5E79Z

Macromolecular diffractive imaging using imperfect crystals
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5e79Z00
5KAIZ 5TISZ 3JCUZ 5H2FZ 4UB6Z 3A0HZ 4IL6Z 3KZIZ 3WU2Z 2AXTZ 5E79Z 5GTIZ 3A0BZ 5B66Z 1S5LZ 4PJ0Z 5B5EZ 5KAFZ 5GTHZ 4UB8Z
chains in the Genus database with same CATH superfamily
2BTQB 3SYQA 4LF4B 4K0KO 1KP3A 1Q3EA 1IBKB 2OCCC 1EFRG 1NI8A 2P6JA 4RWUA 2BOCC 3JD3A 2QGNA 2OTLV 1SQXH 1L1FA 2F4VO 5KX5B 4ZOLB 4JI8O 1VARA 1OCOB 4LH7A 2P5OA 3K5LA 1N32B 3BRCA 2BTQA 3JALA 3VOUA 1N8RW 2PTMA 3WB0A 3KZIZ 3HKEA 4QNHB 5KHGA 5JH7A 3AG2B 4NVPA 4LWSA 1S72V 5EBWC 1BQZA 3CP1A 5AG2A 2UU9O 3X2QB 2VQEB 3L72H 4DR2O 1KECA 2IBZH 1HR0B 3K5MA 4X65O 1Q7YW 3ZMUA 4MW3A 4LF6B 2WLNA 1ZL8A 2AHZA 1K4DC 2XTAA 3E8GA 2GHYA 4YHHB 3CCRV 4FZ1A 3BFRA 1WP7A 4JAVA 3CC4V 1XL6A 3LSUA 1JOYA 1J5EB 4JYAB 1K9MW 4G2KA 4LFAB 1G4YB 3UT5B 2ZM6O 2H94A 4DR4B 1GRJA 3K04A 4LWSB 2AW9A 2DWDC 2HVKC 3CX5F 5B1BB 2R72A 4X66O 3ABLC 1TA8A 3H1IH 4GKKB 3HPLC 2LW1A 3NXSA 4LFCB 1IURA 1B6QA 1M56B 4Q20A 3MHHC 4LF8B 2UXXA 1VP7A 1MG1A 5KHHA 3W7WA 1JMKC 5L3BA 3APQA 1PP9H 3K59A 3CSXA 1K4CC 4PDMA 5EK0A 3K0GA 5LHGA 4DXWA 2IJKA 2UUAB 2JS5A 4FM2A 3IC7A 1AI5A 3KKYA 5TISZ 2X6BA 2DYRC 1P4RA 3E35A 1N36B 1JJ2U 1JQ0A 3SJCC 1DF5A 1R3IC 3ABUA 2JJ2G 4P9OA 4FMTA 4X88A 1AILA 2Q0AA 4GX5A 4KL1A 4XDKA 4D7TA 2JJ1G 1GM9A 4PI0A 2IH3C 5H2FZ 3K58A 1NVPD 1BMFG 1YIJV 3D3IA 3OEEG 5KHIA 3OUSA 3P32A 3AG3C 3CS5A 2ZT9B 2HJDA 1CXZB 3HKDA 3H1KH 4EFBA 5JJNB 1VIBA 1YZBA 2NN4A 4MTGA 3MD0A 2NR5A 1L8DA 5CA3A 4DV3B 1T5EA 2L35A 2QM7A 2WLHA 1QQCA 1WB7A 2H3OA 5E1AC 1TUBB 1WA8B 1HWYA 2E5LO 5BY1A 3N2KB 2GSMB 5LA6A 4YIPA 5JQGB 1F23A 1SERA 3CEIA 5BMVA 4PA9A 1VQMV 2VS0A 4CZZA 3K08A 4OX9B 2A06H 1K5SA 4Z1VA 5LYJB 5B3SB 4O4LB 4QPKA 3ABLB 4IIJA 1H38A 1HNXO 1E79G 4JGSA 4P30A 1R6NA 4TV8A 3QO8A 4E4EA 3ZHSA 5CBGA 1Z5WA 2ILMA 1XMOO 3WU2Z 1SS3A 2DYRB 5L3CA 4YXWG 1X4TA 2B1IA 4JI5O 1BE3H 1FJGB 4UCUA 4JV5B 4O4HB 2ZIOA 3LSSA 3K5OA 1AR1B 3UO2A 1JFFB 4DV4O 1FYJA 1K7DA 1RSOA 5GW7A 2Q68A 4AHCA 5LXTA 1YI2V 1GN4A 2BE3A 4UCSA 4YJ3A 4B3TB 4TV9B 3K79A 3GB7C 4MW8A 2V1DA 1R3LC 3FAVB 1NKDA 3LDEA 3BHPA 2JGUA 1ZUQA 5LGNA 4JI4O 2XOKG 3JARA 3ABKB 2CH7B 1K5QA 5EBMC 2Q9LA 4CS2A 1AI4A 4GKJO 2O57A 4DV2O 4O2AB 5LMNO 5JCOA 3N27A 4JI2O 1YF2A 3VQWA 1K73W 3TXQA 4X62B 2M7WA 4LNUB 1PNMA 4BIZA 2IU3A 3ETEA 1TVKB 1HNZB 4J80A 1G1XB 3U0ZA 1FFXA 2QTSA 4JI3B 3EVKA 4YY3B 5D5QA 3P3PA 3CRAA 1XILA 2AXTZ 1EN6A 3UCSC 4DV7O 3I56V 1O9GA 2VQFO 3Q4HA 1L0LH 5IT9N 4J42A 4DV6O 1B3QA 4B3SB 3T1YO 3WFVA 4MVQA 5IYCO 5HFMA 2M6YA 2PYLA 1NR7A 1Z2GA 2ZR3A 4J41A 3HR0A 1H8EG 4DK1A 1YDXA 3SGIA 4J7ZA 4DR1B 5KA5A 3E83A 3CC7V 2LJ2A 2WLLB 1FAFA 3BA8A 1PM9A 4UCOA 5DECA 5BZBA 4NB5A 1G6UA 3P3NA 1FXHA 1Q43A 3AEIA 3M99B 5IWAO 1I5XA 1SETA 2Q7HA 4JI6O 2E3CA 4DW0A 1VQ9V 2ZE5A 1XNQB 3JAWB 4I0XA 2KQXA 3ZIAG 2QWOB 3RVYA 2Q6AA 2ADQB 2KG7A 4PHZA 3K06A 1RFYA 4X64O 4JI7O 3SJAC 3ETGA 1FXVA 1H2KA 2DWEC 2QWRB 1EZVH 1KC8W 3B40A 2YXHA 1OZ0A 4N23A 4X8AA 1MA1A 4BW5A 5LHHA 4LF9B 4DR7O 5H9CA 2JIZG 1ZX3A 5EYPB 2DQ0A 5LOVA 4TWKA 3RGBA 3X2QC 4AILC 4J11A 2F1MA 1U97A 4KXRA 2CTRA 1Q6HA 2ZKOA 3JAWA 1GAXA 1QLEC 2JVDA 3FYEB 4JF3A 3F7VC 1NS1A 3E89A 1DLBA 2LFSA 1YEWA 1SQQH 3SR2C 5BR8O 2AZ2A 2FYUH 2LW7A 3K3WA 1YVWA 2BCCH 3AG4B 1WB8A 1R3KC 1BT8A 4I4TB 4R7CA 4PD4F 1S3JA 3EHBB 2BTOA 1VMGA 4UV9A 5EIBD 1GN3A 1AJPA 2YUAA 2W6IG 3ZHVA 1BCCH 3RYFA 4FK5C 4UCVA 1AJNA 1FPOA 2UXNA 5JCOC 1JPXA 2F93B 2HR3A 3E22B 4B3RO 4O2BB 2KG7B 2WLLA 4DR7B 2QJ1A 1SA0A 2QA4V 2E75B 3JD4A 2R9RB 2Q8VA 4CS4A 3JCUZ 1QCEA 1Y76B 4K8ZA 1S5HC 3WG7C 1AJQA 4MT8A 3W7UA 3JALB 1KMIZ 2P4KA 2P4VA 4X64B 3L70H 1TAEA 3U11A 3K03A 5IJ0B 4LBEC 2P22C 3K57A 1N0NA 3OTOO 5FPOA 4B7KA 1TUEB 3CCEV 3BA9A 2WPDG 1XOUA 3E8FA 3JCZA 1KUQA 1XREA 5L3EA 1IBLO 1QNMA 4I55B 4OX9O 1NU1H 1OCRC 