5E79Z

Macromolecular diffractive imaging using imperfect crystals
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5e79Z00
3A0HZ 4PJ0Z 3KZIZ 5TISZ 1S5LZ 3JCUZ 5B66Z 5KAIZ 5GTHZ 3A0BZ 5E79Z 3WU2Z 5KAFZ 5GTIZ 2AXTZ 4UB8Z 4UB6Z 4IL6Z 5H2FZ 5B5EZ
chains in the Genus database with same CATH superfamily
3F7YC 3AG7A 3LDDA 1H2GA 4JI2O 1GM8A 1AR4A 5H6RA 1YSCA 5L3BA 3P30A 1YTFB 2CGNA 1URFA 3FB5C 2F43G 4TV9B 3SYQA 2E76B 3F5TA 3CCEV 4F6EA 5KLVH 1ZLZA 1VQ9V 1GMGA 3CCVV 2BE3A 1FYJA 4P9PA 2YEVA 4PD4F 4OX9B 4KL1A 5LXTB 1YCIA 5CBFA 1H8EG 1JQ0A 2IJJA 1N0NA 4TSFG 1P4RA 4GX2A 5EIBD 1VQMV 1S72V 1BCCH 3K9SA 4O4IB 4ZBMA 1MNGA 5J2UA 5C93A 2QWRB 1SS3A 1IDSA 4X66B 3P3NA 1HR0B 5ITZA 5KHKA 1VQ4V 2EULA 1VQPV 1YEWA 4BR6A 4JI6B 1XL4A 3M99B 2L35A 1S5HC 1V54B 1JJ2U 4NXNB 1KUQA 1R73A 3VOUA 3SJAC 1FFXA 2ZDIA 4UFZA 3JD3A 4D7TA 4UCOA 2ZKOA 4O4LB 4UV9A 4BW9A 1IBLO 4JZ2A 3LDEA 3HPLC 4DR3O 1SQXH 3AEIA 4I0XB 1S5LZ 3T1YO 3JARB 4GCZA 2F4VO 4YJ3A 1XMQO 3E89A 1K92A 1SQVH 4TQDA 3OTOO 5IYZA 5EC1C 2DYSC 2F93B 4I4TB 3H9VA 3B8NA 1N34O 3L71H 1B6QA 3CE2A 2QWNB 3BA9A 2VQFB 5B3SB 3IJ4A 5D5QA 3L75H 4O2BB 2WLLA 4LC1A 2Q4PA 4XDLA 2IU3A 2DE0X 3A0RA 1B3QA 3JASB 2WLMA 4UV8A 3C3TA 2CTQA 1RPRA 4JYAO 3ZHUA 2JS3A 4IYHA 2WSSG 1V55C 2DW4A 1QR9A 3J7AU 2D2CB 1KKDA 3ZHTA 1M93A 2UXCO 1HNWB 1Q82W 4DV1O 5B1BC 1KD1W 3EHBB 3EVKA 2GDSA 1NH2D 3IFXA 1PNLA 1XUQA 1AILA 1ENVA 4JI2B 3DXRA 1M9NA 4MTXA 5B5EZ 1SESA 2EZOA 4NTWA 1AB3A 2WLKA 1P7GA 5L3FA 4E4EA 1KC8W 4DUYB 1DTOA 4FK5C 1OCZB 3M8AA 2AXTZ 4DV7O 4H0LB 4UVAA 3OGCC 3H1JH 3T1HO 4MVSA 4W4LA 4QPKA 5H9CA 1EFRG 4FM0A 1PNKA 2IJHA 5BZBA 3C3SA 3Q4HB 3TGUH 4RUFA 4PDMA 3P3PA 2GUZB 4QE7A 3JCZA 5LYJB 5IYBO 3ABKB 2K1EA 2PGGA 1AVMA 3A0BZ 1IBLB 1VF7A 3ASNC 2QR4A 4DR3B 2NNUA 2PY5A 5K1PA 4O4HA 4X65O 5L3GA 4FZ0A 4FLYA 3ETDA 2DYRB 4UB6Z 3E8HA 3T1YB 1SF9A 1N32O 1O9HA 1XMQB 4H13B 4JPRA 3OTOB 1FJGO 2UUCO 3UT5B 1GKFA 4AQYO 1NBMG 1Q6IA 1DF4A 4YY3O 4X1YB 1BZKA 1D2DA 1XNQB 1R6KA 3HKCB 4JAUA 4JI0O 1XHXA 4FLXA 5LA6A 4NVPA 2BCCH 4ZI7B 2QM7A 4JYAB 1BS3A 1SQBH 1KQSU 4IIJA 3T4DA 2RN9A 2D3OW 2CH7A 2IU0A 4MSWC 2DMXA 2IBZH 2UXCB 1TA8A 4Z1VA 3RVZA 4DV1B 1JMKC 2Q69A 2YIBA 1XMOO 3KCYA 4J10A 2H3OA 2EINC 5DN6G 4I7ZB 1AJPA 1Q3EA 2Q9LA 3TK1A 1OV9A 4HNAA 2Y48A 4QGPA 2PF4E 2Z0AA 4EFBA 4DK0A 3MHHC 2N05A 4HAMA 3K9AA 4I55A 1KBHA 1NR1A 4GLXA 4LP8A 3CHXA 3D8CA 1Y74B 3ETGA 3UCSC 5EZYA 1F23A 3QO5A 4DV7B 5BMVB 3OTFA 1BHBA 1OCZC 4TT3G 2FKXA 5IY5C 1K5QA 1M4UA 2ZIMA 4H37A 3TXQA 3T1HB 2YS8A 2YIAA 4WFHA 5IE9A 2ODMA 4DYLA 2EIKC 3OMIB 3FYIB 4N21A 1K34A 2UUAO 1Z2GA 1R6TA 3D36C 4JV5O 2HKOA 1BE3H 2CTPA 2B9ZA 3RYIB 5CA0A 3ZRWB 3HKDA 3I5DA 3CPWU 4RQEA 1D5NA 4K0KO 1SA0A 2Q7HA 3HKEA 4MVMA 1VF6C 4I50A 2DJVA 3CXCU 5HFLA 3OR7C 1K33A 4P30A 4U7NA 3K5MA 2ZE6A 4R50A 5B1NA 3UO2A 1SERA 2QWQB 2XT9A 4P9OA 2WLHA 4LF8O 2GTAA 3MD0A 4X65B 4U7OA 3T1CA 4B08A 4FLWA 1WNSA 2RNBA 4YIOA 1N32B 4CZZA 2X6AA 1SZXA 3JALB 1RPOA 1XDCA 5JJEB 5CBHA 4B3MO 1FJGB 2UUCB 3E8BA 3G6BA 1VQ5V 2X6BA 4AQYB 4LNUB 3QTCA 1OCOC 3F7VC 5CA1A 1J95A 4YY3B 5IYCO 3W7WA 4I9QA 4B3RO 4KP4A 5GTHZ 3ZEDA 4CH5A 5KMGA 3ZRVA 1TUBA 3ZRXA 3OEEG 1JX9A 2QKCA 1HP8A 1IZ3A 1YVWA 1Q86W 3E8FA 4TUYA 4NXMO 2P6JA 2YIDA 3I55V 3BAAA 3RGBA 3NR7A 2ZINA 1NQTA 3AG2C 2LJ2A 2HVKC 2YEVB 2PI5A 1HWYA 5IWAO 3VBBA 3WU2Z 4F6RA 4PA7A 1QLEC 1COWG 1XMOB 3N27A 4ASUG 1JPXA 3L72H 1OZ0A 5J2UB 4LFCO 4JAVA 4X64O 2IW5A 5ITZB 3OD4A 2AHYA 1A32A 1H2SB 5LP6B 4PV1B 4DXWA 1Q5OA 1Q6HA 1PNMA 2Y0PA 2VWJA 3QG5A 1JFFA 1SETA 1JA8A 2KKWA 2AZ0A 4DV3O 1BL8A 3RN4A 4PA6A 4QJFB 2HLDG 1SKVA 1WAZA 1FFXB 1I7FA 4DUZO 4FFKA 4K35A 2V7QG 1NI8A 1U96A 4FM2A 2DWEC 1SC5B 1PM9A 4P2ZA 5E79Z 2GHYA 3ETQA 3CCJV 4W4KA 3S3XA 2LW1A 3ICXA 1H2LA 3SPJA 5JCOA 1DK1A 4YJ3B 1LUWA 3H1IH 1K7DA 2EILC 4JV5B 2OTJV 4YIPA 3LDCA 5IYZB 4YJ2A 