5E7OB

Crystal structure of the perchlorate reductase pcrab mutant w461e of pcra from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
source organism Dechlorosoma suillum (strain atcc baa-33 / dsm 13638 / ps)
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e7oB00
1FXDA 1C4AA 3MMAA 2VPYB 4CI0B 1K0TA 2VKRA 4Y28C 2IVFB 2FJBB 2C3YA 2WSCC 1PC4A 1Q16B 2XSJA 3MM7A 3OR1B 4XK8C 1SJ1A 4RKUC 3C8YA 3LW5C 4L6V3 5BYQA 1BC6A 2FJEB 2V2KA 5CH7B 1GT8A 2C3MA 1FDAA 2FGOA 3MM7B 3MMAB 1FRHA 6FDRA 2V4JA 3IR6B 1B0PA 1FRKA 1JB0C 1FRJA 3MM5B 1XERA 4DHVA 1BLUA 1G3OA 5FD1A 1FTCA 1R27B 1F2GA 4AYBD 5L8RC 1KQGB 7FDRA 2PDAA 1GTEA 1FDNA 1BD6A 3MMCA 5CHCB 1F5BA 1WTFA 3MM6A 3MMBA 1FRIA 1ROFA 2PMZD 1IQZA 2VPZB 5BYRA 2Z8QA 2C3PA 1FRXA 1GTHA 7FD1A 2WSEC 4XDCA 2WSFC 1FDBA 1B0VA 1D3WA 1FRLA 1B0TA 1FERA 1H98A 1FF2A 2C3UA 1HFEL 3MM9B 4KT0C 1FDDA 3OR2B 3MM8B 1IR0A 1AXQA 1H0HB 2VPWB 3EXYA 6FD1A 3OR2A 1A6LA 1Y4ZB 2GMJA 1GAOA 1KEKA 1DURA 1Y5LB 1DFDA 3IR7B 1KQFB 2FJAB 1F5CA 3MM6B 3EGWB 2WAQD 1SIZA 1RGVA 5BYSA 3IR5B 1CLFA 2FJDB 2PA8D 1JNRB 3EUNA 5E7OB 2ZVSA 1VJWA 3MM8A 1Y5NB 1C4CA 3MM9A 1FXRA 2V4JB 1BQXA 1H7WA 4OMFG 3HKZD 4OV1A 2C3OA 1BWEA 1FEHA 2FDNA 1DAXA 2Y0SD 2VPXB 1Y5IB 3GYXB 2WB1D 1SIWB 1H7XA 1FCAA 4YDDB 3MMBB 4ID8A 2C42A 2O01C 3OR1A 1G6BA 2GMHA 3MMCB 1PC5A 1FRMA 1JNZB 3PNIA 2UZAA 4XDDA 2FD2A 3MM5A 1FD2A 2XSJB
chains in the Genus database with same CATH superfamily
4GVLA 2L9NA 2IJNA 4NRUA 1S10A 4LFBJ 2VKRA 3NGTA 4ZPTR 3SXLA 3OL7A 3BF4A 3PM9A 3R5JB 1NZAA 3EZ5A 3IFEA 3DGPB 4DLGA 4X65J 2MGZB 4NPOA 3OJSA 3AA8A 3ZTSA 1LFWA 3M9OB 4ZJQA 4XK8C 1VQ6S 1RTZA 2KT2A 2W2MP 3R5BA 4R8UA 1S1WB 2E5GA 1SJFA 1OQ3A 1IXKA 4Z7CA 5GADU 2RKIB 2FZKB 3T41A 4JYAJ 4ECXA 1FWPA 3CDAA 3HHDA 3BSOA 4BDPA 3GR1A 4NXNJ 3OV7A 1WC4A 3VAFA 2VG5A 3PY8A 2FGOA 3GYGA 1XMQJ 1X0PA 1KFDA 5J2NA 3KG0A 3PW5A 1IKVB 2DH9A 1MMNA 4USWA 4M94A 4TQRA 2W4DA 2MKHA 1B3TA 1HD1A 1SH3A 2MLYA 1NO8A 3L3CA 3KHRA 4LF4J 1DJ0A 2J9DA 2VB6A 3T19A 1HQ2A 5G0RB 3GONA 3KJFB 2HQ3A 1U0HB 4LIWA 4CT9A 1WEYA 2HS3A 4DPTA 4DX7A 4IKAA 1K1SA 2MQ8A 4WFYA 3GIJA 4DL5A 5C2GA 4DN9A 2XB2D 2DYAA 1ROFA 2IDEA 2QYGA 2XMJA 2RF2B 4EBDA 1S1UB 1K0VA 4YUDA 3MAAA 3G2XA 3UQSA 5KFXA 2C3PA 5KT3A 1Y7PA 2ZOGA 3UD3P 5U47A 2ERRA 2M52A 1WF1A 2B5JB 2P2CB 3HDSA 3I6PA 3TZYA 2OLWA 2W7AA 3M6WA 4HT7A 1YGYA 2ZVIA 3GWCA 4RNHA 2W25A 2VC0A 2I8EA 5ETNA 4FS1A 4DR1J 1H0HB 2BM0A 2YX7A 1MMLA 3RGIA 3EPIA 2XMTA 3V6DB 3CO0P 3PRBA 4KGKA 3VGUA 2ZHBA 4DUYF 4KH1B 2Y9HA 1Y4ZB 2GMJA 2HGLA 4YMEA 4FNHA 2R4FA 4DPWA 3SSQA 1DFDA 1EJ7L 2FJAB 1UVIA 2OPRB 1B99A 2AZ3A 1NSPA 1XR5A 1GNKA 1YLXA 2LDIA 2YNFB 5AXMA 5EDWA 1Q8LA 2R7QA 2GVZA 5A8KB 4YFUA 3T5LA 3G9CA 4OZ0A 1AB8A 3LALA 1CLFA 1ZPWX 1RAFB 3HF5A 3CJQA 1RA6A 3TA1A 2DGXA 4WXOA 2WRMA 3I55S 4A8KA 1Z4UA 3WZ0A 3IBCB 1S6QA 2W7PA 4DV4J 4O4GB 2BKOA 2ZOFA 4URSA 3QATA 5HMXA 3K59A 3IGNA 4W98A 1HNIB 4C11B 4DV0J 2HHHF 2HVHA 4C2MA 4QR1A 1LEOA 3NOGA 3BSCA 2PN6A 1UKUA 5BJRA 4DZDA 5KT6A 3PX6A 3D1HA 3DYAB 3SQOP 2FLPA 2R7SA 4R0JA 1PJ6A 3I56S 4KHPF 1VBKA 2RILA 5IC4B 4UZCA 3GSIA 4DJBA 3UW1A 2HPUA 4ECTA 1D9DA 4IRCA 2HS4A 2MJUA 4IFVB 2YNGA 4RWXA 3KHHA 2AQ4A 4WF9Q 1N5TA 1FX2A 3PHTA 4ZP9A 2WONB 4TU7A 4N76A 4AXJA 4USKA 4C6AA 4TQSA 3G4SS 1TP7A 2R2SA 4OV6A 4BWJA 5HMWA 3UE2A 4Y34A 3DOKA 1FD2A 2FHJD 1XMBA 2YH1A 4EFAC 3PVXA 3BKUA 5G0RA 1U47A 1VQNS 2KRBA 4J9RA 1FX4A 2ZUAA 4D3GA 4LMZA 1S1TA 2DXFA 2GJFA 2FPHX 4I1TA 2DY9A 1CJVB 4NXNF 1HI1A 4KRWA 1XJWB 2U2FA 1HMVB 2M9KA 2RSQA 4NX9A 1VBXA 3Q2SC 5BYQA 2VA3A 1NPPA 2CQ1A 4TVAB 4RW4A 2YXLA 1VQSA 1BUXA 1SI9A 4PXBA 4O3RA 2Y1IA 5HN0A 3ISZA 1F2HA 3IP0A 1Q5YA 2ALYB 2OKQA 4KKOB 4B3RJ 2OD6A 1FJ7A 2ZH2A 1W7WA 4DR6J 2MHNA 3R6LB 2QZ8A 2EFNA 1HHQA 2FLLA 2EEYA 1QE1B 3ELHA 3QFHA 3UVJA 4P7TA 1HR0J 3KK1A 7FDRA 2IBOA 1R43A 4CNYA 2VBXA 1KP6A 2JEFA 4Q2MA 1GTEA 2QRRA 3LP1A 4NEZA 1ZA2B 5CAAA 3Q8QB 4LFAF 2G0JA 2HHXA 5G4DA 2ZHAA 4YOEA 3HPOA 3B8HA 3MTJA 1X4EA 4PQAA 2PMZD 3R7NB 3O1LA 4F67A 3CCES 2DKOB 1B7FA 2EFQA 1TKZB 2DH7A 5GVQA 1NNDA 3ADAC 4PUOA 4I2PB 1HI8A 2L9WA 2Z8QA 1N5VA 4PXCA 2AIRB 3S7RA 3TVYA 2N3OA 4UT4A 2YKQA 1SUQB 2W4PA 4QYZK 4ZCMA 1Y10A 2WSFC 5AXLA 4DUYJ 2QLWA 3NL0A 4PQUA 1UZDA 1FRLA 5HMYA 3QNWB 2EC0A 4JV1A 3TJAA 1WG5A 1OY6A 3E51A 3RW6A 1HFEL 2MSTA 4KV8B 4Q0BA 5D0RA 2PE8A 3DLKA 4DR4F 3MM8B 1IR0A 4I0WA 2D74B 3QIPA 1W2IA 4OI2A 1DQAA 3VVUA 3OJUA 4WFNQ 4LSNB 4HHHA 3V6DA 2JLGA 3K5PA 4RBUA 4M8LA 5KT7A 1ZTTA 1Z1ZA 2RB7A 3ET6A 2UUWA 3GFXA 1WG4A 6AT1B 3ULHA 3H5XA 1ZS6A 4LRCA 3ZTPA 4ATNA 4PPZA 1EETA 1F5CA 3CJ4A 3NWGA 3M8QB 2ZC4A 4EK2A 2XS7A 2BE2A 3DM2B 3NXZA 1RKIA 3G86A 5HO4A 3IR5B 2UUBJ 2DHSA 5L38A 5DQHA 4K2JA 1S6PB 2FYXA 4MTPA 1OJ4A 1WUUA 1XMOJ 3W9JA 1N8RT 1QAJA 1ZH5A 3TQ1A 1TZ0A 1VJWA 3MM8A 2R7TA 3GMGA 4WP9A 1RT5B 5GAHU 4X65F 1BQMB 3PJWA 2ZH3A 3CF5Q 1V5IB 2IMWP 1HI0P 1HW8A 4JB8B 3T9ZA 3K5MA 2XY6A 4NE9C 4E8UA 1BY9A 4CDIA 3CVKA 2DH8A 4Q45A 1EP4A 2MQNA 3TJ8A 2E9ZA 3KLEB 4KAIA 2FZGB 4M5GA 4CRJA 3KMSA 3G8TA 2Z58B 4GMKA 2WVCA 5KG4A 2G9OA 3VGTA 1CSJA 1T9TA 1YKWA 4NYPA 2CQ3A 4U96A 1KRPA 2V8HA 4ID8A 4RW7B 3NGSA 1YX2A 2VG5B 3BQ2A 3O3LA 