5E7BA

Structure of a nanobody (vhh) from camel against phage tuc2009 rbp (bppl, orf53)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
QVQLVESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYHQAPGNECELVSAIFSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAATTTVASPPVRHVCNGYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nanobody nano-L06
publication title The Atomic Structure of the Phage Tuc2009 Baseplate Tripod Suggests that Host Recognition Involves Two Different Carbohydrate Binding Modules.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 33
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e7bA00
4JDZA 3KPSD 1X4YA 4HJJH 1S8DA 1RZ8A 5C0EB 1Q8MA 3JTSB 4DVRL 4LSVH 1JPST 3D3VB 4OCNC 3ECBA 3C8KA 3FQXA 3EAKA 3MCG1 4IMKA 4YFLI 5FYJU 3RI5F 3SGJA 2Z0BA 4LAJH 5IFJB 3IF1A 1UM4L 5FK9B 2NX5D 1ZA6A 4XBPA 4RWHA 2CUMA 3H9SD 4Y5XB 5BRZA 3U79A 5C0NC 4QOKA 3V5HA 2WP3T 3BQUB 3DV6A 1SYVA 5KVDL 1HWHB 1GC1C 2HFFB 4YHKL 2V2XA 2LTQB 1IL1B 5D1XB 3HNVH 4OV5A 3ARYA 3O6FB 5GGSA 4NSKB 3BIBX 2R1XA 1T0MA 4XNQA 1NCUA 4ZMAT 4IIQC 1PSKL 2YC1B 3CMGA 4QY8B 5DJZB 3R1GH 4OD3H 2KBGA 3L9RB 5HI4D 2PYEB 3LKRA 3MACH 3QNZB 5D72H 4MA3B 5HHXH 4N0FA 5BOZG 2ZUSA 1FZMB 3UTSA 1K4CA 5EOQL 2Z92B 2V7NB 1CXEA 5I76A 1ZS8B 4F7CA 3BZDA 2BSSA 3GK8H 3RL1A 4NKIH 4P5TD 4LLWB 1J0YA 4E42A 4ZYKB 3BT2H 4I3RL 5IV2A 1AO7B 1HHJA 4WCYH 4CU8A 4OGZA 3IJHA 5MERB 2ED9A 4PGCB 2NMSA 4GKZB 1XGYL 1RZIB 3D2UA 3OX8B 4NNPH 1FL3A 2BMKB 3QDMA 5CGYC 4Y4KC 3F7VB 4IS6B 2HFGH 5HGDA 1CGTA 2VLKA 4J6RL 1U8IA 4YPGB 1TTFA 2R69L 3LQZB 4R4FH 3ILQC 2OCFD 3GMRB 4DN4L 1QKZH 1YEJL 2PYFB 2HN7B 5IROA 1EHXA 2OL3B 4G3YH 4JM2D 4XP6L 2WWKO 4KH2A 1NQBA 1LE5A 2OK0L 1BEYL 1OF2A 1YEIL 4XP1H 5ESVB 3CFBB 3WD5H 4U6YB 5HHNB 2GITA 2AEWA 4FQIL 2X42A 4M6NL 1MREL 1N4XH 5FYJH 1UYWH 5JW5A 4Z76A 5IHUL 2FO1A 4JRYE 3U0TB 4F7PB 2ADJA 1J10A 1VCAA 2K3TA 1NCWH 1A3LH 3CK0L 4PJIE 1P4IH 4PJCE 1YEHL 3MXWH 1YQVL 4Y89A 4I48A 5AAMA 3IXAB 3MRJB 3UYRL 4L4VB 3V4VH 4PUBH 5IVNA 5BQ7B 4F3FA 2Q6WA 3DECA 3ZKND 2GJ6E 4I77H 2FJGB 2HJKA 4G8EB 2FX8H 4YDLC 4OKVA 1OB1A 3RY4A 1JF6A 1A7QL 1ZANL 5F7LB 9CGTA 5FA4A 3H42L 3KPOB 4ZODA 1A0QH 1BZ9B 4OFIA 1N5AA 1HKLL 2PXYB 1KCSH 2VL5B 5KS9B 1DLFH 5I1HL 3OV6A 4KKLD 5E6IC 1X6LA 3OHXB 3V6FB 4PJGF 4CVUA 5D1QC 2CDGA 2G75A 5L88L 2DICA 3MNWA 4LHUG 5CJ5A 3T04D 3TA3D 4ACPA 2BY3A 3P4LA 4S1QH 5J12B 3GRWA 1EERB 5CWSB 4JEGB 1C1EL 3U6RB 3PWJB 4F58L 1CE1L 1OGAA 2NPLX 1E4XL 3QUZC 5DEFB 3BPLB 3D25A 5E2UL 5M95B 2Y36L 3HCVB 2XY2A 2LU7A 4OLYL 1BD2B 4PJ7B 4IOFC 4GRWF 4NWTL 4OUOA 2VH5H 2JIXB 4XXDB 4OCYH 1ULVA 3ARTA 3OJDA 5I1GH 5FXCH 1N3NA 4NO5B 4UU9A 3O11A 3C5ZB 4OF8A 2DQDH 2PO6A 3EO1B 4Y5VC 5CHNA 4P2RE 1AC6A 4X0KB 5DJ2B 1FG2B 5IVXE 3LPWA 3C8HA 3AREA 1F13A 2XTJC 3DMMC 1LK3L 4LPTA 2Q7YA 4U6VH 2DDQH 3GSVA 1XF2B 2XTLA 3GKZA 4Y2DC 1AJ7H 2UVEA 1CZ8H 1GHFH 1RQ5A 4OJFL 3PGDB 5JMRA 1JTOA 2FD6H 1FRGH 3PWNA 4HC1A 2PTTB 4XBGB 4PRBA 3W9EA 4MNGE 2RIKA 1QRNE 5BVPH 4K94H 2YUZA 3RVWD 3UTZA 4RGNB 4FQLH 3VCLB 1KBGL 4NC1E 2YZ8A 1FE8L 2IAMC 3SGKA 1FLTX 5CILL 1H15B 5DD1L 5C0CD 4XGZB 3QBTB 1B88A 2EH7L 4R26L 1NUFA 3D0VB 1MQ8A 1GL4B 5BO1H 1X5YA 4PJXA 4ISVA 2ADIB 3EYQD 1ZGLB 1IEBA 1RJLB 4FQCL 3FB5B 2ZG1A 2G60L 4FQXC 4MQ7B 2FJHB 5FHBH 4KK6D 5KVFL 2GSIB 1MHPH 4GG8A 2VMFA 5E2VH 1W72B 2VABA 3GI8L 4QRSA 4J3XA 4BM7A 4LF3A 3JSSA 4NO3B 1LO2L 1YPZF 3CDYA 2F58H 4UILL 4UOW1 5TDPA 3T0EC 4PJAF 2GI7A 1SEBA 1K8IA 5FO8B 4YEFA 4WI7A 3VXTB 3SDAA 2VC2H 3VXOA 4JFDE 2IBBA 2XZAL 3MA7B 2CGRL 1IGMH 2M8XA 3FCTB 3UC0L 3LH2L 1B0GB 4TSCH 3OAYK 5CP7A 2EEBA 4P49A 5C7XH 3O8XA 1GZPB 1BWMA 1LD9A 2P5EE 2HYMA 1VGKA 3FRPG 1QLEH 3S96A 3QUML 3S5LB 4WU7A 4OGXL 2H8PB 4G8FA 4XAWH 4LLMA 2PR4L 4YGVA 2J8HA 5KVEL 3RY6C 1YC8A 5J6HA 4WHCA 5DLMH 1FYTA 1DN0A 4M48H 2A6IA 4MMZC 4KDWA 1LDPL 3SKNA 1BOYA 1NL0H 3T77A 3SDXA 3VRLE 4M7KH 4LOUD 2X1QA 5CINL 4Z7UE 4F7MB 4JY5H 2ARWA 3P73A 2FB4L 2AI0H 4O58L 3BW9A 2BNRE 4LEOB 1INQB 3IDMB 5CJBA 1E6OH 1MJ7L 3V5DB 1BREA 5J1SC 5MEQB 3OG4B 3TA3B 3IDJA 3VFVA 2Y23A 3CSPA 4RIRA 4POYA 4ZQKA 4MQXC 5MP6L 2PF6A 1FGNH 5HDBE 3HG1A 4HBCL 1IGFH 2LABA 1J8HE 5L8JB 3RIAK 2YD8A 5BZWA 5ERWA 4EUPH 1A4KA 3OMZA 2N7BA 1NGWB 3BUYA 5DJ6A 5C0FA 4NQVB 1NMCC 1ZGLM 1KTKE 3QFJA 3KPQA 4HJJL 3DO7A 4GW5A 1YDPA 4LSVL 2CMRL 1KJ2A 3N1GC 1JPTH 5C6PB 4PFEA 4J2XA 3RVUD 3TCLB 3BZFA 3QFDA 1RUAL 3QNYA 2KQNA 1HKFA 4DCQB 4Y19A 3QIUD 3L7FA 1XGPA 2Z8RA 3MV8A 5E00A 2FRGP 2BVOB 5GZND 3O6LH 2G2RB 3U83A 3CPLA 3HNVL 4RRPA 4Q9QH 3QO1B 5IBLD 4YNYA 5LGHH 1R3HA 1N2RA 4X7EC 2R0LL 1BIHA 3SGJC 1K6QH 1ZLWH 5JR1L 4OD3L 3ZT5A 2LAGB 3BMWA 4R4BB 4NKDA 4C83B 1A6TB 2HKHH 3FO2A 3MACL 5DMGD 3KDMB 3GMOB 4I0PC 5I75C 5IEKA 1JNLH 4PJDF 5D72L 2MQ0A 1FNSH 3TP4A 5HHXL 2VDRH 5FYKE 5C0CB 4LNVA 3OGCB 4A6YH 2FGZA 2A6DA 4XHQA 3CDGB 4N8CH 3KPTA 4LPXA 4NKIL 4OZGA 1F11B 4XCFH 3RDTA 3VXRE 5CGMA 5H37G 4PD4J 3B9KB 4WUUA 1MCPH 1XF4A 4WVRA 3PNWA 1V3LA 3BT2L 4NQCB 4N90E 4WCYL 2ITCB 3KXFA 5IKCB 1QR4A 4OKDA 4WFFE 4AENA 4Q2ZA 4PRHD 4N9OB 1BLNA 3I3DA 5H94B 5A2JH 3MGTB 4ELMF 4NKOA 1CFNB 2JCCF 4QRPB 2X6MA 5FUOH 1MUJB 4O2FB 5F8RC 3ULSB 3RTQD 3I50H 2DL9A 2KKQA 1CLYH 