3TCUA 4XDJA 3JATA 1QVFU 2KSDA 1TVKA 3ZRWA 2C2AA 2AGAA 3THOA 1L0NH 3H1HH 3G71V 3TXSA 2H8PC 4NR1A 3SYOA 3MAQA 5KHKA 1GTOA 2D3OW 1KU9A 5KAIZ 3ABKC 4GX1A 4JI1B 3OR6C 4BAYA 1R3JC 3IAYA 4DUYO 4O2AA 3K0DA 5CA1A 2A0LA 1Q82W 4DV6B 3B77A 4DV1O 2RJZA 5IYDO 3A0HZ 4UVBA 1MMMA 3OR7C 1Y66A 3BAAA 3O65A 3UO3A 4UB6Z 1S0VA 3ZS8C 1ORQC 3HKEB 2Z5UA 5HFLA 4DUYB 4P2ZA 1K34A 2ITDC 4YJ3B 1NZ6A 5LXTB 5KUMA 3T4DA 4PDVA 2ETNA 3D36A 3N2GA 3CMAV 1AI6A 3BY6A 1XMQB 2V4DA 3VQVA 4OXSA 3IJ4A 5CBHA 3CCSV 3B2EE 3FB7C 2E74B 2OTJV 3STZC 1MZFA 4U3JA 5F2VO 1IBLB 3ETQA 1XL4A 2QE7G 4MVSA 4JI4B 1IXMA 4DV1B 3RT3C 4TV8B 1OCZC 5BMVB 2HFEC 5JQGA 1N4CA 4FFKA 4WFAV 4FIPC 2XT9A 2DQ3A 2X6AA 2ZM6B 3FFQA 4OPHA 4P9PA 2ZQMA 1XNRO 1GN2A 3L71H 4WBNA 1FFXB 4PJ0Z 4DV4B 4UCRA 3SJBC 2K9PA 5KMGA 2E76B 2CGOA 1D5AA 3T1HB 3UQ8A 5LA6B 3JSNA 4B3RB 4YHHO 1EM1A 4EKWA 3FB6C 3OW2U 3OE7G 3CRQA 4LH6A 4CS3A 1AR4A 4H33A 1IVSA 4DV5O 1A32A 1PD3A 2BSKB 1H2SB 2RNBA 3ZRSA 2YI9A 3JARB 2X7RB 4FFBA 2GBOA 3CMEV 3E8BA 1GKFA 5GTHZ 3T1HO 1URFA 5DEDA 3FB5C 2HHHO 1KQSU 5L3GA 1P7BA 2FTKA 4FLWA 3G4SV 2GUZB 1XMQO 5FNVA 2V7QG 5C8YB 2A7WA 2W6JG 3HKDB 1XNRB 1HP8A 2CE4A 4MVZA 4MS2A 1H2GA 1MOFA 1FD9A 3L75H 1UPGA 3RYIA 2UUCO 4LF5B 4C7UA 1M56C 4LF9O 4WF9V 1BHAA 4PDLA 1OV9A 3CWBH 4JI0B 4RAIA 4CH4A 4ZHQA 5B1BC 4B08A 2XAJA 1PPJH 4D6TH 5BR8B 4WFBV 4QPJA 1XBLA 3CJHB 1BS3A 5B1OA 3LUTB 3QG5A 4UVAA 3ZHUA 1ZTEA 4DK0A 4PELA 4RUEA 3M7MX 5D5PA 3SPJA 2XNDG 4FLXA 3ZMZA 5JVDA 4X1KA 5IYZB 4JI1O 1M57B 2ZDIC 5LL6Y 5K1XA 2X6CA 3K5NA 3JD2A 2ZIMA 2XAQA 4EB6A 3ZRWB 1LUWA 3EFFK 5CMUA 4HAMA 2DYSB 2EIKC 4LP8A 1Z5VA 3HB3B 3ZRVA 1AB3A 4UCTA 2YC0A 3OFNG 3CPWU 2YDEA 4PDRA 2QM8A 2HLDG 3BABA 4RUFA 1FS0G 4ZHQB 3RYHB 3RW0A 5B3SC 5KUKA 1XNQO 4GKKO 4B3SO 4GX2A 2Y4UA 3APOA 4KUMA 4OPAA 1W59A 4KHPB 2EZPA 5ITZB 3UM7A 1Q81W 1I7FA 3ZX6A 1NQTA 4CC6A 1DK1A 4YY3O 4AI8A 5IJ9B 2N05A 3SPGA 1M5IA 4K8XA 4JYBA 5IYBO 1XQ8A 5CN0A 3IFXA 4YIOA 2RDCA 2QWPB 1OHHG 1M57C 3DC6A 4F6RA 4FFBB 3RYCB 2Z0AA 1NTMH 1LNQA 4ICGA 1DGSA 4Z1MG 2JEXA 1RPOA 3L9DA 4TT3G 4JI0O 4QJFB 4ZIBA 3LSQA 1YHQV 1YJWV 2PZSA 1RM1C 2OWOA 3QO7A 1SRYA 2HKOA 3C90A 2VRZA 2QR4A 1MABG 4JZ2A 2PYJA 1DF4A 5IE9A 4X62O 3C3SA 4BIUA 5KMGB 3ML0A 4LF4O 4JPRA 1WLEA 4W4LA 3JAMN 1WN7A 3A0BZ 2ZCEA 3C3TA 1PNLA 2HHHB 3D8CA 3KCYA 4HBNA 2F43G 4CBCA 3D3QA 1XMOB 2IH1C 2QDOA 4NTXA 1MSWD 5JVDB 1K92A 3FAVA 3A8TA 2XAGA 2XHBA 4IHJB 2QWQB 4DV5B 1VQ5V 2IW5A 1O9HA 2YS8A 3N2GB 5CBFA 5BXZA 3G6BA 1M90W 4PA4A 2ATKC 4J7KA 4HNAB 2GUZA 4MVMA 4JV5O 2WLMA 1VQPV 1FJGO 3IC9A 3FD9A 4XDLA 4J9ZB 4FLYA 2CTPA 3TJTA 2CUGA 1G8MA 2DOSA 3AK2A 2K1EA 3U10A 3CHXA 1K33A 1K8AW 1Q6IA 3E2EA 3L73H 4KHPO 2YXLA 2P7TC 2ZE8A 1XI1A 2QEXV 4X20B 4DRXA 1UFIA 4FLZA 4JI6B 1OCOC 4LC1A 3JD0A 5JJEB 5FLXN 1QLEB 4L87A 1QR9A 4JAAA 3SDLA 5LYJA 1ZLZA 5H6QA 3LNNA 1H2MA 3RVZA 1J95A 2A9HA 2CTQA 1AR5A 1VF6A 2EIKB 5A2QN 2WWWA 3H01A 4IGGA 2DYSC 5B66Z 2BSKA 4O4JB 3F7YC 4GZRB 3ABMB 4GLXA 4K35A 5CA0A 2P06A 3LDDA 1WA8A 4MTOA 2PF4E 4DW1A 3T1YB 1NTKH 1GK9A 4MTFA 1ZSPA 2IJHA 4DV2B 4O4IA 4GKJB 1W0JG 1YJ9V 1Y67A 3E8HA 4KFMA 4U7NA 1OCZB 2JS3A 3OM3B 3OMNB 2CTWA 2B9ZA 5JJJB 1QBZA 4JAUA 3S3WA 4TV9A 2ZE7A 2UUCB 2RQ6A 4LF5O 4BWAA 3JAKA 4I50A 1VQOV 4BW9A 2Y0IA 3KCXA 5DN6G 3KG2A 1EN4A 3RN4A 1Y74A 2ZD9A 4FLUA 4LFAO 2Y48A 2JDIG 1P49A 1AROP 2UUAO 2P67A 1HNWO 5LMNB 2HG5C 2ZNIA 1WJZA 1V54B 1V54C 3AK1A 1RPRA 2EBOA 1GM8A 4D7SA 5E79Z 1OCCC 2OIEA 4LFCO 4GX0A 3ASNB 3R66A 3JYCA 2VWJA 4IHJA 2MW2B 2QKCA 4DR2B 4E2LA 2UU9B 4H0LB 5H6RA 4B3TO 4DR4O 1XHZA 2YEVB 2KB1A 3TK1A 1UJWB 1HNXB 1P84F 1NR1A 2EZOA 1SQFA 4EB6B 4JYAO 3CCLV 2EILB 1N0JA 3O9OA 2XUMA 5LGUA 2CAZC 3OMAB 4N21A 2F4VB 3JSLA 4JI5B 1QVGU 1PKXA 3UKMA 3ZMTA 4R8CA 3L74H 1VQ4V 4HZ3A 4ZI7A 2JGDA 4X65B 1VQKV 4R50A 3HKCA 2E5LB 2AZ0A 3SYPA 1NT2B 3OGCC 2WA4A 5EBLC 