4UF4A 4F0KA 4P2MA 4DOZA 2UVVA 1EHWA 3AH6A 1DHMA 5HBMB 1V3RA 1GXUA 5C5JA 2I5JA 4NLDA 4ED0A 3UI3A 4DEZA 2XYHB 2VFSA 5AE1A 3UVJB 2XCPA 4HLBA 3PYGA 1UTAA 4LF4F 4ANCA 5J2QA 1VLOA 2ACMA 3H7HB 3FMBA 2B4VA 3KLIB 5FDLB 4WKYA 1WJ9A 2RRBA 3IBWA 2V94A 5B0BA 2CJQA 3NS7B 2QA4G 2N4CA 4C98A 1M5KC 3IS9A 5HAOA 2L08A 1FNOA 1VS3A 4LREA 2CJXB 1WHVA 3FGVA 2UV8G 1Q1KA 5F8MA 1PIEA 2H65B 5KFAA 2UXDF 4ZVGA 1ZA1B 3CWJA 4LJMA 3D66A 4UZBA 2RS8A 3IAS9 2D1CA 2EPIA 5A8WB 3GV8B 1AW0A 1VCTA 3R1LA 3M2UA 4NOHA 1ULRA 3KLFB 4ECQA 1P8GA 3D6HB 3TUZC 4ZPBA 2HHSA 2AV5A 2FJEB 3S8SA 1ZETA 3DGVA 1VDHA 2VIHA 1L3TA 3NKYA 3DN9A 1HPZA 4GVBA 1WC0A 3CJ2A 4DV1J 4GKJJ 4A8QA 4DSKA 2FHOB 2CNNB 2J0XA 4LSLB 3ZZUA 1MU2A 3MMAB 3NAIA 4C4WA 3PX4A 1RAOA 3MR7A 3R5DA 1O5JA 3A13A 1P9QC 1HWLA 3BR8A 3J81Y 1F5AA 3MFHA 1FJGJ 5EN1A 3OXGA 3KTQA 3CCLS 1Y0HA 2CWKA 4MIWA 2RVJA 2JEJA 4OX6A 3BGRA 4B3SF 1BQNB 2EW9A 3FCHA 4CO1A 4CO4A 1VR6A 2WBRA 3D1OA 3N4WA 1PG5B 5BR8J 3WQPA 2XNRA 2EK1A 3ILJA 5D4PA 3AY0A 4FYVB 4ELUA 3D3CJ 2HGNA 3NBPB 4OZJA 4PZVA 3OLBA 2YH0A 3A8IA 1TAQA 4DR4J 4WIQA 1JKHB 1PO6A 2A2CA 2H3EB 2KRRA 3RUBL 2D3UA 1F9EB 3W61A 4X2BA 1OSCA 3F41A 5HI7A 3RRHA 5I42A 1FDBA 3P5TL 3DNCA 3ZTRA 2ZNYA 3WC0A 4CO5A 4C9DA 3OQ2A 1HIYA 2CPZA 2C3UA 3N79A 5CYQA 4CO3A 1CJUB 2EG2A 5CYMA 4AE5A 3NCRA 2GJIA 1XIQA 3BKFA 3R97A 2MY7A 5D15A 5IQQA 3Q86A 3WBZA 2CPYA 1JWWA 3DRPA 3UPFA 4KC5A 3NWRA 4ECYA 2AZ1A 4ZIVA 2I6WA 4DX5A 4PRFA 4FZVA 5L9XA 5CXTA 2JZ5A 4H4OB 3I31A 3KYLA 5LXRA 3RBDA 1U1OA 1DTQA 1UA1A 3MM6B 1NXIA 4NRTA 1N33J 3PW2A 4WE1B 1IJEB 4DN0A 1TKTB 1NK9A 1QM9A 3KDOA 2PI4A 2WTFA 4I68A 3Q83A 1RE1B 3KK1B 1K1QA 3WIVA 2EWHA 4P2XA 4OJGA 2JX2A 1H72C 4P74A 1U0SA 1CS4B 3D1QA 1EB0A 2ZE2B 4TU9A 3ITHA 1SKWA 2ZD1A 4KSEB 1FJCA 2Y0BB 3ZXWA 3PZPA 2E1MC 3FRZA 2CQ2A 2YNHB 3GYNA 1B7YB 2B5JA 3LAKA 1YJ7A 1FEHA 4OI1A 2Y0SD 5IM0A 1IKYA 4BWMA 2YWKA 3B54A 4PEOA 2EG1A 3HZGA 3P8BB 4KQZA 1IBCB 4WTOB 4ED6A 4DS5A 4KE5A 2IYGA 3KK3A 1YJ9S 2V4QA 1I1GA 1GH8A 3MEEA 2NCKL 4DFKA 1M1GA 3MECA 4P6QA 3MPWA 5KTQA 3DLGB 1I3OB 4OYOA 3IRXA 1VOMA 4EYHB 1APSA 2CPFA 1NJZA 3PFOA 2ZH9A 4LF1A 1RKJA 3K0JA 2BKPA 2EXUA 1NEEA 3OTCA 1ITPA 1KLMA 2FVQA 2KB2A 4A8WA 3OTEA 2AW0A 2ZBRA 2R8IA 4JV0A 4CM2A 3TQEA 4ENOA 1YI2S 2CPEA 2BE7D 1U8SA 2CJBA 2R7UA 1EKSA 4N5SA 3IMQJ 1QUPA 4HR2A 2C2KB 3D0HE 5K14B 4DUZJ 1RLDA 4LF2A 4RNMA 2XLJA 4K4UA 3AJDA 1PKUA 3ENWA 2AX0A 5GAEU 2ROPA 2MKYA 2R7VA 4UOHA 4PKDB 3CMAS 2HFSA 1WC6A 1UEVA 4DCJB 1QVFR 1FE4A 1CQMA 2OSRA 2ZDOA 3AB4B 5HSPA 5HMZA 3DU5A 3KLHA 1PC4A 2R42A 3AD9C 4FBTA 4V19J 3K17A 2F4VJ 2VASA 2BV3A 4QWBA 1NMEB 3OL8A 5KFNA 2EBEA 2OEMA 3FVYA 3LW5C 3T1HJ 2J0WA 3BPSP 4C8LA 1X5PA 2QA2A 4L6V3 3V4MA 4WCEQ 1SJ4P 1IBMJ 1HNWF 3DYAA 4FYYB 4B9VA 3ENVA 1T9VA 3TAQA 4GKKF 1REVB 4Y2AA 2ZITA 1TKDA 2F7VA 1NUEA 5T7LA 5LXYA 3TZZA 5H1SV 1VHFA 1LWFA 4B3SJ 4U6PA 2UVRA 3VCDA 4RUCA 4BS2A 1RHMB 1S5ZA 3RZAA 3VWSA 3GJTB 4TY8A 4K8RA 1N6QB 4F04B 4EEYA 4HTJA 4EO6A 3CCSS 2BACA 1KQGB 2H51B 2W2QP 4DWIA 1Q4RA 5DDPC 1X5OA 3UNGC 3ZTOA 4WK3A 3TVKA 4X84A 5C42A 3L7UA 1LWXA 4IDKA 3QT5A 3KLVA 3ETOA 4PAAA 5AE2A 1U1KA 1DY3A 4LF7F 1U2FA 1RAEB 1UW4A 5IC6B 4XPCA 4K4ZA 1F6TA 1HARA 4GC7A 1RU1A 1YTYA 1LKZA 4RPFA 1RT4A 2MSSA 4C7QA 8RUCA 1YJNS 3N6NA 2HHQA 4F3MA 2B4OA 1RWPB 4OZ5A 1UP1A 2UUCJ 2YNHA 4CLKA 3UD5A 1PBUA 2M8DB 8ATCB 5KT4A 3JQMA 4G65A 4YB7A 5KFYA 3F44A 4ZS6A 3DLEB 1VQ8S 5A8RA 1AXQA 4KFBB 3CD6S 1GEHA 4X4PA 3THTA 4J90A 3S6EA 4R5PA 4ZJOA 1ZBTA 2DHXA 2ROEA 4NCGA 3LP0A 1TK8A 3MAAB 2OD4A 2LLZA 2QYCA 3ITHB 1GAOA 2Q1LA 4J9KA 4DSFA 2BQRA 1GQEA 1CS4A 2DK2A 2LA6A 3MCNA 2KN4A 2V69A 1ZAXA 3ZZTA 4LFCF 4USTA 3TUIC 3HM9A 4QCLA 4Q8FA 2RHQB 4JI8J 1U0HA 3OXLA 4KGMA 4BCAA 5I3UB 2HSEB 1NSQA 1O51A 2HG4A 2PA8D 3I5CA 3I96A 4WTYA 4YB6A 2YVSA 1S1XB 5E7OB 2JVOA 4O3NA 5KG5A 3JSYA 1CVJA 4RU2A 1VIOA 2CZVC 2MYFA 1RT2B 5CQGA 4QIGA 5KFPA 5I3PA 2LYVA 2LQJA 1PJ7A 5D8HB 4UOCA 5IWAJ 3HKZD 1QY7A 4C8ZA 2WZ1A 5A76A 2RUGA 1REVA 1DAXA 1YRXA 3LP2B 4LT6A 2ADBA 2W01A 1IM4A 3H2VE 2VKZG 5DDOC 1E6VA 5KFLA 4MKAA 4AUKA 4ELTA 5DLGA 1V9OA 1JK9B 3NAHA 4EZ6A 2EK6A 2C28A 1RT3B 1Q95G 2XMAA 4JI2J 2CA9A 1PC5A 1MG7A 2VOPA 1Y3JA 3OTOJ 1YJRA 3PNIA 1Q5VA 3UFCX 2D3OR 3R2DJ 1RUSA 2M88A 3FEZA 1JLGA 1JLFB 3G6YA 3NMAA 4EZ9A 3CJTA 1MROB 4NASA 3FBFA 1R89A 2KFYA 3LAMA 2KXNB 2E9TA 3LGHA 1MN9A 2HVEA 3MTKA 4FKXA 4NLTA 3TJ9A 1JMTA 1N36F 1FE0A 2IHR1 3QIDA 4NLRA 4U67Q 1VQ4S 2HYIB 1WELA 3KG1A 4L3KA 1TL7B 3MM7A 3QYYA 2VF3A 3HJVA 1BE4A 3S1TA 3SMZA 1VFJA 4ECSA 4JI6J 2XLKA 2YKAA 2VBZA 2HQFA 3H2LA 1T9WA 4NA2A 3AHPA 3KK3B 1RWWB 1S9EA 2V2KA 3FSIA 4OHXA 2ABYA 3H59A 4JI0F 4CLWA 1RZMA 1U24A 2W9BA 2AGPA 5IM0B 2BJ9A 3M2UB 3PR4A 2YPZA 3DLGA 4F8RA 1ZOTA 1X9WA 2AT1B 1UA0A 5AT1B 4QWEA 5LOQA 3TZWA 2IM3A 2HFZA 3MZIA 5FDLA 4QZVB 3OPKA 1CC7A 2GJ2A 2DNMA 3FEXB 1FRJA 1K44A 1IKYB 3PEJA 4QW9A 4IH6A 1RT7A 1CBKA 3IGVA 2RE1A 3TVZA 3M1VA 1ZM3A 4WZMA 3J7Z5 1X4FA 1VYAA 1XK8A 1VK8A 1MSWD 2HWTA 2RDJA 3WX8A 4DR3J 3L09A 4CTAB 2WVDA 4HKQA 5KFBA 4K4SA 1TAUA 2R7XA 2WVFA 2V8GA 3LOUA 4WK1A 2AHOB 2X3GA 4ZVPB 2NXEA 5BYRA 1QLNA 3DXBA 3BQ1A 4DFJA 3DRPB 3HVTA 3ONQA 3K5NA 1FRXA 