4KKCD 2DJ4A 3QZWG 3P4MA 4JFFE 4JRXA 1XR8A 5E9DA 4JKMA 5C0AA 3DIFB 3VFGL 2BSED 5SX4I 5BV7B 1IGYB 4G3YL 2GK2A 4R8WL 4G7VH 3ARBB 4U1HA 3VWJD 3ULUF 2CQVA 2X4RB 3STLB 2BVUA 4XP1L 3F58L 3HAEA 1MCOH 5ENWB 4L8SC 4U6XA 4TTDC 4X8JB 2CKBH 3DX9A 1U58B 1CDHA 1VGEL 1N4XL 2R0ZH 3VFOB 4YLQT 3VXQB 5HYJD 1CD1B 1CXIA 4ZOAA 4MXVE 4GG6F 4LDOB 4Q9CA 4ENED 3SCMA 1NFIB 4FXKA 5IROC 4KRPD 3VRIA 1NCWL 1A3LL 1JZ4A 3RP1A 3C09C 3IDIA 1P4IL 3BGMA 1XIWA 2DS4A 3KPPB 1F90H 1VKXB 5JOEA 3SDCA 3P2TA 4LPCA 5ICYA 2BNUB 4PUBL 4UZGA 5C0BD 1SBSH 1FVDA 4LFHG 2DLGA 4I77L 2WIIA 1MAMH 1E4KC 2FX8L 1RIUH 3MV11 2VNCA 1KPUA 3QEQA 1BVLB 1TVBA 5D5MF 4CMHC 1YMMD 4QHLA 3D85D 1A0QL 4Z78A 2XQBH 5D7LE 3S6CA 1KCSL 3EGSA 1DLFL 5EU4A 4OD1H 1RURH 1U91A 2R8SH 1NGXB 4DGYH 2DN7A 3RJDA 1I8KA 3IDGB 3P4OA 3MV9B 2APFA 4PJBE 2HLAA 2YUWA 2AKRB 5DK2A 4PJFE 5D7IE 4W81A 3DROA 1FH5H 3QO0A 4JJ5B 3C60D 1FJ1B 3MRIA 5F97E 1G0YR 3LKPB 1VEMA 2X4PA 1W0WA 4U49A 1FFNB 1RULL 4NJ9H 1EAPB 3OR6A 1S7VA 1GZQA 4H8WH 2YZ1A 3B5TA 2DMBA 1ZT7A 4X4XA 1KLGA 4DZBB 2C4FU 2JB6A 3GHEH 2RBLA 3FKUS 4JM4H 4Q58C 4CDHA 2YUXA 2DQDL 5ELIA 4MCYB 2G9HA 2B8OT 1H3WM 3PABB 2HVKB 4LKXB 5DVMA 5JZ7D 4HC1L 3PWPD 4YBLC 5GISH 5JNYA 3EJZD 5E2WH 2HJFB 3IETA 4G5ZH 4QRTA 4HBQA 4U6VL 2DDQL 5FKAA 2H26A 2DBJA 3B5GA 1PKOA 4OFVA 3HZYA 1CZ8L 3IRPX 1GHFL 3NACL 5HVHB 5MHSD 5AD0B 3HNTH 2FD6L 1FRGL 4WI9A 2WUCL 2PO6C 2R0WH 5BVPL 1OLLA 4K94L 4XP4H 1K5NA 5B39B 4FQLL 4V1DA 4YO0A 4HHAA 4BFGA 1BMGA 4JGJA 4PRHB 5EO1B 1Y0LA 2FECI 3OKOB 1QBMH 3GSNH 5T5FL 1I9RL 1NJ9A 4NO2B 5IB5B 3MSPA 4IRJA 4B7IA 2B4CC 3BH9B 3GJFA 3FT4A 3BP5B 4K9EH 4X4YA 1QZ1A 5FHBL 3C9NB 3CCHA 3TBSA 1MHPL 5E2VL 3ESUF 1J11A 3MRGA 5C0DA 2XKNB 5E6YA 1FNFA 4LLVB 1F4WH 2K7PA 2F58L 3O2WL 5GGQL 1JZ2A 1ZV5A 3X13B 4LLQA 5CD5D 2FL5B 4WI3A 1K2DB 4M7ZC 4PJ8A 3RHWF 3UTTA 1CFQA 3MJ7B 4P4KA 3WV0A 5I71C 1IGML 3JWDH 43CAB 4TSCL 4WFGD 2LAAA 5EN2B 4E41D 2MQ3A 1IAOB 4K94C 2AEQL 3NZ8A 5C7XL 5DSCA 5E7BA 1QLEL 4FFVD 5EU7E 5DYOB 1RVFH 4JG1H 4KRPB 5JORB 3MUY1 4KI5D 1R3IL 4KJWD 2GK0B 3DX8A 4XAWL 4K3HA 2F53D 1DFBH 2IH3B 1SM3L 3B5HA 2QSTA 3VFPB 2DM4A 1KIPB 1Y6KR 4LDEB 5DLML 3G5ZA 4L5FH 2CDFB 3TBTB 3W82A 3E2HC 1NL0L 5IK3A 2C3GA 3A6OA 4Z5RB 4M7KL 1U9KA 4PGDA 2NY3C 1MCBA 1QSFA 3HUJF 3JUYA 4WJ5B 5IMMA 5HI3D 5EOTB 3T2NH 4P9HL 3O8XC 1TQBC 2DAVA 1V5JA 1GGIH 2AI0L 4JZNA 5INDB 4N0CC 1R24B 1GOGA 4IBLT 5C1MB 1E6OL 5ISZA 4F2MA 5AEAA 3VE0A 3DX7A 2AVGA 3MBEC 4LCYA 3BWAB 2R2BB 2BERA 1C5CH 2XN9E 3IS0X 4QXUH 3WBDA 4NT6A 1BJ1J 5BJTB 4QRRE 2OBGA 4OI7A 2Y06L 2W0PA 3U4BH 3U4AA 1AXSB 1IGFL 1L7IL 3CXDH 5FF6B 3JV4A 3KWWB 1OOAA 4P3CH 1BFOA 3QR2A 4GW1A 4XBEH 5JHLL 3OZ9H 4LHUB 5DD5H 1QHOA 1WT5A 4X7DC 3ZDXE 4OZHF 3FFCE 1XZ0A 2FHBA 3C6SA 3LKOB 4J1UA 2FCBA 3BP4A 4GKNB 3SKMB 3HRPA 2H2PD 3U36B 3MOBL 1JPTL 1S7QB 4P9HC 2F19L 2A9ML 4MCZA 1WWAX 4GRMA 4OAWA 3HE7B 5I1CH 3DRQA 3HE6D 4KGJA 5TE7H 4QXWA 1BIIB 1G7QB 1Q9LA 2DB8A 1DCLA 4IRSD 3VFWA 1CGSH 4M6OH 1KTDB 5E7FA 1ZLVH 5FYJD 3ZTNH 4KXZI 5ESQB 5DURB 4C59B 5I9QC 1G7LB 4R97B 4HSQA 3O6LL 4R7NB 1FV1B 2VO5A 3K4AA 3WUWA 4Q9QL 1DN2A 1CL7H 1KIRA 3JTTB 3DV4B 2VDLH 5DJ0A 3TBVA 4NGHH 4JRYA 3FB8A 5LCVH 3UTQA 4NQXA 2FSEB 3KYNA 3JBG7 2HKHL 5HYSG 5D7JD 4GXUM 3MGOB 1FAKT 4PJIA 1JNLL 3LQAC 1PQZA 5JHDD 2VDRL 2DQGH 4UBDC 2WLYA 3G6AB 1KTLA 4A6YL 5J13B 1MLCB 3PWUB 2H32H 3FT2B 3N1PC 4XCFL 3RWDA 1E27A 1MCPL 1A6PA 1NUDA 3S3SA 3N0PB 4R0LA 1I7RA 3A0OA 2R4SH 4CVZA 4OF0A 3RWJA 1DEEA 4QT5B 4L8CA 1C12B 3D0LA 3R0NA 5DDHA 3FOMB 2L7JA 5FUOL 4CW1A 4HUNB 3TM6A 3I50L 1VERA 2X1XR 4NHCH 1CLYL 5IM7B 1VESA 2ATPB 1F45A 3MRKB 5F6IC 3L6FB 1YJDH 2DQHH 3MUGA 4LNRB 2ZSVB 4G7VL 4PV8A 5EBWB 3VI4E 1I1AA 4LVNB 4NRZB 4E41B 1RUMH 1BVKA 4ZAKB 4I4WA 4JN2B 5DUPH 5E5MA 4V2BA 1H0DA 2L0DA 3HPLA 4D3CH 3MRBB 1MCOL 2F53B 3VRJA 4F80A 1TQCB 3QIBB 1GGBH 2CKBL 2EIZB 4I5BB 2R0ZL 3V2AR 3UBXI 5IFJA 3QXWA 3BD4A 4Q0XH 2G5BB 3IXTB 2H1PH 1MVUA 1HYRC 3ZKQD 4KTEH 3GKWH 1OSPL 3CVHB 2FZ3B 5DHVB 3H9YA 3S9DB 4NN7C 5IBTH 1EEZA 1XMWA 1WBYB 2IF7A 2EDDA 3TNMA 5BS0A 4CJ1A 4URTB 1MAML 4PY8I 4UV7H 3SKUD 1BPVA 1BJ8A 3U9PH 3DTXA 4NKMB 4H26B 1AP2A 3G6JE 5A3ID 3L9RA 5DD6A 3R8BB 3QUYC 5GQBA 2WBKA 1DBMH 2EYRB 2HA1A 2EC8A 3QNZA 1FYHB 1XIWC 2W9LA 1VADA 5I19L 4OD1L 4PG9A 1QRNA 1RURL 4S1SH 2EXYC 4WWKD 3SDCC 4APQB 2R8SL 4U4BA 1IKFH 2Z92A 3VW3H 4DGYL 5CSGA 4MQTB 1XCQB 4KI1A 3MV7B 5F71A 4QHUB 4G6AD 3TV3H 4ZYKA 5JA9A 4C55A 1AO7A 4LU5H 1IAIL 1LO4H 4U1NB 4RX4A 1FH5L 1AE6H 2EICA 4JY6B 3CGTA 1RZIA 3OX8A 4KJYB 4Z7WF 3IS1X 3HE6B 5GSRB 3F7VA 1NPUA 5FGBA 3BDYH 3W0WD 4RA3A 3RUGE 5BMFH 2RB8A 1NFDA 4JO4H 5IW1B 4H8WL 6FABL 3SBWA 5EU6A 2ATKB 3GEWB 5DHYB 4BZ2H 2CLRB 4K07A 2PYFA 3AB0B 4JM4L 2QR0B 3V5KB 1IEAB 3IFOA 1TIUA 3NCEB 2VXSH 4YHNB 4AIOA 5GISL 5FYKU 3CFBA 4MJID 5HHNA 2P5EA 3I3BA 3ZKXC 2BNQE 5E2WL 4NNXB 1CDJA 1HNFA 4G5ZL 4H20H 4BELD 2NR6C 1EJOH 4PJGB 3MNVB 5IFHH 4JREC 5DXWA 4F7PA 3FO0H 1U8OB 2APTA 3VXNA 3W39A 3MUHL 5LG1A 1VACA 2C3VB 1D9KD 4L8DA 1GPOH 1I4FA 4GRLD 1CGXA 4UAOC 2R0WL 4GLRI 3IXAA 1P7QB 3ES6B 5E8EA 5BQ7A 3WKMH 3BHBA 1N26A 2KDGA 1CICA 4H8WC 1QBML 3GSNL 3GZKA 4TRPH 4PJEE 5C8JB 4DKFH 1F02I 1N7MH 3HC3H 4N0UB 4X9BA 1MI5D 4GRWB 