2ZM6O 4D6TH 1ZTEA 1L0LH 1VQ8V 4K0KB 2W6JG 2P5OA 3JATA 1EN5A 2RDCA 1GM9A 4PI2A 4K3AA 5JJJB 1GK9A 2R70A 5CBGA 3D3IA 1P7BA 3S3WA 4JAAA 1MOFA 1BSMA 2YI9A 1WPBA 2PZSA 4LF8B 3LUTB 3WB2A 3OFNG 4NB5A 5KA5A 1Q43A 1FD9A 3BVOA 4B3MB 2YXLA 3ABLC 4ZIBA 4PA4A 2Q68A 3GWKC 1QVFU 1AR5A 3RYCB 4JGSA 5FL7G 2H8PC 2RQ6A 1R3KC 5H2FZ 4B3RB 3LNNA 3CB2A 1VQ7V 2IH1C 2VS0A 2LP7A 2VWKA 1YJNV 5FLXN 1B04A 2UXNA 4JI8O 3J81N 3U10A 4JTCB 1VQKV 1FAFA 4LH6A 1G6UA 4NXMB 2A9HA 1KB9F 5CB4B 1MSDA 4LBEC 2OCCB 3CMEV 2Q8VA 3JD1A 2NR5A 1W2BU 4ZOLA 1S0VA 3ZN0A 5KHJA 1OCRB 2HFEC 4G2KA 5IWAB 2Q7EA 3OMAB 4J7JA 3VQVA 3CC4V 3IGAC 4J7ZA 1H8HG 2M7WA 1NVPD 1VQ6V 2VRZA 1FXVA 2LGQA 4J80A 4O2AB 1OCCB 5EBWC 3SYAA 4LFCB 1I0HA 5BXZA 4X64B 5HFMA 2ZNIA 5EBMC 3OM3B 3OR6C 2YSUB 3QVNA 1M1KW 4JZGA 2XHBA 4L8JA 3W7SA 1AJNA 3E86A 3K5OA 1FXHA 3BY6A 2H94A 1IBKO 5L3EA 3BHPA 3IAYA 1RSOA 1Q90D 2BOCC 2N74A 3OE7G 2GTSA 5LP6C 4DV3B 2YI8A 4J7KA 4DUZB 1I08A 1Y67A 3K0GA 3B77A 5LGUA 4UXNA 2V4DA 2QA4V 2XAJA 5KHGA 4O4HB 1IURA 5LMUO 2PYLA 2BOBC 2YXHA 3ABUA 1PP9H 1U97A 5JQGA 4CBCA 3ZMSA 5FNVA 3OGIB 1Q8IA 1AP6A 1I5XA 4CH4A 1K9MW 4JI5O 2ZM6B 1FXKC 1XILA 3G80A 3FB7C 1AJQA 4B7EA 5KA6A 4KFMA 3CRCA 1VEWA 3CCMV 4GYCB 3FFQA 4X8AA 3B40A 3CCQV 2A06H 4UCVA 3N2KB 3P32A 1THZA 4CC5A 2E74B 1GTOA 3AG1B 4PHZA 4AILC 1N4CA 2A7WA 1FS0G 3FAVA 2UXXA 1EN4A 1NS1A 3H1LH 1ZL8A 4IIJB 3CC2V 4B7KA 5LGTA 2LO1A 4DK1A 3U0ZA 1KMIZ 1F7YA 2B1GA 2CH7B 2F66C 1MZEA 1RFYA 4ZKIA 5JJNB 2KSDA 1JR9A 4B3TO 1YZBA 4WCEV 4JI8B 2RJZA 4IGGA 3UQ8A 1G8MA 1IX9A 4JI7O 4HNAB 2CAZC 4O4JA 4ZHQA 5EYPA 4WFGA 2PUSA 2AZ2A 3JSLA 1MG1A 2UXBO 3AG3B 3RW0A 1QU7A 5EZYB 2OIGA 5IJ0B 5JH7A 3I56V 4WFFA 1OCRC 1L1FA 4TV9A 1HDJA 3QO7A 4LFAO 4LR3A 3TXSA 4CS3A 4R8CA 1S5JA 1ROPA 4GKKO 4MTGA 1IXMA 3JAWA 1J5EO 1T5EA 1OCCC 4CH3A 2JJ2G 2A3QA 1RM1B 2Q67A 3DC5A 4GX0A 1ORQC 3LSQA 4KXRA 4O4IA 3E2EA 5CA0B 4DRXA 3HKDB 4JI4O 5LBQA 2FL4A 5BY1A 4JYBA 1TUEB 4I50B 1V54C 4LF4O 1YITV 1YJWV 3C90A 4C7UA 3JAKB 3FB8C 4J41A 4CS4A 1QQCA 2W0FC 5K1XA 4PI0A 2F23A 2Q0AA 3RYFA 2E5LO 3AK3A 3G4SV 2Y0IA 5LMUB 2P7TC 4BWAA 2F4VB 3CS5A 4MT8A 4O4LA 4FLZA 4WFEA 4JI5B 1VQLV 2ATKC 3E22B 4DV4O 3ZMVA 1CPYA 3ABMB 3WFVA 1XOUA 3WB1A 4DR5O 2P67A 4X9QA 5B1AB 3N2GB 5CA1B 4LF5O 3U11A 1R3IC 2JEXA 3AK2A 4L87A 4DR2O 1N34B 3JARA 1Z5WA 1N33O 5KMGB 3CEIA 3FX7A 1CEZA 1TUBB 2MK3A 4I4TA 3A0HZ 4HYOA 5LMNO 3JD4A 1Y66A 2HHHO 4G28B 2CDYA 3ASOB 4OPHA 5B3SC 2QKAA 2DQ3A 5H5NA 2WLIB 4FFBA 4WFAV 4X20A 2X6CA 3ZHSA 2OWOA 1K73W 3FKSG 5EC2C 4MVZA 3ZN1A 1B06A 3AK1A 1UJWB 4PA3A 1W0KG 5JWPA 4F6RB 3ML0A 3B2EE 2ZR2A 3W7TA 4FVMA 4GUNA 2Y69B 1QCEA 4B3TB 1RP3B 1CP9A 3HKBA 2OTLV 1LUVA 1WPXA 4JI7B 2WLNA 1MSWD 2YXYA 4LCUC 1GH6A 3MHSC 1Q6UA 3ZJZA 1YI2V 2ZR3A 4JF3A 3PN1A 4FMTA 2UXBB 3JCUZ 1WN7A 2QKSA 4BW5A 3ZMTA 3CCSV 4LF7O 2GSMB 3DTUB 3AG3C 3QNEA 1JOYA 1KYOF 1L8DA 1QBZA 4NKGB 4LFAB 5DECA 2HVJC 1I5YA 1PKXA 1FPOA 1LR1A 4GKKB 4MVRA 4UCRA 2ILMA 3CP1A 1J5EB 4X89A 4AHCA 3K08A 2BSKA 4MVUA 4GKJO 5E1AC 4HBNA 5LHIA 2ZT9B 5KX5A 1VF5B 1YTFD 1JCHA 3OW2U 3SPIA 3K59A 1G4YB 2G38A 4YJ2B 5GONA 4EB6A 1RM1C 2IM9A 4JI4B 1WP8A 4DR4O 4FZ1A 3D36A 3JATB 1XHZA 2IJIA 4LF4B 3CCUV 5KHHA 2W6IG 4BIOA 3ABKC 5GW7A 3FYEB 1JVMA 2WWWA 1AI4A 2E5LB 4JYYA 3L9DA 2XAQA 2JGDB 4G27B 2WA3A 2NLJC 1M56B 1NR7A 2X0LA 4NR1A 4YHHO 4RWUA 1PPJH 3CRRA 2DYRC 1N8RW 1K4CC 2QM8A 2PI4A 4QIWF 5KUMA 4MVQA 2FMLA 3CXHF 4DV4B 1NTMH 4DR5B 3R66A 2EIJB 2WAMA 4LF5B 1DF5A 4DR2B 1VIBA 5A2QN 3ABMC 4IT5A 2VQEO 1N33B 1XI1A 2JK5C 2Q5ZA 1Z5VA 4D7SA 4JI0B 4TQFA 1HNXO 5DEDA 4BIZA 2OT5A 5LMNB 2HHHB 1SRYA 1N36O 4X1YA 1JJOA 5FPOA 1GN2A 1YHQV 2YUAA 3ASOC 2GV9A 1IBMO 4ZOLB 1R3LC 3O65A 3SPCA 3HR0A 3UM7A 3SJBC 1R3JC 1TAEA 1KP3A 4TV8A 3L73H 4JASA 4UB8Z 4ZI7A 1MA1A 3RT3C 3E8GA 2EX3A 2HR3A 2ITDC 3B8MA 4TOIA 3B09A 4PJ0Z 3JAMN 