2CQIA 3VHQA 1IBKJ 5KT5A 4XDCA 1SL1A 1M0SA 1S7HA 2O5DA 1DTQB 2QG9B 2BANA 2NZ4A 2QN6B 2KDOA 2DNPA 2ADCA 2WOMA 1JLCA 2F63A 4F0MA 3QGGA 1WI6A 4WWSA 4BC9A 3EDRB 5KFIA 4M63A 3BSNA 3C46A 1E6YA 2GQQA 4O3OA 2B4UA 3HFVA 5J2MA 1FESA 1T3NA 1DARA 3D6MB 5CYMB 1WDDA 4JI8F 4O3PA 4M95A 4DV6J 3R3TA 2GC8A 3FCWA 3JYTA 1DLOA 2N4DA 1EIYB 1Y5LB 2OTLS 4DXLA 2VFRA 4FN5A 4Z37A 1S6OA 2UV8A 1VC5A 4NYOA 2YQ1A 1FO1A 1WHYA 2C2OB 3Q2TC 2QL5B 4B3RF 3QGIA 2UUTA 3DDKA 1LXJA 2HQCA 3GE9A 1R8BA 2P6TA 3QIPB 4FVMA 4HHUA 4M5KA 1U1NA 3PJXA 5HROA 3GU0A 1HWUA 3PACA 4HH0A 1RJJA 4B3TJ 1MN7A 1X4HA 2OPSA 2FTRA 1SUQA 3FFIB 2DNNA 4QOTA 1S4EA 2GMLA 2NYIA 1KLNA 1C1CA 1GMWA 3I0RB 2HVIA 3BR9A 3I82A 4CO2A 2XCAA 4RNNA 1T9UA 4I64A 4CLYA 2C42A 5ETKA 2DO0A 4ZVUB 2Z57B 3UNYA 1NRKA 2E1CA 4FF3A 3I4HX 5AE3A 4EWTA 4X62J 2HFOA 2AYBA 3D0IE 2D9PA 3DHXA 3DRRB 1OSDA 2KYXA 4LR9A 4C0OC 5KG6A 4DL2A 4X64J 4OYPA 1K47A 2K06A 4IYQA 4WPAA 2GVDB 2B9YA 3U7JA 2PGCA 3DOMB 3HHNB 1RT6B 3KLIA 3HJFA 1WTBA 4K4TA 2B3TB 1RI7A 1S0NA 1NBEB 2C1EB 2FJBB 4IQMA 4Y2CA 2ZZNA 5KG0A 4KB7A 1BWEA 1NCLA 3FDSA 3TA0A 3H25A 4IUFA 2E5IA 2BJDA 3DOMA 2ALZA 2LEBA 2DGVA 1R8AA 3D9BA 1S57A 3HI9A 5F8NA 2D9OA 1DQ9A 2D41A 4WP3A 3VQTA 1S7IA 3TAMB 3TW0A 4RW4B 3NS5A 4UW2A 5FLXY 4ZVSB 3CC4S 4OYWA 1H3DA 3CD7A 2R7WA 2GW8A 1MWZA 4ICLA 2W2PP 3CCQS 2B0GA 4M5MA 2HRYA 3GIMA 2YX1A 4OHZA 5E5NA 1FA0A 1T8EA 2XQCA 3TANA 5IT9Y 5J1EA 5MLCV 3K57A 3MCMA 5DM7Q 3EM1A 2QLXA 2HHHJ 2AU0A 4Z2XA 3TI0A 1S6PA 3M2VB 2HZVA 4LF9F 2V0NA 3L4BC 4GO5X 4ZPAA 3GV7B 1FD8A 3RAQA 4YDXA 3F73A 2XC9A 2E5JA 5F41A 3KK2B 1AYEA 1JLGB 1JLFA 2JC1A 1HWIA 2MQLA 2PO4A 4IFVA 3PXGa 3VAHA 1M5OC 2J7UA 4AD6A 3WHIA 3R5CA 2R2UA 4WYWA 4ZVHA 2G4BA 3ICLA 1FXLA 4K59A 3VVTA 3ET6B 5F8LA 2MJNA 3PKMA 2BUNA 4FYWB 5JXSA 2HNYB 2F3JA 5J1PA 2HMIB 1EETB 3TWZA 1RWUA 3NMRA 3DRYA 1MWQA 1C1BB 1DLOB 3FSYA 3FQLA 5KFCA 4DR2F 4C8KA 4Q0BB 1H98A 1HNVA 2MB0B 2BDPA 3OL9A 2VFUA 3HHLA 1VISA 3CCWA 5LJ3Y 4DV2F 1NJYA 5HK4A 3X1LB 3C15A 5K5MA 4LQ9A 3EXYA 2M70A 2MZJA 4LF5F 2ZUGA 3QAEA 4HI1A 4W90B 1N88A 4Q2LA 1PGZA 4JI1J 4AL6A 4EGLA 2GHVC 1QDUB 3MF5A 4Y3CA 3R5GA 2ZFHA 3J80U 2ZH1A 1J5EF 2XGPA 1SIZA 2G2OA 2DIUA 3ZZ0A 2C2DA 4OQJA 2GVZB 3QFWA 2VFTA 3GIRA 2BX6A 2H9ZA 3D2WA 5T14A 4EU0A 2BQ3A 3M8WA 1ZPVA 1HNXJ 1IM6A 1C4CA 2JL9A 1I94F 3M30B 4OX8A 1BQXA 4ZITA 3ETMA 4OJHA 2FQQB 2F65A 3TEHB 5CCMA 5IS2A 2ASDA 3CIMA 4HDHA 3M1VB 2FVRA 1NSAA 2BJ3A 2E7VA 4OYMA 3DLBA 1Q79A 2VPXB 3T5KA 4B3OB 4XO0A 4DPUA 1VK3A 2HS0A 1U6BA 3J7A1 3KNAA 5LMUF 1NDLA 2RF2A 4F36A 3T1HF 4UY8T 2H1YA 4Y6IA 4DF8A 3SCLE 3Q24A 2D3ZA 1WSRA 3DLJA 1HNWJ 3ISND 1RT1B 3GSDA 2MQPA 2DVIA 2NUHA 2B7CB 2O67A 3U1MA 4DI6A 2NR0A 1JNZB 5H9FJ 1HBMA 2YNIA 5KG2A 3Q8PB 5L1KA 1EZZB 4FKYA 3I5BA 2DISA 2DNKA 3GB0A 3LGNA 2AD9A 3MXHP 2X1BA 2EFPA 2BJ8A 1AROP 2XLIA 2VPYB 1ZZNA 1RWXB 4C97A 2DO4A 3KUHA 3B4DA 2CYYA 4JI4J 1FFGB 2IRYA 2RDIA 3POTA 2CQPA 4EBEA 3KJNB 4UUXA 1S9GB 2F9JA 2OMLA 2FB0A 1FVQA 2IIHA 2N7CA 2WONA 3N28A 1RLCL 4HH1A 2V8PA 3FCVA 2NXUA 4OZNA 5D0HA 5HQMA 2WVBA 3QJPA 3LQVA 3V5RA 2MGZA 2H48B 3FMWA 3CPWR 3CIZA 2DR5A 1TV6B 4H4KA 2XY5A 3V6HA 3BO2A 2LXUA 4O44B 1U1RA 4DV3J 2KVQE 4FYXB 4NLWA 2GO9A 4R25A 1XMOF 1UVNA 2G0CA 1FRHA 2B51A 5B0GA 1OIAA 2KI2A 3I4PA 3R6GB 4PWUA 5B0DA 2MDAA 2B43A 3VAKA 4FF1A 4ETXA 5FD1A 2RQKA 4FP9A 3SDEB 1TELA 1KQKA 5KFTA 3RU0A 1XNQJ 1IKWA 3CW2C 2MY8A 1U09A 2W8LA 4MMOA 1NKEA 2Z4PA 2IA0A 3WDOA 4LFCJ 1PJ5A 1WTFA 3QPIA 3QT8A 3NCPA 3MWBA 2QLFB 2IFXA 1HBNB 2LCWA 4AT1B 3TR5A 1N0VC 2R7RA 3LANA 4Y0FA 1IJFB 5E3AA 4E2FB 2I2YA 1NB2A 4DU7A 4KO0A 2GA7A 3DI6A 3MR2A 2AX1A 2HZCA 2UU9J 1YJWS 1RTIA 2B7BB 3H98A 3AXMA 3MEEB 5C2CA 1DTTB 3GLJA 4ECRA 1SC3B 1WOSA 2OIHA 4PXEA 3MR5A 3H40A 3M8PA 1HNZJ 4DLEA 2QFIA 1HL6A 1UAWA 2OUGA 3P5BP 5DQIA 4KFBA 4CH0S 2IBKA 1WKLA 1WACA 2HK3A 3DLEA 5D0GA 3C6UB 1R6YA 2ZD1B 1NLKL 5A6WA 1V3ZA 3SFUA 1IBLF 1M1HA 2YTCA 2XWXA 3C14B 3DDNA 3A8KA 3FNNA 4CM0A 1KQFB 2KXFA 2CQGA 5KFDA 1HNXF 2AGOA 3KK2A 3UDCA 2OO4A 2K8GA 3PHEA 4PG7A 4GKKJ 1JIHA 2DGWA 2MPUA 3HSDA 5ETVA 3W66A 4L73A 4DG1B 3K58A 1L3UA 4HDGA 2VQFF 1ZTWA 1E6YB 1FFWB 4MH8A 3H4DA 2ZNZA 1IQTA 4R0EA 3MM9A 4LBHA 3W9IA 1VRUB 3EPGA 3EZOA 1U7LA 1UEKA 1V5VA 2AYMA 4ED2A 4A8FA 2BW7A 3JXOA 4ZVEA 2YQ3A 4QQBA 3SI8A 3E2EA 1KR4A 3FQKA 4LRDA 1WC5A 2BMBA 4H4MB 3SCJE 1U6ZA 4QIFA 4IH5A 3VZHA 4AQYF 1D8YA 3BH7B 3GG0A 4K5SA 1N6QA 1QSSA 2B8QA 3RB6A 2BZ2A 2DHGA 3OHBA 3ZFVA 5C25B 4CLTA 4IG3B 1UJ5A 3IWNC 4YB1P 1AFIA 1RTJB 1X4CA 5ETQA 1TK5A 4B9UA 3W64A 3MEGB 1KFSA 4UTGA 4FVCA 2DRDA 4NXMF 2VICA 4F2SA 1WHWA 1IR2A 2MKIA 4NEYA 5J2PA 1BWVA 4NMXA 5GMDA 1XWLA 5DM6Q 4ECVA 5F8IA 5DG8A 3UWTA 5H9EK 4P72A 2ZZMA 3HFKA 2YKMB 1P9YA 3NGUA 2KHCA 3ZO7A 5K8OA 3OLAA 1CJTA 1K0TA 3KWMA 2KT5A 4KYZA 4ZPVR 2BEFA 2B6AB 1G2EA 1S72S 2X1FA 2BRLA 5KFOA 2C3YA 3FSXA 4LVOP 1WF0A 3BO4A 4QW8A 1YRUA 3A3OB 2E5HA 3V6JA 1REGX 4NLXA 4ANEA 2CZ9A 2MKSA 1YRTA 4DR3F 2HW3A 1TMJA 1N54B 5IQ6A 5BXIA 1KQSR 5D0EA 4F4XA 4C8NA 1T0TV 2QMXA 4ZHRB 3W5YA 3QSIA 4DL0C 4X4QA 2G0IA 3VAGA 2DNYA 5EHHA 4PG4A 2R2TA 2A6MA 2AGQA 1W2BR 3CXCR 4DSLA 3PYDA 3G71S 3PW7A 1BMQB 3MEDB 4JUZA 5D3GA 4WJBA 