3WS6A 1JIBA 2R0KH 5D2NE 1P9MC 1A7PL 4GKSB 3ZE0E 4X6EB 4K9EL 3G9AB 5F7UA 4PRPA 4LSTH 2VL5A 1MIEH 1QVOA 4XX1G 5EOCJ 3OHXA 2C7UA 1F4WL 4U0RB 4EDWH 4FZEH 4P57B 2X9XA 3EDEA 4Z7QE 2A73A 3QHZH 5ANME 1MCCA 1S78C 3FN9A 5F3BA 1FFPB 1QYGH 3QZWB 4AEFA 3PF2A 1A7RH 1QFWH 3JWDL 2X09A 3O6KH 4CVXA 2OTPA 3T4YA 4YUEH 2DMCA 1R5WA 4R2GC 1JP5A 4YC2C 4GAFB 4RNRA 1A2YB 3HCVA 3H2WA 3DX6A 4KUCF 1RVFL 3ROLA 1OWWA 5CMAB 5AYUH 5D70H 4DGVL 5DFVC 3FOLB 5BVJB 2JIXA 4XXDA 5HGAA 1MCRA 3NCBB 4PJ8C 2XXCB 3MRMB 4L5FL 3VFMA 3WMSA 4P4KC 5E1AB 1WBZB 1A22B 4DJMA 3OXRB 5DJ2A 1OARL 1CLOH 3DXAE 1M71A 5FYKH 3T2NL 3PHOB 5EU5B 5CLWA 2L7UA 5C09E 1GGIL 5KW9H 5F7DB 1QLRA 2X4UB 4PJ5E 1CYGA 1YPZB 4RMRA 4Y4HC 1KYOJ 5EFIB 1K4DA 1T1WB 1JUFB 4PJAB 3UBXA 1XCTA 3IDNB 5AZ2H 3A6CH 5JPNA 1C5CL 3PGDA 4QXUL 2XT1B 4QTIH 3RJQB 2DWEB 3ALWA 3CXDL 3VXRA 3TN0D 2H45A 1KB5H 3VCLA 2X4SB 4P3CL 3LN4B 3O2VH 4XBEL 5DO2C 5INCA 2EDFA 3U9UB 3PP3H 4KJPD 4G9DA 5ITFB 4ETQB 1ZWIB 3P9LB 3RL2A 5E8OB 2YD9A 5CSZB 2BY0A 2D4DA 3O4LE 2NW2A 4JQXA 1S7WA 2X7LB 4M8VA 4ZXBA 1MF2L 4MQ7A 5EU3B 4I0KA 1WC7A 2GSIA 2QJDA 3KG5A 4IEFB 2O93L 1G6RB 2VUYA 3VXSD 1P1ZA 4YHPB 4YHLH 5TE7L 4D9QE 4M6OL 1H8SA 2R23A 1DVFC 2BZDA 5FO8A 3H0TA 3HI5H 1VFBB 4MAYA 4UUJB 3VXTA 3ZTNL 1WT5C 4HIEA 2AV1B 4ZFZB 3ZLQC 1SMOA 3L1OH 5IR1B 3LS5L 4WUKH 4X9GA 1CD9B 4K71C 4HKJA 3MLYH 2VDLL 4UOJA 1DQJB 1XGUB 3MROA 3L5WB 1DR9A 4HUVA 1WWBX 2H8PA 4YXKH 1U8HA 3ETBF 4MDJA 3T4AB 1S7SB 4W4NA 3L7EA 4YAQB 4WO4C 2O26U 1OT2A 2IPKB 3X11B 1I9IH 4X5XA 2DQGL 1FZKA 3I6KB 2QV2A 1SQ2N 4DTGH 5I2IB 4L3AA 2J5LB 4FFWD 3RI5K 1L0YA 4KKAD 2BC4B 3PJSB 3J8F7 2B1AH 1R5VA 3D18B 5E8PA 3VXME 4NO0B 1DE4B 1CXHA 2R4SL 3IDMA 4ONGH 1PYWB 4M9OA 3D9AH 3TJEH 2GAZB 1GOHA 2VZTA 2GSGB 1EFQA 4WFHE 5C0IB 4JE4B 5GIRB 3C6LD 4FRWA 2FHFA 4LSPH 1SY6A 5SWZE 3TJHC 4NHCL 5DS8A 4KJQD 5FA3B 4PJBA 2E7BA 1YJDL 4HIIA 4MNQD 4R0LC 4J23A 4PJFA 2AP2A 5D7IA 1RUML 3CSGA 5DUPL 1NGPH 2KUTA 2P7TA 3D6GA 1MJJB 2XA8L 4D3CL 4R90L 4PJDB 1GGBL 2MOVA 4OLZH 2VSDA 3MJ9A 1JRHI 2E7MA 1D5MB 5J3HC 1I8LA 5F6HJ 3VFSA 1LO5B 4Q0XL 5HXMA 3GUTA 2H1PL 1K3IA 1NSNH 2QQLL 5HPMB 1JNHA 3O41B 2FEEI 3MODH 3HZVB 1MHCA 4JVPA 3BP7B 3BPOC 2X1PA 2G2RA 4TVPE 4HKBA 5IBTL 5ITBH 1UCTA 2FHCA 1LVEA 3QO1A 4NUJA 4WHTB 3TBWB 4ELMB 3QEUB 2C5DC 2JCCB 3U9PL 3N06B 4NM4H 3HR5B 2E8YA 3WIHA 1RZJC 4GBXA 3D3VE 2B2XH 1HH9B 5EOCH 1DBML 3NTCH 4JPKH 1TCRA 3L3GB 1A6TA 1QUNA 3QWOB 3KDMA 3OG6B 5K9JL 1EHLH 3VG9C 1SJXA 3TN0B 1HINL 3MRCB 4S1SL 3T3ME 2HFTA 3GBLA 2ZOKB 3BPCA 1WF5A 3VW3L 2D0GA 3CDGA 3R8QA 3B9KA 4UQ2B 3AS3A 2ICEB 3S37L 3TV3L 1OSZA 3CUPA 3MFFB 5IB1A 4GG6B 2YKLH 3D39A 1KEGH 4YFLF 1JGEA 5H94A 3RY5A 2HT4C 3MGTA 2CUIA 3AS2A 4RFEA 5MENE 3RZCA 2KL6A 4Z77A 3EJYD 1MUJA 5BMFL 4OFYD 4O2FA 4G9FE 4QF1B 2YEZA 4PGZA 5IUSA 4DVBA 3I02B 3VGDA 4JANB 1JI2A 4BZ2L 4F9PA 1NUGA 3HPJA 3RWEB 5D8JL 4MA8L 1GXEA 4LLDA 3IU4H 1KGCD 1J05B 3ARBA 4JQIH 1QNZH 5JO5A 3NCCB 4U7MA 2UWEE 5D5MB 2VXSL 1UM6H 3IDXH 1FAIH 3PQYB 3GHBH 4MZ2A 4QTHB 2OJEB 5EZOH 4YXLH 4YIQB 2EE6A 5FGBC 5ADPH 4TUOA 1G7HB 1QSED 3VXQA 5IFHL 1HXYB 3O4OB 1HDMB 4FQ2H 2D7QA 1U3HC 1AKJB 2IADB 3SBWC 3FO0L 3FAWA 3T2PA 1IVLA 5DD3H 3VWKA 5LBSH 3SDDB 2EE3A 4ORGB 3NFPB 1GPOL 3VXUD 4K7FA 5HYSB 4HEPG 3EOBA 4DEPB 1KIQB 4P4RB 2FR4B 5KSVB 4IHOB 3WKML 4BZ1H 3MO1B 2IAND 1BOGB 2XZCH 2AXGB 4GH7B 3CIQA 5D1ZB 3T8XA 4DKFL 1N7ML 5LGJB 2YPVH 3PV6A 4EEEA 2LE9A 2OJZH 4D0CA 3K3QA 2R0KL 1A9BB 2PETA 4EVNB 5T5NG 4ZUSB 4AM0A 2BJMH 1ES0A 3K2MC 4LSTL 4U33A 4NQDD 4MNQB 4EDWL 2NY1C 4FZEL 3ILQD 3QI9C 4ZD3H 3QHZL 5I16B 2B1HH 1CICC 2WWMD 4L9LA 4X6DA 1MRCH 1QYGL 5HHOD 2AKRA 2FGWH 4BYHA 5E4EC 1A7RL 5JXED 5FOBA 1XGQB 1QFWL 2XRAH 3O6KL 4NDMB 1L4IA 1NMAH 3WYRA 4OCXH 1M1SA 4YUEL 4CMMB 5HD8C 4LCCB 4NQEA 3BRDA 3GSWA 4ZFOL 5F9WB 1FFNA 3ROOB 5AYUL 5D70L 5HHMB 5KS9E 1QFUH 5CIPH 4LSQH 1S3KH 2VWEE 3P40A 4MGXA 1OPGH 2BOCA 3OR7B 3UTPD 2DTML 3KPSE 4MCYA 4U1JB 1CLOL 4O2EA 3SEPA 3PABA 4O2CB 1UT9A 5FYKL 4Y16C 3TZVB 2NY2D 3IJSA 4S1DC 4KFZC 5E0QA 3NAAH 2NX5E 1D6EA 1JPFB 3UPAA 3H9SE 3S97C 3PDOB 5F21B 2B5IC 5AZ2L 3A6CL 1IGTA 4PJ7E 4HUKB 4QTIL 5E6ID 4XNZB 3CXHJ 5A1AA 1HHHA 3FQRB 3FB7B 1KB5L 3O2VL 2IC2A 1T6VN 2GUOB 4XT1C 5KANG 2RQ8A 3EYFB 3FAXA 1I85A 2HTKD 3QUZD 4NUGH 1FVCB 3BH9A 1CGWA 2HMIC 3BP5A 2E6PA 2JELH 3KJ6H 3FFDB 4HS6B 4P2QA 4JY4B 5I1AB 4TVSa 2X4OA 2R39A 5IFAH 5EDXA 4UMGA 4WTWA 2IWGA 2CIKA 3HUJB 2D9QB 4AYFA 4P2RD 4ZUUA 4E0RA 4OZGF 2FL5A 2HVJA 3DYOA 3SQOH 3HI5L 4YDVA 1U92B 1U8NB 2BXZA 5GS0H 4IIQB 3WJLA 1WCQA 2IPTH 1P53A 3LKNA 1IQDA 3L1OL 3ILPA 4WUKL 4QLRA 3AU1A 2R2HB 1T7ZA 5T1LA 3TO2A 3X14A 3U1SH 5C9KA 3MLYL 3PDDA 4ZXBC 2MPAH 4YXHH 5FKPB 2AJSH 5KVMC 4NOFA 5KOVC 3W9DA 2NNAA 4WY7H 1KOAA 4YXKL 3VXUB 2GK0A 3MR9B 4HWUA 4QXGL 5CBEA 2IH3A 5GGVY 3LMJH 4ERSH 2DQTH 2C3HA 3BEVA 4KHXL 4MAYC 4U1MA 2NXZC 4AEIH 1SEQH 5KSAD 1IBGL 5EUOE 4OZHB 2IANB 2XA3A 4R3SA 5IB2B 3OKNA 2CK2A 4MS8D 4DTGL 4PPTA 1E4WH 2X89D 2DTSA 3MJ8A 4MAUH 4OFKA 5FUCE 1EMTL 1QEWB 1SY6L 1ORSA 1U8MB 3SE3A 2VXVH 2B1AL 4TSAH 4I13B 5HI5C 4Y4KB 2OR8A 1EZVX 1R24A 4HZLB 4ONGL 2ED7A 5ICXB 4RBPK 3TJEL 3Q5YA 4LK4A 5DJ8A 1LP9E 5FIEA 4JFOB 3BWAA 4JN1L 8CGTA 3OKKB 