5E79O

Macromolecular diffractive imaging using imperfect crystals
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 55
structure length 243
sequence length 243
chains with identical sequence o
ec nomenclature
pdb deposition date 2015-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5e79O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5e79O02
5KAIO 3JCUO 2AXTO 3A0HO 5G3AA 4UB8O 5B5EO 5TISO 3WU2O 5B66O 4PJ0O 4IL6O 1S5LO 3A0BO 3KZIO 5H2FO 5GTHO 5GTIO 5KAFO 5E79O 5G39A 4UB6O 5G38A
chains in the Genus database with same CATH superfamily
4AZLA 2KZ7A 2XG6A 4N75A 3PGSA 2O4VA 3A0HO 3VE2A 3WI5A 1OSMA 1BXWA 2Y0KA 1IZNA 2K0LA 2KDYA 4G76A 2XE3A 2LFUA 2XE5A 3LK42 4E1TA 6PRNA 4QQ1A 5TISO 3AAEA 3BS0A 3AA6B 5PRNA 4PJ0O 3K19A 3A0BO 3V8UA 3SY7A 3AA7B 3VE1A 5DL5A 4AYMC 1PHOA 2JMMA 1HXXA 2KXPA 3LK2A 3NSGA 1MM5A 3C5OA 4FOZA 2M07A 4AKMA 3AA0A 3AA1A 5E79O 5G39A 3RBHA 2PORA 2Y2XA 2KC0A 3JTYA 4AFKA 4FQEA 3AAAA 5KAIO 4RLBA 4PUXA 1QJ9A 1GFNA 1Q9FA 1T16A 2FGQX 3PGUA 4GCPA 4LSEA 3T20A 2JQYA 4LSFA 4Z3TA 4AKRB 2YPVA 4FUVA 5B5EO 3DA3A 8PRNA 4O4XA 4GCQA 2MNHA 1QJPA 4GCSA 2YNKA 3QRCA 3DZMA 2K4TA 2GE4A 1P4TA 4JCHA 2KZ7B 3WU2O 4IL6O 2IWWA 4XNLA 4FRTA 4O3XB 2J4UP 2XE1A 3WI4A 4C69X 4O3WA 2XTQA 1G90A 3GP6A 2ERVA 2Y0HA 3POXA 4FZLA 4N58A 4RJXA 3LK3B 5H2FO 4O49A 5DL7A 4AUIA 5G26A 2F1CX 4BUMX 3BRZA 4XNKA 4G75A 1T1LA 5KAFO 1BH3A 1Q9GA 3KVDD 4O3ZA 2ZFGA 1PRNA 2R8AA 4LSIA 4O3YA 2Y7SA 2N2MA 4KRAA 5G38A 2F1TA 3AA6A 3T24A 3SYSA 5EE2A 4RL9A 2AXTO 1ZHXA 2KXPB 2WJRA 3AA7A 3LK2B 4C4VA 5AFUL 5IYUA 2ODJA 4UB8O 2R4NA 3UAQA 4AYDC 4FSPA 3AA1B 4D64A 3A2SX 4F4BA 3SZDA 3QRAA 2R89A 1HXUA 1MM4A 2Y0LA 4GHBA 4RJWA 4C00A 3AAAB 5DL6A 2F1VA 5ADXL 4AYEC 5AFUK 2N2LA 4K3BA 4D5UA 1QJ8A 1GFOA 2FGRA 1GFQA 1S5LO 2MHLA 3DWNA 1ZHTA 3FYXA 3G7GA 3KZIO 3PQUA 4GF4A 4U9CA 3POQA 1IZNB 3VZUX 2PRNA 5GTHO 4LSHA 3PF1A 5GTIO 5ADXK 5D5DA 3DA4A 2X27X 1ORMA 3AAEB 3POUA 3DWOX 4KR8A 2W81C 2IWVA 3VZWX 2R4PA 1GFMA 2R4OA 4AYID 1THQA 3PGRA 2R4LA 2XMXA 3PQSA 2LHFA 3JCUO 2XTRA 5DL8A 4D65A 4FZNA 3O0EA 3VZTX 5G3AA 7PRNA 4N74A 1OPFA 