4P71A 2HKEA 4ZHRA 1QAYA 4RW6A 4ZJLA 1PILA 2ZHOA 2RU3A 4RW8B 3KXDA 1T9XA 3E3XA 3ILIA 2DB1A 2F1FA 1NHKL 2NLWA 2ZWOA 2O3DA 4NI2B 1XERA 3FZBA 4CH1A 1TL1B 2FHJA 5E33A 4ED4A 5J2PB 1NKCA 1F2GA 2M0GB 4UUWA 1EQ0A 5GAEI 3A8JA 3MPUB 4A47A 2MQQA 1NKBA 3MCSA 4IRKA 1L5UA 1AA1B 2ZE2A 3AODA 2G1DA 3BYPA 2Y8YA 3KG4A 1F60B 1T05A 3ISNC 3MI7X 1SB6A 3ZNJ1 4A8XA 3OL6A 2NXJA 1N5YB 1S1VB 4CT8A 2R8GA 5DETA 3OTOF 3BKTA 5LMNF 1ACMB 1NH8A 4NLGA 2W2NP 4WU2A 3GG1A 1X5SA 1T94A 5HBMA 5F8GA 4QWCA 3LP2A 3P4UB 4GO7X 1W25A 2B9WA 5J2MB 4LBPA 4WE1A 2Y8WA 3W5ZA 2LU2A 4X66F 3D3BJ 3CCJS 5DGBA 2VOOA 4K7QA 3IWLA 5GMEA 2IVYA 3PKYA 3BV8A 4EUVA 2PFFB 1AZSA 1FERA 2B8PA 5L39A 1D09B 3MM9B 3HHEA 1UMJA 2JNJA 1HBUA 3OR2B 1AUSL 1NU4A 1S1XA 2VPWB 4F4WA 2MZTA 4F4KA 2DCLA 2XSFA 4DSEA 2CPJA 1N5SA 1RHJB 2LP4A 3H5YA 3HVAA 4OI0A 2OEKA 3CD0A 5AJ3F 2MZQA 3OVBA 1RWKB 1VRUA 2IMOA 2QL7B 3M2RB 2KZZA 1VIXA 2D7SA 1RT5A 2VG6B 4QPXA 4EO8A 1FK9A 1Y11A 3S01A 2G2ZA 1HR0F 3O8WA 2ZZTA 3T5JA 1YK9A 3M7VA 3CCUS 4EBCA 5DS7A 4U7UD 1FKPB 3OSPA 4Q43A 2YKPA 2VHGA 2XMKA 1WD6A 2JOQA 2BE2B 3DOLA 2DGUA 2VQEF 4DV5J 5CA5A 3W65A 1LFPA 3A3PB 1Y5NB 5ETTA 1HQEB 1FNMA 4PWDA 1Z2LA 2V4JB 1FWLA 4ZVRB 5DLFA 1RAIB 4OX9F 5KOXA 1RTIB 1U6FA 1K8AT 4TKTA 4LQ3A 3W9HA 2J6TA 5KG3A 5KFJA 3MR3A 3PCOB 3TRGA 4ES3A 2HHVA 3D5MA 3U1LA 3AD7C 1TL3A 5B08A 2XEXA 2H54B 3M05A 3M32B 4HVZA 4NA3A 2GHWA 3MPVA 2AWZA 1Q8KA 4RW8A 3PR5B 1RTDB 3VF0B 2L9DA 2O01C 2CG8A 2V2ZA 2WCXA 1XR7A 2GMHA 2DGOA 1X7VA 3DI6B 3MEDA 5D3GB 1KOHA 4DPOA 1N33F 2YWGA 2JEGA 1Q7LB 2DTJA 1NPRA 2FGCA 4ZIWA 2AYGA 3HHLC 4NYZA 4XDDA 1KDNA 3SDEA 4ZLJA 2BM1A 4PYDA 4U7CA 3H5UA 3MMJA 4E0DA 2ZJQQ 2CPDA 4TY8B 2MTLA 1DRZA 5C24A 2V5HG 4DPYA 3D68A 3H0PA 4K0KF 4USJC 2NXNA 3EE3A 2CVEA 2OP5A 3H90A 5CZVA 5KFEA 1VRTB 2FC9A 1CJKB 2RH3A 1Q81T 2MZSA 2P9GA 3GP9A 2QEXS 1U4BA 5LM7E 1QE1A 3CJ0A 5I3QA 3QGHA 4NLOA 1SQFA 1LK7A 2HFVA 3JAMY 5K8MA 5M2PA 3JQJA 3FZ2A 1YG0A 1RB0A 2HNZA 4KKOA 4ZVQB 3R8YA 3TNVA 5MAOA 1U2RA 3C8YA 4IG3A 1UCNA 2IVMA 3M6XA 4I2QB 4PXDA 1QTMA 1F9HA 1JLEB 3DRXA 1HYSB 5CH7B 2FHMA 3OTDA 4TLRA 1S48A 3DMJA 4OHVA 1TUGB 1JLAA 2LVWA 2W1BA 2PT0A 2RMLA 2OFGX 3SZ2A 4IRDA 3IR6B 5H9FK 4PYAA 3FJ2A 2RNEA 2PI5A 1CC8A 1Q82T 3CGIA 4DUZF 5E0OA 1F3VA 1CQNA 1UWAA 2MKCA 1UVKA 2VFVA 4H4MA 2IYIA 4NMLA 5HP1B 4FBUA 2VC1A 1T11A 2B56A 2XG8A 4DBQA 1SXLA 2QGFB 2Y1RI 4OZ3A 4DG1A 4ED7A 1J5OA 5DZ6A 2ZWPA 2XS5A 1EX8A 1EQMA 4O3SA 1M5PC 2BXJA 2A10A 4CNZA 2FVPA 4X66J 1M5HA 2RDDA 3DOKB 2VJVA 3MECB 3MEKA 1XBWA 1FRIA 3I32A 3A3NB 4X62F 3CUNA 1S9FA 3UR0A 2I1RA 2LDYA 2YKNA 3N0VA 4RZRA 2ZH4A 3AJ2A 2DXDA 3C6UA 1V6HA 4KHMA 2LQ5A 1SC4B 2ZOMA 5HVFA 1HBOB 3DM2A 4TNOA 3ZTQA 4R5PB 3SYZA 2WSEC 3C3LA 1URRA 1RT1A 1YWXA 2HFUA 3NP5A 5I4MA 5A8RB 3TOQA 2KM8C 2V9WA 1F0XA 2KXHA 1B0VA 5AJ3J 4WKRA 3EICA 5GMKa 3AQPA 4FPIA 4ZA1A 2NPIA 2JLFA 3D28A 3M6VA 4N7TA 4OZ2A 4LSNA 2JC0A 5K9FA 1XQIA 2CJKA 2BJ1A 4WFBQ 4MYTA 4MK8A 3SBMA 4CLZA 4RO0A 1A6LA 4KV8A 5KFFA 4WIIA 2JFDA 5D4LA 4ZK7M 2XMMA 2RAQA 2BA9A 3QBCA 3Q8SB 3PW0A 3D54A 3V6KA 2NS1B 2R2RA 3BGFA 4G3IA 1X8DA 2ZEJA 5GAHI 2Q3PA 3CDUA 3OUYB 1MLAA 1RGVA 2MLZA 2RIJA 4IDKB 3EJMA 4JI6F 1NZ8A 2H5JB 3TA2A 3HSJA 4ZVOB 1VBYA 2HBYB 4ILLA 1FWKA 2EKYA 2IRUA 3RAXA 1JNRB 1JLQB 4A8YA 5EGYA 3OUYA 4JI0J 2DR7A 1T3OA 3RR8A 2X1GA 2EFGA 3D0GE 4DQSA 1YBUA 1N48A 2OMOA 1N4LA 2HBQB 5HLFA 2UUBF 2C2EA 3VAMA 1CPZA 3OTBA 2ZBIA 3NCQA 1O6XA 3GFZA 4RNFA 3IN5A 1P1TA 3AFGA 4A8SA 4RJVA 3QSYB 1JKHA 1C0UB 2QV6A 4NLYA 1RP5A 3CDEA 3BPDA 1VLYA 3DRSA 3HHLB 1Y5IB 4ZPWR 3RTVA 4DL6A 1NK7A 3BM7A 5B09A 5CCLA 2Q6CA 4DCOB 2AJFE 1VQPS 1P6TA 4YS2A 2I0XA 1TL5A 1B64A 2OHDA 3SSSA 4OLOA 2XYGB 1S0OA 4NL5A 3D67A 4PG8A 4B9MA 3G6XA 4Q8EA 3M2VA 1S1UA 3POTB 4B3MF 2A0FB 2HHTA 4DR2J 1S79A 2OFHX 2FVSA 1UPMB 2DNRA 2VV5A 4CLFA 4ZLLA 2BABA 4J9MA 4DPXA 3CDWA 4Y2MA 3C2PA 4URQU 2OGUA 3GR0A 4PG5A 4DDFA 1GXLA 3V81B 1MU2B 1S9GA 3MMAA 4KGVB 5ETPA 2KHDA 3UDVA 1MW7A 4KPCA 3HD2A 5HVGA 5JMNA 2A1BA 2KU7A 5L1LA 2IVFB 1URNA 1HPZB 4GVBB 1KLMB 1HBMB 2CJAA 1NSKL 2YNIB 2WSCC 3F56A 5HP1A 1NK8A 3H4BA 3CC7S 4JI1F 2WB4A 4FF2A 3V81A 3TAMA 1QSYA 3LO3A 1QSLA 3HT0A 1R3NA 7AT1B 3OFEA 1K73T 3QO9B 1KVIA 1J2VA 1S49A 3FBCA 4QIVA 4DL7A 1Q0NA 1RISA 4YQWA 5IV4A 5M2RA 3ENAA 4JI2F 5IFMA 2MQMA 2ILZA 3CSKA 4F3QA 3HMJG 2X1AA 2VJUA 1IR1A 2U1AA 2HNDB 3CTRA 3W1YC 2AP6A 1FDAA 3GTYX 3RRGA 2XO6A 2GNKA 3VAIA 4JV5J 1HQUB 1HNZF 4B02A 3QT7A 2CQBA 4O0IA 1NDCA 1Q53A 2CNKB 4ZCLA 1EKRA 1JJHA 1TVRA 3DGPA 4OYAA 4TYAA 4F4ZA 2A6OA 2RUSA 2GVDA 4G1IA 2ZH8A 1N34J 2E7WA 2RT3A 4CYUB 1ZAWA 1VRTA 2DIVA 1VMBA 5LMUJ 3AOBA 1PSDA 2I5JB 4ZP8A 2DJWA 3Q22A 3RBEA 1PAEX 1SKUB 1S6QB 1XNRF 4P7VA 5CHCB 2XBPA 1RK8A 1N36J 1RBAA 2AF6A 4J7CA 4RW7A 1SKSA 1DZ5A 1WHXA 1X60A 4OJ1A 1JLQA 2YWEA 4RR5A 3RBXA 4CLLA 2XYPB 2VPZB 4C0HA 1OS5A 4Y2IA 1S76D 2VQFJ 4LSZB 3EGZA 3QJJA 4QU7A 3JB9k 3KMQA 3CJRA 2DHHA 2K3KA 5KAKA 1TU0B 2PA3A 1IUJA 2Q66A 2KO1A 3BSAA 1PCAA 2OPSB 3Q89A 5HQ8A 1G1XA 3MPYA 1UETA 1D3WA 5LSRA 2CQCA 5CZXA 4RW9A 3PV8A 2Q79A 1K9MT 4JI4F 4LF6J 1FF2A 1BQMA 3GILA 1C1CB 3FRYA 4UQTA 3M9NB 4AQYJ 2Y1JA 2G2YA 1FJEB 1UVLA 3O5TB 1S97A 