2EIJC 1HW7A 3CRCA 1WP8A 5EZYB 1VQNV 4WFGA 4FZ0A 4DV3O 3OEHG 3G80A 3MDSA 3IGAC 3K9SA 1SC5B 4I55A 1KKCA 1GMGA 2FB5A 2PGGA 1RM1B 3JASB 4RQEA 1R6TA 1NVPB 1MSDA 4BR6A 1M4UA 3RBZA 5IJ0A 3G6EV 4X1IA 4O2BA 3CE2A 4L8JA 3E22A 2Q67A 3ZHQA 1TGOA 4F6RB 3I5DA 1JA8A 3SJQC 2ZXWB 1Y76A 1NBMG 1N36O 1AVMA 5J2TA 4Z2WA 1VF6C 5B1NA 3OD4A 2W0FC 4ZKIA 4W4KA 3F5WC 5FL7G 1KB9F 2OCHA 2NLJC 4JYCA 1EBOA 1H2NA 4MVOA 3CCJV 5IJ9A 1KYOF 4B3MO 5DM6V 3DXRA 4TOIA 1Y4MA 2L6LA 2CDYA 3RYFB 1FFTB 2ZNJA 3PJSK 1Y6XA 4PV1B 2Y69B 3JASA 4LF8O 2YSUB 3J7AU 2DMXA 2F23A 1D5NA 5B1AC 1D2DA 4FLTA 4UFZA 2YIBA 4CH6A 2MK3A 4X66B 5KAFZ 3UT5A 1Q8IA 2XAFA 2OCCB 5IWAB 2LQTA 3AG7A 1YJNV 2G38A 3P30A 1J5EO 1OJHA 3H1LH 3B09A 3RYIB 1R1BA 1N34O 3LNMB 4DR1O 3M8AA 1XEQA 2Q5ZA 3JD1A 2WLIA 4J7JA 2JK5C 2CH7A 4NKGB 4LF6O 1Y74B 2YIAA 3ZCCA 4NTYA 3OTOB 1HR0O 2VWKA 3NR7A 4DR3O 1WPBA 2DE0X 5GONA 4U3JB 3BEHA 2OT5A 2VQFB 2PI4A 4EFEA 1VQ7V 1EN5A 1I5YA 1YCIA 1YITV 1JVMA 3SPIA 3F5TA 4UB8Z 1V55B 1E1QG 5KX5A 1U96A 4LCUC 1RSOB 4MVRA 3AG1B 1GM7A 4DUZO 3CCUV 4WFEA 1FXKB 4I0XB 2B5UA 4QE7A 4AQYO 1XDCA 3RWRD 4K0KB 5J2UA 4DR3B 4LFBO 4DO2A 3OMIB 4O4JA 5FPRA 2UUBO 2JRIA 2VQEO 2WA3A 1LR1A 1VQ6V 4UXNA 5CB4B 4A5UB 2ADPA 1WAZA 4I50B 1WNSA 1SKVA 5CA1B 1CP9A 4H44B 3OTFA 1JX9A 3FYIB 3AG4C 4LF7B 2DJVA 4NXNO 1PL0A 3AG3B 4LR3A 1PV0A 4FJCC 2YXYA 2Z3YA 2Y0PA 4LNUA 2Y69C 4PA7A 3CCVV 2F95B 3T2MA 1DTOA 4DR5O 1GO3F 4FLVA 2BOBC 2LGWA 1W2BU 2QWNB 3QTCA 1FKAO 4B3MB 2OIGA 4JTAB 4QGPA 5LMUB 2Q7EA 4JASA 2LFRA 4MSWC 4MTXA 1BHBA 1I94B 3GWOA 3ETDA 3DTUB 1BL8A 2HJFC 2WLKA 4WBNB 4X89A 4U3FH 4JI7B 3AG1C 2EULA 1M9NA 5J2UB 1IX9A 1V55C 1I0HA 2GDSA 3TETA 1SA0B 1VQLV 3A2FA 4K3AA 2ODMA 3PN1A 3ZHTA 4YJ2B 4PA3A 5CB4A 2EINB 4NXNB 1S76D 4NYKA 4QE9A 3WB1A 1K3EA 5IY5C 3ICXA 3SPHA 2RN9A 1MZEA 3CD6V 3CRMA 2QKAA 2FMLA 2PY5A 4HNAA 2X0LA 4I9WA 1N33O 5JWPA 2UUBB 1MNGA 1JFFA 2R9AA 4G28B 3T4ZA 1KD1W 2QM4A 3GWKC 1AI7A 1FXKC 5GTIZ 3JATB 1EZJA 3AK3A 3TGUH 2ZE6A 3ZN1A 5LBQA 2EILC 4DUZB 4OGQB 4DV7B 2UXCB 4DV0B 2F66C 4O4LA 1COWG 3DC5A 4JI3O 1VF7A 5LOVB 1KBHA 2HP8A 1F7YA 1PNKA 5EYPA 3FX7A 1HNZO 1IBMO 1B06A 3QNEA 4DR6O 2Q4PA 4TSFG 3W7TA 3J81N 3ASOB 2GTAA 2IU0A 3SYCA 4JI2B 5LGTA 3B4SA 2WAMA 1V9PA 1R73A 4NXMB 2EIMB 4X20A 4DRXB 4J9YB 5B5EZ 2IJIA 3HKBB 3CCQV 2YIDA 3K9AA 4PA6A 1YTFD 3OUFA 2D2CB 1US6A 2CGNA 4RQFA 5K1PA 4GCZA 2UXBO 5LP6A 2N74A 2A79B 3LDCA 2PUSA 2NNUA 4X1IB 4GUNA 2B1GA 1JR9A 4JTDB 4QIWF 2W0XA 3SYAA 4I9QA 2UXBB 1WPXA 2UXDO 2CK3G 5LP6B 1H8HG 3OGIB 4JTCB 3VQYA 1THZA 2JGDB 1CPYA 4DV0O 2XAHA 3QVNA 4MVUA 1F51A 2RCVA 1XUQA 5GONB 4Q6GA 1PL4A 4NXMO 4CH5A 5EZYA 1NH2D 1ENVA 3CC2V 1AP5A 1VF5B 2WLIB 4B7EA 3B8NA 4BIOA 1ZWIC 2R70A 1R6KA 5LP6C 4I4TA 3I55V 5KA6A 4TQFA 1SZXA 3CJHA 4J10A 1F4NA 4DYLA 2ITCC 3HKCB 4H37A 3T1CA 1IBKO 4U7OA 2RMKB 3BCCH 5L3FA 3A0RA 1ZL8B 1M93A 3E86A 1P7GA 4ZOLA 2EIMC 3DXRB 4I5SA 1I08A 4EEQA 2R9IA 4JZGA 4WFFA 3H1JH 2Q69A 3RYCA 1SQGA 2HVJC 4CH3A 1IXBA 1BZKA 3ASOC 1QU7A 2YEVA 3EXAA 5H5NA 2Q0OC 2Q73A 2QTOA 1Q5OA 1RP3B 2GTSA 1YXBA 2QSAA 5KHJA 2JEUA 5B1AB 1BQ0A 4I7ZB 4IT5A 4IL6Z 1JCHA 4X9QA 4PI2A 4YJ2A 1ZAUA 3JAKB 4O4HA 1H2LA 5JH7B 5ITZA 1LUVA 3J80N 2PI5A 4TQDA 2LP7A 1S5LZ 2YICA 3RFRA 3QF7A 4HYOA 3VBBA 3OAAG 4F6EA 2EJRA 2XASA 4JYYA 2IJJA 4O4IB 1ROPA 3HKBA 3STLC 5LMUO 1SQBH 3D36C 3RYHA 5LHIA 3ABMC 1Q86W 3ZRXA 3H9VA 3W7SA 1IDSA 4NTWA 5A9GA 2GV9A 2FL4A 2ARHA 2WLJA 1HNWB 3WB2A 4IIJB 4DR5B 4ZI7B 5IY5B 2UXDB 4UV8A 4AQYB 2FKXA 1NTZH 2EINC 4X1YA 4TUYA 2YIBD 1BGYH 1IBMB 1B04A 3Q4HB 4XBFA 3FB8C 1W0KG 5KLVH 4ZBMA 3G67A 3CXCU 2KKWA 3N2KA 1F4MA 1SQPH 4X1KB 5IYZA 3ZHRA 1M1KW 5CA0B 4G27B 1QLNA 1HDJA 3VQXA 2HEPA 1E1RG 4IYIA 4LFBB 4FPPA 5EC1C 1YTFB 1SESA 1S5JA 1VQ8V 3W7XA 1N33B 1QHTA 1SQVH 3OT7A 1QR8A 4DR6B 1SZTA 1GN6A 2ZXWC 1N34B 1FXKA 3R65A 3AG2C 3GVMA 2LGQA 