3KCXA 2ZE7A 2OYQA 3CRMA 1E79G 1KP2A 5IJ9A 2QWPB 1RSOB 1XQ8A 3X2QB 1R6NA 1BQ0A 1S76D 1X59A 2B5UA 4N23A 1XNRO 4LF7B 2P22C 3JSNA 3H1KH 4DV5O 2Q0OC 4IYIA 1GAXA 4CS2A 4QPJA 1W0JG 4QE9A 3CYOA 1P49A 4NXNO 2ZE5A 1XEQA 3QF7A 5LHHA 1ZX3A 5BMVA 2UUAB 4GKJB 4OPAA 3ZS8C 5FNVB 1DGSA 2ETNA 1MMMA 3ETEA 4XBFA 1H38A 2QDOA 5B66Z 2E75B 1X4TA 2P90A 2JJ1G 1AROP 4DR4B 4K8XA 5EK0A 2DYSB 1SQPH 4EEQA 2Q6AA 2F1MA 3IC9A 1H2KA 5J9PC 1I94O 2WLLB 2E3CA 2HG5C 2XOKG 3ZRWA 3L74H 4ABMA 5D5PA 3BRCA 5KHIA 5TISZ 3K06A 5JVDA 1YF2A 4YHHB 2PTMA 4PA9A 1HNZO 4UCUA 4KUMA 3PJSK 1IXBA 1BT8A 1TVKA 1PV0A 1OJHA 1V55B 2AW9A 3BEHA 1V9PA 3WB0A 2O57A 2JIZG 2VQEB 2EIJC 2F95B 1W59A 1PL4A 3K57A 1HNXB 1UPGA 5B1BB 4IHJA 3DXRB 4B3SO 1N36B 5J2TA 3CJHA 4MW3A 1WB7A 5EYPB 1WA8A 4EKWA 1WJZA 4WBNA 1AI5A 1LNQA 2ZXWB 4MTOA 3T2MA 2Q73A 2CE4A 3K04A 1GO3F 1IBMB 3GVMA 2R9AA 1Q7YW 3T4ZA 3E35A 4FIPC 3JYCA 2DN9A 5JH7B 4X62O 2EZPA 2QWOB 4FM1A 4JI3O 2ZNJA 3ZMZA 4DUYO 1EZJA 3APOA 4JTAB 3JAWB 3R65A 1AR1B 1AI7A 4CC6A 4QNHB 2UUBO 4DR6O 2ITCC 2JDIG 4RQFA 4DRXB 1MABG 4LWSA 4DV0O 2B1IA 3UO3A 1XNRB 2FYUH 3X2QC 3OEHG 4Q20A 4XDJA 5LP6A 4LH7A 4DV5B 2CGOA 2EJ7A 2BTOA 1O9GA 2ZDIC 3THOA 3RYFB 4GX1A 1VP7A 3SPGA 3GWOA 2RMKB 4X1IA 3GB7C 2WA4A 3QO8A 3MAQA 1Y76A 2R72A 3ASNB 3K3WA 3KKYA 5BR8O 3SDLA 3CRQA 3BA8A 4Z2WA 4R7CA 1XREA 2ZE8A 3FD9A 2ADPA 4KHPO 3AG4B 2CTWA 4AI8A 1SZTA 1FXKA 5C8YA 4K8ZA 2RCVA 1BHAA 1I94B 4DV2O 1XL6A 1H2NA 5LA6B 1M90W 4NYKA 3CD6V 3ZHRA 3O9OA 2EJRA 4MVOA 4YXWG 2YICA 4FFBB 4X20B 2QJ1A 1KECA 1HNZB 4F4LA 2JS5A 1XNQO 5LL6Y 3TETA 3OAAG 3HB3B 2XNDG 4A5UB 3HKBB 4WF9V 4E2LA 5LOVA 2HEPA 2BTQA 2P06A 3SR2C 2KG7A 4EFEA 1SQFA 2GBOA 4B3SB 5LGNA 3TCUA 2EINB 4OXSA 3RYCA 1KKCA 1CXZB 4X1KA 4U3JA 4I55B 3LSUA 3RYHA 1QHTA 1ZSPA 1NT2B 2OCCC 2ZXWC 2FTKA 1BQZA 1GN6A 3OUSA 1GM7A 2EIMB 4X62B 2A79B 3K79A 5CB4A 1K4DC 3STZC 3B4SA 4GZRB 4J11A 1GN3A 2R9IA 4JI3B 2WPDG 5CMUA 5KAIZ 3BPZA 1ZUQA 1SQQH 3CCLV 5LXTA 5IY5B 1NTZH 2BSKB 2UUBB 4DR6B 4DW1A 4J9ZB 2M6YA 1IBKB 5KX5B 4PDVA 2UXDO 2EIKB 2KB1A 2Z5UA 3UKMA 4EB6B 5GONB 4O2AA 2XTAA 3L70H 1SA0B 2YDEA 3HKEB 3VQWA 2ZCEA 4DV0B 3K5LA 3DC6A 1WLEA 1E1QG 4FJCC 3APQA 2QEXV 2Z3YA 1G1XB 1NKDA 1FFTB 2JGUA 3ZHQA 2HJFC 4HZ3A 3OT7A 2LGWA 3H1HH 4MW8A 1VQOV 3CWBH 5BR8B 1SQGA 3G6EV 4J42A 2Y4TA 4UVCA 2ARHA 1P84F 4KHPB 4I0XA 3BFRA 2ZQMA 2JRIA 3CSXA 4I9WA 3NXSA 3ABTA 5EBLC 1OCOB 3AG4C 3VQXA 4DV2B 4BAYA 3BABA 3RBZA 3SJQC 1BGYH 4TUYB 4GX5A 1NVPB 4H33A 2HJDA 1YJ9V 3AG1C 4UCSA 2P4VA 1VARA 1UFIA 4WFBV 4DW0A 1EN6A 1KU9A 4O2BA 4UCTA 1QLNA 4DO2A 3N2KA 4NTXA 3JASA 4TV8B 3AG2B 1F4MA 2QTSA 3E83A 4FLTA 2YC0A 3RVYA 5KUKA 2QM4A 4RUEA 4JI1O 2P4KA 2DQ0A 1QLEB 2LFRA 4PDLA 4GT1A 2ZD9A 4IL6Z 1OHHG 5IJ9B 2C2AA 3K5NA 1JFFB 4LF9O 5FPRA 2XAFA 2A0LA 4BIUA 1QR8A 2X7RB 2XAGA 4RAIA 1US6A 2EIMC 4LFBO 1K8AW 1FKAO 1F4NA 1AP5A 1F51A 5IJ0A 2Y4UA 4LF6O 1VMGA 2XASA 4UVBA 2HP8A 3G71V 1NU1H 2UXDB 5L3DA 1S77D 4PELA 2AGAA 5IT9N 4DR1O 4J9YB 1QVGU 2EILB 2LFSA 3RFRA 2V1DA 3K0DA 3DGEA 1S3JA 3Q4HA 1NJIW 2QTOA 3DSQA 2QSAA 1NZ6A 4R6ZA 1EZVH 1VF6A 1XBLA 2GUZA 4OGQB 3JD0A 1YIJV 2K9PA 5LYJA 3STLC 2L6LA 4JYCA 3SJCC 2UU9O 1QNMA 1NH2B 5DM6V 4X88A 3SYCA 3TJTA 5A9GA 5JVDB 3JAKA 3ZX6A 3A8TA 1WB8A 1MZFA 3EXAA 1M57B 4DV6O 1HW7A 3WG7B 3BCCH 1TVKB 1NTKH 3ABLB 3ZHVA 2LQTA 1YDXA 5B1AC 2ZIOA 4DR7O 3ZMUA 3UT5A 1EM1A 3E22A 2QGNA 4PDRA 2W0XA 4IHJB 2EBOA 3N2GA 5J2TB 3CJHB 3K58A 1WA8B 3CRAA 2FB5A 4WBNB 5F2VO 3JD2A 5EIBC 2WLJA 3HKCA 3ZBHA 1GN4A 3RWRD 3CC7V 2R9RB 2CK3G 5LHGA 3OMNB 1DLBA 3KG2A 4FPPA 2WLIA 4RO2A 3A2FA 5IYDO 5B1OA 4JI1B 4Q6GA 2Y69C 4JTDB 2OCHA 4OX9O 2NN4A 5AG2A 4H44B 2PYJA 1ZAUA 2IH3C 4U3FH 2XAHA 3G67A 4LF9B 4X66O 1HR0O 2KQXA 1YXBA 3FB6C 4LWSB 3ZRSA 2DWDC 5CN0A 1H2MA 4FLUA 3VQYA 4JI6O 3LNMB 4NTYA 3H01A 3ZIAG 3ZCCA 1K5SA 1WP7A 4LFBB 4CH6A 2YIBD 