5E79O

Macromolecular diffractive imaging using imperfect crystals
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 55
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2015-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5e79O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5e79O02
1S5LO 2AXTO 5TISO 4IL6O 5GTHO 4UB8O 5G38A 4UB6O 5B66O 3A0BO 3JCUO 5G39A 3A0HO 5GTIO 5B5EO 5E79O 5KAIO 3KZIO 5G3AA 5KAFO 3WU2O 4PJ0O 5H2FO
chains in the Genus database with same CATH superfamily
1HXXA 4K3BA 3WI5A 2FGRA 1OSMA 3SZDA 5GTHO 2R89A 1T1LA 4KR8A 2XTQA 3SY7A 4AKRA 4GCSA 2R88A 5B66O 1ORMA 3T24A 3BS0A 4AYNA 2Y7SA 3A0BO 2Y0KA 3AA6B 4FOZA 4JFBA 2Y0HA 4U9CA 4E1TA 1G90A 2R4NA 4FRTA 5ADXL 2KZ7A 3A0HO 2YPVA 4FESA 5GTIO 3VE1A 2WJQA 5B5EO 5E79O 1P4TA 2KC0A 5KAIO 2R8AA 1T16A 4C4VB 2KDYA 2WVPA 2KXPA 3VZUX 2LFUA 1ZHXA 2PORA 4AZLA 8PRNA 2Y2XA 3AA1B 5G26A 4LSFA 4FUVA 4GCPA 4RLBA 5PRNA 5FVNA 3HW9A 4FT6A 1ZHYA 2XE2A 4RL9A 3WU2O 2GE4A 3LK2B 1HXUA 1ZHZA 4RJXA 4RJWA 3QRCA 4FQEA 4PJ0O 1S5LO 3AA7A 1IZNA 4FZNA 2JMMA 3BRZA 4AYID 2XE1A 4FMSA 2IWWA 5DL7A 4O4XA 4FZMA 3V8UA 3POQA 1PHOA 2WJRA 3JTYA 3AAAB 5JDPA 2XE5A 5D5DA 2F1CX 3HOLA 4KRAA 4PUXA 3PRNA 4RLCA 1BXWA 1Q9FA 2N2MA 3PGRA 5G39A 4FSPA 4G76A 4XNLA 3TZGA 2JQYA 4AUIA 5GV0A 2Y0LA 3A2SX 3UAQA 3UPGA 3SYSA 4GCQA 4E1SA 3LK2A 4O3ZA 3DWNA 3C5OA 1YS5A 4N74A 4FZLA 2N2LA 2XMXA 4KR4A 5T5FA 4C00A 2F1VA 3SZVA 1MM4A 3DA3A 3BRYA 3K19A 3WI4A 4JCHA 7PRNA 3O0EA 3AAAA 1ZHTA 3PQSA 3PGUA 3VZWX 2R4PA 3AAEB 3VY9X 2QTKA 3GP6A 1ZHWA 3AA6A 4AKMA 3HOEA 2AXTO 1BT9A 3LK42 4IL6O 3RBHA 4AFKA 3EMNX 4PR7A 5EE2A 4UB8O 2K0LA 2M06A 2MNHA 3T20A 4UB6O 4C4VA 4N59A 4N75A 3JCUO 3G7GA 4FRXA 4LSIA 1BH3A 4D5UA 4D65A 4D64A 1GFNA 3AA1A 3FYXA 5AFUK 2X27X 2J4UP 3POUA 4AKRB 2R4LA 4O3WA 3KZIO 4O49A 3NSGA 1QJPA 3AAEA 2ERVA 3AA0B 5IYUA 4O3YA 2MHLA 3PORA 5KAFO 3DA4A 2KZ7B 1PRNA 2F1TA 5ADXK 2XE3A 3LK3B 3PGSA 4G75A 2X9KA 1GFMA 3DZMA 2KXPB 4Z3TA 4AYMC 2K4TA 2M07A 2ZLDA 4F4BA 5H2FO 5AFUL 1MM5A 2FGQX 3VY8X 1QJ9A 3DWOX 4LSEA 5TISO 3VE2A 4QQ1A 4FSOA 4C69X 5DL6A 