4UVCA 1IZ3A 2EJ7A 3CYOA 1N32O 1VEWA 4F4LA 5C8YA 2LO1A 5FNVB 2UXCO 1AP6A 4JI8B 4WCEV 1XHXA 3CRRA 3QO5A 1OCCB 3S3XA 3ZMSA 2QKSA 2ZR2A 3ZMVA 3MHSC 1NH2B 4R6ZA 4CC5A 4FM0A 3DSQA 4H13B 3ZJZA 1Q6UA 4TUYB 4KP4A 1Q90D 1SF9A 2EIJB 4X1YB 3CB2A 2P90A 5EIBC 1I94O 4IYHA 2EX3A 5J9PC 2OYQA 1OCRB 3BVOA 3CXHF 4RO2A 4GT1A 1TUBA 1YSCA 2DN9A 3ABTA 2WSSG 4ASUG 3FKSG 5IDJA 3B8MA 2ZDIA 2AHYA 3BPZA 3DGEA 3WG7B 3ZEDA 4UUJC 5C93A 5EC2C 1NJIW 2Q7GA 2IM9A 4GYCB 2YI8A 4LF7O 1JJOA 1X59A 2DW4A 4ABMA 1BSMA 4FM1A 1S77D 3CCMV 3ASNC 1GH6A 4FVMA 3ZN0A 4WFHA 1CEZA 2ZINA 2N04A 5L3DA 1KP2A 1KKDA 3SPCA 3ZBHA 5J2TB 2A3QA 1K97A 2Y4TA
chains in the Genus database with same CATH topology
5KAIZ 5TISZ 3JCUZ 5H2FZ 4UB6Z 3A0HZ 4IL6Z 3KZIZ 3WU2Z 2AXTZ 5E79Z 5GTIZ 3A0BZ 5B66Z 1S5LZ 4PJ0Z 5B5EZ 5KAFZ 5GTHZ 4UB8Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI Z;  5TIS Z;  3JCU Z;  5H2F Z;  4UB6 Z;  3A0H Z;  4IL6 Z;  3KZI Z;  3WU2 Z;  2AXT Z;  5E79 Z;  5GTI Z;  3A0B Z;  5B66 Z;  1S5L Z;  4PJ0 Z;  5B5E Z;  5KAF Z;  5GTH Z;  4UB8 Z; 
#chains in the Genus database with same CATH topology
 2BTQ B;  3SYQ A;  4LF4 B;  4K0K O;  1KP3 A;  1Q3E A;  1IBK B;  2OCC C;  1EFR G;  1NI8 A;  2P6J A;  4RWU A;  2BOC C;  3JD3 A;  2QGN A;  2OTL V;  1SQX H;  1L1F A;  2F4V O;  5KX5 B;  4ZOL B;  4JI8 O;  1VAR A;  1OCO B;  4LH7 A;  2P5O A;  3K5L A;  1N32 B;  3BRC A;  2BTQ A;  3JAL A;  3VOU A;  1N8R W;  2PTM A;  3WB0 A;  3KZI Z;  3HKE A;  4QNH B;  5KHG A;  5JH7 A;  3AG2 B;  4NVP A;  4LWS A;  1S72 V;  5EBW C;  1BQZ A;  3CP1 A;  5AG2 A;  2UU9 O;  3X2Q B;  2VQE B;  3L72 H;  4DR2 O;  1KEC A;  2IBZ H;  1HR0 B;  3K5M A;  4X65 O;  1Q7Y W;  3ZMU A;  4MW3 A;  4LF6 B;  2WLN A;  1ZL8 A;  2AHZ A;  1K4D C;  2XTA A;  3E8G A;  2GHY A;  4YHH B;  3CCR V;  4FZ1 A;  3BFR A;  1WP7 A;  4JAV A;  3CC4 V;  1XL6 A;  3LSU A;  1JOY A;  1J5E B;  4JYA B;  1K9M W;  4G2K A;  4LFA B;  1G4Y B;  3UT5 B;  2ZM6 O;  2H94 A;  4DR4 B;  1GRJ A;  3K04 A;  4LWS B;  2AW9 A;  2DWD C;  2HVK C;  3CX5 F;  5B1B B;  2R72 A;  4X66 O;  3ABL C;  1TA8 A;  3H1I H;  4GKK B;  3HPL C;  2LW1 A;  3NXS A;  4LFC B;  1IUR A;  1B6Q A;  1M56 B;  4Q20 A;  3MHH C;  4LF8 B;  2UXX A;  1VP7 A;  1MG1 A;  5KHH A;  3W7W A;  1JMK C;  5L3B A;  3APQ A;  1PP9 H;  3K59 A;  3CSX A;  1K4C C;  4PDM A;  5EK0 A;  3K0G A;  5LHG A;  4DXW A;  2IJK A;  2UUA B;  2JS5 A;  4FM2 A;  3IC7 A;  1AI5 A;  3KKY A;  5TIS Z;  2X6B A;  2DYR C;  1P4R A;  3E35 A;  1N36 B;  1JJ2 U;  1JQ0 A;  3SJC C;  1DF5 A;  1R3I C;  3ABU A;  2JJ2 G;  4P9O A;  4FMT A;  4X88 A;  1AIL A;  2Q0A A;  4GX5 A;  4KL1 A;  4XDK A;  4D7T A;  2JJ1 G;  1GM9 A;  4PI0 A;  2IH3 C;  5H2F Z;  3K58 A;  1NVP D;  1BMF G;  1YIJ V;  3D3I A;  3OEE G;  5KHI A;  3OUS A;  3P32 A;  3AG3 C;  3CS5 A;  2ZT9 B;  2HJD A;  1CXZ B;  3HKD A;  3H1K H;  4EFB A;  5JJN B;  1VIB A;  1YZB A;  2NN4 A;  4MTG A;  3MD0 A;  2NR5 A;  1L8D A;  5CA3 A;  4DV3 B;  1T5E A;  2L35 A;  2QM7 A;  2WLH A;  1QQC A;  1WB7 A;  2H3O A;  5E1A C;  1TUB B;  1WA8 B;  1HWY A;  2E5L O;  5BY1 A;  3N2K B;  2GSM B;  5LA6 A;  4YIP A;  5JQG B;  1F23 A;  1SER A;  3CEI A;  5BMV A;  4PA9 A;  1VQM V;  2VS0 A;  4CZZ A;  3K08 A;  4OX9 B;  2A06 H;  1K5S A;  4Z1V A;  5LYJ B;  5B3S B;  4O4L B;  4QPK A;  3ABL B;  4IIJ A;  1H38 A;  1HNX O;  1E79 G;  4JGS A;  4P30 A;  1R6N A;  4TV8 A;  3QO8 A;  4E4E A;  3ZHS A;  5CBG A;  1Z5W A;  2ILM A;  1XMO O;  3WU2 Z;  1SS3 A;  2DYR B;  5L3C A;  4YXW G;  1X4T A;  2B1I A;  4JI5 O;  1BE3 H;  1FJG B;  4UCU A;  4JV5 B;  4O4H B;  2ZIO A;  3LSS A;  3K5O A;  1AR1 B;  3UO2 A;  1JFF B;  4DV4 O;  1FYJ A;  1K7D A;  1RSO A;  5GW7 A;  2Q68 A;  4AHC A;  5LXT A;  1YI2 V;  1GN4 A;  2BE3 A;  4UCS A;  4YJ3 A;  4B3T B;  4TV9 B;  3K79 A;  3GB7 C;  4MW8 A;  2V1D A;  