5E79O

Macromolecular diffractive imaging using imperfect crystals
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 55
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2015-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5e79O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5e79O02
4PJ0O 5G38A 5G39A 5E79O 5H2FO 5B5EO 3A0BO 5KAFO 5B66O 4UB6O 5GTHO 3KZIO 5TISO 2AXTO 5G3AA 5KAIO 3JCUO 4UB8O 1S5LO 4IL6O 3WU2O 3A0HO 5GTIO
chains in the Genus database with same CATH superfamily
3VZTX 3PQUA 4GCPA 3POXA 4LSEA 3AA7B 4N58A 4PJ0O 5G39A 3HWBA 3LK41 4XNKA 4AKRA 4QQ1A 4RJWA 3SY9A 4FRTA 2W80C 3BS0A 5PRNA 3DWOX 5B5EO 5H2FO 2F1CX 1P4TA 3AAEB 3SYSA 1G90A 2R4NA 5B66O 3KVDD 3KZIO 4AFKA 2PORA 2K4TA 4AZLA 3DWNA 3LK2A 1GFPA 4E1SA 4GHBA 3LK3B 5JDPA 4G76A 3AA1B 8PRNA 2PRNA 5GV0A 5D5DA 1Q9GA 4K3CA 4KR8A 4N74A 5ADXL 2X9KA 2ZLDA 5KAIO 2R89A 3QRCA 4UB8O 4C4VA 3PORA 4AYNA 2M06A 3AAAA 2FGQX 2KC0A 3WU2O 2F1TA 1Q9FA 2Y0LA 5AFUK 3T0SA 3GP6A 4C00A 5DL7A 4B61A 5GTIO 4AYDC 3DZMA 3PGSA 3TZGA 4N75A 1HXXA 5E79O 4AYEC 1OSMA 2JQYA 3BRZA 4G75A 2XE5A 1MM4A 2XTRA 2GE4A 2MHLA 3POUA 4U9CA 5EE2A 4RLCA 5T5FA 4RJXA 4AUIA 1GFNA 4RLBA 3V8UA 5KAFO 4UB6O 2QTKA 6PRNA 5GTHO 4O4UA 2YNKA 3O0EA 3WI4A 4O49A 3QRAA 1ZHXA 2KXPA 3VY9X 2IWWA 4RL9A 2Y2XA 3AA7A 3PRNA 3DA4A 4LSFA 3LK3A 4XNLA 2R4OA 3T20A 2K0LA 3AA1A 5DL6A 2FGRA 2O4VA 2JMMA 4JCHA 3UU2A 4FZMA 4LSHA 3PQSA 2MNHA 3AA0B 1T1LA 2N2LA 5G3AA 3AAEA 2KZ7A 4GCQA 4FZNA 4C4VB 1S5LO 3LK2B 2LFUA 3NJTA 4Z3TA 1H6S1 4O3XB 4FUVA 1HXUA 3JTYA 1GFOA 4FZLA 1ZHWA 4AYID 2KDYA 3PGRA 3HW9A 2WVPA 2N2MA 2Y0KA 1ORMA 3SZVA 4FSPA 3AA6A 2W81C 4FSOA 1PRNA 1ZHTA 2XE3A 4FT6A 4BUMX 4D5UA 1HXTA 1PHOA 3G7GA 4N59A 3LK42 4AYMC 4O3ZA 3NSGA 3T24A 2WJQA 3UPGA 2XE2A 3K19A 4O3WA 2XTQA 3BRYA 2XG6A 4KRAA 2ERVA 4FRXA 3PGUA 4JFBA 4C69X 3JCUO 3PF1A 2OMFA 1THQA 1IZNB 1OPFA 2KZ7B 4IL6O 2XMXA 4PR7A 7PRNA 3HOLA 4D65A 2KXPB 2XE1A 2YPVA 1ZHYA 4O4XA 2WJRA 3A0HO 4LSIA 5DL8A 3VY8X 1MM5A 3AA0A 5G38A 4K3BA 2LHFA 4AKMA 5FVNA 3HOEA 3POQA 1BH3A 4AKRB 2Y7SA 4FOZA 3DA3A 2R4LA 