 3RS4A 3GLDA 1CLCA 4MIEA 3ZHXA 2GPJA 2QKIC 1QS0A 3UFBA 1XK6A 4MJ5B 2NX5D 2HJSA 5I66A 3SDSA 3O4VA 4F15C 3CT4A 5J43A 4KK6C 1JFRA 5CK5A 4ISCA 5SWZD 3QTLA 5DVNA 1I9RH 4KREA 1CYEA 1WMBA 3DE7X 4P22A 5DGQA 4HIJB 2JGDA 2O5XH 1QLFA 4X6CB 1V1MB 4TWIA 1ZH6A 3JQEA 1EUYA 3MA0A 3MLYH 1YR3A 2QADC 1TQ2A 2V96A 4XSVA 4LTNA 1H3WM 3TCLA 5L4IA 1A7AA 5LZ7A 5HGDA 3UMJA 1DBML 4BUCA 2GTPA 4PB0L 4D0NA 3JQ9C 1E2KA 2VK8A 2E4VA 4GVLA 5I1HL 2QGFA 3TQRA 3T3OA 5CZXD 3ME0B 2HH9A 4C56A 3C4JA 2ZIAA 4ZKDA 2VAPA 1Z9LA 1HYSD 1BIIA 4GKKB 4U49A 4CIYA 4URFA 3G5MA 1CZOA 3F5MA 4GGPA 5ILTL 5JMTA 3P9LA 1HT3A 4LXYA 1PGJA 3O21A 4XNUL 1SEQL 4AICA 2DJ5A 5DHAA 3T7AA 1UOOA 1N7ML 2DQKA 3GBML 1NLUA 1OF0A 4ZI2A 2Y9MB 3MINB 3DCIA 5D1XC 3BGMB 4X5QA 4LGMA 3RAGA 4BKMA 2P9RA 2JAPA 3DDZX 3BT2L 4XGNA 3Q6FA 1GZPA 5HTOA 3VZDA 3VDNB 3RGVC 4K3JL 1E1KA 4FHJA 1ECLA 5DYOB 3VXTB 4G1BA 3WRWA 1NSFA 3LKRA 3NHLA 1H19A 4TTVA 3URMA 1I7NA 3W8FA 4IEFB 2WZ5A 4DQDA 3HFRA 4RJLA 4CQNA 1DVFD 5E1OA 3NDBB 3BQUC 1A9QA 1S7GA 3NZ8A 4NXMB 1CJCA 1EEXB 4BO4A 4GFDA 4L5FE 2PGIA 4QNPE 4HN4B 4KCGA 3EYFB 4GR5A 1RJZB 3BKCL 2DYKA 4K6HA 3NOOA 2GBCA 2QW0X 2QM7A 4NMXB 3NGBC 3PWPD 1L4GA 4W7SA 4G81A 5JXEA 4ARCA 1FGVH 2X4PA 2YASA 4TLLB 5H2BB 3CX6A 4OGYL 4ZHQA 2AEQH 3RUIA 1XF1A 4L8SB 4D0DA 4GT1A 2QQLL 3ZGZA 1TD9A 2PR7A 2WZPA 5CD5C 3RYCA 1VFNA 2D06A 1KJVB 2RHEA 2YL2A 4TNGA 3W7BA 4U7TB 4UOQA 4XWTA 3ZDYB 3D7MA 1ZCRA 1F90L 4KNSA 1CB7A 4FR5A 2IALB 3U09A 2O54A 1QHFA 4JM4L 3H7BB 3HZOA 3L0SA 2FO8A 1R0ZA 5BYAA 2IP1A 4FSXA 4HQKA 4PJEE 1A9BA 3NDYE 4F5CE 1U7ZA 2VR3A 2CR6A 3D43A 4NNXA 3FKQA 4NNPH 4LQLA 1H2WA 2NYVA 2EJWA 3X14A 3SZ6A 4OJNA 1P7HL 2FPIB 2HKAA 5CILH 3QG7L 4JVMA 3UV3A 3B2NA 3LZFH 4A55A 4LT7A 4DOHE 1IFXA 4JI6B 1T7ZA 3QUMH 3A1CA 3WTWA 1LC0A 4HNAA 4F2EA 1ULAA 3I4LA 4PYMA 1UJTA 4NM8L 4XMVA 4BMSA 2X1PA 5TF1L 3U0WH 1BMWA 3DIVA 3CUWA 3O4LE 3P52A 4EJSB 5HHXL 1N6IA 3ABZA 