1CI5A 2OM5A 4MLSA 1NC2B 2IFFH 4LSPL 4ODWB 3PL6A 3QUXA 1FSKC 3IDUA 3G04B 5FM5O 5B22A 1HHKB 2Z93A 4ALAH 1HIML 4JVUA 5E6ZA 4ZS6D 2DM3A 4LHUA 2XACC 3HR6A 1BX2B 5HYFA 1FCGA 1NGPL 3JZ7A 1KCRL 5GGRY 2PUQT 3SKMA 3W2DL 5DD0L 3VGBA 1RJYB 4L3EA 4OLZL 4RWYH 3P0VH 2FNBA 3U36A 3RUGA 1MPAH 3HS0A 1HQRA 5CFHA 3O45A 3HE7A 3A67H 4MA7H 4OGAD 2A1WH 35C8L 3MODL 1U42A 3GMPA 1KTDA 1PG7X 2IQ9H 4JDTH 1TVDA 1G7MA 2SEBB 4YDLB 4U3XA 5D2LF 2HWZH 4K3DL 3V7AG 5DJDA 1IAMA 1FNHA 1Q0YH 2CLVB 1IGCH 4FTVB 2GY5A 1A1NB 3QG7H 3LDBC 1RK1A 4NM4L 5IIEB 4JKPH 5TE6L 3ZYJA 1I8LC 1P4BH 5E6IB 2B2XL 1QOKA 5D1QB 3NTCL 5F7HA 4JPKL 3IVKB 1TTGA 43C9B 1DEDA 2VISA 3KPMA 5J1AB 3L5JA 3MGOA 1RJZB 1ZVHA 1M7XA 4U3CA 3UO1H 1FQ9C 4Y4FC 1MY5A 4J8RB 4AJ0A 3PWUA 4XWOC 5F1KC 3CSYA 4XVUC 3KR3L 2VL4A 3QUZB 3KYMB 3SPVA 2VR4A 1XR9B 5GGVH 3LRSA 3FHQA 4GBXC 4NFCA 4KUZH 4W6YB 2YKLL 3O81A 1JPGB 2EDRA 3LS4H 1J0KA 1C12A 4KVCL 2J6EH 3B2VH 4P5MB 3FOMA 4M02A 4OLXH 5I1IL 1TDQA 4QKXB 4U1SB 4POZD 4Y5VB 3VJ6B 4MX7B 3WS3A 1A6AB 2AGJH 1H8NA 2YBRA 5C0CE 2P8MB 1BZ7B 4EUPG 2XTJB 3DMMB 3DRTA 3IU4L 4JQIL 3S34H 1QNZL 1BFVH 4NRZA 3RQ3A 5C0JB 5L2KA 5GZOC 1ZSDB 1RY7B 1UM6L 4NQCE 3IDXL 3GHBL 4Y2DB 3NFSH 4PB0H 2J8OA 2PTUA 5T1KB 4X6FA 3RZCC 4ODBD 1OGTB 4RRPG 3S7GA 5ADPL 1MHEB 1OTTD 3DYMA 5F3HA 3MRQB 2CO6B 3HRZB 4FQ2L 4QOKD 4QRPE 2G5BA 3OGOE 5F9JB 4PLJC 5I0DA 5DD3L 4N1HB 4F9PC 4PTTA 4Z7NE 5LBSL 1KC5L 2IAMB 2VQ1B 2NY4C 2XQYG 1NC4B 3VGHA 4N9GA 1PJ9A 4JFZL 4GQPH 3CAFA 1NCCH 1Q9OA 2W9DL 1FO0H 2C1PA 5IHLB 3FN3A 4Z7WB 2VIRB 4LLUA 4YHZH 3KPRA 3VD7A 5EA0L 3BVNB 5D6CA 4FQXB 5EU7C 2DKMA 2Z9TA 5KN5B 3LRGA 2VXUH 1SJEB 3BD5A 4IDJH 4M43H 1V7MH 2YPVL 3LEVH 2OJZL 1ZEAH 3WDIA 1PVHA 3VWKC 1RMFH 2EYRA 2QADD 1FFQA 1P2CB 2J8UA 3UTSD 2DQCH 4LARL 1BAFH 3LVEA 3UEZA 3EYUH 4FZ8L 3EFDL 1UH2A 4ZD3L 3JWOL 2VERN 2B1HL 1N6QH 3TT1H 5CJQH 1NGZA 1FFOA 1WZMA 2FGWL 1T7XA 1UJ3C 3CFDA 25C8L 3D2UD 1IZJA 2XRAL 4LIQE 3C2AH 3WFHB 4OCXL 3R06B 1M6OA 4LCWD 1A14H 2CJUH 1D5IH 1M7DA 4PRIB 3D87B 4KK5C 1AQDB 2M1KA 2VLKD 2W0FB 2QHRH 4UIMA 5GSRA 3TVMA 5JW3L 1VA9A 3QQ4A 4N5EC 4XVSH 3QUKA 4M9PA 1YQ2A 5TDNA 4KU1A 2ZNXA 5IW1A 2NQCA 1QFUL 4LSQL 4FABH 4DAGH 1S3KL 4GAYA 3HA0A 4L9LC 5F7KC 1I8IB 1D3CA 1OPGL 3F5WB 1TETH 2P47B 3OB0K 4X6CE 3VD4A 3MV9E 1Y18B 3K8LA 3MMEB 5FGSA 4YHNA 5DRNB 1EO8L 4X4ME 2VZUA 1CG9A 2F54A 3VDAA 1H3PH 1LEGB 5HYQB 4NN5C 3WXWH 4XMPH 3JWOC 4OZ4A 3NAAL 4QYOB 2GJZB 5IEHA 5FECB 4LKCA 4XZUA 3VI3F 5IMOB 3QUMB 3RHWK 5ID0B 4JVWA 1U8OA 1KXTB 3Q6FA 4PY7B 1OD9A 4P2OA 3OAYH 1GIGH 4ZUVA 2UUDK 5JXAL 1JGLH 2JK5A 3IFPA 5K9KA 2IH1B 5H2BA 1NMCB 3ES6A 3OTTA 3TBYA 2N4IA 1I7UB 4MJ5B 2ESVA 3I6GB 3QJFB 3H7LA 3UPCA 3S35X 4AIZB 1I75A 3TNNB 1EFXA 3KLAB 5KG9B 4LLYB 2W60B 3GMMA 1A7OH 4NUGL 2A74A 4HWBA 5FCUL 3CLFH 3EZJB 4GKSA 4XP9L 4E9LA 4ZFGL 3V79C 3KJ6L 4PJIF 1F97A 1PKQE 4I9WD 2HT3C 5IFAL 1TPXC 5GGUA 4JDZB 5LWYH 5C2UB 3D1MC 4P57A 1S8DB 2VLLA 3AUVA 4O9HH 5DMKA 2Q86B 3BMVA 1ROWA 3SQOL 4PD4K 2HJLB 4OLWL 2IPTL 2GTWB 3C8KB 3FQXB 3QXAA 1I85C 3C5SB 4PRHE 5CP3H 1I9JH 3IF1B 4XBPB 4PJ9A 4U31A 5BRZB 5IQ7H 4KK9D 4TVPH 4QOKB 4YXHL 4HXAL 4CBPA 4I0PB 1SYVB 5I75B 2AJSL 2EZ0C 3EYSH 4HT1H 4LMQE 3V4UH 5ESAA 4JHZA 4WY7L 2V2XB 3OAZK 1JI1A 4IOSD 5TDOB 2OZ4A 2OQJB 3LMJL 3CMOH 5GGSB 2DQTL 1R3JA 4LPWA 2YHGA 5J1TC 4XNQB 4PY8J 2PO6D 4HK3N 3WJLC 5DMIH 1M4KA 1B9ZA 2E9WA 1G84A 1NCBH 5F7MC 2YSSB 4TNVF 5SWSB 5E1AA 4D0DB 1D5BB 3HTLX 3SE9L 3ARED 2VRAA 3MLSH 4RMSA 3PHOA 4MAUL 4WU5A 1FC2D 3OJVC 4U1KA 1KPVA 2VXVL 4TSAL 5HYJE 5F7DA 3H3PH 3MLRH 4N0FB 2X4UA 4ZUWA 1K4CB 1YPZA 1T1WA 4FMFA 1R0AH 3T0AA 4F7CB 4JHAH 3RL1B 2BK8A 3RIFF 4E42B 1OHQA 5HDQH 2QLVB 5IV2B 1IM9D 4L8BA 2IFFL 2DWEA 3IJHB 5C0BE 3SJVA 1UENA 4H88H 1A47A 4TN9A 3G08A 4OCRH 3D2UB 1CXFA 1IC5H 3C08H 1E0OB 1FL3B 3DBXB 3KVQA 3SE3C 3VG0H 4ALAL 1T20B 5E03A 3QDMB 4L8SB 3T0VA 5HGDB 4ETQA 2VLKB 5EIQA 5J56B 1U8IB 4PREA 5JOFB 5CSZA 1YMME 4XVJL 1EO5A 2DQUH 1ACZA 5MENA 3UJIL 3P0VL 4RWYL 1MPAL 4FQQA 1H3VA 1TZHB 3C09B 3OF6A 3M07A 1T7WA 1G6RA 3HFMH 3PL6C 4JFPB 3QUXC 4MA7L 1LE5B 2A1WL 1LE9B 1OF2B 2OTUB 3WHE0 3SDAD 5GS3A 5ACMA 4KHTL 5AG8A 2IQ9L 2GITB 4PP1C 1L7TL 5FCSH 1JBJA 5JW5B 4B0MM 2HWZL 2DQEH 4Z76B 2XFXB 4L1DA 1Q0YL 2ADJB 3O8XD 1IGCL 4CMHB 4ODXA 3DHMA 3UZVB 1GOFA 1KJ3H 2DYPD 1RK0A 4P46A 1ZHBB 4N0CD 2DLFH 2OL3H 1DQJA 1XGUA 1RZGB 3L5WA 4JKPL 4M1CD 1J0JA 2GJJA 4AEHH 3RWCA 3MYZA 5GS2D 1NFDF 3T4AA 1NEZG 2R4RH 1FYTD 3IKCB 2Q6WB 2Z8WC 1GGUA 5IB3A 1KCUL 3QXDB 4HG4K 3O9WD 1J12A 2HJKB 3CU1A 4OKVB 3MOQA 3QPQC 3UO1L 4QXTA 3PGCB 3DSFH 3PWPE 5FA4B 3AMLA 2O61A 5CZVH 1N5AB 3CVIH 3QIWA 4PR5A 1J0IA 3PJSA 5GGVL 4WV1C 1HSBB 4KXZH 3J7HA 2IBZX 5EBMB 2ENSA 2CDGB 3DOSA 4KUZL 5GRZA 3MNWB 5MHSE 2GSGA 3WFEH 2J6EL 3B2VL 4OLXL 3EOAA 5C0IA 1TJGH 3GBNH 3HG1D 8FABA 1I3GH 5GIRA 2EDWA 3VRLF 1W8OA 1OGAB 1IZKA 1QPXA 4I18A 5CZXC 3BRFA 2AGJL 4M7LH 1S5IH 4ODTL 4TSBL 4YBLB 3BUTA 1Q9KA 4LSUH 3ARFD 3S34L 2JLLA 4JRWA 1CDUA 3OXSA 2P8PA 1OAKH 3V0VB 2EO9A 3TGXA 3NFSL 4PB0L 1MJUH 3NZHH 4PJDA 3OJDB 1JZ8A 1N3NB 3B2UC 3ZHLA 4WDIA 4JFEB 4AL8L 1X7QA 3ULVC 5JW4R 5F8QC 1RUKH 2FJFA 5CHNB 2PO6B 4EQ2A 4RFNC 2YN3A 4Y19D 1A7NH 3O2DA 4ZPVA 2DJUA 4BKLA 