1GFQA 2OMFA 4BUMX 5G38A 1HXTA 3AA7B 1IZNB 3AA0A 4B61A 3SY9A 4GF4A 1MPFA 1E54A 3SYBA 5DL5A 3LK3A 1H6S1 2IWVA 2XTRA 4LSHA 2ODJA 6PRNA 3NJTA 4O4UA 3POXA 2W80C 1GFPA 3PQUA 3UU2A 3VZTX 4K3CA 1QJ8A 2O4VA 5G3AA 2W81C 4XNKA 4AYDC 1THQA 1Q9GA 1GFOA 4N58A 3QRAA 2PRNA 3HWBA 3PF1A 1OPFA 4GHBA 2ZFGA 3T0SA 4AYEC 5DL8A 3KVDD 2XG6A 2LHFA 2R4OA 4O3XB 3LK41 2YNKA 2J1NA 4CTDA
chains in the Genus database with same CATH topology
1S5LO 2AXTO 5TISO 4IL6O 5GTHO 4UB8O 5G38A 4UB6O 5B66O 3A0BO 3JCUO 5G39A 3A0HO 5GTIO 5B5EO 5E79O 5KAIO 3KZIO 5G3AA 5KAFO 3WU2O 4PJ0O 5H2FO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L O;  2AXT O;  5TIS O;  4IL6 O;  5GTH O;  4UB8 O;  5G38 A;  4UB6 O;  5B66 O;  3A0B O;  3JCU O;  5G39 A;  3A0H O;  5GTI O;  5B5E O;  5E79 O;  5KAI O;  3KZI O;  5G3A A;  5KAF O;  3WU2 O;  4PJ0 O;  5H2F O; 
#chains in the Genus database with same CATH topology
 1HXX A;  4K3B A;  3WI5 A;  2FGR A;  1OSM A;  3SZD A;  5GTH O;  2R89 A;  1T1L A;  4KR8 A;  2XTQ A;  3SY7 A;  4AKR A;  4GCS A;  2R88 A;  5B66 O;  1ORM A;  3T24 A;  3BS0 A;  4AYN A;  2Y7S A;  3A0B O;  2Y0K A;  3AA6 B;  4FOZ A;  4JFB A;  2Y0H A;  4U9C A;  4E1T A;  1G90 A;  2R4N A;  4FRT A;  5ADX L;  2KZ7 A;  3A0H O;  2YPV A;  4FES A;  5GTI O;  3VE1 A;  2WJQ A;  5B5E O;  5E79 O;  1P4T A;  2KC0 A;  5KAI O;  2R8A A;  1T16 A;  4C4V B;  2KDY A;  2WVP A;  2KXP A;  3VZU X;  2LFU A;  1ZHX A;  2POR A;  4AZL A;  8PRN A;  2Y2X A;  3AA1 B;  5G26 A;  4LSF A;  4FUV A;  4GCP A;  4RLB A;  5PRN A;  5FVN A;  3HW9 A;  4FT6 A;  1ZHY A;  2XE2 A;  4RL9 A;  3WU2 O;  2GE4 A;  3LK2 B;  1HXU A;  1ZHZ A;  4RJX A;  4RJW A;  3QRC A;  4FQE A;  4PJ0 O;  1S5L O;  3AA7 A;  1IZN A;  4FZN A;  2JMM A;  3BRZ A;  4AYI D;  2XE1 A;  4FMS A;  2IWW A;  5DL7 A;  4O4X A;  4FZM A;  3V8U A;  3POQ A;  1PHO A;  2WJR A;  3JTY A;  3AAA B;  5JDP A;  2XE5 A;  5D5D A;  2F1C X;  3HOL A;  4KRA A;  4PUX A;  3PRN A;  4RLC A;  1BXW A;  1Q9F A;  2N2M A;  3PGR A;  5G39 A;  4FSP A;  4G76 A;  4XNL A;  3TZG A;  2JQY A;  4AUI A;  5GV0 A;  2Y0L A;  