2HAIA 4OYBA 2XY7A 5JJBA 4OJ3A 3SV3A 2EVZA 4TU8A 2CRLA 1UWBA 3CMQA 4F26A 5KFSA 2GAHC 2IPOB 2BJ7A 3NBPA 3VAJA 3QWUA 3OFHA 3W3SA 3IR7B 2Q6BA 1NK6A 1U26A 1GMUA 4GC6A 1B4SA 3FBEA 4ETZA 4DV4F 1VC6A 1F3FA 1WF2A 1RWMB 2V9KA 2XULA 2CQ0A 1ZYQA 1NJWA 2CADA 2H5IB 4CCHA 1UL3A 4JV2A 5A0YA 1TFYA 1KONA 3DHWC 9ATCB 4BC7A 1FXRA 4DFMA 1KC8T 2BOPA 3KJVB 4HL9A 4RW9B 1J5OB 1I5OB 2A2DA 3L7PA 4OYIA 4YP3A 3VGSA 4ZP7A 2JWNA 4OFZA 2GAGC 2DPJA 5KG7A 4I69A 3AXKA 3WC2A 2VBYA 4MAKA 1Q78A 3DC2A 1AZSB 3OHAA 4TXSA 2CUYA 3H20A 2BANB 2BJEA 2OSQA 1JLAB 3CDBA 4URGA 2IM1A 3OXFA 3AQOA 1KVKA 2PC6A 4JOUA 3MFIA 2HHUA 3W8GA 1UVJA 3CJ8A 3NNCA 1N5QA 2F8MA 2OPPB 5B0EA 2BR0A 2HIYA 1M90T 1RT7B 4P75A 2VH7A 1FTRA 3I0SA 1U8WA 2W7OA 3VV2B 1UFLA 3CB4A 5HJXA 2P9CA 4FXWA 5J2QB 2ZDPA 4F4YA 4ECZA 1UW9A 3NOCA 2HNDA 4B3TF 4I7FA 1TL1A 2M2BA 2E44A 5IV3A 2MQOA 3K7RA 1U1QA 3TX8A 2YWFA 3QT6A 3U1NA 2OPQA 5ITHA 4XIUA 4N47A 2ZH7A 4X4OA 4IOBA 5DGAA 5IWAF 1HMVA 3QZ7A 2IY5B 3HLUA 4YR2A 4C8OA 5K8PA 3US5A 1F1BB 1WNEA 2JLEA 3I0RA 5ETSA 2EI5A 1S1TB 2Z2ZA 1U02A 1UJ4A 3M8ZA 3MHYA 2J8SA 3NGRA 8AT1B 1RYSA 2BBEA 1WDTA 2RQMA 2AYEA 3HVWA 4B9TA 4OZLA 2PMHA 2HZAA 5KFMA 3IRWP 2KFNA 4IR1A 2LEAA 1IBMF 1MROA 1R7IA 1H74A 2K3IA 2CNLB 2MHEA 3EZUA 4OYZA 1XNRJ 4RBVA 2DPIA 3D4JA 1BLUA 4OLPA 4DX6A 2CNOB 4AYBD 5JUMA 4PG6A 4G1PA 3BQ0A 2C2NA 2XMUA 3QGPA 4MKYA 1WEZA 1CJTB 5F8HA 1UVMA 1FFSB 1N56A 4WFZA 3DU6A 3IA0A 2DNLA 3SEOA 1F5BA 2YNGB 1SV5A 4M5LA 5B0AA 2FY8A 2GIFA 3IM9A 3C16A 2CJ9A 4LF6F 2RU9A 3CNQP 4D3HA 2IAJB 1UWBB 1WKJA 5KFHA 5EWFA 4QWDA 4FF4A 1YHQS 2V2QA 3P96A 4JBCA 2KH9A 1FT8A 2W2OP 1M5SA 1S12A 3E8OA 2VG6A 3CO9A 2J0QD 3SQGA 3W2WA 2D3O1 2EBGA 4FNIA 1ZM2A 1JLCB 1E6VB 2UUAJ 4KT0C 3GFYA 4PQUB 1YZ6A 3QLHA 3Q8UA 1W26A 2XZDB 1UEUA 1R8HA 3ILOA 3X3UA 1BXNA 4A8OA 2HK2A 5GAGU 3OR2A 3KNGA 4USHA 3RB0A 1T9YA 4NLQA 3R2CJ 3CEDA 3W63A 2Y3YA 3O44A 2L41A 2KKHA 3C19A 1KEKA 4B3MJ 1RT2A 1X4GA 3GCXP 3SCKE 4BLGA 3EGWB 4IOAQ 3JTNA 2HEKA 2IC3B 3RRKA 4DL3A 4USVA 4AL7A 2UVWA 4B9LA 3CE8A 5KT2A 1I6JA 3CJSA 1C0TA 3T6BA 3G6VA 2LQBA 1AT1B 1XN9A 1ZM4A 4QR0A 2QMWA 1T05B 1T7PA 4LF8F 3A8EA 2XM3A 1TVRB 2MLXA 3G87A 4I6WA 2UVUA 1RHRB 1RCXB 2N7YA 3BGOP 3QWPA 2DHAA 3LP0B 4RX6A 3GJQB 4Y65A 1PYOB 1OPIA 1RAJA 2KVIA 1LWEB 4G1QA 4E98A 1TKXB 2AKWB 4J9NA 1IBKF 1N0UA 4OV1A 3HK2A 4BHQA 2QL9B 4K4VA 1JJCB 4NI2A 5DDQC 2CQDA 3G82B 2CWXA 3LWLA 3OW2R 3DLHA 1DTTA 2FHKA 1VHIA 2YKNB 4P9SA 3UN2A 4Q44A 3KJQB 4OYXA 2QTWA 1HWKA 2QSWA 2Z2MA 3JS9A 3N6LA 4QIEA 3JAMU 3EYZA 2ZH6A 4Y00A 2DRAA 1RXOB 2OELA 2WW8A 1RHKB 4OI4A 5B0FA 4B17A 4NA1A 1RT4B 3LGMA 2DNQA 3JYTB 4MT1A 4OZ1A 1XMQF 3SV4A 3CT9A 5KFGA 2IJFA 1T03B 3IXQA 3AB2B 3KFWX 3QRRA 1VGYA 3GV5B 1G4CA 2DD8S 2VUGA 2Z0GA 2ROGA 4H4KC 4XPEA 3B6BA 3ENQA 2B4PA 1OWXA 1IN0A 3DMJB 3KUGA 3N6MA 5T7LB 2CPHA 2GHPA 3M6UA 4LIRA 1N52B 3UDLA 4ER8A 3LF0A 3U02A 1XEZA 1NDPA 1FKOB 3I5AA 3OR1B 3CD5A 4K4XA 4DV1F 5FIIA 4R8UB 2FJWA 4GKJF 1U1PA 5IT0A 1IBLJ 3TAPA 2HBRB 2CXEA 2WVEA 1OY8A 1R6VA 5F9NA 1FJGF 2N3LA 1TFWA 1IKXA 1IKXB 3LPEA 4I67A 4CZCA 2GGPA 2HWHA 1Y9OA 4O3QA 5LL6d 2MEWA 2Y1LB 2DNGA 3A12A 1JXEA 3HZEA 4MIBA 1O8BA 1NJXA 2E7XA 3AJ1A 3EVWA 4OX9J 2HMIA 1LW0A 5F9LA 4YR0A 4LRAA 4O4GA 1N32J 2BKNA 3DDIA 1RCOB 3PG9A 3PTWA 5BR8F 2HBZB 2FLNA 2Q43A 3N5FA 2OJ3A 4X4VA 1X4AA 4YHHJ 2GFFA 1SVDA 2FUG9 1FDNA 2NUUG 2VZ9A 1ZZFA 3BN7A 5A8KA 2YNFA 3M8SA 1NK5A 3IRXB 4QBUA 3MMCA 2OPRA 4L72B 5KFZA 4AXIA 3RB4A 2F8HA 1ICEB 5ETLA 2ATCB 3IAM9 1IQZA 1HWJA 1RTDA 2VDHA 4NCGB 2EFOA 1WEXA 3J7YI 7FD1A 3NGDA 5KOWA 3K8VA 4LBIA 4OX7A 5C7PA 3JTOA 4FS2A 4RWWA 1WC1A 3UDEA 1LWEA 2BOAA 2V63A 3OD2A 2JDJA 4FPRA 4G1QB 4ILRA 4O23A 2YQ0A 5RUBA 3FKBA 1RTHB 1VJQA 2YPYA 3G8QA 4J91A 4OI3A 3T1YF 3G82A 4ES1A 3NNAA 2XZTB 3CJ5A 3AOCA 3KLGA 2VODA 3OSNA 3T5HA 6FD1A 4KHPJ 4ILMA 3BREA 2YY3A 3CJKA 1L3VA 2CKWA 4IO9Q 1LV5A 3LPYA 4RL1A 4L76A 2LXIA 2GQ2A 1LNQA 1HHSA 3FEYB 3K5OA 5K20B 2IM0A 4MJKA 2PSZA 4A4JA 2MXYA 2KG0A 1KBRA 4FXVA 4JI3F 4LF8J 4KO0B 3CCVS 2CJYB 2EC2A 4QU6A 4U9RA 2ASLA 1RQ0A 1KTVA 2BQUA 4WZQA 2QLJB 5KFKA 2F5GA 1JXLA 3Q8YA 2EFVA 2HVZA 2E66A 3ZZOA 3OT9A 3JTPA 1JJ4A 2R8KA 1NDKA 3L95X 4H4OA 4F4AA 3LTOA 2ZJRQ 3QAUA 2UXCJ 1S77D 1R0BG 2LEPA 2VU5A 3IM8A 3ZZRA 5L46A 1LW0B 3VALA 3W7BA 4KTQA 4ZN1A 2L48A 4WBFA 1LWFB 3N9UC 3HO1A 4PR6A 4X4UA 1IKWB 4RBTA 3PIPQ 2DBBA 2Z2LA 2BVZA 3UN5A 2FDNA 2KYZA 3QLHB 2K2PA 2V50A 4HT5A 1GXTA 4P2SA 3QQCD 4USMA 4FXDA 2HQGA 2FY1A 4UOFA 5CYQB 2WB1D 3ZC4A 3MURP 2ACYA 3LA0A 1MMDA 3C16B 3MAHA 1C1BA 3AOAA 2X3DA 2ZBCA 2ZBQA 2JSXA 2KJWA 3BBFA 3K8WA 4C8MA 3SQGB 2J6SA 4O44A 3OR1A 5F3ZA 3RAMA 4ED1A 1CG2A 3MAQA 3G8SA 4OL8A 3KLHB 3BH6B 4MK7A 2IAJA 4LF5J 2NSBA 3J7YU 3NNHA 1D9AA 2DY1A 2HHPA 4CH7A 1LK5A 3MD3A 1CJKA 3HD1A 4KBIA 4MKVA 2FD2A 5HATA 1YDLA 2KJVA 2HRTA 3G6ES 3GJSB 2R9LA 4DR1F 4L74A 3K89A 2F4VF 5JVGQ 2CDRB 4CI0B 4K5RA 4BBYA 1VQ5S 1AUDA 5KFWA 4PWWA 1XC9A 3E01B 4JI5J 2XO7A 5J1EB 4IH7A 5DG9A 1I94J 2K7KA 3T9NA 2ZJPQ 4J9SA 3UCZP 4CLSA 3PJ9A 1RYRA 2I9SA 2K1RB 1JLBA 2F4FA 1RHQB 3HHLD 1SJ1A 4RKUC 1NK0A 1RDRA 4UOGA 3MUMP 5CD4H 4DQRA 1N32F 5F8JA 2JVRA 4WU3A 2DGTA 4RUAA 4DL4A 