2R8AA 4FQEA 1YS5A 2M07A 5DL5A 3AA6B 3A0BO 2ODJA 3VE1A 4D64A 5TISO 4F4BA 3AAAB 3UAQA 3WI5A 2X27X 1QJ9A 2J4UP 3VZUX 1QJPA 1GFMA 2J1NA 5G26A 4FESA 2F1VA 1BXWA 1ZHZA 2Y0HA 3VE2A 3SYBA 3VZWX 4PUXA 1GFQA 3SZDA 5ADXK 2ZFGA 2AXTO 4FMSA 3C5OA 3FYXA 1QJ8A 1BT9A 4E1TA 1IZNA 3SY7A 4O3YA 4KR4A 1E54A 1MPFA 3A2SX 5AFUL 2IWVA 3EMNX 3RBHA 2R4PA 4CTDA 5IYUA 4GCSA 2R88A 4GF4A 1T16A
chains in the Genus database with same CATH topology
4PJ0O 5G38A 5G39A 5E79O 5H2FO 5B5EO 3A0BO 5KAFO 5B66O 4UB6O 5GTHO 3KZIO 5TISO 2AXTO 5G3AA 5KAIO 3JCUO 4UB8O 1S5LO 4IL6O 3WU2O 3A0HO 5GTIO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 O;  5G38 A;  5G39 A;  5E79 O;  5H2F O;  5B5E O;  3A0B O;  5KAF O;  5B66 O;  4UB6 O;  5GTH O;  3KZI O;  5TIS O;  2AXT O;  5G3A A;  5KAI O;  3JCU O;  4UB8 O;  1S5L O;  4IL6 O;  3WU2 O;  3A0H O;  5GTI O; 
#chains in the Genus database with same CATH topology
 3VZT X;  3PQU A;  4GCP A;  3POX A;  4LSE A;  3AA7 B;  4N58 A;  4PJ0 O;  5G39 A;  3HWB A;  3LK4 1;  4XNK A;  4AKR A;  4QQ1 A;  4RJW A;  3SY9 A;  4FRT A;  2W80 C;  3BS0 A;  5PRN A;  3DWO X;  5B5E O;  5H2F O;  2F1C X;  1P4T A;  3AAE B;  3SYS A;  1G90 A;  2R4N A;  5B66 O;  3KVD D;  3KZI O;  4AFK A;  2POR A;  2K4T A;  4AZL A;  3DWN A;  3LK2 A;  1GFP A;  4E1S A;  4GHB A;  3LK3 B;  5JDP A;  4G76 A;  3AA1 B;  8PRN A;  2PRN A;  5GV0 A;  5D5D A;  1Q9G A;  4K3C A;  4KR8 A;  4N74 A;  5ADX L;  2X9K A;  2ZLD A;  5KAI O;  2R89 A;  3QRC A;  4UB8 O;  4C4V A;  3POR A;  4AYN A;  2M06 A;  3AAA A;  2FGQ X;  2KC0 A;  3WU2 O;  2F1T A;  1Q9F A;  2Y0L A;  5AFU K;  3T0S A;  3GP6 A;  4C00 A;  5DL7 A;  4B61 A;  5GTI O;  4AYD C;  3DZM A;  3PGS A;  3TZG A;  4N75 A;  1HXX A;  5E79 O;  4AYE C;  1OSM A;  2JQY A;  3BRZ A;  4G75 A;  2XE5 A;  1MM4 A;  2XTR A;  2GE4 A;  2MHL A;  3POU A;  4U9C A;  5EE2 A;  4RLC A;  5T5F A;  4RJX A;  4AUI A;  1GFN A;  4RLB A;  3V8U A;  5KAF O;  4UB6 O;  2QTK A;  6PRN A;  5GTH O;  4O4U A;  2YNK A;  3O0E A;  3WI4 A;  4O49 A;  3QRA A;  1ZHX A;  2KXP A;  3VY9 X;  2IWW A;  4RL9 A;  2Y2X A;  