1R3L C;  3FAV B;  1NKD A;  3LDE A;  3BHP A;  2JGU A;  1ZUQ A;  5LGN A;  4JI4 O;  2XOK G;  3JAR A;  3ABK B;  2CH7 B;  1K5Q A;  5EBM C;  2Q9L A;  4CS2 A;  1AI4 A;  4GKJ O;  2O57 A;  4DV2 O;  4O2A B;  5LMN O;  5JCO A;  3N27 A;  4JI2 O;  1YF2 A;  3VQW A;  1K73 W;  3TXQ A;  4X62 B;  2M7W A;  4LNU B;  1PNM A;  4BIZ A;  2IU3 A;  3ETE A;  1TVK B;  1HNZ B;  4J80 A;  1G1X B;  3U0Z A;  1FFX A;  2QTS A;  4JI3 B;  3EVK A;  4YY3 B;  5D5Q A;  3P3P A;  3CRA A;  1XIL A;  2AXT Z;  1EN6 A;  3UCS C;  4DV7 O;  3I56 V;  1O9G A;  2VQF O;  3Q4H A;  1L0L H;  5IT9 N;  4J42 A;  4DV6 O;  1B3Q A;  4B3S B;  3T1Y O;  3WFV A;  4MVQ A;  5IYC O;  5HFM A;  2M6Y A;  2PYL A;  1NR7 A;  1Z2G A;  2ZR3 A;  4J41 A;  3HR0 A;  1H8E G;  4DK1 A;  1YDX A;  3SGI A;  4J7Z A;  4DR1 B;  5KA5 A;  3E83 A;  3CC7 V;  2LJ2 A;  2WLL B;  1FAF A;  3BA8 A;  1PM9 A;  4UCO A;  5DEC A;  5BZB A;  4NB5 A;  1G6U A;  3P3N A;  1FXH A;  1Q43 A;  3AEI A;  3M99 B;  5IWA O;  1I5X A;  1SET A;  2Q7H A;  4JI6 O;  2E3C A;  4DW0 A;  1VQ9 V;  2ZE5 A;  1XNQ B;  3JAW B;  4I0X A;  2KQX A;  3ZIA G;  2QWO B;  3RVY A;  2Q6A A;  2ADQ B;  2KG7 A;  4PHZ A;  3K06 A;  1RFY A;  4X64 O;  4JI7 O;  3SJA C;  3ETG A;  1FXV A;  1H2K A;  2DWE C;  2QWR B;  1EZV H;  1KC8 W;  3B40 A;  2YXH A;  1OZ0 A;  4N23 A;  4X8A A;  1MA1 A;  4BW5 A;  5LHH A;  4LF9 B;  4DR7 O;  5H9C A;  2JIZ G;  1ZX3 A;  5EYP B;  2DQ0 A;  5LOV A;  4TWK A;  3RGB A;  3X2Q C;  4AIL C;  4J11 A;  2F1M A;  1U97 A;  4KXR A;  2CTR A;  1Q6H A;  2ZKO A;  3JAW A;  1GAX A;  1QLE C;  2JVD A;  3FYE B;  4JF3 A;  3F7V C;  1NS1 A;  3E89 A;  1DLB A;  2LFS A;  1YEW A;  1SQQ H;  3SR2 C;  5BR8 O;  2AZ2 A;  2FYU H;  2LW7 A;  3K3W A;  1YVW A;  2BCC H;  3AG4 B;  1WB8 A;  1R3K C;  1BT8 A;  4I4T B;  4R7C A;  4PD4 F;  1S3J A;  3EHB B;  2BTO A;  1VMG A;  4UV9 A;  5EIB D;  1GN3 A;  1AJP A;  2YUA A;  2W6I G;  3ZHV A;  1BCC H;  3RYF A;  4FK5 C;  4UCV A;  1AJN A;  1FPO A;  2UXN A;  5JCO C;  1JPX A;  2F93 B;  2HR3 A;  3E22 B;  4B3R O;  4O2B B;  2KG7 B;  2WLL A;  4DR7 B;  2QJ1 A;  1SA0 A;  2QA4 V;  2E75 B;  3JD4 A;  2R9R B;  2Q8V A;  4CS4 A;  3JCU Z;  1QCE A;  1Y76 B;  4K8Z A;  1S5H C;  3WG7 C;  1AJQ A;  4MT8 A;  3W7U A;  3JAL B;  1KMI Z;  2P4K A;  2P4V A;  4X64 B;  3L70 H;  1TAE A;  3U11 A;  3K03 A;  5IJ0 B;  4LBE C;  2P22 C;  3K57 A;  1N0N A;  3OTO O;  5FPO A;  4B7K A;  1TUE B;  3CCE V;  3BA9 A;  2WPD G;  1XOU A;  3E8F A;  3JCZ A;  1KUQ A;  1XRE A;  5L3E A;  1IBL O;  1QNM A;  4I55 B;  4OX9 O;  1NU1 H;  1OCR C;  3TCU A;  4XDJ A;  3JAT A;  1QVF U;  2KSD A;  1TVK A;  3ZRW A;  2C2A A;  2AGA A;  3THO A;  1L0N H;  3H1H H;  3G71 V;  3TXS A;  2H8P C;  4NR1 A;  3SYO A;  3MAQ A;  5KHK A;  1GTO A;  2D3O W;  1KU9 A;  5KAI Z;  3ABK C;  4GX1 A;  4JI1 B;  3OR6 C;  4BAY A;  1R3J C;  3IAY A;  4DUY O;  4O2A A;  3K0D A;  5CA1 A;  2A0L A;  1Q82 W;  4DV6 B;  3B77 A;  4DV1 O;  2RJZ A;  5IYD O;  3A0H Z;  4UVB A;  1MMM A;  3OR7 C;  1Y66 A;  3BAA A;  3O65 A;  3UO3 A;  4UB6 Z;  1S0V A;  3ZS8 C;  1ORQ C;  3HKE B;  2Z5U A;  5HFL A;  4DUY B;  4P2Z A;  1K34 A;  2ITD C;  4YJ3 B;  1NZ6 A;  5LXT B;  5KUM A;  3T4D A;  4PDV A;  2ETN A;  3D36 A;  3N2G A;  3CMA V;  1AI6 A;  3BY6 A;  1XMQ B;  2V4D A;  3VQV A;  4OXS A;  3IJ4 A;  5CBH A;  3CCS V;  3B2E E;  3FB7 C;  2E74 B;  2OTJ V;  3STZ C;  1MZF A;  4U3J A;  5F2V O;  1IBL B;  3ETQ A;  1XL4 A;  2QE7 G;  4MVS A;  4JI4 B;  1IXM A;  4DV1 B;  3RT3 C;  4TV8 B;  1OCZ C;  5BMV B;  2HFE C;  5JQG A;  1N4C A;  4FFK A;  4WFA V;  4FIP C;  2XT9 A;  2DQ3 A;  2X6A A;  2ZM6 B;  3FFQ A;  4OPH A;  4P9P A;  2ZQM A;  1XNR O;  1GN2 A;  3L71 H;  4WBN A;  1FFX B;  4PJ0 Z;  4DV4 B;  4UCR A;  3SJB C;  2K9P A;  5KMG A;  2E76 B;  2CGO A;  1D5A A;  3T1H B;  3UQ8 A;  5LA6 B;  3JSN A;  4B3R