1BC6A 2QSFA 2ZH5A 1GT8A 4C0BA 1PBAA 1SQEA 4NZ7A 1VRQC 2OEJA 3T6JA 1TKXA 1X5TA 3EVOA 2LQ8A 3CCTA 4HACA 1YJTA 5A8WA 1SL0A 3MPDA 1R0AA 2P8IA 2OPQB 2V4JA 5A6PA 2RQCA 4B9NA 1FRKA 1NHVA 1KWMA 4C48A 4DUTA 4ZLPA 4B3OA 2CQ4A 2OH2A 5DRKA 4LF7J 1UFKA 3HXMA 4I7FB 4F25A 4J9LA 4ECWA 3DOLB 3EDQB 5ETMA 5KFRA 2MZRA 2AEMA 3MEGA 2XWYA 1C0TB 2HLUA 3HSZA 4M5DB 1SKRA 2M8HA 5A2QU 1XNQF 2M5YA 3EVMA 5EX3A 1J27A 3I0SB 2LKZA 2RQ4A 2J7KA 3MM6A 4I6YA 5D6GA 3BDEA 4Q5VA 2CPIA 5ADZA 3PIOQ 3QZ8A 4F50A 1RU2A 1WOOA 3M2RA 1RAGB 1SQGA 5E3RA 3CCZA 3P3DA 3IG1A 3JSMA 3DRRA 3T1YJ 2CVIA 2I38A 2MKKA 4C3LA 3O2IA 3NY0A 1TUVA 4OHWA 4KJIA 1Y3KA 1HBUB 1SBRA 4IO1A 4N8OA 2QFJA 2DGSA 1QJHA 2LA4A 4J9UE 1AFJA 4N8NA 2WK4A 4M5HA 1CULA 4ED8A 4K0KJ 2HQDA 3F0NA 1U49A 3KLEA 5A0YB 3GCWP 2E5LJ 3C15B 4K2XA 3HCXA 3MR6A 4TN2A 3CULA 5F3TA 2UP1A 4LFBF 4QIWD 3P45B 1SJRA 1GX6A 9RUBA 3UR3C 2D69A 3GJRB 1YJUA 2ZC3A 2ZKUA 3JQKA 1LW2B 3RR7A 3B82A 4ALZA 3KJVA 5DG7A 1SH2A 1DURA 4DQQA 3AT1B 4YR3A 1OQ6A 3ILLA 2K7JA 2PMWA 1BHNA 1LQ9A 4DS4A 2QMUB 3PDNA 5HQLA 2ATLA 4IFYA 1BQNA 1SJ3P 4QPTA 2WBMA 2GZOA 3B4MA 3OVSA 3THPA 4ZVFA 2VD3A 4X4TA 3H5SA 1T95A 3EUNA 3M8QA 4JV5F 4DZ6A 2NYHA 4LRBA 2ZVSA 3V2UC 4RU9A 1C2PA 1SV5B 3JSRA 3M8PB 4F7VA 3Q8RB 3LWMA 2C2RA 2ZKTA 1TMMA 2FJVA 4B08A 4M5NA 4HI2A 1A9NB 4DQIA 5IOLA 1DBDA 1VQLS 2XHWA 4OMFG 5SUHA 5HJYA 2JFKA 1YIJS 2W9CA 1X0FA 2HVDA 2FJXA 2HHWA 3BZQA 2R3VA 2QE5A 5D77A 5GAGI 2E9RX 3FUYA 3TP2A 3UCGA 3GYXB 3VGVA 3KLFA 2RJZA 2WOMB 2W9AA 1VQ7S 1Q8BA 1FCAA 5M2UA 1YBTA 2QA4S 3MCOA 2V34A 1R8CA 1S99A 2XMVA 3IWXA 4MFBB 4DV7J 3LP1B 1WOPA 4PABA 4N56A 3HVTB 4P2FA 3IG1B 4S0MA 2CQHA 3BYRA 3JSMB 2ZM6J 1SL2A 2VA2A 3TEGA 3KUEA 4MIAA 2UZAA 3FBBA 2B6AA 4TLQA 1TTHB 1S4FA 3G96A 2VQEJ 4ZCKA 3W60A 2A3JA 2HQIA 2XSJB 5THWA 1RADB 4DV5F 2YKMA 4DCPB 1HQUA 3PYFA 4F0HA 3BBCA 5EUHA 4UQGA 4X4NA 1BGXT 3R9LA 1RSCA 4Q7AA 4WP8A 1JJ2R 4CYUA 1JXVA 3IS9B 3DLLQ 2GV1A 1O0PA 1TV6A 2A18A 1TQLA 2DEIA 2AEFA 1PYSB 1TL4A 4NZ0A 2M3DA 4TY9A 2E1AA 3HHKA 1R0AB 2XSJA 4A46A 4HACB 2JHEA 4MK9A 2UXDJ 3QO9A 2G13A 2H4WB 3EGNA 4N77A 2QJ3A 2CG4A 3PRDA 1WWHA 4XAKA 2CIMA 5EX0A 2DXEA 4P10A 1D1UA 5IZHA 4ED3A 1S9EB 1VQYA 2QA1A 4QYRA 4A8MP 2NQPA 2G1HA 5DZ7A 2POKA 4KH0B 3TYTA 4LVNP 4I56A 3HKWA 3OFGA 2F40A 4NCBA 1U25A 3SIPB 2CPXA 1H2TZ 1A7GE 1TL7A 2AJ2A 3BGLA 2V67A 3MM7B 5E2QA 6FDRA 2VG7B 3CCRS 4ZMMA 5B0CA 3H2UB 3MM5B 2JJ4D 1G3OA 4B9SA 1EP4B 1VC0A 3FFIA 2V68A 3HT3A 5H9EJ 5CYJA 2PDAA 1R0CB 2FVCA 2QO3A 1WG1A 3J81U 2J0SD 4ZPDA 1BD6A 4ITSA 4ZVTB 5HROB 1NPKA 5ETOA 3BO3A 2DGQA 2X7IA 1RHUB 5AXNA 2OTJS 1IVZA 2P5VA 2R7OA 5IXUA 1ZM9A 4KY3A 3D6FB 5A2QY 4WFXA 2QLBB 1C0UA 1QTNB 1RWOB 4IFYB 1X4DA 2W8KA 1QVGR 4JYAF 2C2MB 4WFAQ 1HNIA 1U1LA 2P6SA 1KVJA 5HLFB 3TUPA 4J9PA 4ECUA 1B0TA 2RD5C 4I6AA 2E1PA 3U27A 4ANDA 4ZN3A 1H2VZ 2FC8A 3DRSB 3EWGA 1RAHB 1HLWA 2VBWA 3PO5A 1KS2A 1L3KA 1OO0B 4I4BA 2BW2A 1IWAA 2B9EA 3DLKB 5HVHA 1CULB 1FVSA 1I51B 1U1MA 5HL7Q 2HAFA 2JRSA 2F9DA 3MD1A 4J37A 1S0VA 2GS8A 1S59A 2WAQD 2XMWA 2XZWA 1QD1A 3EGVA 4MYUA 2E29A 3RBZA 2GX8A 1OPZA 4WYLA 3VR1A 5BYSA 2DEJA 5EWGA 2LU1A 1NK4A 3WIUA 4CO0A 2NXCA 2FLOA 4LUBA 4QYZJ 4JI5F 4NXMJ 1HD0A 3C66A 1Q86T 4JI7F 1V3SA 2EKNA 1HNVB 1SH0A 3O6QA 3JSBA 5LMNJ 2SXLA 1H7WA 1NAQA 4YN3B 1HW9A 3CJKB 4CWBA 3PRVA 4NWBA 4EI2A 2KTQA 3ZZYA 3UO0A 2HNYA 3MUVP 3KLGB 4LRFA 1HBOA 1Y00A 4J9QA 4DV7F 3J7AN 1TK0A 1P1LA 1SC1B 3D7SB 4U8YA 1RTHA 3BGUA 4X64F 2JH3A 5GADI 2QIFA 1H7XA 1T02A 4YDDB 4CLUA 4DF4A 2CZ4A 3LH2S 3M8RA 1G6BA 3B78A 5AXKA 1KSPA 2YWHA 1SJQA 4CLPA 1CJVA 1FRMA 4DX8H 5CD4A 3PX0A 3UCUP 1QAXA 1MWYA 3VQSA 1S0MA 4ES2A 2DNZA 2L3MA 3J80Y 1WORA 1KNZA 2W24A 3MM5A 4C3KA 4O0NA 2XGQA 4ZKAA 5B7WA 3PW4A 2PEHA 1X9SA 1C4AA 3GPAA 1U45A 1XR6A 2M4MA 4JP8A 4F2RA 2DCUB 3BEGB 1U48A 4Y28C 3DXSX 4ICLB 3THVA 3SCIE 3QRPA 1TR0A 5KG1A 2CFXA 4NLPA 4NZ6A 1RBOB 1R31A 2W4CA 1IKVA 3UN3A 1VBZA 5D78A 2GO8A 2KM8B 3P6YC 4K4WA 2RKIA 1KOOA 3T3FA 5E3CA 2XI3A 3W5XA 2Z30B 3N5BA 2DR6A 2B9XA 3K5LA 4DSJA 2JEIA 2J76E 1F9FA 2GGPB 1UFWA 2AJ1A 2V8DA 5HANA 4U7UK 1HYSA 4WXWA 5L1JA 4Y2KA 1WC3A 3PFEA 2OAUA 2QX0A 4I2QA 1RT3A 4HYKA 2DR8A 2H4YB 2KL8A 4C8YA 3QRQA 2KZMA 3KHGA 1FKOA 1Q8IA 3M30A 5EWEA 2J5AA 5C24B 5JVHQ 1B0PA 2O1PA 1HKAA 1JB0C 2BYCA 1GFWB 1FTCA 4M5IA 4PPDA 1WI8A 4DR7J 4W4MA 4C11A 4NCAA 1GMVA 4JI3J 5KFUA 4OHYA 4MFBA 3EX7B 1LWCB 2CAJA 3KKFA 2YWWA 5ETRA 2ILYA 2M7SA 3GFHA 3J7ZT 4Z7YA 1T03A 4DFPA 5I3UA 5DJBA 2NPFA 3PYEA 1GTHA 1QUVA 1RWVB 5D4NA 2KG1A 3KHLA 2UXCF 4ZLNA 4QJVA 3HVRA 1YSJA 3H8YA 3RG6A 4V19X 2XS2A 4EMDA 4C3MA 4J5OA 3M32A 2KFZA 2N82B 3BB5A 1RA7A 2NSCA 3BJYA 3CCMS 2APOA 1ZAVA 4ZPCA 2LFVA 5IT4A 1FNXH 3W62A 2UXBJ 2MKJA 1N34F 2GQCA 3MUTP 5LJ5Y 2J8AA 3LUYA 1OYEA 1WKKA 3M4XA 2ZM6F 4YB5A 3BDPA 3C6TB 4PWDB 1FEEA 4RLEA 1EARA 2DT9A 1X9MA 1HQEA 5DO2A 5LSOA 3ZNUA 1M5VC 4O4RA 4PCQA 1MNEA 3R5AA 1H2UX 2COLA 2IDLA 1UZHA 1H38A 2LMIA 3NS6A 2J6UA 3I9V9 3NLCA 4CP5A 3FC9A 3HSGA 2VONA 5DQGA 3TUJC 3HX9A 3I9ZA 1NM2A 2LQ9A 4L75A 2O66A 4RUBA 2V6AA 5KFQA 1NHUA 2HGMA 2QT7A 2XHCA 5CABA 2PFDA 5L1IA 3MDFA 2VG7A 3QMQA 1KD1T 3R27A 3CMES 3CC2S 2VL1A 1GX5A 1YJVA 