4R01A 2X42A 1XXHB 2Q5IA 3ON5A 3U56A 3PNBA 3QKTA 4LVUA 2Y1FA 3VFWB 5IPFA 1VJDA 1L4IA 5BR8B 3B2EA 1AU9A 3VFOB 5E9JA 3GEEA 2YBRB 1QGUA 3I12A 4D1YA 4YAUA 4XTCS 1D5WA 1XRPA 5CFQA 3WP1B 4V0LA 3LKBA 4DANA 4ZI3A 1U6IA 4TNVK 5EZOH 2EXTA 2PMCA 4YGYA 2NW3A 2NU7B 1TB4A 4L6IA 1T8SA 3NEEA 1KEKA 3V4SA 3FC8A 1PNTA 2Z65C 5JJ5A 1XAHA 4QGBA 4RHEA 2JE8A 2A33A 3OLEA 2WAHA 3RX7A 2IHKA 1RK0B 4XNMA 3BH8B 4BUQA 4HD5A 3RFXA 4LGSB 3SYCA 3S40A 4XPZA 2QD4A 4I4LA 4ZYLA 4S1TA 4KBYA 1G8SA 4QXUH 4GECA 2PXCA 5DASA 2YD1A 4QYOA 2XE4A 1YH3A 4JFHD 4Y9CA 5EY5B 3L4ZA 2A0LC 2J1ZA 1VKHA 2G4GA 3EGXA 1G1YA 3NMEA 3BRGC 3WYGA 3JBG7 3MLRL 3DEJA 3HBAA 4CEJB 2QRKA 1VSCA 1A9BB 4XGRA 4IJ3C 1L9SA 1YUHB 1QSFD 1Y9ZA 2WG2A 2ZJAA 2DJIA 4WU5B 2PZLA 3IAXA 2QDWA 4O63O 1PVVA 3QZMA 3FUWA 3T71A 121PA 3VB8A 4HH0A 3OOSA 2AJVL 3HJEA 1DQYA 4FWIB 4WHMA 1PG2A 4WWID 5TD4A 2ZE6A 1FZTA 2CLCX 3KB2A 4R9NA 5HI5C 4K8RB 4R2LA 2V1XA 4OFYA 4PRNB 4L4TE 3RU7A 3OU6A 2UKDA 2GTWA 1FPQA 3D0VA 1WW3A 3NJJA 1YR2A 2VDLH 1XF4B 2I5YH 1ZEMA 4CQMD 2Z1NA 3H2ZA 4K5MA 2YK1L 2WVVB 2F3SA 2QNRA 1IM3D 1F4PA 2G71A 1CZHA 3K09C 3BMWA 2X1QA 4PJ9A 4FHEA 5BUGA 4IZHA 3TQIA 3BA6A 4J2QA 4WZ9A 4QYIA 1XRQA 5IK2A 3EGDA 1YJAA 4TYPA 3LLMA 1J5DA 4YSQA 3W81A 3A36A 5EMHA 2ZVJA 2DMRA 1E5YA 5CT6A 1ZUNB 3E4CA 3G6WA 4YY3B 4O4YL 4HPHA 4B7CA 5IT0A 3EXAA 1XNHA 3V0IA 2X9QA 1IATA 1K4DA 1EO8H 2ITFA 4RMVA 1G0DA 5IH3A 5EJ5A 2P9HA 2EHJA 3CSFA 1TSRA 2FECL 1WPCA 2O0HA 2ENSA 1LW7A 1DFBL 2MYNA 3GI8H 5D71H 1AD0B 2Y2WA 1RJFA 2DLCX 4YI5A 5IZCC 5CCGE 4KTEH 3SKUD 4JZJB 2WKRA 3BMOB 1BXKA 5JPDA 5K8TA 4IMJB 4Q9NA 3DL0A 3IUJA 5G0UA 5GGRB 4CKYA 4TYYA 1TETH 4BNDA 2O2GA 4X61A 3QJOA 1W16A 2H92A 5BMFL 4PRHB 3DMRA 5IEJA 1E7QA 1TM7E 2JLSA 3VH4A 4L2IA 4U9IS 4F9PA 5T7BA 3ACCA 4XMWA 3J81k 3KPRE 3D85B 4UZGA 4X7SH 2D1SA 5KEZA 4JJIA 2Q07A 3ARDA 1HL4A 2W2KA 2JWYA 2QTVA 3AIMA 5JISA 2CNKA 1U92A 5TQVA 3GF4A 