B;  4YHH O;  1EM1 A;  4EKW A;  3FB6 C;  3OW2 U;  3OE7 G;  3CRQ A;  4LH6 A;  4CS3 A;  1AR4 A;  4H33 A;  1IVS A;  4DV5 O;  1A32 A;  1PD3 A;  2BSK B;  1H2S B;  2RNB A;  3ZRS A;  2YI9 A;  3JAR B;  2X7R B;  4FFB A;  2GBO A;  3CME V;  3E8B A;  1GKF A;  5GTH Z;  3T1H O;  1URF A;  5DED A;  3FB5 C;  2HHH O;  1KQS U;  5L3G A;  1P7B A;  2FTK A;  4FLW A;  3G4S V;  2GUZ B;  1XMQ O;  5FNV A;  2V7Q G;  5C8Y B;  2A7W A;  2W6J G;  3HKD B;  1XNR B;  1HP8 A;  2CE4 A;  4MVZ A;  4MS2 A;  1H2G A;  1MOF A;  1FD9 A;  3L75 H;  1UPG A;  3RYI A;  2UUC O;  4LF5 B;  4C7U A;  1M56 C;  4LF9 O;  4WF9 V;  1BHA A;  4PDL A;  1OV9 A;  3CWB H;  4JI0 B;  4RAI A;  4CH4 A;  4ZHQ A;  5B1B C;  4B08 A;  2XAJ A;  1PPJ H;  4D6T H;  5BR8 B;  4WFB V;  4QPJ A;  1XBL A;  3CJH B;  1BS3 A;  5B1O A;  3LUT B;  3QG5 A;  4UVA A;  3ZHU A;  1ZTE A;  4DK0 A;  4PEL A;  4RUE A;  3M7M X;  5D5P A;  3SPJ A;  2XND G;  4FLX A;  3ZMZ A;  5JVD A;  4X1K A;  5IYZ B;  4JI1 O;  1M57 B;  2ZDI C;  5LL6 Y;  5K1X A;  2X6C A;  3K5N A;  3JD2 A;  2ZIM A;  2XAQ A;  4EB6 A;  3ZRW B;  1LUW A;  3EFF K;  5CMU A;  4HAM A;  2DYS B;  2EIK C;  4LP8 A;  1Z5V A;  3HB3 B;  3ZRV A;  1AB3 A;  4UCT A;  2YC0 A;  3OFN G;  3CPW U;  2YDE A;  4PDR A;  2QM8 A;  2HLD G;  3BAB A;  4RUF A;  1FS0 G;  4ZHQ B;  3RYH B;  3RW0 A;  5B3S C;  5KUK A;  1XNQ O;  4GKK O;  4B3S O;  4GX2 A;  2Y4U A;  3APO A;  4KUM A;  4OPA A;  1W59 A;  4KHP B;  2EZP A;  5ITZ B;  3UM7 A;  1Q81 W;  1I7F A;  3ZX6 A;  1NQT A;  4CC6 A;  1DK1 A;  4YY3 O;  4AI8 A;  5IJ9 B;  2N05 A;  3SPG A;  1M5I A;  4K8X A;  4JYB A;  5IYB O;  1XQ8 A;  5CN0 A;  3IFX A;  4YIO A;  2RDC A;  2QWP B;  1OHH G;  1M57 C;  3DC6 A;  4F6R A;  4FFB B;  3RYC B;  2Z0A A;  1NTM H;  1LNQ A;  4ICG A;  1DGS A;  4Z1M G;  2JEX A;  1RPO A;  3L9D A;  4TT3 G;  4JI0 O;  4QJF B;  4ZIB A;  3LSQ A;  1YHQ V;  1YJW V;  2PZS A;  1RM1 C;  2OWO A;  3QO7 A;  1SRY A;  2HKO A;  3C90 A;  2VRZ A;  2QR4 A;  1MAB G;  4JZ2 A;  2PYJ A;  1DF4 A;  5IE9 A;  4X62 O;  3C3S A;  4BIU A;  5KMG B;  3ML0 A;  4LF4 O;  4JPR A;  1WLE A;  4W4L A;  3JAM N;  1WN7 A;  3A0B Z;  2ZCE A;  3C3T A;  1PNL A;  2HHH B;  3D8C A;  3KCY A;  4HBN A;  2F43 G;  4CBC A;  3D3Q A;  1XMO B;  2IH1 C;  2QDO A;  4NTX A;  1MSW D;  5JVD B;  1K92 A;  3FAV A;  3A8T A;  2XAG A;  2XHB A;  4IHJ B;  2QWQ B;  4DV5 B;  1VQ5 V;  2IW5 A;  1O9H A;  2YS8 A;  3N2G B;  5CBF A;  5BXZ A;  3G6B A;  1M90 W;  4PA4 A;  2ATK C;  4J7K A;  4HNA B;  2GUZ A;  4MVM A;  4JV5 O;  2WLM A;  1VQP V;  1FJG O;  3IC9 A;  3FD9 A;  4XDL A;  4J9Z B;  4FLY A;  2CTP A;  3TJT A;  2CUG A;  1G8M A;  2DOS A;  3AK2 A;  2K1E A;  3U10 A;  3CHX A;  1K33 A;  1K8A W;  1Q6I A;  3E2E A;  3L73 H;  4KHP O;  2YXL A;  2P7T C;  2ZE8 A;  1XI1 A;  2QEX V;  4X20 B;  4DRX A;  1UFI A;  4FLZ A;  4JI6 B;  1OCO C;  4LC1 A;  3JD0 A;  5JJE B;  5FLX N;  1QLE B;  4L87 A;  1QR9 A;  4JAA A;  3SDL A;  5LYJ A;  1ZLZ A;  5H6Q A;  3LNN A;  1H2M A;  3RVZ A;  1J95 A;  2A9H A;  2CTQ A;  1AR5 A;  1VF6 A;  2EIK B;  5A2Q N;  2WWW A;  3H01 A;  4IGG A;  2DYS C;  5B66 Z;  2BSK A;  4O4J B;  3F7Y C;  4GZR B;  3ABM B;  4GLX A;  4K35 A;  5CA0 A;  2P06 A;  3LDD A;  1WA8 A;  4MTO A;  2PF4 E;  4DW1 A;  3T1Y B;  1NTK H;  1GK9 A;  4MTF A;  1ZSP A;  2IJH A;  4DV2 B;  4O4I A;  4GKJ B;  1W0J G;  1YJ9 V;  1Y67 A;  3E8H A;  4KFM A;  4U7N A;  1OCZ B;  2JS3 A;  3OM3 B;  3OMN B;  2CTW A;  2B9Z A;  5JJJ B;  1QBZ A;  4JAU A;  3S3W A;  4TV9 A;  2ZE7 A;  2UUC B;  2RQ6 A;  4LF5 O;  4BWA A;  3JAK A;  4I50 A;  1VQO V;  4BW9 A;  2Y0I A;  3KCX A;  5DN6 G;  3KG2 A;  1EN4 A;  3RN4 A;  1Y74 A;  2ZD9 A;  4FLU A;  4LFA O;  2Y48 A;  2JDI G;  1P49 A;  1ARO P;  2UUA O;  2P67 A;  1HNW O;  5LMN B;  2HG5 C;  2ZNI A;  1WJZ A;  1V54 B;  1V54 C;  3AK1 A;  1RPR A;  