2J9CA 2AJ4A 1RACB 2V2VA 4NLUA 2BRKA 5LT5A 2DRBA 4V1Ak 2HWIA 3PO4A 1FHTA 4OIXA 1OYDA 1FKAF 4W92B 1RABB 1SIWB 2IM2A 2OI2A 4LR8A 5J2NB 4HHJA 2PD1A 1N5YA 3W8PA 3MMBB 2YKOA 1H73A 4CTAA 2HNZB 2KT3A 3OVAA 3GZ7A 4DR5F 2LXFA 3HULA 5DDRC 1S6UA 4IQXA 3UD4P 1SPBP 4DQPA 1X4BA 2GIRA 2Z56B 1JLEA 2PIIA 4YY3F 1NH7A 1S1VA 4DMZA 3AD8C 1S1WA 4IG0A 5E3PA 3V4IB 4LF9J 3KDNA 1Q7YT 1QAIA 1D9FA 1SC6A 3QJLA 3RB3A 1FXDA 1RT6A 1CEZA 4QWAA 1G7CB 4YEAA 2AJ0A 3I87A 5E41A 3Q0AA 2ASYA 4HEA9 2UUAF 4K50A 2PEBA 1NB7A 1HHTP 1SCJB 5J1NA 4ZOSA 2GCFA 4OI6A 4RUHA 5F0WA 3NGKA 2W9BB 2XNQA 4NLVA 3R7SB 2V4RA 4AL5A 1ELOA 1Q16B 5K14A 4IOCQ 2LECA 3W2VB 1M1KT 4LSLA 4DV0F 4P73A 1X31C 4DV3F 1L3SA 1IWGA 2YBVA 2K1RA 2AMCB 2CDQA 2X51A 3RYLA 1H6KX 1JQGA 4U8VA 1GK8A 2QC3A 4ID5A 4RNOA 2R8HA 3EXCX 4DV2J 2C3MA 2YX4A 1YQHA 3K2YA 2GIQA 4G6VB 3N01A 2W9CB 3OFFA 3H42A 2DNHA 3MGJA 4ZP6A 3A1YG 3NEKA 4USUA 3MOZA 2RRAA 3ZZPA 2E5LF 3L9ZA 3NG8A 1TL3B 2R8JA 1YITS 4FYDA 2IRXA 5IT9U 4DHVA 3R1HA 1KN6A 4IG0B 3TX0A 1HA1A 1R27B 4XTTA 3BN4A 5L8RC 3V4IA 3GIIA 1NJIT 1J5EJ 4ED5A 4DV6F 4KPYA 2RRNA 1FKPA 2V8VA 2C22A 1XTZA 3AAWB 4KGZB 3DKDA 5SZTA 3IO1A 2C2ZB 3TZXA 3BS9A 2UU9F 5D4OA 1KKHA 4ELVA 3MMBA 1DQ8A 4DU8A 4JI7J 3KOAA 4ERDA 5C25A 2AJQA 1EAYC 1LOUA 1PAUB 2MMYA 2OPPA 3IBFB 1LW2A 2WHOA 3PEHA 5F0UA 4KGXB 2XI2A 4EYIB 2DITA 3EMTA 4QR2A 3GIKA 1TKTA 2F8EX 3TARA 1RTJA 2IJRA 2RHSB 3P49B 2IC3A 4ZDNA 4MKBA 3FK4A 2UXBF 1FK9B 3SFGA 2VDIA 3DCAA 4KIAA 3M8YA 2HRUA 4L3NA 5K8NA 3MOJB 3VZIA 4X4RA 5T41A 1VQMS 2E1RA 1VQOS 1VQKS 1FDDA 2NZCA 1OY9A 3TO8A 4CIOA 4P52A 4TYBA 1UJ6A 4ZCIA 2NREA 4IR9A 4J9VA 3HFZB 1JX4A 1TUWA 2ASJA 1CJUA 1FI4A 4NLSA 4K4YA 4DR6F 3A4TA 3W2WB 5E3QA 1B70B 1LXNA 1YBAA 2DNOA 3R7BB 5I42B 1VQ9S 5FLXU 1VI7A 4FDFA 3WX4A 2J9DE 1R8PA 2ZBPA 3C6TA 2HURA 1P27B 3D6TB 4J9OA 5FJ4A 4KR0B 4M5DA 3J81j 2FJDB 3BBBA 4LFAJ 3IC1A 3Q8VA 1KTQA 2HLTA 1A0OB 5KFVA 2BE9B 4GRSA 1KHVA 2FIUA 3C14A 4DSIA 1YZ7A 4LR7A 1PYTA 1GMWD 1UPPA 4F3OA 4USIA 2P9EA 4M5JA 4A48A 3BGRB 4M1KA 3ZZZA 4RW6B 5LSLA 1OMSA 1D0EA 4F02A 2H5EA 1KHWA 2C3OA 2J7WA 2WW4A 4DR5J 2XTJP 4HTIA 4N41A 2Z2YB 1RBLA 1RAAB 2HFNA 3SSRA 2HIQA 3CJ3A 4CQ1A 4X4SA 2AEJA 3OBIA 4YY3J 2MZ1A 4YHHF 3DFEA 3HP6A 2IA6A 3AA9A 1D8ZA 1JLBB 1WSVA 1Z2ZA 1RWNB 2FZCB 1YVFA 3MMCB 3Q23A 4KHRA 3L7OA 4ID5B 3VTIA 5C42B 3RW7A 3NRBA 4I2PA 3RJMB 2DR9A 3T1AA 2J9EA 1TKZA 4U95A 3E01A 1HBNA 4PUOB 4H54A 2RS2A 4UY85 4DR7F 5L9NA 3M9MB 1U2CA 2UUCF 3W2VA 4AFFA 3GQCA 1LWCA
chains in the Genus database with same CATH topology
2L9NA 2IJNA 4NRUA 1S10A 2VKRA 4ZPTR 3SXLA 3BF4A 3PM9A 3EZ5A 1NZAA 4DLGA 3IFEA 2MGZB 4NPOA 3OJSA 3AA8A 1LFWA 3M9OB 1VQ6S 4XK8C 2KT2A 3R5BA 4R8UA 1S1WB 2E5GA 1OQ3A 1IXKA 5GADU 2RKIB 4ECXA 4BDPA 3CDAA 3HHDA 3BSOA 3GR1A 3OV7A 3VAFA 3PY8A 2VG5A 2FGOA 1X0PA 1KFDA 5J2NA 3KG0A 3PW5A 1IKVB 2DH9A 1MMNA 4M94A 4TQRA 2W4DA 2MKHA 1HD1A 1SH3A 3L3CA 1NO8A 3KHRA 1DJ0A 2J9DA 2VB6A 3T19A 3JYTA 5G0RB 4LIWA 2HQ3A 4CT9A 1WEYA 2HS3A 4IKAA 1K1SA 4WFYA 4DL5A 3GIJA 4DN9A 2XB2D 1ROFA 2XMJA 4EBDA 2RF2B 1S1UB 1K0VA 4YUDA 3UQSA 5KFXA 2C3PA 5KT3A 1Y7PA 2ZOGA 3UD3P 5U47A 2ERRA 2M52A 1WF1A 2B5JB 3I6PA 3HDSA 2OLWA 2W7AA 3M6WA 4HT7A 1YGYA 3GWCA 4RNHA 2W25A 2VC0A 2I8EA 4FS1A 1H0HB 2BM0A 2YX7A 1MMLA 3EPIA 2XMTA 3V6DB 3PRBA 4KGKA 2ZHBA 4DUYF 1Y4ZB 2GMJA 2HGLA 4YMEA 4FNHA 2R4FA 3SSQA 1DFDA 2FJAB 1UVIA 2OPRB 2LDIA 1XR5A 1GNKA 5AXMA 2YNFB 5EDWA 4YFUA 3T5LA 1Q8LA 2R7QA 5A8KB 1CLFA 4OZ0A 3LALA 1ZPWX 3HF5A 1RA6A 3TA1A 2DGXA 4WXOA 2WRMA 3I55S 4A8KA 1Z4UA 3WZ0A 1S6QA 2W7PA 4O4GB 2ZOFA 4URSA 5HMXA 3K59A 3IGNA 4C11B 1HNIB 2HHHF 2HVHA 4C2MA 4QR1A 3BSCA 2PN6A 1UKUA 5BJRA 5KT6A 3PX6A 3D1HA 3DYAB 2FLPA 2R7SA 4R0JA 3I56S 4KHPF 2RILA 4IRCA 1D9DA 4DJBA 4ECTA 4KPYA 3UW1A 2HPUA 2HS4A 2MJUA 4IFVB 2YNGA 4RWXA 3KHHA 2AQ4A 4WF9Q 1N5TA 4ZP9A 2WONB 4TU7A 4N76A 4AXJA 3G4SS 4TQSA 1TP7A 2R2SA 4BWJA 5HMWA 3UE2A 4Y34A 3DOKA 1FD2A 2FHJD 1XMBA 2YH1A 4EFAC 3PVXA 5G0RA 1U47A 1VQNS 2KRBA 4J9RA 4LMZA 4D3GA 1S1TA 2FPHX 4I1TA 4NXNF 1HI1A 4KRWA 2U2FA 1HMVB 2M9KA 2RSQA 4NX9A 1VBXA 3Q2SC 5BYQA 2VA3A 2CQ1A 4RW4A 1VQSA 4PXBA 1SI9A 4O3RA 2Y1IA 5HN0A 3ISZA 2OKQA 4KKOB 1FJ7A 2OD6A 2ZH2A 2MHNA 2QZ8A 2EFNA 2FLLA 1QE1B 4P7TA 3KK1A 7FDRA 2IBOA 1R43A 4CNYA 2VBXA 2JEFA 4Q2MA 1GTEA 2QRRA 3LP1A 4LFAF 2HHXA 3Q8QB 5G4DA 2ZHAA 4YOEA 3HPOA 3B8HA 3MTJA 1X4EA 4PQAA 2PMZD 3CCES 3O1LA 1B7FA 2EFQA 1TKZB 2DH7A 5GVQA 1NNDA 4PUOA 4I2PB 1HI8A 2L9WA 2Z8QA 1N5VA 4PXCA 3S7RA 3TVYA 2N3OA 2YKQA 1SUQB 2W4PA 4ZCMA 2WSFC 5AXLA 2QLWA 3NL0A 4PQUA 1FRLA 5HMYA 2EC0A 4JV1A 4Q0BA 1WG5A 3E51A 3RW6A 1HFEL 2MSTA 4KV8B 2PE8A 3DLKA 4DR4F 3MM8B 1IR0A 4I0WA 2D74B 3QIPA 1W2IA 4OI2A 1DQAA 3OJUA 3V6DA 4WFNQ 4LSNB 2HMIA 2JLGA 3K5PA 4RBUA 4M8LA 5KT7A 1ZTTA 1Z1ZA 2RB7A 2UUWA 3GFXA 1WG4A 3ULHA 3H5XA 4ATNA 4PPZA 1EETA 1F5CA 3CJ4A 3NWGA 3M8QB 2ZC4A 2XS7A 2BE2A 3DM2B 1RKIA 3G86A 5HO4A 3IR5B 2DHSA 5L38A 5DQHA 1S6PB 4MTPA 1ZH5A 1N8RT 1QAJA 3TQ1A 1TZ0A 1VJWA 3MM8A 2R7TA 3GMGA 5GAHU 1RT5B 4X65F 1BQMB 3PJWA 2ZH3A 3CF5Q 2IMWP 1HI0P 1HW8A 3T9ZA 3K5MA 2XY6A 4E8UA 1BY9A 3CVKA 2DH8A 4Q45A 1EP4A 2MQNA 2E9ZA 3KLEB 4KAIA 3KMSA 3G8TA 4GMKA 5KG4A 2G9OA 1CSJA 4NYPA 2CQ3A 1KRPA 2V8HA 4ID8A 4RW7B 2VG5B 3BQ2A 3O3LA 2UVVA 4DOZA 3AH6A 1DHMA 5HBMB 1V3RA 1GXUA 5C5JA 2I5JA 4NLDA 4ED0A 3UI3A 4DEZA 2VFSA 5AE1A 2XCPA 4HLBA 4LF4F 5J2QA 3FMBA 2B4VA 3KLIB 5FDLB 4WKYA 2RRBA 3IBWA 2V94A 5B0BA 2CJQA 2QA4G 2N4CA 4C98A 1M5KC 3IS9A 2L08A 1FNOA 1VS3A 1WHVA 3FGVA 2UV8G 1Q1KA 5F8MA 5KFAA 2UXDF 4ZVGA 3CWJA 4LJMA 2RS8A 3IAS9 2D1CA 2EPIA 5A8WB 3GV8B 1AW0A 3R1LA 3M2UA 4NOHA 1ULRA 3KLFB 4ECQA 1P8GA 2HHSA 3TUZC 4ZPBA 2AV5A 2FJEB 3S8SA 1ZETA 1L3TA 3NKYA 3DN9A 1HPZA 3CJ2A 4A8QA 4DSKA 2FHOB 4LSLB 2J0XA 3ZZUA 1MU2A 3MMAB 3NAIA 4C4WA 3PX4A 3R5DA 1O5JA 3BR8A 1P9QC 1HWLA 3J81Y 3MFHA 1F5AA 5EN1A 3OXGA 3KTQA 3CCLS 1Y0HA 4MIWA 2RVJA 2JEJA 4OX6A 3BGRA 4B3SF 1BQNB 2EW9A 3FCHA 4CO1A 4CO4A 2WBRA 3D1OA 3N4WA 2XNRA 2EK1A 5D4PA 3AY0A 4ELUA 2HGNA 3NBPB 4OZJA 3OLBA 2YH0A 1TAQA 1JKHB 1PO6A 2A2CA 2KRRA 2D3UA 4X2BA 1OSCA 3F41A 5HI7A 3RRHA 5I42A 1FDBA 3P5TL 3DNCA 2ZNYA 3WC0A 4CO5A 4C9DA 3OQ2A 3N79A 2CPZA 2C3UA 5CYQA 4CO3A 2EG2A 5CYMA 4AE5A 3NCRA 2GJIA 3WBZA 1JWWA 2MY7A 5IQQA 2CPYA 3DRPA 3UPFA 4KC5A 4ECYA 4PRFA 4FZVA 5L9XA 5CXTA 2JZ5A 4H4OB 3I31A 3KYLA 5LXRA 3RBDA 1U1OA 1DTQA 1UA1A 3MM6B 4NRTA 3PW2A 4WE1B 1IJEB 4DN0A 1TKTB 1NK9A 1QM9A 2PI4A 2WTFA 4I68A 3KK1B 1K1QA 2EWHA 4OJGA 2JX2A 3D1QA 2ZE2B 4TU9A 3ITHA 1SKWA 2ZD1A 4KSEB 1FJCA 3PZPA 2E1MC 3FRZA 2CQ2A 2YNHB 3GYNA 3LAKA 2B5JA 4OI1A 1BWEA 1FEHA 5IM0A 2Y0SD 1IKYA 4BWMA 2YWKA 2EG1A 3HZGA 4KQZA 4ED6A 4DS5A 1YJ9S 4KE5A 2IYGA 3KK3A 2V4QA 1I1GA 1GH8A 3MEEA 4DFKA 3MECA 5KTQA 4P6QA 3MPWA 3DLGB 3IRXA 1VOMA 4EYHB 1APSA 2CPFA 1NJZA 3PFOA 2ZH9A 3K0JA 1RKJA 1NEEA 3OTCA 1KLMA 2FVQA 2KB2A 4A8WA 3OTEA 2AW0A 2R8IA 1YI2S 4JV0A 2CPEA 2R7UA 1U8SA 2CJBA 4N5SA 5K14B 1QUPA 3D0HE 2XLJA 4RNMA 4K4UA 3ENWA 2AX0A 5GAEU 2ROPA 2R7VA 4PKDB 3CMAS 1UEVA 1QVFR 1FE4A 1CQMA 2OSRA 2ZDOA 3AB4B 5HMZA 3DU5A 3KLHA 1PC4A 4V19J 4FBTA 2VASA 2BV3A 4QWBA 3OL8A 5KFNA 2EBEA 3FVYA 3LW5C 2J0WA 4C8LA 1X5PA 2QA2A 4L6V3 3V4MA 4WCEQ 1SJ4P 1HNWF 3DYAA 4B9VA 3ENVA 4GKKF 3TAQA 1REVB 4Y2AA 2ZITA 1TKDA 2F7VA 5T7LA 5LXYA 5H1SV 1VHFA 1LWFA 4U6PA 2UVRA 3VCDA 4RUCA 4BS2A 3VWSA 3RZAA 4TY8A 1N6QB 4EEYA 4HTJA 4EO6A 3CCSS 2BACA 1KQGB 4DWIA 1Q4RA 5DDPC 1X5OA 3UNGC 4WK3A 3TVKA 4X84A 5C42A 4IDKA 3KLVA 3ETOA 5AE2A 1U1KA 4LF7F 1U2FA 1UW4A 4XPCA 4K4ZA 1HARA 4GC7A 1YTYA 1LKZA 4C7QA 1RT4A 2MSSA 1YJNS 3N6NA 2HHQA 4F3MA 2B4OA 4OZ5A 1UP1A 2YNHA 2M8DB 5KT4A 4YB7A 5KFYA 3F44A 4ZS6A 3DLEB 1VQ8S 5A8RA 1AXQA 4KFBB 3CD6S 4X4PA 3THTA 3S6EA 4R5PA 1ZBTA 2DHXA 2ROEA 4NCGA 3LP0A 1TK8A 2OD4A 2QYCA 2LLZA 3ITHB 1GAOA 2Q1LA 4J9KA 4DSFA 2BQRA 1GQEA 2DK2A 2LA6A 2KN4A 1ZAXA 3ZZTA 4LFCF 3TUIC 3HM9A 4QCLA 4Q8FA 3OXLA 4KGMA 4BCAA 5I3UB 1O51A 2HG4A 2PA8D 3I5CA 3I96A 4WTYA 4YB6A 2YVSA 1S1XB 5E7OB 2JVOA 4O3NA 5KG5A 3JSYA 1CVJA 4RU2A 1VIOA 2CZVC 2MYFA 1RT2B 5CQGA 4QIGA 5KFPA 5I3PA 2LYVA 2LQJA 5D8HB 4UOCA 3HKZD 1QY7A 4C8ZA 2RUGA 1REVA 1DAXA 1YRXA 3LP2B 4LT6A 2ADBA 3H2VE 1IM4A 2VKZG 5DDOC 1E6VA 5KFLA 4MKAA 4AUKA 4ELTA 5DLGA 1V9OA 1JK9B 3NAHA 4EZ6A 2EK6A 2C28A 1RT3B 1PC5A 2VOPA 1Y3JA 1YJRA 3PNIA 3UFCX 2D3OR 2M88A 3FEZA 1JLGA 1JLFB 3G6YA 3NMAA 4EZ9A 1MROB 1R89A 2KFYA 3LAMA 2KXNB 2E9TA 3MTKA 4NLTA 1JMTA 1N36F 1FE0A 2IHR1 3QIDA 4NLRA 4U67Q 1VQ4S 2HYIB 1WELA 3KG1A 3MM7A 3QYYA 3SMZA 4ECSA 3S1TA 1VFJA 2XLKA 2YKAA 2VBZA 3H2LA 3KK3B 4NA2A 3AHPA 3FSIA 1S9EA 2V2KA 4OHXA 2ABYA 3H59A 4JI0F 2AGPA 1U24A 2W9BA 5IM0B 3M2UB 3PR4A 4F8RA 3DLGA 1ZOTA 1X9WA 1UA0A 4QWEA 2IM3A 2HFZA 3MZIA 5FDLA 4QZVB 3OPKA 1CC7A 2GJ2A 2DNMA 3FEXB 1FRJA 4QW9A 1IKYB 3PEJA 4FS2A 4IH6A 1RT7A 3IGVA 2RE1A 3TVZA 3M1VA 1ZM3A 4WZMA 3J7Z5 1X4FA 1XK8A 1VK8A 1MSWD 2HWTA 2RDJA 3L09A 4CTAB 4HKQA 4K4SA 5KFBA 1TAUA 2R7XA 2V8GA 3LOUA 4WK1A 2X3GA 5BYRA 1QLNA 3DXBA 3BQ1A 4DFJA 3DRPB 3HVTA 3ONQA 3K5NA 1FRXA 2CQIA 5KT5A 4XDCA 1SL1A 1M0SA 1S7HA 2O5DA 1DTQB 2BANA 2NZ4A 2KDOA 2DNPA 2ADCA 2WOMA 1JLCA 3QGGA 1WI6A 4BC9A 5KFIA 4M63A 3BSNA 3C46A 1E6YA 2GQQA 4O3OA 2B4UA 5J2MA 1FESA 1T3NA 1DARA 4JI8F 5CYMB 4O3PA 4M95A 3R3TA 2GC8A 2OTLS 1DLOA 2N4DA 1Y5LB 2VFRA 4FN5A 4Z37A 1S6OA 2UV8A 1VC5A 4NYOA 1FO1A 1WHYA 3Q2TC 4B3RF 3QGIA 2UUTA 3DDKA 1LXJA 3GE9A 3QIPB 1R8BA 2P6TA 4FVMA 1U1NA 3PJXA 5HROA 1HWUA 3PACA 4HH0A 1RJJA 1X4HA 2OPSA 2FTRA 1SUQA 3FFIB 2DNNA 4QOTA 2GMLA 2NYIA 1KLNA 1C1CA 3I0RB 2HVIA 3BR9A 3I82A 4CO2A 2XCAA 4RNNA 4I64A 2C42A 2DO0A 4FF3A 1NRKA 2E1CA 3I4HX 5AE3A 4EWTA 2AYBA 2HFOA 3D0IE 2D9PA 3DHXA 3DRRB 1OSDA 2KYXA 1QSSA 4C0OC 5KG6A 4DL2A 4IYQA 2B9YA 3U7JA 2PGCA 3HHNB 1RT6B 3KLIA 3HJFA 1WTBA 4K4TA 2B3TB 1RI7A 1S0NA 2FJBB 4IQMA 4Y2CA 2ZZNA 5KG0A 4KB7A 3FDSA 3TA0A 3H25A 4IUFA 2E5IA 2BJDA 3DOMA 2ALZA 2LEBA 2DGVA 1R8AA 5F8NA 3HI9A 2D9OA 1DQ9A 2D41A 3VQTA 3TAMB 3TW0A 4RW4B 3NS5A 4UW2A 5FLXY 3CC4S 1H3DA 3CD7A 2R7WA 2GW8A 1MWZA 4ICLA 3CCQS 2B0GA 2HRYA 3GIMA 2YX1A 4OHZA 5E5NA 1FA0A 1T8EA 5IT9Y 3TANA 5J1EA 5MLCV 3K57A 5DM7Q 2QLXA 2AU0A 4Z2XA 3TI0A 1S6PA 3M2VB 4LF9F 2V0NA 4GO5X 4ZPAA 3GV7B 3RAQA 1FD8A 4YDXA 3F73A 2XC9A 2E5JA 5F41A 3KK2B 1JLFA 1JLGB 2JC1A 2PO4A 1HWIA 2MQLA 4IFVA 3PXGa 3VAHA 1M5OC 2J7UA