2P6OA 4FQQB 4WI8A 1UPXA 3WL9B 1GGMA 2HH0L 2M6LA 1Q1ZA 3EGVA 3N6XA 1ZSNA 4MNGA 1MRFL 3E8UL 3ECQA 2P4SA 1CQKA 3FWNA 2FPOA 5IHPA 2MQGA 2VDNL 3UMGA 1YMMA 4A04A 2DQSA 5HJ7A 2H7VA 5TNXA 2HT4C 1NNI1 2Q5FA 3SGDH 3CMGA 4Y7MA 4ACPA 2YA1A 3NVAA 2C7PA 3VR2A 1LSSA 4MRMA 4MUKA 3EYWA 4MKMA 1OCWL 1BHO1 1VCBC 1CGUA 1RZPA 3VX4A 2V6JA 3NBMA 3A3OA 4C2TA 2GJ6E 4OJCA 5I4IA 1XF5B 4NQCA 4UANA 4DETA 3PNVA 2JLBA 4TS3A 1WBJB 4R2GD 4CMJA 1NF9A 5C2BH 2DLGA 4MRPA 4L07A 2PDAA 5DURB 1Z37A 3PR2B 2HRZA 1P5VA 4F2ME 1XNJA 3MDJA 5MFZA 3K70D 3ZNNA 3WLEA 1OTTC 3FJ1A 4EWLA 4Z1OA 1JWMB 4DLAA 2OGZA 4HP8A 5KNDA 1E58A 1Y82A 2XV6B 2VMFA 5FO9B 1SC1A 2V97A 3H11B 1ETUA 5T41A 3D9AH 3M4JA 2D0PB 3BH8A 4L4VB 4DOHB 1KEGL 1Y4AE 2YWRA 3NAAL 5A9TA 1MNQA 4UATA 1K5PA 2HPHA 3GAZA 5AYVA 2Q5HA 4M0PA 4BO2A 1YRYE 1JMYA 2QGCA 5F8QC 4RCVA 3MRFB 1FYFA 3Q15C 3SZMA 4MPDA 2Z2KA 3ZHVA 1A3CA 1AKUA 1FZMB 4BIKA 1OZHA 3P2JA 5E2VL 5C0NC 5JWHA 3AUWB 1CWUA 4BSVB 2FRDC 4EVIA 1NCDH 1RZJC 1S3SA 4NE7A 1O7JA 4BQFA 3F7VB 1F3DJ 4Z7NF 2P8MB 5JXAH 3HY4A 3KOYA 3OQMA 4OGYH 2WC1A 2YBRA 5J3HD 3TZBA 3I3BA 3CN9A 1TZHA 5BS0B 2P5WE 4G6FD 1SDDB 2Y9RT 4YTEA 5KS2A 5CDSA 5AUPB 4FONA 5FWXA 4Y9TA 1WOMA 5FQNA 4M4RA 1N9KA 2G60L 1E7YA 3AKDA 5KOHB 3ELQA 5LCVH 1DB3A 3BORA 4BB9A 4RLSA 2Z8SA 4UDNA 3I28A 1P2SA 1XF5A 4P04A 3L0BA 3QPXH 1HX7A 2Y8EA 4EMUA 4KJWD 5EL0A 1RJLB 4JGNA 3HPLA 4FQLH 2ZOKB 3I2JA 4FI3F 1DKPA 2QF7A 4U5QA 3LXXA 1KZYC 1G9HA 2JB6A 4GJTB 2LGJA 2NV6A 2BN4A 5KOJA 1KCVH 1NLDL 1NVDA 1Q6ZA 3F47A 2OK8A 4RK7A 2ODHA 3KYIB 1QE0A 3GCZA 3T7CA 5H35A 4E94A 3ISWA 5KNBH 4PLHA 4LY3A 4PRZA 1T9AA 3K05A 3PHOA 4O4HA 2HCZX 3BEWB 5C08E 1J90A 3HM9A 3OF2A 2C5EA 2HFEA 2SNIE 3MLWH 4GXUM 1GPUA 4IS2A 1QI5A 3A37A 2WICA 1AXTH 1WIUA 2J3KA 4K07A 1PNOA 1Q9WA 3ORJA 4DV2B 4G37A 4C56D 1SVCP 1AXIB 2XQYG 1QQBA 4V0QA 4E2ZA 5B1IA 5GZ6A 4CQMB 4LAQL 1RH8A 4U1SB 1E63A 4WK0B 3WWZA 1UODA 1VFOA 