4H0IA 1OQOA 4HMDA 3CFKA 12E8H 3MV8D 1ADQH 4QWWD 3LY6A 5IT2H 5JQHC 1QR1A 1NGQH 4UBDD 4U3HA 2HTLC 1MAKA 1A6ZA 3BP7A 1P5UA 1U8LA 2Z8SA 5T33H 2Q7YB 3BOVA 5DQ9A 4WFGE 3GSVB 1FO0L 4Q9RH 2LFGA 2D03H 2UY7A 5F44A 4E41E 4YHZL 5DQJB 4ELMA 3FRUB 1OP3K 2NX5A 2LU3A 4IDJL 4KI5E 5DF0A 3W9EB 1ZLSH 3HR5A 2F53E 3MCLH 2ZG2A 1HILA 1DANU 5EO9B 1HH9A 1OAUL 1O7SA 1FFRA 1ZEAL 3L3GA 3O3DB 3B83A 2DQCL 2OX5A 4M7ZB 1BAFL 3CU7A 3MRCA 1KSRA 2HKFL 4TUJA 3RGVC 2MCPH 3EYUL 3RDTD 4BJLA 2ZOKA 4ISVB 4JFYA 5I71B 1QSZA 1IEBB 4WUUD 3IT8D 3TYGH 1YNLH 1N6QL 3TT1L 3WO4C 5CJQL 1TTUA 1SMAA 1IM3A 3KXFD 2P5WB 4XVTH 4GG8B 4HIJA 1B0RB 4DFIA 1LILA 3C2AL 4CU6A 2V9QA 5TDPB 4ZG1A 4KTYA 1A14L 2CJUL 1SEBB 3ZE2E 1D5IL 5GS0D 1AXTH 3RFZC 2QHRL 1NAKH 3V6ZB 1PY9A 3T2QA 4XVSL 3ABZA 4XB8A 5F7EH 3E2HB 4NCC1 4P5TA 4JRXD 1OTUD 1F4HA 3I02A 5E9DD 5C0AD 3UROR 1I7TA 2PCPB 4DAGL 2NY3B 4FABL 5CP7B 5CAYB 4XPTH 4K7PY 1TETL 3O8XB 1TQBB 1LD9B 3P0YH 1VGKB 1W72H 3S96B 5MEOA 1TJIL 4C56B 4WU7B 1J05A 3MV7E 1S5HA 1XFPA 4OF6A 5F89A 4LLMB 4YGVB 1GGCH 5EZLA 2E6JA 3MBEB 5J6HB 3OJ2C 1H3PL 1EEYA 3TVMC 3G9VA 2DD8H 4WFED 3WXWL 4XMPL 1FYTB 3LRHA 1DN0B 1X5AA 2A6IB 1I1RA 4YHIA 3WIFB 5JW4N 3T77B 3SCMD 5IWLC 3LV3A 5FYJE 1QLFA 1T1ZA 2ZUQC 3X3GH 1N0XH 1GIGL 4JM2A 3SDDA 2VXTH 3NFPA 3RWGA 2FBJL 3SDCD 1PW3A 1LO3H 1AGCA 4RAUA 2YA0A 1KIQA 4KMQA 4RQQA 5HTSA 3RVXC 2XYCA 3T0BA 3GNML 3WL9A 3OBAA 3ET9F 3IDJB 4DZ8B 3VFVB 4RIRB 4G6JH 2J88H 3QCTL 2WZPD 4ZDHA 1A7OL 4WGWB 2XKUA 4MXVF 1FDLH 2HLFC 1LP9A 3LSOA 3CLFL 3EFFA 2NXYD 3PXJA 4EVNA 3OKEA 4P2OC 5BZWB 5ERWB 5JHDE 4OM0L 2ORBL 1A4KB 1EEQA 3BUYB 5FO9A 1MFEH 5I9QB 5LWYL 1NDMA 3QFJB 1LO0L 4Y1AA 3K74B 1JPSH 1YDPB 3LHPH 1KJ2B 1S9WA 2VLRD 4S1RH 5I6XC 1IT9H 1I9JL 4RMVA 1EGJA 4X5WB 1XGQA 3QFDB 3QNYB 4NDMA 1R3LA 5IQ7L 4TVPL 4Y19B 2W0KA 1UKSA 2WQ8A 4MYWB 4N0UE 4GRWE 3L7FB 4XPHL 4WI4A 5EO0A 5L6YH 3OPZL 2D7TL 3MV8B 3EYSL 5E00B 2A0LD 1MELA 3CPLB 4XI5C 3QG6A 4O5LL 4YR6B 2Z91A 1YY8A 5EBLA 4ZSOA 3CMOL 2JJVA 4QHMA 3A6BH 2CUHA 3TEUA 4PJBF 3CFJA 1N2RB 3OR7A 5DMIL 1NCBL 3MJGX 1G0DA 4PJFF 3WN5A 5D7IF 4U1JA 4KROC 4PJ9C 3U7WL 4AQ1B 4ZUTA 2W07A 4NKDB 4CDGC 4LVEA 1MJ8H 1RV6X 5IEKB 2FX9H 1ZVYA 4HUMB 2BHUA 3F6LA 2ZUYA 3MLRL 2V5YA 4K7PH 3SHSA 4D9LH 4ONHA 2A6DB 1H3GA 2Y4SA 5MEPA 4OZGB 5IQ9A 3O3EA 1EA9C 5F6IB 1XF4B 5HDQL 1NAMA 2FIRT 4XPGH 1OAXL 3NA9H 3W11C 5JMOC 4V1DD 4P3WA 4Q2ZB 5D96C 3H9ZA 2AQ1A 4H88L 3FB7A 1S78D 4FQHA 4OCRL 1IC5L 2DI7A 3C08L 5CKGA 3VG0L 1W0VA 3BDBA 4A6YB 4NKOB 2AJVL 1ZLUK 3AMKA 1F5WA 2CD0A 4M62H 4IRJD 5FB8B 4OZIA 2I5YH 4OF7A 2YD2A 1I3VA 1FVCA 3VFTA 1J0ZA 2DQUL 3P4MB 4LSSH 3GFUA 1XR8B 4MJ6A 1E4XI 3FFDA 5C0AB 2EDLA 4YPJA 4HS6A 5ID1A 4EXKA 3HFML 4U1HB 3MRDA 5EPMB 3OWEA 4NN7B 4OFDA 3FQNB 3HAEB 5C09D 1P7HL 3GMQB 3HC0A 3RVVC 4PJ5D 3PIQA 4U6TA 3QUYB 3H3KA 4FXKB 5BV7H 2Y07H 4OCWH 5FKPA 3W0WE 4BFBD 3IDIB 2HG5A 3BGMB 1XIWB 2VDQH 3MX0A 2I07B 1JHKH 4G43B 3SDCB 3T0DA 4XHJC 5ICYB 2FX7L 2R4RL 4ZO9A 4X4ZA 1FVDB 2AK4A 3G6DH 4G42A 1V3MA 5IMLB 3IJYA 4X9HA 3MC0A 1MFNA 4OZHA 1JWSB 1G7PA 3QEQB 3DSFL 4M5YH 4X99A 4Q74A 4MJIE 4HPYH 2VZOA 4QHLB 5F1SA 4P46C 4Z78B 2D31A 5TPWH 5CZVL 3CVIL 5JQ6L 1NBZB 5ISZD 3EGSB 4HZLA 2VDNH 1U91B 3WFBH 5IHBA 1JWMA 2EIBA 3UPRA 1I8KB 1DBKH 3P4OB 5ALCL 4LIQH 3WFEL 2CKNA 1MCNA 3OKKA 1CGUA 2D0FA 3QHFL 3H9HB 4AK1A 1TJGL 5DK2B 1I3GL 4PV9A 5D2LB 4XRCB 1RD6A 4XNMB 1X5FA 3DROB 3QO0B 2VN4A 1NMBL 1S5IL 3G04A 3EKCA 1I1YA 3QIWC 1U8JA 3S36H 3DURA 4LSUL 3B3IA 3QJHA 3ZKXB 3THMH 2X4PB 1W0WB 3V0WL 1MI5E 1MOEA 3OR6B 4I2XA 4HKXA 1S7VB 4FXGA 1GZQB 1OAKL 1YEFL 4JREB 1C7SA 4Z9KB 5CGTA 3ALPA 5GS1C 5J0BA 1Y6NR 3NZHL 1LDSA 1ZT7B 4X4XB 1WK0A 4N8VA 1RJYA 1KLGB 2GQHA 5AAWA 1G9ML 2WIMA 1YEKH 3BN9C 1RFDH 1RUKL 4UAOB 1A7NL 3FO1B 2P8LA 5LAXA 2G9HB 4I18C 1HYSD 12E8L 5JNYB 1ADQL 4BFIA 3FMGH 1BFTA 4X7CC 5IT2L 3IETB 4X6DF 4X9IA 4QRTB 2SEBA 3ZDXF 5T33L 5JDJA 3K0WA 2H26B 4Q9RL 2W9EL 5F7NC 1CGYA 4I3SH 4OZFA 4RMWA 3HZYB 4FTVA 5KSBE 2IGFH 5ABDE 3V7MA 1D6VH 4ZS7L 5FAAA 3RKDC 1WCBA 5A16A 3MCLL 1MCLA 2DM7A 3K81A 5D1QA 1K5NB 2VWEC 3WFDH 4V1DB 5SWZD 4YO0B 4NBXB 4K8RC 3MA9L 3RA7H 1Y0LB 3MLTA 2BVEA 3LOWA 1RJZA 3WE6A 5AUMA 3HMXH 1T83C 4L3CA 1NJ9B 1JRHH 1D7FA 1G9MC 2GW5A 4P23D 3TYGL 3BKMH 1YZZA 3QH3A 2EKSA 1NANH 3GJFB 3FT4B 4KDTA 4X4YB 4R2GB 4YC2B 3CCHB 3K8KA 4XVTL 3TBSB 5JW4Q 5I1JH 2E27H 3MRGB 4M7JL 5C0DB 1CDBA 2JCCE 1OTSC 2NCMA 1CU4L 4F7EA 5DR5H 1UCBH 1UH3A 1AXTL 3ZDZF 4P5MA 4PJ8B 1PKQA 1RIVH 3UTTB 1JTPA 4DFHA 4P4KB 1ACYH 4MXQD 3PWVB 3QRGL 1KNOA 3KYKH 4XPTL 1I1AD 1BZ7A 3LPFA 4PG2C 3P0YL 4M7LT 1OAQH 5DSCB 5HI4C 3UTOA 2W92A 2Z35A 2O5XH 1JZ5A 4HLJA 3S88H 1T5WB 3DX8B 3QWRA 3AAZB 1ZSDA 4Y4HB 1EDQA 1GGCL 3LIZH 4CJ0A 3DI2B 1NCTA 4HGMA 1IAIM 2ARJA 4V2CB 3G5ZB 4ZOBA 1MHEA 3VXSE 3I2CH 3GGWA 3MRQA 4P5TC 5IK3B 4Z6AT 5TE4H 4XTRD 3SO5A 4PGDB 3MREA 1QSFB 5C2BH 5IMMB 2GHWB 3X3GL 1N0XL 1MWAA 2IAMA 3JUZA 4JZNB 3VWJA 1LO3L 4YGAB 2NY7H 5ISZB 4F2MB 2AV7A 32C2A 3VE0B 1INEH 3DX7B 5C08A 1O5DT 2QQKH 2DMKA 4LCYB 2EKJA 5D5ME 5HYJA 4FQXA 1WAAE 3SGEH 5KN5A 3PQYE 5F1NA 2LU4A 2J88L 5LJYH 2Q76A 2HRPL 2PYED 3O3BA 2FWOA 1X5GA 3JV4B 3T0EA 1BFOB 1AGDA 3NCJH 3U2SA 4JM2C 4GW1B 5FHAH 1DVFB 