3K03A 5IDJA 5GTIZ 1K97A 3W7XA 1N0JA 1Y74A 4TWKA 3CMAV 4X1IB 3F5WC 2N04A 4LF6B 1Y76B 2MW2B 1Y6XA 1L0NH 5H6QA 5JQGB 1AI6A 5JCOC 1Y4MA 2DOSA 5L3CA 1E1RG 2OIEA 2ADQB 1GRJA 4DR1B 3M7MX 2JEUA 2JVDA 3SYOA 4XDKA 5KAFZ 1FXKB 5C8YB 1VQNV 5CA3A 1ZWIC 2Q7GA 1M5IA 4ICGA 3IC7A 3OUFA 1D5AA 3RYIA 4FLVA 3FAVB 3SPHA 3KZIZ 1EBOA 3J80N 2UU9B 2XUMA 1K3EA 3CX5F 1ZL8B 3D3QA 2IJKA 2VQFO 1M56C 2AHZA 3SYPA 3MDSA 3LSSA 4DV6B 1R1BA 4MTFA 4Z1MG 3CCRV 4I5SA 2JGDA 1PD3A 2LW7A 3SGIA 1TGOA 1M57C 3WG7C 3JALA 1IVSA 4DR7B 5LOVB 2BTQB 2QE7G 4LNUA 2KG7B 1PL0A 2CTRA 3EFFK 4O4JB 1HNWO 4ZHQB 1Q81W 1BMFG 3W7UA 4MS2A 2CUGA 4X1KB 4U3JB 4UUJC 3RYHB
chains in the Genus database with same CATH topology
3A0HZ 4PJ0Z 3KZIZ 5TISZ 1S5LZ 3JCUZ 5B66Z 5KAIZ 5GTHZ 3A0BZ 5E79Z 3WU2Z 5KAFZ 5GTIZ 2AXTZ 4UB8Z 4UB6Z 4IL6Z 5H2FZ 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H Z;  4PJ0 Z;  3KZI Z;  5TIS Z;  1S5L Z;  3JCU Z;  5B66 Z;  5KAI Z;  5GTH Z;  3A0B Z;  5E79 Z;  3WU2 Z;  5KAF Z;  5GTI Z;  2AXT Z;  4UB8 Z;  4UB6 Z;  4IL6 Z;  5H2F Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 3F7Y C;  3AG7 A;  3LDD A;  1H2G A;  4JI2 O;  1GM8 A;  1AR4 A;  5H6R A;  1YSC A;  5L3B A;  3P30 A;  1YTF B;  2CGN A;  1URF A;  3FB5 C;  2F43 G;  4TV9 B;  3SYQ A;  2E76 B;  3F5T A;  3CCE V;  4F6E A;  5KLV H;  1ZLZ A;  1VQ9 V;  1GMG A;  3CCV V;  2BE3 A;  1FYJ A;  4P9P A;  2YEV A;  4PD4 F;  4OX9 B;  4KL1 A;  5LXT B;  1YCI A;  5CBF A;  1H8E G;  1JQ0 A;  2IJJ A;  1N0N A;  4TSF G;  1P4R A;  4GX2 A;  5EIB D;  1VQM V;  1S72 V;  1BCC H;  3K9S A;  4O4I B;  4ZBM A;  1MNG A;  5J2U A;  5C93 A;  2QWR B;  1SS3 A;  1IDS A;  4X66 B;  3P3N A;  1HR0 B;  5ITZ A;  5KHK A;  1VQ4 V;  2EUL A;  1VQP V;  1YEW A;  4BR6 A;  4JI6 B;  1XL4 A;  3M99 B;  2L35 A;  1S5H C;  1V54 B;  1JJ2 U;  4NXN B;  1KUQ A;  1R73 A;  3VOU A;  3SJA C;  1FFX A;  2ZDI A;  4UFZ A;  3JD3 A;  4D7T A;  4UCO A;  2ZKO A;  4O4L B;  4UV9 A;  4BW9 A;  1IBL O;  4JZ2 A;  3LDE A;  3HPL C;  4DR3 O;  1SQX H;  3AEI A;  4I0X B;  1S5L Z;  3T1Y O;  3JAR B;  4GCZ A;  2F4V O;  4YJ3 A;  1XMQ O;  3E89 A;  1K92 A;  1SQV H;  4TQD A;  3OTO O;  5IYZ A;  5EC1 C;  2DYS C;  2F93 B;  4I4T B;  3H9V A;  3B8N A;  1N34 O;  3L71 H;  1B6Q A;  3CE2 A;  2QWN B;  3BA9 A;  2VQF B;  5B3S B;  3IJ4 A;  5D5Q A;  3L75 H;  4O2B B;  2WLL A;  4LC1 A;  2Q4P A;  4XDL A;  2IU3 A;  2DE0 X;  3A0R A;  1B3Q A;  3JAS B;  2WLM A;  4UV8 A;  3C3T A;  2CTQ A;  1RPR A;  4JYA O;  3ZHU A;  2JS3 A;  4IYH A;  2WSS G;  1V55 C;  2DW4 A;  1QR9 A;  3J7A U;  2D2C B;  1KKD A;  3ZHT A;  1M93 A;  2UXC O;  1HNW B;  1Q82 W;  4DV1 O;  5B1B C;  1KD1 W;  3EHB B;  3EVK A;  2GDS A;  1NH2 D;  3IFX A;  1PNL A;  1XUQ A;  1AIL A;  1ENV A;  4JI2 B;  3DXR A;  1M9N A;  4MTX A;  5B5E Z;  1SES A;  2EZO A;  4NTW A;  1AB3 A;  2WLK A;  1P7G A;  5L3F A;  4E4E A;  1KC8 W;  4DUY B;  1DTO A;  4FK5 C;  1OCZ B;  3M8A A;  2AXT Z;  4DV7 O;  4H0L B;  4UVA A;  3OGC C;  3H1J H;  3T1H O;  4MVS A;  4W4L A;  4QPK A;  5H9C A;  1EFR G;  4FM0 A;  1PNK A;  2IJH A;  5BZB A;  3C3S A;  3Q4H B;  3TGU H;  4RUF A;  4PDM A;  3P3P A;  2GUZ B;  4QE7 A;  3JCZ A;  5LYJ B;  5IYB O;  3ABK B;  2K1E A;  2PGG A;  1AVM A;  3A0B Z;  1IBL B;  1VF7 A;  3ASN C;  2QR4 A;  4DR3 B;  2NNU A;  2PY5 A;  5K1P A;  4O4H A;  4X65 O;  5L3G A;  4FZ0 A;  4FLY A;  3ETD A;  2DYR B;  4UB6 Z;  3E8H A;  3T1Y B;  1SF9 A;  1N32 O;  1O9H A;  1XMQ B;  4H13 B;  4JPR A;  3OTO B;  1FJG O;  2UUC O;  3UT5 B;  1GKF A;  4AQY O;  1NBM G;  1Q6I A;  1DF4 A;  4YY3 O;  4X1Y B;  1BZK A;  1D2D A;  1XNQ B;  1R6K A;  3HKC B;  4JAU A;  4JI0 O;  1XHX A;  4FLX A;  5LA6 A;  4NVP A;  2BCC H;  4ZI7 B;  2QM7 A;  4JYA B;  1BS3 A;  1SQB H;  1KQS U;  4IIJ A;  3T4D A;  2RN9 A;  2D3O W;  2CH7 A;  2IU0 A;  4MSW