3EFDH 3PWNB 4R7DB 5FWAA 1XVAA 1YZLA 2QS9A 4ODUA 3UTSB 1GDHA 3QDMB 1M1YE 3AM1A 3KBPA 3BUDA 3BKWA 3OSKA 1G2IA 1NMSA 2GDJA 1FYTA 1UPAA 3BMNB 3BHNA 4OFWA 1L4KA 4XUDA 3AB3A 4XVUA 4FLFA 5IM5A 4LE0A 4LPXA 4YRZA 3RTEA 1HPLA 4U1NA 4AK2A 3G5ZA 2Q8PA 4TT3A 3SYRA 2BOBA 3IJEA 4F7EB 4ERNA 4YHZH 3QFJE 5CDTA 4O02B 5HYSB 5F9JA 2CO1A 2HA5A 1UXSB 3Q7TA 3DX3A 4EABA 1DIHA 5KTEL 2QTCA 4X99A 2JJTC 2C4FU 4ZNCD 1NRWA 3ICQB 3KPVA 3ADKA 1UKVY 1ZMTA 1RIFA 1JTTA 3QK0A 3KS9A 3CX5K 1G6Q1 4EFLA 1WQ3A 4HUXA 5JAPA 3IKTA 2EVHA 5ERGB 3ZHNA 1QTRA 2PWEA 1R5VB 1K8XB 2GZ3A 3FQ4A 1D2NA 4QTIH 1RZRA 2NLOA 3S29A 5E24E 4NBKA 4J1UB 3U5ZB 3Q1SL 2FG6C 4GKBA 1G87A 3WLAA 5C7ZA 1V16B 4LWPA 1T20A 3DVAB 3QVTA 4TXLA 1XLVA 1QKKA 4N4AA 3TDNA 3DGGB 1PW5A 4ZTZB 2PBLA 2XUWA 3T5TA 1BO6A 2NCEA 3MACL 5IHHA 4MRAA 3P69A 1A7OH 4TTAA 1PRYA 1KFJB 4ZAWA 5A4JA 4D4LA 1E98A 5TS2A 2B0SH 3HVRA 3KPYA 3EIQA 1ET5A 2WMDA 5BW7C 4LEOB 1GJIA 2X2FA 3HKFA 4PO9A 3PXLA 1DJNA 1DELA 3TOSA 3VFOA 2AMFA 3ARDC 3U7RA 5CH5A 1GNVA 1LTHR 3N06B 1QSEA 3OC5A 1VMDA 1BMTA 3D7PA 2Y1VA 3U46A 1ZU5A 2VK1A 2FWJA 3Q40A 3LPDA 4EE2A 2B83A 4FI6A 4EXKA 3QBTA 2AFHA 2V7XA 1QTPA 4H7PA 1AQKH 4NCIA 3DMMB 4HX9A 1L7VC 3FDIA 3GFGA 5E8OA 4I55A 1XI2A 1IY2A 2P3QA 1JSZA 1BQEA 5DLYA 1G8KA 3IVXA 3UK6A 3COJA 1XTTA 2HC9A 5L9DH 4H77A 3G0GA 5CZVL 1M9NA 3HBLA 1NBYB 3GDFA 4XE5B 3QKSA 4H6XA 2CFIA 4J29A 4TQAA 1N77A 3MXTA 2PNFA 1VLQA 2AWNA 1N7JA 5LU9A 2KQMA 5EOQL 4KK9C 4R1SA 1WTLA 3O9WA 1J05A 5LNK6 1MLBA 3OZTA 2WTMA 2CDEB 4KFUA 2QP9X 1YZQA 4LJ9A 1EVYA 1XE3A 3VXPA 5KWYC 3BIWA 3QH3B 2RGGA 1HU8A 1JQDA 3TO2B 5DTEA 3LZOA 1ZIDA 4B3VA 1NJ5A 1CR9L 5ERWA 1N64L 5DYFA 5FHRA 2A9OA 1BM3L 3L7FB 2B4CH 4DHEA 4JASB 1AKPA 5D87A 1X7ZB 4RV5A 4DY6A 1DSFH 4JANB 2NZ1A 3STLA 2CBGA 4HADA 4MJID 3WBFA 4QUBA 2H3NB 1OWRM 2ZP0T 5ICZA 4EKGA 4HJ1A 4LI3X 5EXXA 4AM0Q 3E35A 2ZUCA 2JRLA 4LF7B 1OSYA 3P71T 5KOMC 1CP2A 4KJQD 