1LMKA 2Y25A 2YUVA 1Z0MA 2B0SH 5CJ8A 1AIFB 2DLTA 2VDMH 3C6SB 4J1UB 3UJJL 3BP4B 3DVFA 3GSOB 4MNHA 1JPSL 1TITA 2VLME 4K71B 1AO7D 3LHPL 3ISWA 4RX4D 3F7YA 4S1RL 1PLGH 4MCZB 1YMMA 4OAWB 4DUWA 3G6JF 3D85A 4XPAH 4HGWA 3R06A 1BQHG 1Q9LB 5HVGB 3VFWB 3MLXH 2V5TA 4Z7VE 2AXFA 3SO3C 4PS4H 4PRIA 4WO4B 5L6YL 1AQDA 2VDKH 2W0FA 5GSVA 5DUMH 4Q6IA 3V6OE 4C54A 4EDXA 4DKEL 5EU6D 4KTDH 3ZKNC 2A6KB 5I18H 3QYCA 4MNQE 2BVQA 2YK1H 5T1MB 5DJ0B 3DWTA 5HHQA 3F62A 5FM5M 3C60A 4JRYB 3FB8B 1NAML 4UDUB 5K59F 4NQXB 3KYNB 4RISH 4KKLC 2ENYA 2FX9L 2YXMA 4PJIB 3RAJL 1PQZB 7CGTA 3WHXA 3RUGF 5KANI 4K7PL 3ZSSA 5L7XH 3QDGA 1KTLB 4D9LL 2AK1L 5IMOA 3QUMA 4OI9A 5FGRA 1E27B 1GAFH 1OL0A 1RU9L 3NA9L 4XPGL 4L4VD 3WN5C 4R0LB 1I7RB 2XXMB 4NJAH 5J89A 2GY7B 2IH1A 3B9VA 1HQ4A 4CVZB 4F7TA 1CICD 4L8CB 3D0LB 3QJFA 4NQUA 1CLZH 3OL2A 5DDHB 4PLKD 3I6LD 3TNNA 4M62L 2A77H 1MAJA 4D94A 2I5YL 2W60A 4MMXC 4N0RA 3RWFA 3C87A 2PXYD 4MD5B 4PRPD 3JV0A 3QA3A 1KEMH 1FNGB 2A6JB 1SYSA 2MNUA 4J12A 4XPBH 4N68A 4L4TA 2QSCH 1WUNT 4I4WB 3BPOB 1YA5A 5E5MB 2UYLA 1H0DB 3HPLB 2Q86A 2XG4A 5DI8A 3VRJB 2HJLA 2GTWA 3C5SA 4POUB 4R96A 5HVWA 4GAGH 1MVUB 4S1DD 3ZE0F 5BV7L 2Y07L 4OCWL 4GO6B 4I0PA 4OIIL 1WZLA 1BD2D 3VG9B 4PGEA 2VDQL 1QP1A 1T04A 1JHKL 2JIXD 5TDOA 3U30C 5K9OA 3ULVF 3B8YA 1EEZB 2OQJA 1KTRL 4JO3L 4AH2A 4HJGB 4S11A 3TNMB 1CFVH 3C5ZD 5BS0B 1KGCE 3HUJE 4FG6D 3C5JB 3DTXB 2YSSA 5F96H 5SWSA 2WBWB 2ZCHL 4D0DA 1D5BA 4M5YL 1AP2B 5CJOH 5DD6B 4KK6C 1CR9H 3CLEL 5TJWK 3RU8H 3P11H 1QSEE 3CVHH 1VADB 5DHVH 4PG9B 1F58L 1QRNB 3L5IA 2VDNL 5IW6A 2HMID 5JLZB 5GPRA 1DBKL 1H5BA 4LIQL 4H1LH 3VXUE 2IBZY 4DN3H 1F6LL 5DEGA 1H3UA 3MQIA 4RGND 3NA4A 4OD2A 4CL7A 2ZUVA 4G80A 4JFQB 5E1HB 2IANE 1T7VA 4MD0A 1URLA 3B6SA 3DBXA 1I1FA 3S36L 2P24A 3F7RA 1T20A 2AW2A 4L8SA 3THML 1ZHLB 3F12B 3F65A 4PLOB 1DBAH 4ZNEE 4CU7A 5JOFA 5JPMA 4YFEA 1NFDB 4ZXBD 4KAQH 1U3HB 4OLUL 5EU6B 1B4JH 4JR9H 4LEXL 2J8UF 4NQDE 1TZHA 1YEKL 4JFDB 4N1EA 1RFDL 4NZUH 3IFOB 4JFPA 5EB9A 4NHUA 1LE9A 3UZQA 4MAYD 1ZXQA 2ARJQ 2OTUA 3FMGL 2P5EB 5E08H 5HHOE 1MRFH 3S4SG 3ZYZA 3EHBD 3VMNA 1E4KA 2YPLA 4WW2C 4JHWH 2XFXA 5TFSL 4I3SL 1XF5A 2IGFL 2YWZA 2DKUA 2XWTA 3VXNB 3W39B 3TT3H 1VACB 1ZHBA 4L8DB 2WINB 4Z8FH 1RZGA 1I4FB 1UZ6E 1MCWW 1FIEA 2CRIA 2DIJA 4M93C 1TZIB 2NY1B 5E8EB 3WFDL 5L2JB 3IKCA 3BHBB 3QI9B 3UTPE 3RA7L 1CICB 3QXDA 2EH8H 2ZG3A 1QO3B 1ZVSA 3CFCH 4RGMC 5E4EB 3GJFK 3PGCA 3BKML 5I15H 2ZCKH 1QFOA 4PRPB 5I1JL 5IOPA 1HSBA 1QVOB 1BBJA 3E8UH 2AERT 5FO7B 3QIUC 2C7UB 5EBMA 1J8HB 2WV3A 5D7JA 5I1EL 4WEUD 3MOAH 5C0RH 4G6MH 1UCBL 2A73B 4LAQH 5JHDA 4NCDA 1MNUH 1IILE 5F3BB 1NCDH 5H37H 1F3JA 4GRWH 4WI5A 1FCCA 5IBLC 3SKOA 1ACYL 3CXHK 4KC3B 4NPYA 5J6GA 4JHBA 3MXVH 4CVXB 4TULL 2NTSP 3T4YB 4KDTC 3T3PF 1R5WB 2RJMA 4Y2OA 4Y16B 3INUH 1OAQL 4RNRB 3DI3B 1PX4A 3KS0J 3DX6B 3ROLB 1MWAL 3S88L 1KJMA 5DMGC 5EIIA 1EPFA 1WQVT 2DI9A 3V0VA 4DOHB 1U41A 3BRGC 5HGAB 1H8OA 3QCUH 4Q9BA 2B5IB 3BYTA 3N85L 4FQPA 1T21B 3VFMB 4JFEA 2OSLA 5B21A 4YHMH 3I2CL 2VDPH 2VDOH 1X5LA 5TE4L 3GB7A 1UVQA 5C2BL 1CVRA 1M71B 1CQKA 1MIML 3SOBH 5KOMC 2R56H 1QLRB 1AD9A 2NY7L 4J3SA 4MDIA 4XWOD 2XWJA 4GW4B 1K4DB 1INEL 1F2XK 1JF1A 4P3DA 1XCTB 2QQKL 3UBXB 1AGEA 5DQJA 3FRUA 5JPNB 3RTQC 1L6XA 1HCFX 1T4KA 5EO9A 4GJTB 4OQTH 3VXRB 1PFCA 2F8OA 2ICWA 3BISA 5C6WH 3HI6H 3NCJL 4CGTA 1QFPA 5FHAL 5INCB 2EYTA 3VWJC 3O3DA 4G9DB 3I9GH 1UWGH 2MMXA 2E9BA 2VDML 4LGPB 2D2OA 3RL2B 1I3RA 2NY5H 3B9KD 1FPTH 1UACH 2NW2B 5TF0A 1S7WB 4NQCD 4AY0A 4ZXBB 2P5WA 1WC7B 4Z7WE 1B0RA 5GZOD 1PLGL 1DQQA 3D39D 5CKAA 4F57L 1P1ZB 1JE6A 1Q1JH 3QNXB 4JFFB 4QRPD 3MLXL 3RZCD 2R23B 4PS4L 1S7UA 3TYFA 2VDKL 3H0TB 4MAYB 2BOBA 2NXZB 5DUML 3STBA 3V6ZA 1CIUA 4HIEB 5DQDH 4PLJD 3T2OA 5I18L 4WEBH 4PRAA 4U1LA 3HC4L 4YDKH 1RZ7L 2PCPA 4HKJB 1YEGH 2V2WA 3CDFA 2NY4D 1F00I 3ARBD 3WUZA 3MROB 4C56A 4LGSB 1A5FH 4HUVB 4GKOA 1U8HB 4MDJB 3TH3T 4D8PB 4HQQH 4OM1H 3WFZA 4RISL 3L7EB 4GUPB 3W0WA 3MBEA 4KVNH 1DJSA 1QFWM 1EBPA 2UZIH 4Q6IC 5I8OH 2Y7QB 4X5XB 5L7XL 1FZKB 2YD7A 1WWWX 3WIFA 3X3FH 4UIKH 5E2JA 3VWKD 1F3RB 4UB0H 1FSKB 2BVTA 1UXWA 3L3OA 4GMTL 4LQ1A 4MD4B 1GAFL 1IFHH 3NPZB 4G8GA 2OR9H 3EYVA 1R5VB 5E8PB 3TO4A 1AY1L 2R29L 3C60C 5D7SH 3GSRB 4XCCH 2YWYA 2UWEF 5DFWH 1WLHA 3AGVA 5DJXA 5DWUL 5FGCE 4UNTA 1E4JA 5GRUL 1YNKH 2F8VA 1FNAA 4GOSA 1NLDL 5IG7B 5CD3A 4DZ8A 5IMKA 3QULA 3PHQB 4N0YL 4HIXH 1IAII 5DS8B 4Y5YC 5DA0B 1CFSB 4PJBB 4TNVK 1KEML 6CGTA 4HIIB 2VZVA 3PDGA 4N5ED 2FYYA 4PJFB 3ZZ1A 5D7IB 4YQXH 1BQSA 4K23H 3EJZC 2EDBA 4U1GC 3N1FC 3MV9D 2P7TB 4JLRA 2C4XA 2XI9A 4RBPH 4PBXA 3QAZC 2AJZB 5EC1A 2ZOLA 3LB6C 1CBVH 4ONOA 4MJ2A 2F5AH 3LDBB 3RIFK 4X5WA 3VFSB 2DQJH 3GUTB 4EUPA 4NN6C 4GAGL 1JNHB 2O5ZH 2QBWA 4NQED 2NZ9C 3E3QC 1MHCB 3TIDA 3E6HA 4M1DH 2V5MA 4HKBB 4YR6A 4MA1C 4Y4FB 3BEWB 4NUJB 4HFUH 3G5VA 1FLRH 1U95B 1DZBA 2BHYA 3R1GL 5F96L 4R9HA 2HT2C 5CJOL 4GBXB 1A8JH 3VXPB 5F1IA 2D3VA 5HPOA 1TCRB 2YRPA 5I1KH 3P11L 2FATH 1X9QA 3K1KC 4YFDB 1T03H 1A1MB 4QOKE 1AGFA 4J7RA 5CD5C 1NBVH 3BPCB 1IGIH 3GK8L 4U2ZA 1D5XA 4GXVH 4DN3L 2H2SD 1OSZB 3CUPB 2CR3A 5IB1B 1L9MA 3D39B 1JGEB 4NNPL 5BW7A 1OP9A 4KI5C 1M05B 4RFEB 3RBGA 3RZCB 4A6YA 5J7CC 4Z77B 2VITA 5SWQA 