C;  2DMX A;  2IBZ H;  2UXC B;  1TA8 A;  4Z1V A;  3RVZ A;  4DV1 B;  1JMK C;  2Q69 A;  2YIB A;  1XMO O;  3KCY A;  4J10 A;  2H3O A;  2EIN C;  5DN6 G;  4I7Z B;  1AJP A;  1Q3E A;  2Q9L A;  3TK1 A;  1OV9 A;  4HNA A;  2Y48 A;  4QGP A;  2PF4 E;  2Z0A A;  4EFB A;  4DK0 A;  3MHH C;  2N05 A;  4HAM A;  3K9A A;  4I55 A;  1KBH A;  1NR1 A;  4GLX A;  4LP8 A;  3CHX A;  3D8C A;  1Y74 B;  3ETG A;  3UCS C;  5EZY A;  1F23 A;  3QO5 A;  4DV7 B;  5BMV B;  3OTF A;  1BHB A;  1OCZ C;  4TT3 G;  2FKX A;  5IY5 C;  1K5Q A;  1M4U A;  2ZIM A;  4H37 A;  3TXQ A;  3T1H B;  2YS8 A;  2YIA A;  4WFH A;  5IE9 A;  2ODM A;  4DYL A;  2EIK C;  3OMI B;  3FYI B;  4N21 A;  1K34 A;  2UUA O;  1Z2G A;  1R6T A;  3D36 C;  4JV5 O;  2HKO A;  1BE3 H;  2CTP A;  2B9Z A;  3RYI B;  5CA0 A;  3ZRW B;  3HKD A;  3I5D A;  3CPW U;  4RQE A;  1D5N A;  4K0K O;  1SA0 A;  2Q7H A;  3HKE A;  4MVM A;  1VF6 C;  4I50 A;  2DJV A;  3CXC U;  5HFL A;  3OR7 C;  1K33 A;  4P30 A;  4U7N A;  3K5M A;  2ZE6 A;  4R50 A;  5B1N A;  3UO2 A;  1SER A;  2QWQ B;  2XT9 A;  4P9O A;  2WLH A;  4LF8 O;  2GTA A;  3MD0 A;  4X65 B;  4U7O A;  3T1C A;  4B08 A;  4FLW A;  1WNS A;  2RNB A;  4YIO A;  1N32 B;  4CZZ A;  2X6A A;  1SZX A;  3JAL B;  1RPO A;  1XDC A;  5JJE B;  5CBH A;  4B3M O;  1FJG B;  2UUC B;  3E8B A;  3G6B A;  1VQ5 V;  2X6B A;  4AQY B;  4LNU B;  3QTC A;  1OCO C;  3F7V C;  5CA1 A;  1J95 A;  4YY3 B;  5IYC O;  3W7W A;  4I9Q A;  4B3R O;  4KP4 A;  5GTH Z;  3ZED A;  4CH5 A;  5KMG A;  3ZRV A;  1TUB A;  3ZRX A;  3OEE G;  1JX9 A;  2QKC A;  1HP8 A;  1IZ3 A;  1YVW A;  1Q86 W;  3E8F A;  4TUY A;  4NXM O;  2P6J A;  2YID A;  3I55 V;  3BAA A;  3RGB A;  3NR7 A;  2ZIN A;  1NQT A;  3AG2 C;  2LJ2 A;  2HVK C;  2YEV B;  2PI5 A;  1HWY A;  5IWA O;  3VBB A;  3WU2 Z;  4F6R A;  4PA7 A;  1QLE C;  1COW G;  1XMO B;  3N27 A;  4ASU G;  1JPX A;  3L72 H;  1OZ0 A;  5J2U B;  4LFC O;  4JAV A;  4X64 O;  2IW5 A;  5ITZ B;  3OD4 A;  2AHY A;  1A32 A;  1H2S B;  5LP6 B;  4PV1 B;  4DXW A;  1Q5O A;  1Q6H A;  1PNM A;  2Y0P A;  2VWJ A;  3QG5 A;  1JFF A;  1SET A;  1JA8 A;  2KKW A;  2AZ0 A;  4DV3 O;  1BL8 A;  3RN4 A;  4PA6 A;  4QJF B;  2HLD G;  1SKV A;  1WAZ A;  1FFX B;  1I7F A;  4DUZ O;  4FFK A;  4K35 A;  2V7Q G;  1NI8 A;  1U96 A;  4FM2 A;  2DWE C;  1SC5 B;  1PM9 A;  4P2Z A;  5E79 Z;  2GHY A;  3ETQ A;  3CCJ V;  4W4K A;  3S3X A;  2LW1 A;  3ICX A;  1H2L A;  3SPJ A;  5JCO A;  1DK1 A;  4YJ3 B;  1LUW A;  3H1I H;  1K7D A;  2EIL C;  4JV5 B;  2OTJ V;  4YIP A;  3LDC A;  5IYZ B;  4YJ2 A;  2ZM6 O;  4D6T H;  1ZTE A;  1L0L H;  1VQ8 V;  4K0K B;  2W6J G;  2P5O A;  3JAT A;  1EN5 A;  2RDC A;  1GM9 A;  4PI2 A;  4K3A A;  5JJJ B;  1GK9 A;  2R70 A;  5CBG A;  3D3I A;  1P7B A;  3S3W A;  4JAA A;  1MOF A;  1BSM A;  2YI9 A;  1WPB A;  2PZS A;  4LF8 B;  3LUT B;  3WB2 A;  3OFN G;  4NB5 A;  5KA5 A;  1Q43 A;  1FD9 A;  3BVO A;  4B3M B;  2YXL A;  3ABL C;  4ZIB A;  4PA4 A;  2Q68 A;  3GWK C;  1QVF U;  1AR5 A;  3RYC B;  4JGS A;  5FL7 G;  2H8P C;  2RQ6 A;  1R3K C;  5H2F Z;  4B3R B;  3LNN A;  3CB2 A;  1VQ7 V;  2IH1 C;  2VS0 A;  2LP7 A;  2VWK A;  1YJN V;  5FLX N;  1B04 A;  2UXN A;  4JI8 O;  3J81 N;  3U10 A;  4JTC B;  1VQK V;  1FAF A;  4LH6 A;  1G6U A;  4NXM B;  2A9H A;  1KB9 F;  5CB4 B;  1MSD A;  4LBE C;  2OCC B;  3CME V;  2Q8V A;  3JD1 A;  2NR5 A;  1W2B U;  4ZOL A;  1S0V A;  3ZN0 A;  5KHJ A;  1OCR B;  2HFE C;  4G2K A;  5IWA B;  2Q7E A;  3OMA B;  4J7J A;  3VQV A;  3CC4 V;  3IGA C;  4J7Z A;  1H8H G;  2M7W A;  1NVP D;  1VQ6 V;  2VRZ A;  1FXV A;  2LGQ A;  4J80 A;  4O2A B;  1OCC B;  5EBW C;  3SYA A;  4LFC B;  1I0H A;  5BXZ A;  4X64 B;  5HFM A;  2ZNI A;  5EBM C;  3OM3 B;  3OR6 C;  2YSU B;  3QVN A;  1M1K W;  4JZG A;  2XHB A;  4L8J A;  3W7S A;  1AJN A;  3E86 A;  3K5O A;  1FXH A;  3BY6 A;  2H94 