1BT9A 3LK3A 4CTDA 1E54A 2J1NA 1GFPA 2M06A 4FZMA 3AA0B 2R88A 3HOLA 3PRNA 4K3CA 4PR7A 4FRXA 4O4UA 1ZHZA 3SYBA 3UU2A 1ZHYA 2WJQA 4FSOA 4JFBA 3SZVA 4N59A 1MPFA 3BRYA 5B66O 1HXTA 4KR4A 4RLCA 3TZGA 4FESA 3NJTA 3EMNX 3VY9X 4C4VB 3HW9A 3T0SA 4AYNA 5JDPA 3UPGA 1H6S1 5FVNA 2X9KA 2XE2A 3VY8X 4FMSA 4FT6A 3HWBA 4E1SA 4B61A 3SY9A 1YS5A 3PORA 2WVPA 3HOEA 4AKRA 5T5FA 3LK41 5GV0A 2QTKA 2ZLDA 2OMFA 4UB6O 1ZHWA 2W80C
chains in the Genus database with same CATH topology
5KAIO 3JCUO 2AXTO 3A0HO 5G3AA 4UB8O 5B5EO 5TISO 3WU2O 5B66O 4PJ0O 4IL6O 1S5LO 3A0BO 3KZIO 5H2FO 5GTHO 5GTIO 5KAFO 5E79O 5G39A 4UB6O 5G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI O;  3JCU O;  2AXT O;  3A0H O;  5G3A A;  4UB8 O;  5B5E O;  5TIS O;  3WU2 O;  5B66 O;  4PJ0 O;  4IL6 O;  1S5L O;  3A0B O;  3KZI O;  5H2F O;  5GTH O;  5GTI O;  5KAF O;  5E79 O;  5G39 A;  4UB6 O;  5G38 A; 
#chains in the Genus database with same CATH topology
 4AZL A;  2KZ7 A;  2XG6 A;  4N75 A;  3PGS A;  2O4V A;  3A0H O;  3VE2 A;  3WI5 A;  1OSM A;  1BXW A;  2Y0K A;  1IZN A;  2K0L A;  2KDY A;  4G76 A;  2XE3 A;  2LFU A;  2XE5 A;  3LK4 2;  4E1T A;  6PRN A;  4QQ1 A;  5TIS O;  3AAE A;  3BS0 A;  3AA6 B;  5PRN A;  4PJ0 O;  3K19 A;  3A0B O;  3V8U A;  3SY7 A;  3AA7 B;  3VE1 A;  5DL5 A;  4AYM C;  1PHO A;  2JMM A;  1HXX A;  2KXP A;  3LK2 A;  3NSG A;  1MM5 A;  3C5O A;  4FOZ A;  2M07 A;  4AKM A;  3AA0 A;  3AA1 A;  5E79 O;  5G39 A;  3RBH A;  2POR A;  2Y2X A;  2KC0 A;  3JTY A;  4AFK A;  4FQE A;  3AAA A;  5KAI O;  4RLB A;  4PUX A;  1QJ9 A;  1GFN A;  1Q9F A;  1T16 A;  2FGQ X;  3PGU A;  4GCP A;  4LSE A;  3T20 A;  2JQY A;  4LSF A;  4Z3T A;  4AKR B;  2YPV A;  4FUV A;  5B5E O;  3DA3 A;  8PRN A;  4O4X A;  4GCQ A;  2MNH A;  1QJP A;  4GCS A;  2YNK A;  3QRC A;  3DZM A;  2K4T A;  2GE4 A;  1P4T A;  4JCH A;  2KZ7 B;  3WU2 O;  4IL6 O;  2IWW A;  4XNL A;  4FRT A;  4O3X B;  2J4U P;  2XE1 A;  3WI4 A;  4C69 X;  4O3W A;  2XTQ A;  1G90 A;  3GP6 A;  2ERV A;  2Y0H A;  3POX A;  4FZL A;  4N58 A;  4RJX A;  3LK3 B;  5H2F O;  4O49 A;  5DL7 A;  4AUI A;  5G26 