2HFGL 1J1XH 4ELKB 2N7AA 3U46A 5FB8A 4QCIA 2MFNA 2VXQH 2YEZB 4OUUA 4DVBB 4XAKE 1XF3A 2WP3O 3VGGA 4R4FL 3TFKC 1H5BC 4EI5A 4P2QD 2LVEA 3UTSE 1B4JL 3HPJB 1QKZL 2F5BH 4HWEH 3VDCA 4C58B 4LLDB 2YMXH 1BQHB 4NZUL 2NY4B 1U3ZA 4B5EA 5HI3C 5JO5B 1RPQA 1X4XA 5EPMA 4HCRH 3P77A 3WD5L 3IGAA 3FQNA 5I8CA 1A4JB 2WAHA 5IVZB 5E08L 3EW3B 5GRJH 1MRFL 1Z9OA 3OKYA 4TUOB 5FYJL 2E7LA 1UYWL 5T1LD 3GMQA 4GS7C 2WLZA 4XNXH 3S3JA 4LCWE 5ACZA 5T3ZH 4X7FC 2X1WL 3WFCH 1HHGA 5C07A 3QUYA 4HAFA 4JCLA 3VD3A 2VLKE 1JVKA 3GJEA 3TT3L 3VWKB 5J57B 2D9CA 4Z8FL 1QQDA 4K7FB 5EORH 1K85A 3MXWL 3RNKB 5J9PA 4XC3H 2I07A 3EOBB 3V4VL 4G43A 3EO0B 2CKBA 2VKXA 2N1KA 2EH8L 5IMLA 3CFCL 3T8XB 4FS0A 1JWSA 1UJ3B 3PV6B 4QNPF 2H2PC 4CAGA 4D0CB 2Y72A 4KPHH 1WAAA 2XN9B 3BH8A 4AM0B 1NBZA 1ES0B 4IRSC 1D5ZB 1ZKAA 3E8UL 3STZA 4H25A 2X44D 5F93C 3MOAL 5C0RL 4G6ML 3TWCH 1KG0A 3FTGB 2VLJA 1MNUL 4AT6A 2D4FA 4D2NA 3QEHA 4L9LB 4S1QL 4X6DB 1CS6A 3H9HA 4JM2F 4J3VA 5EUOF 3FFCB 5D2LA 5FOBB 4XRCA 4XNMA 2P43B 4WENB 4I8DA 4LHUD 4M00A 2CH8A 1DQLH 3INUL 4XCYA 4NQEB 3GSWB 4G6FB 4HUXA 4NN5B 4EKXA 1T0NA 3FZUD 2R2CA 3FHAA 2VUOA 2I27N 4OTXH 5D7JC 4L3ED 4YWGH 2VH5L 4Z7VA 4OGYH 1LP9F 4PRDB 1KXQE 4OCYL 3QCUL 2ICCA 4KKBC 4HG4J 5I1GL 2BOCB 2W59A 4I9WE 3L3IB 3HE7D 4JPWH 4P48A 4YHML 3NMEA 5KZCB 5TH2A 1JWUA 3FO1A 2P49B 4O2EB 5E56A 2R9HD 3SOBL 5DURD 1DQMH 2Y9RT 3IJSB 1MCEA 3FQWA 1VB9A 1OGAE 1D6EB 3QDJA 3ZDYF 2DBLH 2ZP0T 1AJ7L 5SV4A 3LQMA 2HH0H 1IGTB 1P9MA 1EXUA 1J87A 4QHNB 1FZOB 1CK0H 5K93A 3OB0H 3GI9H 3UX9B 1U93B 3MLPA 3FB6A 1TPXB 1HHHB 4OQTL 2WBJA 3HI6L 4U6HB 3N1QC 2YRZA 4MQSB 2Q1EA 4UTBH 2W1NA 2XG5A 2PKDA 3I9GL 5DMYA 1OLZA 1I1CA 5BO1L 2NY5L 1ZK9A 5FEBA 4XCEA 1FPTL 5TGBA 1B6UA 1UACL 3VMOA 1JGDA 3OAUH 4QHKI 5FOJA 2VZSA 4P2QB 3MRNA 4KK8D 3O6MH 2X4OB 2XY1A 4AQOA 2CIKB 5I1DA 2CRZA 2B39A 2A9NH 3GSNA 2Q8BH 4ZUUB 4OT1H 4E0RB 2HVJB 3EIFA 4YDVB 3ULVD 3RKPA 2VC2L 1KN2H 3LKNB 1IQDB 1F6AB 3ILPB 4WEBL 3PWVA 3AU1B 1HH6A 5T1LB 3TO2B 3X14B 1DTUA 3NCMA 3ZE1E 1IAKA 3UAJC 1YN7A 4PJXE 3SDYH 4ZAKD 3RZWA 5FM4A 5A3IC 1T3FA 5HHPB 2QQNH 1GC1H 4X6BA 3W9DB 1A5FL 2NNAB 5CZKA 3EOYG 2ZUUA 1MEXH 1T5WA 3S4SB 3AAZA 4HQQL 4OZIF 1GCFA 1U6AH 4OM1L 1KACB 3MLUH 4Y4HA 3QIBD 5CBEB 4KVNL 4WWKC 3BEVB 4U1MB 2WQRA 5I8OL 1MHHA 4M48L 2M2DA 4R3SB 3OKNB 2ZNWA 4BSWB 4UB0L 5LKNA 1KUMA 4NQTA 3MJ8B 4JY5L 3Q5TA 1IQWH 1ORSB 3T65A 3EDDA 5HGBA 2OR9L 1NEZA 5FM8A 4GSDH 1RHHA 4XCCL 3G6JB 4D9RD 3OAZH 5F9DC 1TXKA 2QEJA 2FH6A 5DJ8B 2IPUG 1YNKL 3T1FA 1JNNH 4UT6H 2WK2A 1T2XA 1OW0A 1FNEA 3M1BA 2EC9T 4LBEA 1FGNL 1W2KT 5KVDH 1FYTE 3PL6B 3QUXB 4R4ND 4YHKH 2CIIA 2GYSA 3AM8A 2Z93B 1WICA 3SDXE 2WWKT 1DVFA 4APQD 3TO4C 3VFRB 4K23L 5IJVA 1AIFA 4LP5A 1JV5A 2AQ2A 2W38A 2NY6C 3KNBA 2F74A 3MV7D 5CUSH 2BVPA 3GSOA 5EBGA 1AGBA 5GRVL 4L3EB 1CBVL 3RUGB 2F5AL 3HS0B 1JGVH 1HQRB 3BO8B 1ZHNB 2DQJL 1VFAA 3O45B 1NGYA 1OP5K 4WHYG 1D9KC 2O5ZL 1KIUA 4GRLC 5JDSB 3GMPB 3HG1E 4X7SH 4WO4A 4NQDA 1VPOH 3MZTA 1KF9B 1G7MB 5DTFB 5I1LA 4E5XA 2A6KA 5DJDB 1L0XA 2UZYB 3L3KB 4HFUL 5K9QI 1C5DA 5IP4A 1FLRL 5LGHL 1Z3GH 3QFJE 5T1MA 5JXEA 3ZKMC 1RK1B 1K6QL 4WV1B 1JYVA 4LHQB 4L29A 1V3JA 4UDUA 4UDTA 2F54D 4ODUB 4WW2F 1UC6A 2VISB 5I1KL 3KPMB 4Z7OE 3T08A 2FATL 2IFGA 2CK0H 4J4PD 4PJCA 1JYXA 1JHLH 1FNSL 4Y19E 4DN4H 3CX5J 5L0QC 1NBVL 1IGIL 3MV8E 4P2OD 2D7PA 5B4MC 4GMSH 4XP6H 4N8CL 3CSYB 2GJ6A 5H35A 4UV4H 2OK0H 4GXVL 3SPVB 4X6CF 1O7VA 3LRSB 1P7QD 2F9BT 3TCXA 4YBQD 2ESVD 3CH1A 3BXNA 4XB7A 5DC9B 4LCIH 1AR1D 1U8QA 3EDJA 2BCKA 2J4WH 1EFXD 3MLVH 3CSBA 4TNWF 2H32A 4S0SD 1J1XL 3RBSA 3KJ4C 3OQ3B 2VXQL 1FP5A 4RFNB 1YEHH 3WS3B 4EOWH 1YQVH 4MD5A 4F33A 4MHHG 2YBRB 2F5BL 1FNGA 4HWEL 2A6JA 1LK2A 4NYLA 3DRTB 4OZGE 5DK0A 2IBGA 2H3NA 5L2KB 4WUUE 5I8EB 1MRDH 3TC9A 4HCRL 1CTOA 3KXFE 1A7QH 1MY7A 5BW7C 4X6FB 5GRJL 4LSRH 3QCVH 4KROD 1DSFH 4PTUA 4XNXL 1UA6H 5F3HB 5DJYA 1ZT1A 1QBAA 1CFTA 3UJTH 3WFCL 4EI5C 5JTWA 4PTTB 5D6DA 3HZMB 3DETC 2W65B 2FEDD 5EORL 3RPIA 4N9GB 4JRXE 1F90L 4P2RA 3GDBA 3RGVB 5IVXA 5E9DE 1Q9OB 5C0AE 4KJPC 2C1PB 1SBSL 4G8IA 4LLUB 4HJGA 3KLHD 3WO4B 3KPRB 1XAUA 5D6CB 2E7LC 1E4XH 3C5JA 2NY0C 1RIUL 2EDQA 4EQ3A 3ARDA 2I9LA 5GGRB 1JMXA 1T5XA 4KPHL 4WFEE 1EK3A 4LFHD 5ALBH 1PZ5A 2XQBL 2J8UB 5DRWA 4NFBA 2F8XC 3UDWC 4MNGA 2DF3A 3DVGA 2YD4A 1ZT4A 4XXCA 3DUHA 4B7LA 4HV8B 5JLZA 3TWCL 5KSAA 5AZEH 4RAHA 1NGZB 2VAJA 1FFOB 5JIIA 2AJ3B 2JJSA 3GMNB 3SJVD 1OP3H 3CFDB 4JFQA 3JV6A 2EXWD 1CN4A 1V7NH 1M6OB 4H0HB 1DQLL 4P2YA 4KMTH 1M7DB 4MWFA 3TVMB 4UIMB 1HXMA 4YJZL 1ZHLA 3RVVD 3F12A 4NJ9L 4RGOH 1J86A 3QQ4B 4OTXL 5E99H 3QUKB 4OLEA 5TDNB 4MLIA 1U3HA 4YWGL 4P0DA 4OGYL 5DJAA 1NEUA 2I60H 5JIHA 4GAYB 1TMCB 3OF6D 4G7YH 2ZUQB 2GT9A 3GHEL 4JPWL 5GGSY 3OJMB 4JFDA 3MBXH 4FFWC 5CILH 1HWGB 2R1WA 4KKAC 3MRHA 1IC1A 1UM5H 3VGAC 4WTXA 1HZHH 1CFBA 2F15A 3X12A 1CG9B 2F54B 2VLRE 3SGDI 4OZ4B 5IEHB 1X5ZA 2XZZA 1BJ1H 4LKCB 4XZUB 1A21A 4P46D 3Q6FB 2HH0L 3HNTL 3C6LC 2BY2A 4P2OB 3V6OC 1CK0L 4ZUVB 1V05A 2WINA 2P48B 4ORZC 1CD0A 3GI9L 2R15A 2BFVH 2JK5B 4KJQC 2OR7A 2APVA 3IFPB 5K9KB 5H2BB 1RHFA 1TZIA 4LP4A 4XP4L 4Z7UA 3TBYB 4HF5H 5DVOA 5L2JA 2ESVB 3QI9A 4M03A 2BRQA 2DKSA 2BNRA 4UTBL 3VXMB 4XH2A 1C08A 1QO3A 1EFXB 