2VP9A 1I7ZA 4U5XA 4HWPA 5C7IO 1FYTD 1RAMA 2CUIA 3I01M 4ETWA 4RXUA 1LWRA 1YEDB 1JAXA 1MAMH 5DYGA 3I1YA 1Z34A 5AW1B 3DMMA 4M1DH 4MJ6B 4RIRA 5K0ZA 3BN3B 1NL0H 1L4YA 4WBNB 2NPLX 3I92A 4PG4A 3U36B 2G75A 2A35A 3KW7A 4AL8C 4NZRH 3TBKA 3TWOA 5BURA 2FB9A 5B64A 2D1FA 1TF5A 3K0SA 2R83A 3L0OA 3C0KA 1VPLA 5LA6A 1CQPA 3TQHA 3B34A 4L16A 4OVVA 2FH8A 1CLYH 1X38A 1JAHA 3UJ3X 1TCCA 4BNYA 4G01B 2D54A 3OJVC 3WK4A 4WLOA 1F4VA 3B3FA 5IW8A 1G5HA 4YNYB 4PAWA 4P5TB 1FH5H 1GC1C 2BZ7A 3JQ8A 4JSYA 3V3TA 2DR2A 2ZKHL 4HUVB 5IM7B 3GAMA 4PZ9A 3TSCA 4MAMA 5FBLB 2FIKA 3FPEA 2Z6UA 4DTCA 2YBDA 4FUQA 4ODVH 4X54A 3HUEA 3PHIA 3SK0A 4LDCA 1U93B 3DR5A 1XQVA 2Q8BL 3OOHA 3KYNB 4GZ8A 4C57C 1IC7L 5IFLA 1C1EH 4DN3L 2YZ7A 5I6XC 2CFRA 4MDFA 2ZSWB 4YE0A 4UT9L 1KYAA 3D3WA 1PFQA 2COEA 2F1HA 4I14A 4HA1A 1CY2A 3FQTA 3JV6A 1T1XA 2KLBA 3RTDA 4ND5A 3G7SA 4ZP1A 1IFHL 1OZGA 2QM3A 3FTGA 1BQ4A 3DLBA 3AU1A 5LQDA 4CMEA 2DQCH 5GS1C 2E8ZA 4TWJA 2I0FA 1CD9B 2QDKA 1KTIA 4XBGB 1E1DA 5IFKA 1JFTA 4KWTA 3NIWA 4UREA 3CBRA 4FW8A 4QHTA 4YUVA 2WXQA 4G8CA 1OVMA 1K86A 1VBFA 2X0UA 4EQ3A 2C82A 4KXCA 4YWHA 5FUYA 3P5BA 3CLFH 1RWNA 3RT1A 3BP5A 1VZ3A 3ZK9A 4PAQA 1NPJA 3HV2A 1A1NA 2HJGA 2G4EA 1K7EB 2GBVA 3FU6A 1K6JA 1NYTA 4S1NA 4TLSA 3V4PL 2KM1A 2VKWA 2HU8A 2BM0A 4E5NA 2AQSA 4TTJA 5ABDE 3WHLA 3D3KA 3VXMA 2NXEA 4WE3A 5F73A 1MVUB 1GPBA 1D6EB 4Y2LA 2OMZA 3QE4A 4D81A 4FJYA 1WFJA 4CF3A 2FQYA 4V1DB 1OFTA 4OW6A 3PL6A 4JO5A 3C7DB 2QMUA 4NMLA 5SY6A 5DJAA 1ZL2A 3VFRB 1C5DB 4IDNA 1YD7A 5AIAA 5I01A 1TLKA 3KGSA 2X76A 4GKLA 4XPGL 4GW1A 2C2YA 2YW9A 2C3MA 5G3YA 1QGDA 5FPKA 3MV9D 5IK3B 4P5TA 3L8FA 2QT0A 4DGIH 3UMMA 4TS4A 4HGQA 3GVXA 2E4YA 1DVYA 4JFUA 4J07A 1PL3A 2R1VB 3PWLB 1OGJA 2BOVA 1C3VA 4N90E 2VEDA 3U83A 4D9RE 3C1OA 4PG8A 2H52A 2BJVA 4W9RA 1NC4A 3IP6A 4CEHA 3L8YA 4GNKA 1Z62A 1R5WA 5K9OA 2Q62A 5LLIC 1H69A 3BA1A 3JQDA 4D25A 4HUWA 4FDTA 4PY2A 2CLKB 4KO7A 