A;  1IBK O;  5L3E A;  3BHP A;  3IAY A;  1RSO A;  1Q90 D;  2BOC C;  2N74 A;  3OE7 G;  2GTS A;  5LP6 C;  4DV3 B;  2YI8 A;  4J7K A;  4DUZ B;  1I08 A;  1Y67 A;  3K0G A;  3B77 A;  5LGU A;  4UXN A;  2V4D A;  2QA4 V;  2XAJ A;  5KHG A;  4O4H B;  1IUR A;  5LMU O;  2PYL A;  2BOB C;  2YXH A;  3ABU A;  1PP9 H;  1U97 A;  5JQG A;  4CBC A;  3ZMS A;  5FNV A;  3OGI B;  1Q8I A;  1AP6 A;  1I5X A;  4CH4 A;  1K9M W;  4JI5 O;  2ZM6 B;  1FXK C;  1XIL A;  3G80 A;  3FB7 C;  1AJQ A;  4B7E A;  5KA6 A;  4KFM A;  3CRC A;  1VEW A;  3CCM V;  4GYC B;  3FFQ A;  4X8A A;  3B40 A;  3CCQ V;  2A06 H;  4UCV A;  3N2K B;  3P32 A;  1THZ A;  4CC5 A;  2E74 B;  1GTO A;  3AG1 B;  4PHZ A;  4AIL C;  1N4C A;  2A7W A;  1FS0 G;  3FAV A;  2UXX A;  1EN4 A;  1NS1 A;  3H1L H;  1ZL8 A;  4IIJ B;  3CC2 V;  4B7K A;  5LGT A;  2LO1 A;  4DK1 A;  3U0Z A;  1KMI Z;  1F7Y A;  2B1G A;  2CH7 B;  2F66 C;  1MZE A;  1RFY A;  4ZKI A;  5JJN B;  2KSD A;  1JR9 A;  4B3T O;  1YZB A;  4WCE V;  4JI8 B;  2RJZ A;  4IGG A;  3UQ8 A;  1G8M A;  1IX9 A;  4JI7 O;  4HNA B;  2CAZ C;  4O4J A;  4ZHQ A;  5EYP A;  4WFG A;  2PUS A;  2AZ2 A;  3JSL A;  1MG1 A;  2UXB O;  3AG3 B;  3RW0 A;  1QU7 A;  5EZY B;  2OIG A;  5IJ0 B;  5JH7 A;  3I56 V;  4WFF A;  1OCR C;  1L1F A;  4TV9 A;  1HDJ A;  3QO7 A;  4LFA O;  4LR3 A;  3TXS A;  4CS3 A;  4R8C A;  1S5J A;  1ROP A;  4GKK O;  4MTG A;  1IXM A;  3JAW A;  1J5E O;  1T5E A;  1OCC C;  4CH3 A;  2JJ2 G;  2A3Q A;  1RM1 B;  2Q67 A;  3DC5 A;  4GX0 A;  1ORQ C;  3LSQ A;  4KXR A;  4O4I A;  3E2E A;  5CA0 B;  4DRX A;  3HKD B;  4JI4 O;  5LBQ A;  2FL4 A;  5BY1 A;  4JYB A;  1TUE B;  4I50 B;  1V54 C;  4LF4 O;  1YIT V;  1YJW V;  3C90 A;  4C7U A;  3JAK B;  3FB8 C;  4J41 A;  4CS4 A;  1QQC A;  2W0F C;  5K1X A;  4PI0 A;  2F23 A;  2Q0A A;  3RYF A;  2E5L O;  3AK3 A;  3G4S V;  2Y0I A;  5LMU B;  2P7T C;  4BWA A;  2F4V B;  3CS5 A;  4MT8 A;  4O4L A;  4FLZ A;  4WFE A;  4JI5 B;  1VQL V;  2ATK C;  3E22 B;  4DV4 O;  3ZMV A;  1CPY A;  3ABM B;  3WFV A;  1XOU A;  3WB1 A;  4DR5 O;  2P67 A;  4X9Q A;  5B1A B;  3N2G B;  5CA1 B;  4LF5 O;  3U11 A;  1R3I C;  2JEX A;  3AK2 A;  4L87 A;  4DR2 O;  1N34 B;  3JAR A;  1Z5W A;  1N33 O;  5KMG B;  3CEI A;  3FX7 A;  1CEZ A;  1TUB B;  2MK3 A;  4I4T A;  3A0H Z;  4HYO A;  5LMN O;  3JD4 A;  1Y66 A;  2HHH O;  4G28 B;  2CDY A;  3ASO B;  4OPH A;  5B3S C;  2QKA A;  2DQ3 A;  5H5N A;  2WLI B;  4FFB A;  4WFA V;  4X20 A;  2X6C A;  3ZHS A;  2OWO A;  1K73 W;  3FKS G;  5EC2 C;  4MVZ A;  3ZN1 A;  1B06 A;  3AK1 A;  1UJW B;  4PA3 A;  1W0K G;  5JWP A;  4F6R B;  3ML0 A;  3B2E E;  2ZR2 A;  3W7T A;  4FVM A;  4GUN A;  2Y69 B;  1QCE A;  4B3T B;  1RP3 B;  1CP9 A;  3HKB A;  2OTL V;  1LUV A;  1WPX A;  4JI7 B;  2WLN A;  1MSW D;  2YXY A;  4LCU C;  1GH6 A;  3MHS C;  1Q6U A;  3ZJZ A;  1YI2 V;  2ZR3 A;  4JF3 A;  3PN1 A;  4FMT A;  2UXB B;  3JCU Z;  1WN7 A;  2QKS A;  4BW5 A;  3ZMT A;  3CCS V;  4LF7 O;  2GSM B;  3DTU B;  3AG3 C;  3QNE A;  1JOY A;  1KYO F;  1L8D A;  1QBZ A;  4NKG B;  4LFA B;  5DEC A;  2HVJ C;  1I5Y A;  1PKX A;  1FPO A;  1LR1 A;  4GKK B;  4MVR A;  4UCR A;  2ILM A;  3CP1 A;  1J5E B;  4X89 A;  4AHC A;  3K08 A;  2BSK A;  4MVU A;  4GKJ O;  5E1A C;  4HBN A;  5LHI A;  2ZT9 B;  5KX5 A;  1VF5 B;  1YTF D;  1JCH A;  3OW2 U;  3SPI A;  3K59 A;  1G4Y B;  2G38 A;  4YJ2 B;  5GON A;  4EB6 A;  1RM1 C;  2IM9 A;  4JI4 B;  1WP8 A;  4DR4 O;  4FZ1 A;  3D36 A;  3JAT B;  1XHZ A;  2IJI A;  4LF4 B;  3CCU V;  5KHH A;  2W6I G;  4BIO A;  3ABK C;  5GW7 A;  3FYE B;  1JVM A;  2WWW A;  1AI4 A;  2E5L B;  4JYY A;  3L9D A;  2XAQ A;  2JGD B;  4G27 B;  2WA3 A;  2NLJ C;  1M56 B;  1NR7 A;  2X0L A;  4NR1 A;  4YHH O;  4RWU A;  1PPJ H;  3CRR A;  2DYR C;  1N8R W;  1K4C C;  2QM8 A;  2PI4 A;  4QIW F;  5KUM A;  4MVQ A;  2FML A;  3CXH