1DQTA 5I6XB 3GMMB 2A74B 1TNNA 3QIWD 5LGKA 1ED3A 2VZ3A 1U2CA 3W5NA 5K33A 2ZCLH 1ONQA 4NO0D 2PR4H 2R2EA 3O6ML 4LCCC 3IB4A 5IGXH 5FO7A 5GGUB 5GGTH 5T3XD 1J8HA 5GJSH 2WBJC 2Q8BL 2A9NL 2VLLB 5DMKB 4OT1L 5DJCA 4OI8A 5EZIH 3NN8B 4GFTB 2AABH 1HI6A 3BN9D 5ICZB 5CINH 1U36A 1CT8A 4V1DE 3QXAB 3ELAT 4HUUA 3ARGA 4N8VG 3QQ9D 1UADC 4KROB 3BZEA 4PJ9B 1K3ZA 2L4OA 3SDYL 4Y16A 1MJ7H 4EI6A 3QISA 2J7LA 5DUBA 3VA6A 3F8UB 3RWHA 5ESAB 4JG1L 1JK8B 2B7DT 4S2SA 5C9JA 4HH9A 1GH7A 1U6AL 1DFBL 3MLUL 5MP6H 3WSQH 1R3JB 2CPCA 3H8NA 5HVFB 2EIDA 2YRLA 1T21A 2Z31A 3FO9B 4OZFG 4K9EC 4Z0XB 4K3EH 4O51A 5D96B 4K8RD 3UTTE 5B8CA 3P9MA 4ZFOA 3MLZH 4WU5B 4OCSH 1IQWL 4U1KB 1KPVB 2X05A 4NP4H 5IHZB 2A83A 4GSDL 4CN1A 4ZUWB 1N6VA 5HJ3B 3FN0H 2CMRH 3KYAA 4GW4A 2IMNA 2Q20A 1B90A 2FO4B 3EJYC 5D9SA 3VMPA 1RUAH 5CEZD 3JWDC 1JNNL 4UT6L 1EO7A 2UZXB 1OTSD 4ETYA 2IALA 4L8BB 3REVB 4O4YH 2NYYC 1DP0A 3SJVB 3U4BL 1WIOA 1LNUA 1X5HA 3MV01 1HCVA 1Q94A 3G08B 4HK0A 3OZ9L 1L0QA 5DD5L 3ULUD 1GJIA 1QSFE 4PJHE 1A6VH 3S37X 4PREB 1N8ZA 2R0LH 1EAJA 2BVYA 4R7DB 5CUSL 1F3DJ 5JR1H 1FG9C 1YMHA 4J3WA 5ISZE 3QP3A 3RNQB 1WBXA 5MENB 4M6MH 1OW0C 3RVTD 2RFXA 5ADOH 1JNJA 4FQQB 4KI5F 1JGVL 2Y6SD 1KB5A 4G9FB 2E9IA 5C6TH 2KQMA 2X4QA 5I1CL 3IDYC 4K2UH 1F6FB 4PB9H 5B39G 3HZKA 3LKSA 1MCIA 3V4PH 3QNXA 4JFFA 3AM8C 4Q7DA 1CGSL 4JZJA 5GJTH 4X7SL 4ZOEA 1VPOL 5IVOA 2X4TB 1ZLUH 3MLWH 4ZOCA 2UWEB 5J11C 5T5NF 3HMWH 5T3ZD 1LEIB 1CL7L 1Q9WB 4ODXB 2NTFA 1Z3GL 1RK0B 4P46B 2JB5H 1UEYA 3R0MA 3KHOA 4YH6A 4JFHD 4NGHL 3PQYD 4LCWA 5LCVL 3RWCB 4RMQA 5DRZA 4CNIA 4D8PA 1QA9A 2QHLA 3ZE2F 1NDGA 4GUPA 5IB3B 3VI3E 2CK0L 1JHLL 4NZTH 4XC1H 2Y7QA 1AKJD 3VFGH 2C3XA 2UY6A 4HX1B 2VE6B 4YHYC 4QXTB 2WWMC 4R8WH 4J3UA 4GMSL 3SDDD 1UXSA 4UV4L 4MD4A 5JXEC 2O61B 3F58H 3QIWB 1C16B 4PR5B 2VLMD 4HJ0C 2WUBH 1CDIA 3GSRA 5E4IA 1LEKA 1VGEH 5GRXG 4LCIL 2EDKA 2DOCA 5GS1B 4DKAA 2J4WL 5D7LA 5KAQF 5D1ZD 2GEEA 3MLVL 3EOAB 5IG7A 8FABB 1VSCA 2APWA 3PHQA 4EOWL 3DGGA 4I18B 3BP6B 3ZMRA 1CFSA 2D0HA 2DQHL 3GIVA 1LGVA 1Q9KB 5F7FA 3RWIA 3ME0A 2ITDA 4Y1AD 1FGVH 1NFKA 3O0RH 1MRDL 4KZDH 3GSUA 2NY2C 4ZO8A 3OXSB 2P8PB 1BJMA 1CVSC 4Y8AA 3PHSA 4PBWD 2AJZA 3GRWH 4LSRL 3QCVL 4WDIB 1PEZA 1DSFL 1UA6L 1X7QB 2FJFB 3DVNA 5J8OA 3UJTL 4BH8A 4ZPVB 5DT1H 4BKLB 5C0GA 3CFKB 1N6UA 1QR1B 4MSWB 4KTEL 3GKWL 1A6ZB 3KPSB 5HHMD 1U8LB 5DQ9B 4JGUA 4X98B 1YY9D 4Y4FA 3BEWA 4IMLA 4CADA 1U95A 4EJ1C 4UV7L 2HTKC 2NX5B 3M8OH 4KGLA 3UXFA 5FDWA 4KRMB 4HULB 4F8TA 1YJDC 4ZPTB 3H9SB 4XP5H 1JN6B 1HILB 3TZVD 3VXPA 1RULH 2EDHA 4CVWA 1UGNA 1UKTA 1T89A 2PW1A 5D6DC 5ALBL 3G5YA 4U1IB 4M61A 1KCKA 4DKDC 1A1MA 4TUJB 4ODSH 1IKFL 2FIKB 4JFYB 5BXFB 5IBUG 3B8SA 2OI9C 2B4CH 3L5XH 1HEZA 5AZEL 2WSKA 5F6HI 1IM3B 1R5IB 1VEOA 4HC1H 3T1WA 4HIJB 2YD5A 3K7UA 4LU5L 1LO4L 3FT3B 2MJWA 3ARDC 5BS0E 1AE6L 1V7NL 2CLZA 2Y5EA 4NC0B 4RMUA 4KMTL 4FA8A 2ICES 1JF5A 1M05A 2HAZA 3NACH 4FOMA 4ONFH 3BDYL 2PYEE 4ELKA 4RGOL 4XXCC 5E99L 2V2TB 4P5TB 4JO4L 5C0ND 2WUCH 4NC1C 5KSAC 3T0WA 1I7TB 2DIAA 2I60L 2ID5A 3LD8C 1IM9A 2DQFA 4G7YL 4MS8C 2JJSC 3MRLA 1BQHA 5MEOB 4HDIA 3MBXL 1YUHA 3DJ9A 1S5HB 1UM5L 5F89B 5T5FH 1I9RH 3WLBA 1HZHL 1AO7E 5EZLB 1S9VA 2P42B 1A4JA 5IVZA 1EEYB 2GFBA 2V17H 5FV1L 4XPFH 4H20L 1EJOL 4YHIB 4U7SA 4ZUSA 4Y7MA 2PW2A 3LV3B 4JPIA 1K9TA 1QLFB 3LKQA 1T1ZB 5GGQH 3O2WH 1NFDE 4JM2B 1ZA3B 4FMKA 1QG3A 5EUOB 4BA8A 3RWGB 3NIGE 5L8LB 5EU6E 2BFVL 3RNKA 4YX2H 1AGCB 4RAUB 3VFNA 1RI8A 2AK4D 1JYWA 3EO0A 4ZS6C 1FC1A 4RQQB 4HF5L 3ZTJH 4RFOH 5GS2H 1XF1A 1F3DH 1J7VR 3WL9B 4TRPL 5JA8B 2AEQH 1BGXH 1UJ3A 3HC3L 5I30H 1U8KA 3GMLA 1ZAGA 4ZDHB 4KZEH 2W0LA 2DYPA 4W70A 1LP9B 3KYOA 3REWA 3LSOB 5LVEA 3EFFB 1R3IH 3OKEB 5CGYD 4Y4KD 2ZCLL 2XN9A 3SO3B 4OGAC 1SM3H 1AHWA 1MIEL 3H6JA 4QRRA 1D5ZA 2CSPA 2YPKA 1I3UA 4NWUH 5FO9B 5IGXL 2K7QA 5SX5K 3RX8A 1IEHA 5GGTL 1FBIH 5GJSL 4ZFFA 1NDMB 4Y1AB 4J3OC 3O9WA 3FTGA 5E5RB 5EZIL 1UZ8A 2HRLA 4TOYH 2AABL 4H1LG 4L4VE 1NC2D 1YNTA 2CXKA 4P9HH 1S9WB 3FFCA 1R3KA 3KLSA 2MQCA 3O3AB 1R3LB 3Q6GH 2V5SA 3LEXA 2BSRB 3I6LE 1MCJA 4PYHA 5EO0B 4FN0A 4PRPE 1OY3B 3QG6B 3QQNA 2Z91B 1YY8B 5EBLB 4H5SB 4ZSOB 3WSQL 2R1YA 4PRDA 4QHMB 2Y06H 3WNMA 2IJ0C 1KJ2H 1L7IH 3CFJB 1RUQH 1PAMA 1SVCP 3L3IA 4RAVA 5HY9B 3U4EA 1DDHA 1N59B 5JHLH 3WN5B 5I17B 4U7KA 3ARGC 5KAQG 5BZDA 1OCWH 1X3DA 4K3EL 4ZUTB 3BPNC 3MLZL 4U05A 3ARFA 4OCSL 3LQAH 5KW9L 3SE4C 1MH5A 4NP4L 5CIPA 1X5IA 4NRXA 4FTVD 3FN0L 3MOBH 4ONHB 2F19H 2A9MH 1A02N 5MEPB 5B38A 1CTNA 4ODHH 5IQ9B 3O3EB 1PZUB 4POZC 1BD2E 3GSQA 4QHNA 1FZOA 1NAMB 1U0QA 2O5YH 2Z31C 3QDHA 1T2QH 4DOHE 1CDYA 5D1QD 5KTEH 2IEPA 1U93A 4O4YL 4F37F 3NGBC 5B8CC 3DUUA 3NFNB 4FQHB 4U6HA 2VB5A 5IF0A 1W0VB 1T0PB 4PRNA 1A6VL 5I74C 5TQ0H 4IMKC 5A2LH 1HOCA 4OZIB 2DQIH 1ODAA 5KSBF 3VFTB 1OTTC 1KV3A 4MJ6B 4M6ML 1IE5A 3VH8A 5ADOL 3CZJA 5ID1B 5C6TL 4IOFD 5JW4M 4YZFE 4K2UL 4PB9L 3RGHA 3MRDB 3U30B 4YHLL 5F70A 5F9OH 3V4PL 5GJTL 1BVZA 3KGRA 4DQOH 3WLWC 2IQAA 5CEXA 3NBNA 4RGNE 1YC7A 3RPKA 3MLWL 2Y5TA 1F6AA 3HC0B 3BYYA 3HMWL 3PIQB 3MNZB 5KJRH 2XTJD 1MCWM 3DMMD 2DI8A 1KJVA 1I8MA 1ZGLP 1BHGA 2JB5L 1G9NH 3BWUC 2HG5B 5HHPA 3QWRD 4EN3A 5F72S 4WIQA 4Y2DD 1FZJB 2QADC 2V6HA 3EBAA 5T1KD 3S4SA 3E0GA