4NS0A 4ODSH 4X00A 2V17H 3DE1X 4PJBA 2BFDB 1NAML 1SM4A 1UM6L 5KQRA 4HSQA 1Q1JH 3K8OE 3D5QA 3I9PA 3C16C 3ATFA 4JELA 1FFCA 4LLYA 4L4VE 2IS1A 4L8GA 2JHCA 3K5IA 5TIIA 3OU7A 2VT3A 1BOGB 1RUPH 1UURA 4O4JA 1NH6A 1N18A 2ZSKA 4MV3A 2G76A 4E13A 5LB4A 4E11A 1HO3A 3LSOB 3TN7A 1GLNA 4N8CL 1YU6A 2JAHA 2CHXA 5IJZA 4PM1A 4WW2C 1KORA 3BP5B 5TK4A 2G4CA 2R4QA 5F8RC 3HS3A 4JU8A 4EKYA 2EE9A 5DR5H 1O5PA 4HLZH 5BJTB 4UQPA 3KSAC 4PS1A 1JUFB 5ALZA 2ZKWA 3NRBA 2J0EA 3GRKA 2WSYB 2FB4H 2O61A 5IJCC 1DTSA 4V1DA 2C8VA 4WI2A 5JCOC 2VMCA 3ER8A 1UFOA 4MA4A 3QIUB 3WB2A 3AT1A 3QF7A 1LJMA 3ZWYA 5CB8A 4GG6E 2CO2A 1ZK3A 4LRYA 1T8YA 5CWSB 4EVQA 2VR6A 2YOCA 4MXQD 2MCG1 4J4HA 4BNIA 1MJJB 4RKWA 1J8SA 1QBLL 5EDXA 3QPQC 3CC5A 3U1SH 2CSUA 4BQIA 3FLMA 3TPUA 1NBHA 4PY8J 1KMQA 4HC1A 1QC5B 5I1DB 3R6LA 2BGGA 5JLZA 4CPDA 4HGPA 3T5DA 1D1TA 2BZ1A 5HY9A 3SNHA 2X23A 3RILA 5JDSA 5EIFA 3F6CA 1YVPA 1E5TA 4A0HA 5HQJA 3CR8A 1DL5A 2R00A 2J8OA 1VPOL 3UHOA 5CAYB 1P6AB 3EW7A 2CXOA 4JA2A 1VLHA 4PS4L 1EE9A 2J1XA 3JT2A 3VYVA 1ZUIA 5HS6A 4YE4L 1XZ0A 1BJRE 5L6MB 2IYOA 3V7NA 4D4HA 2GJSA 1X87A 3B1KA 1NDGB 4H8HA 1U93A 1XDBA 4D2IA 2XLLA 4KX5A 3DX1A 3CVHL 1NEPA 4PWEA 1XDZA 2ZSHA 5F23A 1LPMA 3UTCA 4XN4A 4DF9A 1TYAE 5IH7A 1F38A 2YS7A 5D70L 1NIAA 4ICIA 3EYSL 3FGPA 5ALRA 2ARJQ 4D8OA 3HJAA 3M6FA 3P1JA 1MW0A 1KE2A 4OLUL 4HOXA 1JFHA 3AOEC 3C48A 4DWVA 2Y36H 3IP1A 3B2QA 4DCPA 2XMBA 2ZJBA 1ONOA 3QI9B 4N41A 2WTUA 1JI0A 3CFCH 3S34L 4Y1EA 3IAHA 1SYSB 3MBOA 4LV8B 2E82A 3VUAA 1X1TA 3MJ9A 3H9HB 2EDBA 2W42A 3RTQD 1YECH 4CNQA 3H1ZA 5I47A 2XE7A 3FNQA 4GMFA 3U4MA 2C1EA 1GRCA 1AKJD 1G6KA 4YRLA 5DGIA 2X10A 1D4ZA 1QSZA 5ISMA 2HRBA 4DSTA 3LA6A 4M55A 2H8PA 1I32A 5FTJA 5TC4A 4HUCA 1DSSG 1VKXA 1JG1A 5C8YB 721PA 4KI5F 2JKZA 1EX6A 4QOKD 3OA0A 2VITB 3FFBA 1BIIB 5I2IB 5HM8A 1D4AA 4OCWH 2X9ZA 4D9IA 3HBZA 1PUJA 5I17B 4GW4B 1NOAA 4DLKA 3WFDH 1KYXA 5KAMA 4R0LB 