F;  4DV4 B;  1NTM H;  4DR5 B;  3R66 A;  2EIJ B;  2WAM A;  4LF5 B;  1DF5 A;  4DR2 B;  1VIB A;  5A2Q N;  3ABM C;  4IT5 A;  2VQE O;  1N33 B;  1XI1 A;  2JK5 C;  2Q5Z A;  1Z5V A;  4D7S A;  4JI0 B;  4TQF A;  1HNX O;  5DED A;  4BIZ A;  2OT5 A;  5LMN B;  2HHH B;  1SRY A;  1N36 O;  4X1Y A;  1JJO A;  5FPO A;  1GN2 A;  1YHQ V;  2YUA A;  3ASO C;  2GV9 A;  1IBM O;  4ZOL B;  1R3L C;  3O65 A;  3SPC A;  3HR0 A;  3UM7 A;  3SJB C;  1R3J C;  1TAE A;  1KP3 A;  4TV8 A;  3L73 H;  4JAS A;  4UB8 Z;  4ZI7 A;  1MA1 A;  3RT3 C;  3E8G A;  2EX3 A;  2HR3 A;  2ITD C;  3B8M A;  4TOI A;  3B09 A;  4PJ0 Z;  3JAM N;  3KCX A;  2ZE7 A;  2OYQ A;  3CRM A;  1E79 G;  1KP2 A;  5IJ9 A;  2QWP B;  1RSO B;  1XQ8 A;  3X2Q B;  1R6N A;  1BQ0 A;  1S76 D;  1X59 A;  2B5U A;  4N23 A;  1XNR O;  4LF7 B;  2P22 C;  3JSN A;  3H1K H;  4DV5 O;  2Q0O C;  4IYI A;  1GAX A;  4CS2 A;  4QPJ A;  1W0J G;  4QE9 A;  3CYO A;  1P49 A;  4NXN O;  2ZE5 A;  1XEQ A;  3QF7 A;  5LHH A;  1ZX3 A;  5BMV A;  2UUA B;  4GKJ B;  4OPA A;  3ZS8 C;  5FNV B;  1DGS A;  2ETN A;  1MMM A;  3ETE A;  4XBF A;  1H38 A;  2QDO A;  5B66 Z;  2E75 B;  1X4T A;  2P90 A;  2JJ1 G;  1ARO P;  4DR4 B;  4K8X A;  5EK0 A;  2DYS B;  1SQP H;  4EEQ A;  2Q6A A;  2F1M A;  3IC9 A;  1H2K A;  5J9P C;  1I94 O;  2WLL B;  2E3C A;  2HG5 C;  2XOK G;  3ZRW A;  3L74 H;  4ABM A;  5D5P A;  3BRC A;  5KHI A;  5TIS Z;  3K06 A;  5JVD A;  1YF2 A;  4YHH B;  2PTM A;  4PA9 A;  1HNZ O;  4UCU A;  4KUM A;  3PJS K;  1IXB A;  1BT8 A;  1TVK A;  1PV0 A;  1OJH A;  1V55 B;  2AW9 A;  3BEH A;  1V9P A;  3WB0 A;  2O57 A;  2JIZ G;  2VQE B;  2EIJ C;  2F95 B;  1W59 A;  1PL4 A;  3K57 A;  1HNX B;  1UPG A;  5B1B B;  4IHJ A;  3DXR B;  4B3S O;  1N36 B;  5J2T A;  3CJH A;  4MW3 A;  1WB7 A;  5EYP B;  1WA8 A;  4EKW A;  1WJZ A;  4WBN A;  1AI5 A;  1LNQ A;  2ZXW B;  4MTO A;  3T2M A;  2Q73 A;  2CE4 A;  3K04 A;  1GO3 F;  1IBM B;  3GVM A;  2R9A A;  1Q7Y W;  3T4Z A;  3E35 A;  4FIP C;  3JYC A;  2DN9 A;  5JH7 B;  4X62 O;  2EZP A;  2QWO B;  4FM1 A;  4JI3 O;  2ZNJ A;  3ZMZ A;  4DUY O;  1EZJ A;  3APO A;  4JTA B;  3JAW B;  3R65 A;  1AR1 B;  1AI7 A;  4CC6 A;  4QNH B;  2UUB O;  4DR6 O;  2ITC C;  2JDI G;  4RQF A;  4DRX B;  1MAB G;  4LWS A;  4DV0 O;  2B1I A;  3UO3 A;  1XNR B;  2FYU H;  3X2Q C;  3OEH G;  4Q20 A;  4XDJ A;  5LP6 A;  4LH7 A;  4DV5 B;  2CGO A;  2EJ7 A;  2BTO A;  1O9G A;  2ZDI C;  3THO A;  3RYF B;  4GX1 A;  1VP7 A;  3SPG A;  3GWO A;  2RMK B;  4X1I A;  3GB7 C;  2WA4 A;  3QO8 A;  3MAQ A;  1Y76 A;  2R72 A;  3ASN B;  3K3W A;  3KKY A;  5BR8 O;  3SDL A;  3CRQ A;  3BA8 A;  4Z2W A;  4R7C A;  1XRE A;  2ZE8 A;  3FD9 A;  2ADP A;  4KHP O;  3AG4 B;  2CTW A;  4AI8 A;  1SZT A;  1FXK A;  5C8Y A;  4K8Z A;  2RCV A;  1BHA A;  1I94 B;  4DV2 O;  1XL6 A;  1H2N A;  5LA6 B;  1M90 W;  4NYK A;  3CD6 V;  3ZHR A;  3O9O A;  2EJR A;  4MVO A;  4YXW G;  2YIC A;  4FFB B;  4X20 B;  2QJ1 A;  1KEC A;  1HNZ B;  4F4L A;  2JS5 A;  1XNQ O;  5LL6 Y;  3TET A;  3OAA G;  3HB3 B;  2XND G;  4A5U B;  3HKB B;  4WF9 V;  4E2L A;  5LOV A;  2HEP A;  2BTQ A;  2P06 A;  3SR2 C;  2KG7 A;  4EFE A;  1SQF A;  2GBO A;  4B3S B;  5LGN A;  3TCU A;  2EIN B;  4OXS A;  3RYC A;  1KKC A;  1CXZ B;  4X1K A;  4U3J A;  4I55 B;  3LSU A;  3RYH A;  1QHT A;  1ZSP A;  1NT2 B;  2OCC C;  2ZXW C;  2FTK A;  1BQZ A;  1GN6 A;  3OUS A;  1GM7 A;  2EIM B;  4X62 B;  2A79 B;  3K79 A;  5CB4 A;  1K4D C;  3STZ C;  3B4S A;  4GZR B;  4J11 A;  1GN3 A;  2R9I A;  4JI3 B;  2WPD G;  5CMU A;  5KAI Z;  3BPZ A;  1ZUQ A;  1SQQ H;  3CCL V;  5LXT A;  5IY5 B;  1NTZ H;  2BSK B;  2UUB B;  4DR6 B;  4DW1 A;  4J9Z B;  2M6Y A;  1IBK B;  5KX5 B;  4PDV A;  2UXD O;  2EIK B;  2KB1 A;  2Z5U A;  3UKM A;  4EB6 B;  5GON B;  4O2A A;  2XTA A;  3L70 H;  1SA0 B;  2YDE A;  3HKE B;  3VQW A;  2ZCE