2EBO A;  1GM8 A;  4D7S A;  5E79 Z;  1OCC C;  2OIE A;  4LFC O;  4GX0 A;  3ASN B;  3R66 A;  3JYC A;  2VWJ A;  4IHJ A;  2MW2 B;  2QKC A;  4DR2 B;  4E2L A;  2UU9 B;  4H0L B;  5H6R A;  4B3T O;  4DR4 O;  1XHZ A;  2YEV B;  2KB1 A;  3TK1 A;  1UJW B;  1HNX B;  1P84 F;  1NR1 A;  2EZO A;  1SQF A;  4EB6 B;  4JYA O;  3CCL V;  2EIL B;  1N0J A;  3O9O A;  2XUM A;  5LGU A;  2CAZ C;  3OMA B;  4N21 A;  2F4V B;  3JSL A;  4JI5 B;  1QVG U;  1PKX A;  3UKM A;  3ZMT A;  4R8C A;  3L74 H;  1VQ4 V;  4HZ3 A;  4ZI7 A;  2JGD A;  4X65 B;  1VQK V;  4R50 A;  3HKC A;  2E5L B;  2AZ0 A;  3SYP A;  1NT2 B;  3OGC C;  2WA4 A;  5EBL C;  2EIJ C;  1HW7 A;  3CRC A;  1WP8 A;  5EZY B;  1VQN V;  4WFG A;  4FZ0 A;  4DV3 O;  3OEH G;  3G80 A;  3MDS A;  3IGA C;  3K9S A;  1SC5 B;  4I55 A;  1KKC A;  1GMG A;  2FB5 A;  2PGG A;  1RM1 B;  3JAS B;  4RQE A;  1R6T A;  1NVP B;  1MSD A;  4BR6 A;  1M4U A;  3RBZ A;  5IJ0 A;  3G6E V;  4X1I A;  4O2B A;  3CE2 A;  4L8J A;  3E22 A;  2Q67 A;  3ZHQ A;  1TGO A;  4F6R B;  3I5D A;  1JA8 A;  3SJQ C;  2ZXW B;  1Y76 A;  1NBM G;  1N36 O;  1AVM A;  5J2T A;  4Z2W A;  1VF6 C;  5B1N A;  3OD4 A;  2W0F C;  4ZKI A;  4W4K A;  3F5W C;  5FL7 G;  1KB9 F;  2OCH A;  2NLJ C;  4JYC A;  1EBO A;  1H2N A;  4MVO A;  3CCJ V;  5IJ9 A;  1KYO F;  4B3M O;  5DM6 V;  3DXR A;  4TOI A;  1Y4M A;  2L6L A;  2CDY A;  3RYF B;  1FFT B;  2ZNJ A;  3PJS K;  1Y6X A;  4PV1 B;  2Y69 B;  3JAS A;  4LF8 O;  2YSU B;  3J7A U;  2DMX A;  2F23 A;  1D5N A;  5B1A C;  1D2D A;  4FLT A;  4UFZ A;  2YIB A;  4CH6 A;  2MK3 A;  4X66 B;  5KAF Z;  3UT5 A;  1Q8I A;  2XAF A;  2OCC B;  5IWA B;  2LQT A;  3AG7 A;  1YJN V;  2G38 A;  3P30 A;  1J5E O;  1OJH A;  3H1L H;  3B09 A;  3RYI B;  1R1B A;  1N34 O;  3LNM B;  4DR1 O;  3M8A A;  1XEQ A;  2Q5Z A;  3JD1 A;  2WLI A;  4J7J A;  2JK5 C;  2CH7 A;  4NKG B;  4LF6 O;  1Y74 B;  2YIA A;  3ZCC A;  4NTY A;  3OTO B;  1HR0 O;  2VWK A;  3NR7 A;  4DR3 O;  1WPB A;  2DE0 X;  5GON A;  4U3J B;  3BEH A;  2OT5 A;  2VQF B;  2PI4 A;  4EFE A;  1VQ7 V;  1EN5 A;  1I5Y A;  1YCI A;  1YIT V;  1JVM A;  3SPI A;  3F5T A;  4UB8 Z;  1V55 B;  1E1Q G;  5KX5 A;  1U96 A;  4LCU C;  1RSO B;  4MVR A;  3AG1 B;  1GM7 A;  4DUZ O;  3CCU V;  4WFE A;  1FXK B;  4I0X B;  2B5U A;  4QE7 A;  4AQY O;  1XDC A;  3RWR D;  4K0K B;  5J2U A;  4DR3 B;  4LFB O;  4DO2 A;  3OMI B;  4O4J A;  5FPR A;  2UUB O;  2JRI A;  2VQE O;  2WA3 A;  1LR1 A;  1VQ6 V;  4UXN A;  5CB4 B;  4A5U B;  2ADP A;  1WAZ A;  4I50 B;  1WNS A;  1SKV A;  5CA1 B;  1CP9 A;  4H44 B;  3OTF A;  1JX9 A;  3FYI B;  3AG4 C;  4LF7 B;  2DJV A;  4NXN O;  1PL0 A;  3AG3 B;  4LR3 A;  1PV0 A;  4FJC C;  2YXY A;  2Z3Y A;  2Y0P A;  4LNU A;  2Y69 C;  4PA7 A;  3CCV V;  2F95 B;  3T2M A;  1DTO A;  4DR5 O;  1GO3 F;  4FLV A;  2BOB C;  2LGW A;  1W2B U;  2QWN B;  3QTC A;  1FKA O;  4B3M B;  2OIG A;  4JTA B;  4QGP A;  5LMU B;  2Q7E A;  4JAS A;  2LFR A;  4MSW C;  4MTX A;  1BHB A;  1I94 B;  3GWO A;  3ETD A;  3DTU B;  1BL8 A;  2HJF C;  2WLK A;  4WBN B;  4X89 A;  4U3F H;  4JI7 B;  3AG1 C;  2EUL A;  1M9N A;  5J2U B;  1IX9 A;  1V55 C;  1I0H A;  2GDS A;  3TET A;  1SA0 B;  1VQL V;  3A2F A;  4K3A A;  2ODM A;  3PN1 A;  3ZHT A;  4YJ2 B;  4PA3 A;  5CB4 A;  2EIN B;  4NXN B;  1S76 D;  4NYK A;  4QE9 A;  3WB1 A;  1K3E A;  5IY5 C;  3ICX A;  3SPH A;  2RN9 A;  1MZE A;  3CD6 V;  3CRM A;  2QKA A;  2FML A;  2PY5 A;  4HNA A;  2X0L A;  4I9W A;  1N33 O;  5JWP A;  2UUB B;  1MNG A;  1JFF A;  2R9A A;  4G28 B;  3T4Z A;  1KD1 W;  2QM4 A;  3GWK C;  1AI7 A;  1FXK C;  5GTI Z;  3JAT B;  1EZJ A;  3AK3 A;  3TGU H;  2ZE6 A;  3ZN1 A;  5LBQ A;  2EIL C;  4DUZ B;  4OGQ B;  4DV7 B;  2UXC B;  4DV0 B;  2F66 C;  4O4L A;  1COW G;  3DC5 A;  4JI3 O;  1VF7 A;  5LOV B;  1KBH A;  2HP8 A;  1F7Y A;  1PNK A;  5EYP A;  3FX7 A;  1HNZ O;  1IBM O;  1B06 A;  3QNE A;  4DR6 O;  2Q4P A;  4TSF G;  3W7T A;  3J81 N;  3ASO B;  2GTA A;  2IU0 A;  3SYC A;  4JI2 B;  5LGT A;  3B4S A;  2WAM A;  1V9P A;  1R73 A;  4NXM B;  2EIM B;  4X20 A;  4DRX B;  4J9Y B;  5B5E Z;  2IJI A;  3HKB B;  3CCQ V;  2YID A;  3K9A A;  4PA6 A;  1YTF D;  3OUF A;  2D2C B;  1US6 A;  2CGN A;  4RQF A;  5K1P A;  4GCZ A;  2UXB O;  5LP6 A;  2N74 A;  2A79 B;  3LDC A;  2PUS A;  2NNU A;  4X1I B;  4GUN A;  2B1G A;  1JR9 A;  4JTD B;  4QIW F;  2W0X A;  3SYA A;  4I9Q A;  2UXB B;  1WPX A;  2UXD O;  2CK3 G;  5LP6 B;  1H8H G;  3OGI B;  4JTC B;  3VQY A;  1THZ A;  2JGD B;  1CPY A;  4DV0 O;  2XAH A;  3QVN A;  4MVU A;  1F51 A;  2RCV A;  1XUQ A;  5GON B;  4Q6G A;  1PL4 A;  4NXM O;  4CH5 A;  5EZY A;  1NH2 D;  1ENV A;  3CC2 V;  1AP5 A;  1VF5 B;  2WLI B;  4B7E A;  3B8N A;  4BIO A;  1ZWI C;  2R70 A;  1R6K A;  5LP6 C;  4I4T A;  3I55 V;  5KA6 A;  4TQF A;  1SZX A;  3CJH A;  4J10 A;  1F4N A;  4DYL A;  2ITC C;  3HKC B;  4H37 A;  3T1C A;  1IBK O;  4U7O A;  2RMK B;  3BCC H;  5L3F A;  3A0R A;  1ZL8 B;  1M93 A;  3E86 A;  1P7G A;  4ZOL A;  2EIM C;  3DXR B;  4I5S A;  1I08 A;  4EEQ A;  2R9I A;  4JZG A;  4WFF A;  3H1J H;  2Q69 A;  3RYC A;  1SQG A;  2HVJ C;  4CH3 A;  1IXB A;  1BZK A;  3ASO C;  1QU7 A;  2YEV A;  3EXA A;  5H5N A;  2Q0O C;  2Q73 A;  2QTO A;  1Q5O A;  1RP3 B;  2GTS A;  1YXB A;  2QSA A;  5KHJ A;  2JEU A;  5B1A B;  1BQ0 A;  4I7Z B;  4IT5 A;  4IL6 Z;  1JCH A;  4X9Q A;  4PI2 A;  4YJ2 A;  1ZAU A;  3JAK B;  4O4H A;  1H2L A;  5JH7 B;  5ITZ A;  1LUV A;  3J80 N;  2PI5 A;  4TQD A;  2LP7 A;  1S5L Z;  2YIC A;  3RFR A;  3QF7 A;  4HYO A;  3VBB A;  3OAA G;  4F6E A;  2EJR A;  2XAS A;  4JYY A;  2IJJ A;  4O4I B;  1ROP A;  3HKB A;  3STL C;  5LMU O;  1SQB H;  3D36 C;  3RYH A;  5LHI A;  3ABM C;  1Q86 W;  3ZRX A;  3H9V A;  3W7S A;  1IDS A;  4NTW A;  5A9G A;  2GV9 A;  2FL4 A;  2ARH A;  2WLJ A;  1HNW B;  3WB2 A;  4IIJ B;  4DR5 B;  4ZI7 B;  5IY5 B;  2UXD B;  4UV8 A;  4AQY B;  2FKX A;  1NTZ H;  2EIN C;  4X1Y A;  4TUY A;  2YIB D;  1BGY H;  1IBM B;  1B04 A;  3Q4H B;  4XBF A;  3FB8 C;  1W0K G;  5KLV H;  4ZBM A;  3G67 A;  3CXC U;  2KKW A;  3N2K A;  1F4M A;  1SQP H;  4X1K B;  5IYZ A;  3ZHR A;  1M1K W;  5CA0 B;  4G27 B;  1QLN A;  1HDJ A;  3VQX A;  2HEP A;  1E1R G;  4IYI A;  4LFB B;  4FPP A;  5EC1 C;  1YTF B;  1SES A;  1S5J A;  1VQ8 V;  3W7X A;  1N33 B;  1QHT A;  1SQV H;  3OT7 A;  1QR8 A;  4DR6 B;  1SZT A;  1GN6 A;  2ZXW C;  1N34 B;  1FXK A;  3R65 A;  3AG2 C;  3GVM A;  2LGQ A;  4UVC A;  1IZ3 A;  2EJ7 A;  3CYO A;  1N32 O;  1VEW A;  4F4L A;  5C8Y A;  2LO1 A;  5FNV B;  2UXC O;  1AP6 A;  4JI8 B;  4WCE V;  1XHX A;  3CRR A;  3QO5 A;  1OCC B;  3S3X A;  3ZMS A;  2QKS A;  2ZR2 A;  3ZMV A;  3MHS C;  1NH2 B;  4R6Z A;  4CC5 A;  4FM0 A;  3DSQ A;  4H13 B;  3ZJZ A;  1Q6U A;  4TUY B;  4KP4 A;  1Q90 D;  1SF9 A;  2EIJ B;  4X1Y B;  3CB2 A;  2P90 A;  5EIB C;  1I94 O;  4IYH A;  2EX3 A;  5J9P C;  2OYQ A;  1OCR B;  3BVO A;  3CXH F;  4RO2 A;  4GT1 A;  1TUB A;  1YSC A;  2DN9 A;  3ABT A;  2WSS G;  4ASU G;  3FKS G;  5IDJ A;  3B8M A;  2ZDI A;  2AHY A;  3BPZ A;  3DGE A;  3WG7 B;  3ZED A;  4UUJ C;  5C93 A;  5EC2 C;  1NJI W;  2Q7G A;  2IM9 A;  4GYC B;  2YI8 A;  4LF7 O;  1JJO A;  1X59 A;  2DW4 A;  4ABM A;  1BSM A;  4FM1 A;  1S77 D;  3CCM V;  3ASN C;  1GH6 A;  4FVM A;  3ZN0 A;  4WFH A;  1CEZ A;  2ZIN A;  2N04 A;  5L3D A;  1KP2 A;  1KKD A;  3SPC A;  3ZBH A;  5J2T B;  2A3Q A;  1K97 A;  2Y4T A; 
#chains in the Genus database with same CATH homology
 5KAI Z;  5TIS Z;  3JCU Z;  5H2F Z;  4UB6 Z;  3A0H Z;  4IL6 Z;  3KZI Z;  3WU2 Z;  2AXT Z;  5E79 Z;  5GTI Z;  3A0B Z;  5B66 Z;  1S5L Z;  4PJ0 Z;  5B5E Z;  5KAF Z;  5GTH Z;  4UB8 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...