A;  2F1C X;  4BUM X;  3BRZ A;  4XNK A;  4G75 A;  1T1L A;  5KAF O;  1BH3 A;  1Q9G A;  3KVD D;  4O3Z A;  2ZFG A;  1PRN A;  2R8A A;  4LSI A;  4O3Y A;  2Y7S A;  2N2M A;  4KRA A;  5G38 A;  2F1T A;  3AA6 A;  3T24 A;  3SYS A;  5EE2 A;  4RL9 A;  2AXT O;  1ZHX A;  2KXP B;  2WJR A;  3AA7 A;  3LK2 B;  4C4V A;  5AFU L;  5IYU A;  2ODJ A;  4UB8 O;  2R4N A;  3UAQ A;  4AYD C;  4FSP A;  3AA1 B;  4D64 A;  3A2S X;  4F4B A;  3SZD A;  3QRA A;  2R89 A;  1HXU A;  1MM4 A;  2Y0L A;  4GHB A;  4RJW A;  4C00 A;  3AAA B;  5DL6 A;  2F1V A;  5ADX L;  4AYE C;  5AFU K;  2N2L A;  4K3B A;  4D5U A;  1QJ8 A;  1GFO A;  2FGR A;  1GFQ A;  1S5L O;  2MHL A;  3DWN A;  1ZHT A;  3FYX A;  3G7G A;  3KZI O;  3PQU A;  4GF4 A;  4U9C A;  3POQ A;  1IZN B;  3VZU X;  2PRN A;  5GTH O;  4LSH A;  3PF1 A;  5GTI O;  5ADX K;  5D5D A;  3DA4 A;  2X27 X;  1ORM A;  3AAE B;  3POU A;  3DWO X;  4KR8 A;  2W81 C;  2IWV A;  3VZW X;  2R4P A;  1GFM A;  2R4O A;  4AYI D;  1THQ A;  3PGR A;  2R4L A;  2XMX A;  3PQS A;  2LHF A;  3JCU O;  2XTR A;  5DL8 A;  4D65 A;  4FZN A;  3O0E A;  3VZT X;  5G3A A;  7PRN A;  4N74 A;  1OPF A;  1BT9 A;  3LK3 A;  4CTD A;  1E54 A;  2J1N A;  1GFP A;  2M06 A;  4FZM A;  3AA0 B;  2R88 A;  3HOL A;  3PRN A;  4K3C A;  4PR7 A;  4FRX A;  4O4U A;  1ZHZ A;  3SYB A;  3UU2 A;  1ZHY A;  2WJQ A;  4FSO A;  4JFB A;  3SZV A;  4N59 A;  1MPF A;  3BRY A;  5B66 O;  1HXT A;  4KR4 A;  4RLC A;  3TZG A;  4FES A;  3NJT A;  3EMN X;  3VY9 X;  4C4V B;  3HW9 A;  3T0S A;  4AYN A;  5JDP A;  3UPG A;  1H6S 1;  5FVN A;  2X9K A;  2XE2 A;  3VY8 X;  4FMS A;  4FT6 A;  3HWB A;  4E1S A;  4B61 A;  3SY9 A;  1YS5 A;  3POR A;  2WVP A;  3HOE A;  4AKR A;  5T5F A;  3LK4 1;  5GV0 A;  2QTK A;  2ZLD A;  2OMF A;  4UB6 O;  1ZHW A;  2W80 C; 
#chains in the Genus database with same CATH homology
 5KAI O;  3JCU O;  2AXT O;  3A0H O;  5G3A A;  4UB8 O;  5B5E O;  5TIS O;  3WU2 O;  5B66 O;  4PJ0 O;  4IL6 O;  1S5L O;  3A0B O;  3KZI O;  5H2F O;  5GTH O;  5GTI O;  5KAF O;  5E79 O;  5G39 A;  4UB6 O;  5G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...