A;  4DV0 B;  3K5L A;  3DC6 A;  1WLE A;  1E1Q G;  4FJC C;  3APQ A;  2QEX V;  2Z3Y A;  1G1X B;  1NKD A;  1FFT B;  2JGU A;  3ZHQ A;  2HJF C;  4HZ3 A;  3OT7 A;  2LGW A;  3H1H H;  4MW8 A;  1VQO V;  3CWB H;  5BR8 B;  1SQG A;  3G6E V;  4J42 A;  2Y4T A;  4UVC A;  2ARH A;  1P84 F;  4KHP B;  4I0X A;  3BFR A;  2ZQM A;  2JRI A;  3CSX A;  4I9W A;  3NXS A;  3ABT A;  5EBL C;  1OCO B;  3AG4 C;  3VQX A;  4DV2 B;  4BAY A;  3BAB A;  3RBZ A;  3SJQ C;  1BGY H;  4TUY B;  4GX5 A;  1NVP B;  4H33 A;  2HJD A;  1YJ9 V;  3AG1 C;  4UCS A;  2P4V A;  1VAR A;  1UFI A;  4WFB V;  4DW0 A;  1EN6 A;  1KU9 A;  4O2B A;  4UCT A;  1QLN A;  4DO2 A;  3N2K A;  4NTX A;  3JAS A;  4TV8 B;  3AG2 B;  1F4M A;  2QTS A;  3E83 A;  4FLT A;  2YC0 A;  3RVY A;  5KUK A;  2QM4 A;  4RUE A;  4JI1 O;  2P4K A;  2DQ0 A;  1QLE B;  2LFR A;  4PDL A;  4GT1 A;  2ZD9 A;  4IL6 Z;  1OHH G;  5IJ9 B;  2C2A A;  3K5N A;  1JFF B;  4LF9 O;  5FPR A;  2XAF A;  2A0L A;  4BIU A;  1QR8 A;  2X7R B;  2XAG A;  4RAI A;  1US6 A;  2EIM C;  4LFB O;  1K8A W;  1FKA O;  1F4N A;  1AP5 A;  1F51 A;  5IJ0 A;  2Y4U A;  4LF6 O;  1VMG A;  2XAS A;  4UVB A;  2HP8 A;  3G71 V;  1NU1 H;  2UXD B;  5L3D A;  1S77 D;  4PEL A;  2AGA A;  5IT9 N;  4DR1 O;  4J9Y B;  1QVG U;  2EIL B;  2LFS A;  3RFR A;  2V1D A;  3K0D A;  3DGE A;  1S3J A;  3Q4H A;  1NJI W;  2QTO A;  3DSQ A;  2QSA A;  1NZ6 A;  4R6Z A;  1EZV H;  1VF6 A;  1XBL A;  2GUZ A;  4OGQ B;  3JD0 A;  1YIJ V;  2K9P A;  5LYJ A;  3STL C;  2L6L A;  4JYC A;  3SJC C;  2UU9 O;  1QNM A;  1NH2 B;  5DM6 V;  4X88 A;  3SYC A;  3TJT A;  5A9G A;  5JVD B;  3JAK A;  3ZX6 A;  3A8T A;  1WB8 A;  1MZF A;  3EXA A;  1M57 B;  4DV6 O;  1HW7 A;  3WG7 B;  3BCC H;  1TVK B;  1NTK H;  3ABL B;  3ZHV A;  2LQT A;  1YDX A;  5B1A C;  2ZIO A;  4DR7 O;  3ZMU A;  3UT5 A;  1EM1 A;  3E22 A;  2QGN A;  4PDR A;  2W0X A;  4IHJ B;  2EBO A;  3N2G A;  5J2T B;  3CJH B;  3K58 A;  1WA8 B;  3CRA A;  2FB5 A;  4WBN B;  5F2V O;  3JD2 A;  5EIB C;  2WLJ A;  3HKC A;  3ZBH A;  1GN4 A;  3RWR D;  3CC7 V;  2R9R B;  2CK3 G;  5LHG A;  3OMN B;  1DLB A;  3KG2 A;  4FPP A;  2WLI A;  4RO2 A;  3A2F A;  5IYD O;  5B1O A;  4JI1 B;  4Q6G A;  2Y69 C;  4JTD B;  2OCH A;  4OX9 O;  2NN4 A;  5AG2 A;  4H44 B;  2PYJ A;  1ZAU A;  2IH3 C;  4U3F H;  2XAH A;  3G67 A;  4LF9 B;  4X66 O;  1HR0 O;  2KQX A;  1YXB A;  3FB6 C;  4LWS B;  3ZRS A;  2DWD C;  5CN0 A;  1H2M A;  4FLU A;  3VQY A;  4JI6 O;  3LNM B;  4NTY A;  3H01 A;  3ZIA G;  3ZCC A;  1K5S A;  1WP7 A;  4LFB B;  4CH6 A;  2YIB D;  3K03 A;  5IDJ A;  5GTI Z;  1K97 A;  3W7X A;  1N0J A;  1Y74 A;  4TWK A;  3CMA V;  4X1I B;  3F5W C;  2N04 A;  4LF6 B;  1Y76 B;  2MW2 B;  1Y6X A;  1L0N H;  5H6Q A;  5JQG B;  1AI6 A;  5JCO C;  1Y4M A;  2DOS A;  5L3C A;  1E1R G;  2OIE A;  2ADQ B;  1GRJ A;  4DR1 B;  3M7M X;  2JEU A;  2JVD A;  3SYO A;  4XDK A;  5KAF Z;  1FXK B;  5C8Y B;  1VQN V;  5CA3 A;  1ZWI C;  2Q7G A;  1M5I A;  4ICG A;  3IC7 A;  3OUF A;  1D5A A;  3RYI A;  4FLV A;  3FAV B;  3SPH A;  3KZI Z;  1EBO A;  3J80 N;  2UU9 B;  2XUM A;  1K3E A;  3CX5 F;  1ZL8 B;  3D3Q A;  2IJK A;  2VQF O;  1M56 C;  2AHZ A;  3SYP A;  3MDS A;  3LSS A;  4DV6 B;  1R1B A;  4MTF A;  4Z1M G;  3CCR V;  4I5S A;  2JGD A;  1PD3 A;  2LW7 A;  3SGI A;  1TGO A;  1M57 C;  3WG7 C;  3JAL A;  1IVS A;  4DR7 B;  5LOV B;  2BTQ B;  2QE7 G;  4LNU A;  2KG7 B;  1PL0 A;  2CTR A;  3EFF K;  4O4J B;  1HNW O;  4ZHQ B;  1Q81 W;  1BMF G;  3W7U A;  4MS2 A;  2CUG A;  4X1K B;  4U3J B;  4UUJ C;  3RYH B; 
#chains in the Genus database with same CATH homology
 3A0H Z;  4PJ0 Z;  3KZI Z;  5TIS Z;  1S5L Z;  3JCU Z;  5B66 Z;  5KAI Z;  5GTH Z;  3A0B Z;  5E79 Z;  3WU2 Z;  5KAF Z;  5GTI Z;  2AXT Z;  4UB8 Z;  4UB6 Z;  4IL6 Z;  5H2F Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...