3A2S X;  3UAQ A;  3UPG A;  3SYS A;  4GCQ A;  4E1S A;  3LK2 A;  4O3Z A;  3DWN A;  3C5O A;  1YS5 A;  4N74 A;  4FZL A;  2N2L A;  2XMX A;  4KR4 A;  5T5F A;  4C00 A;  2F1V A;  3SZV A;  1MM4 A;  3DA3 A;  3BRY A;  3K19 A;  3WI4 A;  4JCH A;  7PRN A;  3O0E A;  3AAA A;  1ZHT A;  3PQS A;  3PGU A;  3VZW X;  2R4P A;  3AAE B;  3VY9 X;  2QTK A;  3GP6 A;  1ZHW A;  3AA6 A;  4AKM A;  3HOE A;  2AXT O;  1BT9 A;  3LK4 2;  4IL6 O;  3RBH A;  4AFK A;  3EMN X;  4PR7 A;  5EE2 A;  4UB8 O;  2K0L A;  2M06 A;  2MNH A;  3T20 A;  4UB6 O;  4C4V A;  4N59 A;  4N75 A;  3JCU O;  3G7G A;  4FRX A;  4LSI A;  1BH3 A;  4D5U A;  4D65 A;  4D64 A;  1GFN A;  3AA1 A;  3FYX A;  5AFU K;  2X27 X;  2J4U P;  3POU A;  4AKR B;  2R4L A;  4O3W A;  3KZI O;  4O49 A;  3NSG A;  1QJP A;  3AAE A;  2ERV A;  3AA0 B;  5IYU A;  4O3Y A;  2MHL A;  3POR A;  5KAF O;  3DA4 A;  2KZ7 B;  1PRN A;  2F1T A;  5ADX K;  2XE3 A;  3LK3 B;  3PGS A;  4G75 A;  2X9K A;  1GFM A;  3DZM A;  2KXP B;  4Z3T A;  4AYM C;  2K4T A;  2M07 A;  2ZLD A;  4F4B A;  5H2F O;  5AFU L;  1MM5 A;  2FGQ X;  3VY8 X;  1QJ9 A;  3DWO X;  4LSE A;  5TIS O;  3VE2 A;  4QQ1 A;  4FSO A;  4C69 X;  5DL6 A;  1GFQ A;  2OMF A;  4BUM X;  5G38 A;  1HXT A;  3AA7 B;  1IZN B;  3AA0 A;  4B61 A;  3SY9 A;  4GF4 A;  1MPF A;  1E54 A;  3SYB A;  5DL5 A;  3LK3 A;  1H6S 1;  2IWV A;  2XTR A;  4LSH A;  2ODJ A;  6PRN A;  3NJT A;  4O4U A;  3POX A;  2W80 C;  1GFP A;  3PQU A;  3UU2 A;  3VZT X;  4K3C A;  1QJ8 A;  2O4V A;  5G3A A;  2W81 C;  4XNK A;  4AYD C;  1THQ A;  1Q9G A;  1GFO A;  4N58 A;  3QRA A;  2PRN A;  3HWB A;  3PF1 A;  1OPF A;  4GHB A;  2ZFG A;  3T0S A;  4AYE C;  5DL8 A;  3KVD D;  2XG6 A;  2LHF A;  2R4O A;  4O3X B;  3LK4 1;  2YNK A;  2J1N A;  4CTD A; 
#chains in the Genus database with same CATH homology
 1S5L O;  2AXT O;  5TIS O;  4IL6 O;  5GTH O;  4UB8 O;  5G38 A;  4UB6 O;  5B66 O;  3A0B O;  3JCU O;  5G39 A;  3A0H O;  5GTI O;  5B5E O;  5E79 O;  5KAI O;  3KZI O;  5G3A A;  5KAF O;  3WU2 O;  4PJ0 O;  5H2F O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...