2VN3A 1X3SA 5DS2A 3L5KA 4UEWA 3C1AA 2YD0A 3HS9A 5DW0A 4G8GA 2HOQA 3WAGA 5CD1A 4P2QD 5EU5B 1Y1UA 5LUBA 4G0UA 4X9HA 4P9MH 3KAQA 4MB5A 4R8RA 3PPWA 5D4IA 2R8BA 1ASPA 2IIQA 1MXGA 3ZTTA 3F9IA 4JCOA 2WQXA 3K6RA 4O5AA 1A6ZB 4XO4A 1DEXA 4IRSA 3DJ9A 1JHVA 4WVLA 1WM1A 2J0VA 1UEMA 3U81A 3V2AR 2B8WA 1ZEAH 1Z5LB 4Z7WF 2VJOA 5ALJA 2R69A 3MYYA 5KQPA 5GJSH 2R7EA 1W88A 1FNEB 2L8AA 1BC5A 1XFPA 5IXJA 1V54B 2R2CA 4X93A 1RQNA 4ZK6A 5CA0F 1S7SA 4X20B 4FYJA 5IYZA 2NY1B 3LRKA 1E20A 4DZZA 5I19H 5FUCC 4MHTA 1GYVA 2XZDA 2GITB 4F71A 5I74C 2JLLA 1C41A 2O61B 4DERA 4TTRA 5C0OE 2XZAH 5A4FS 2FH5B 3PEYA 25C8H 4K9SA 4CGZA 4D3CL 1OT5A 1PZMA 1T0OA 2Z8XA 4GMHA 3BXOA 3ZYIA 1VHJA 2BGTA 2C7UA 2Z2XA 5IBCA 1SHMA 1XRRA 3ZRFC 4KXFB 4K05A 3B9BA 4I19A 1WS7A 4Q48A 2QRHA 3R1IA 3R8XA 3CFTA 4H20H 2R3SA 3CFIC 2ADMA 1TZMA 2QVIA 4AKPA 2QLJA 4RGNC 3EIEA 3MRJA 2HMSA 3RLFA 4KRNA 4J39A 3HCVA 4U4AA 1E9DA 2J3LA 3S37X 1OZ0A 3DJZA 3I1JA 3WWDA 1KTVA 4NRXA 4XJTA 4DN4L 1DLHB 4U1IA 4AQEB 2KJQA 5JH7B 4JUBA 3D06A 3W39A 1ST2A 3OKCA 2O6DA 3HBGA 4GSDL 1O0CA 3CVDA 2B2XA 3KDSE 3THOA 3O1IC 4EI9A 3PQDA 4DIXA 1VL6A 3WFZA 1IVYA 1ZJYA 1T6NA 2ZPKL 1KLUB 1CQIB 1HH6A 4I1RA 4WO0A 5FWDA 2AVGA 2VDLB 2QDXA 3HE7D 1QZNA 3KQKA 2H1LM 2ZTSA 1HSAB 3FRUB 3LKSA 1UQUA 2A4KA 4LC9A 3PP8A 4XH9B 4TVOA 3S96B 2QPLA 5FUWA 2DPKA 3M3PA 2EYSB 3AZQA 4CRPA 3CU7A 4N0CC 2EEFA 4MXVF 3ULUF 4IU2A 4V33A 2F8SA 4AL8H 3GJFA 3EDJA 2QJRA 4NYIQ 3B9KC 4KHTH 2XT0A 4WA7A 5DVPA 2IAMC 1HLFA 2GJRA 3GJTA 2CMDA 4KIWA 4P4NA 2J32A 2VN6A 2ZOOA 4KBFA 1RIUL 1TTAA 4EG1A 4MIKA 1MX9A 4L3CB 5CA1A 3NORA 5GGTL 4F8OA 1QSGA 5E6IB 4YIQA 2GF2A 2KX7A 2MHCA 4R0NA 5I9LA 1V3LA 4HG4J 2ZCZA 2ZRGA 5ILQA 2ZJ4A 1MFAH 5D1NA 1FXSA 1XBRA 1NC2A 4QWWA 4G5ZH 1NRXA 1IIIA 1Z5YD 4ZV7A 1GKKA 2HR1A 4RS3A 1N6QL 1KAGA 2K1MA 3AI1A 3FVVA 4MNQA 1QJCA 4FULA 2OXTA 3WLLA 3AC0A 3V1KA 4G9FA 2YYAA 2PSDA 3P4NB 2FXIA 4HUJA 1VBKA 