3AA7 A;  3PRN A;  3DA4 A;  4LSF A;  3LK3 A;  4XNL A;  2R4O A;  3T20 A;  2K0L A;  3AA1 A;  5DL6 A;  2FGR A;  2O4V A;  2JMM A;  4JCH A;  3UU2 A;  4FZM A;  4LSH A;  3PQS A;  2MNH A;  3AA0 B;  1T1L A;  2N2L A;  5G3A A;  3AAE A;  2KZ7 A;  4GCQ A;  4FZN A;  4C4V B;  1S5L O;  3LK2 B;  2LFU A;  3NJT A;  4Z3T A;  1H6S 1;  4O3X B;  4FUV A;  1HXU A;  3JTY A;  1GFO A;  4FZL A;  1ZHW A;  4AYI D;  2KDY A;  3PGR A;  3HW9 A;  2WVP A;  2N2M A;  2Y0K A;  1ORM A;  3SZV A;  4FSP A;  3AA6 A;  2W81 C;  4FSO A;  1PRN A;  1ZHT A;  2XE3 A;  4FT6 A;  4BUM X;  4D5U A;  1HXT A;  1PHO A;  3G7G A;  4N59 A;  3LK4 2;  4AYM C;  4O3Z A;  3NSG A;  3T24 A;  2WJQ A;  3UPG A;  2XE2 A;  3K19 A;  4O3W A;  2XTQ A;  3BRY A;  2XG6 A;  4KRA A;  2ERV A;  4FRX A;  3PGU A;  4JFB A;  4C69 X;  3JCU O;  3PF1 A;  2OMF A;  1THQ A;  1IZN B;  1OPF A;  2KZ7 B;  4IL6 O;  2XMX A;  4PR7 A;  7PRN A;  3HOL A;  4D65 A;  2KXP B;  2XE1 A;  2YPV A;  1ZHY A;  4O4X A;  2WJR A;  3A0H O;  4LSI A;  5DL8 A;  3VY8 X;  1MM5 A;  3AA0 A;  5G38 A;  4K3B A;  2LHF A;  4AKM A;  5FVN A;  3HOE A;  3POQ A;  1BH3 A;  4AKR B;  2Y7S A;  4FOZ A;  3DA3 A;  2R4L A;  2R8A A;  4FQE A;  1YS5 A;  2M07 A;  5DL5 A;  3AA6 B;  3A0B O;  2ODJ A;  3VE1 A;  4D64 A;  5TIS O;  4F4B A;  3AAA B;  3UAQ A;  3WI5 A;  2X27 X;  1QJ9 A;  2J4U P;  3VZU X;  1QJP A;  1GFM A;  2J1N A;  5G26 A;  4FES A;  2F1V A;  1BXW A;  1ZHZ A;  2Y0H A;  3VE2 A;  3SYB A;  3VZW X;  4PUX A;  1GFQ A;  3SZD A;  5ADX K;  2ZFG A;  2AXT O;  4FMS A;  3C5O A;  3FYX A;  1QJ8 A;  1BT9 A;  4E1T A;  1IZN A;  3SY7 A;  4O3Y A;  4KR4 A;  1E54 A;  1MPF A;  3A2S X;  5AFU L;  2IWV A;  3EMN X;  3RBH A;  2R4P A;  4CTD A;  5IYU A;  4GCS A;  2R88 A;  4GF4 A;  1T16 A; 
#chains in the Genus database with same CATH homology
 4PJ0 O;  5G38 A;  5G39 A;  5E79 O;  5H2F O;  5B5E O;  3A0B O;  5KAF O;  5B66 O;  4UB6 O;  5GTH O;  3KZI O;  5TIS O;  2AXT O;  5G3A A;  5KAI O;  3JCU O;  4UB8 O;  1S5L O;  4IL6 O;  3WU2 O;  3A0H O;  5GTI O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...