1WW8A 2WHQA 3DVAA 1FFBA 3LC7O 1WGVA 4AQ1C 1OPGL 4V0MA 4LGCA 1F12A 3DVNA 4QLAA 5KBNC 2FEOA 4MWOA 3ORHA 2D13A 1FCCA 1NBWB 4EQ2A 1SN2A 2WBLC 4GM4A 2CIKA 4EL5A 5ISZA 2BHLA 2R23A 1QBLH 1GFSA 1M83A 5C80A 3REVB 3QDGA 1J8MF 4JRYA 3FF7A 5DZVA 2O7NA 1QM5A 3FDZB 4FHDA 2DX7A 3E23A 4KLRA 2DBLH 4ZS7L 3UPUA 2AOUA 5FA4A 1XN4A 3M6VA 3A0OA 4PJXA 1PG7X 4DJJA 5EHIA 1I8MA 4RH3A 1EA7A 3KPSB 2OFPA 1XIWB 1XRSB 2A5FA 2J8ZA 2O8EB 3OZ9L 2JFWA 1UWGH 2E75C 3NCJL 2MSCB 3WGVB 1OFUA 5DQJB 1GDTA 3GIVA 5K3OA 1QABA 1IGJB 3CHXA 1ADFA 3ARSA 1G9MC 2AJCA 1HORA 1TX4B 4J91A 3L4SO 3LY7A 3CZ4A 2J8UB 2C9BA 2DQUH 2DT8A 1QYIA 4W9DC 2JD1A 4RA3A 4KDFA 5C0CE 2DHCA 1HCZA 1U5CA 2HZHA 4JVSB 2ZJ5A 4Z3JA 4M9RA 4BB6A 3GMQA 4RMNA 4JRWA 1B4TA 4HUWB 3RVOA 1XLTA 5KNCA 2CLHB 1OQOA 3ITNA 2HLNA 4BO0A 5F9WC 3EQ2A 3GLEA 4LBAA 1WBBA 5G41A 1R2QA 3RWIA 4JFSA 4Q7MB 2QRMA 4ED9A 1SXJE 4F7KA 2F61A 3L0CA 4HC4A 1MCHA 3P3UA 4HOZA 1JQJC 1J2RA 5F33A 2V7UA 3EAGA 3T8XA 2AC4A 3G85A 4O58H 3AU9A 2BWIA 2ZFUA 1C9KA 4CGTA 2C3PA 4GC5A 3GBEA 3RUAA 3TM5A 3WAJA 4I5BA 4XMKH 1C5BH 1T8WA 3FZEA 3RL1A 2BX5A 1JPST 1Y1SA 3Q8CA 2O4CA 4RGOH 1LMIA 5C8DA 3QIBC 1A22B 1RZ8A 2FEXA 2R56L 2AW5A 4JYZA 4X8HA 2VW4A 3VR1A 4L28A 2PMDA 2LKDA 1LDPH 1DTWA 2Y72A 2O1SA 1E7UA 4Q7DA 3VOTA 1A7JA 3GGOA 3QA3B 3LH8A 4ZXBA 1NVXQ 4IBOA 1EK6A 3P2YA 1P1ZA 3WYBA 1ULBA 4RK6A 5E2WL 1YC5A 2WINB 5F3DA 5H80A 4K8RC 1SVKA 3TMYA 4MKHA 4F3FA 5HDRA 4Y2UA 4JL6A 4DUWA 1NXOA 3BIAX 4ADIA 5KS9B 2Q3ZA 5FYDA 4XI5D 3WDKA 3O4FA 1FGVL 5KSVA 5GRUH 4JG0L 2ZWIA 1FS4A 1Q0YL 1V7NL 1JV5B 1ISHA 5LWYH 1Z2OX 4D9KA 3MZGB 5FYLH 3TC9A 2R4TA 3NZSA 1Z18A 3WHE0 4Y1RA 2IOYA 4X6LA 2PXYD 3EGOA 2LNDA 4N0FB 3BWZA 1R6UA 3EW9A 3EEOA 1KJWA 2R44A 1H6UA 4H1TA 4TVPH 3TH5A 1IXKA 3V0GA 5J6GB 2HZBA 4ZD3H 4JFDD 2IEPA 4I9UA 4CMHA 3EGCA 1NLZA 5BW4A 5D51S 3MV7A 3GZNB 2VPYA 3FO9B 5GOZA 1JQBA 4X6BA 1HZHH 1QGUB 2D0GA 4I48B 4C5CA 3JW8A