5E8DH

Crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPLNDKTKYDPKFQGKATITADTSSNSAYLQLSSLTSEDTAVYYCSRGGGDPVFVYWGQGTLVTVSAAKTTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Proepiregulin
publication title Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dH02
5C0BD 1RVFH 2IEPA 1RUKH 4APQC 5F6IB 2C3VB 4X83A 4QRUA 2YPVL 1KCUL 2CRZA 1UWXH 2L0DA 5DVMA 2DKMA 3IDUA 1OAUL 3WFCL 5KSBA 4NZTL 4QHUB 1NAMA 1AKJD 5GS0D 2CLVA 2CK0H 2YSSA 4DKAA 4KY1H 4TTGA 1CR9L 2W0PA 1KYOJ 1P4BL 4BFBD 2VOTA 2XQYG 3SCMC 3N1QC 3O3AB 3C8HA 2BXYA 3CSPA 2VL5B 3MXVL 4DTGL 3FQXB 4E0RA 1D7FA 3QP3A 2H6PA 4FXKB 5ILTL 3V52L 2NY5H 3BKYH 5EU3B 4I0PD 2XKSA 3B5HA 3DVFA 5MEPB 2I9LB 4CVUA 3RX7A 3MRHB 4V2CB 5ISZA 1NSNL 1VGEH 5JLZA 3O8XC 4CN1A 3SDDA 3EJZD 3BWAB 4MQTB 1M71B 4G7VH 5J1AA 4GG8B 2ENYA 4QGTA 1LDPH 4QRPB 1BFOA 3C8KA 4JREB 2CKBA 3MROA 3NH7H 2XN9B 3R1GL 2KUTA 4OFPA 1MCPL 5CEXA 3K0WA 1J1XL 3LPFA 1NL0H 3LH2H 5E2VL 5FA4A 1KG0A 2FLRT 1ZV5A 4NRXB 5F7MC 4U31A 4MJ4A 1YEEH 4JGMA 3F7VA 1U91B 2Y5TB 2J8UA 1MHEB 1A6ZA 1ERNA 3ZE0E 3QG6A 4RNRB 1CICA 3UJIH 1G9MC 4BKLA 4TULL 1JNLH 2HRPL 1SJVA 2VAAB 3FQWB 4TTDC 1VFMA 2DYPB 1DVFA 3LEXB 5BMFL 3WEXB 1NDGA 3C9NA 3TH2T 3IVKB 3WIHH 4XC1L 3O45B 1SVZA 4MA8L 4P0DA 3MV9B 4UTBL 1DQLH 3VXNB 2YMXL 3ZTJG 5C0IA 1SY6L 4PJGF 4V1DD 1XCTA 2W59A 3H9HA 3P4MA 5EU6B 3VXMD 4AIZA 4QCIB 3BD3A 1UJ3B 1NMAL 3EHBD 5IT2L 3FO1B 4HWZA 5F1IA 5FECA 2FWOA 3WLWD 4PRAA 5IWLC 1EHXA 5DRXA 1GOGA 3MRMB 4E5XA 1UB5A 6CGTA 1FNGA 3QEHA 4Y1AB 4P57B 4ZAKC 1YEHL 4G8FA 4IMLA 2VERN 1WZMA 1NGYB 4HUWB 3DV6A 4LNRB 1RSFA 4KHXH 4MSWB 4RWYL 1AFVL 4JM2B 4JY5L 4ODHH 4RGMC 2F53E 4GLRH 1YEDA 4EN3D 4JKPH 3KPSA 2YRLA 3HPJA 1RURL 5JXAL 4Y4HB 3MREB 1N6UA 1CD8A 3QEGL 4M6MH 4U1GC 1X7QA 3BRFA 4PJ8C 1AR2A 3E8UL 2LE9A 2CH8A 1ONQA 4TVPL 3IFPB 3HPLB 5EBWA 1CD0A 1IGTA 1Q9OA 4ERSL 3NCYP 5BRZD 2PCPA 1IM3A 2YXFA 2KZWA 4XPGH 3V2AR 1FZOA 3O6KH 2FX9L 4P9HL 4Y19E 3EJJX 4HS3B 5EG6C 1NBZB 4ZOBA 4F15C 1KYOK 4E42A 4HJJL 3MGTA 2P4AB 5J3HC 4KTDL 3Q48A 3HA0A 1PBYA 4MAUL 4NZJA 5DJYA 2Z92B 3KGRA 4JRYE 3SKMB 4BQ8A 3FZUD 1FYHB 4NDMB 2OP4H 2EIBA 4PGZA 3RNQA 3RI5F 1UGNA 3LMJH 4XNZB 3CH8A 4LSUH 1ADQA 4QNPE 3UZQA 2GTZA 3KPTA 4K8RC 1A1OA 4UQ3A 5AZEL 1HXMA 3QPXH 1JZ4A 1RZJH 3GKWL 4XNXL 3JUZA 1A6TA 4NSKA 3D3VD 4IS6A 1NFDE 1JUFB 1OAKL 4F58L 4GRWF 3FMGH 3HC3L 4PJDE 3IDYC 4NGHL 5SWZE 1Q94B 3BH9A 2GITB 4X9BA 5CHNA 4EVNB 3U36A 5DJ2A 4PJ7F 2Q6WA 2VDQL 3MNZB 5BVPL 4TUOA 4IRSB 1TTGA 3K80A 1DQJA 4M7LT 2XKNB 3ZO0A 3IKKA 4OLZL 4QY8B 3S35H 3MLZL 1GPOH 2CLZA 1YMMB 2EKJA 2B0SL 4RISH 5EC1B 1M7IA 5FGBC 4UDUA 4YHIB 1DBBH 5D1ZA 4JDVA 1TJGL 2V5YA 3IU4H 1AE6L 1IBGL 4Y2OA 15C8H 5IB1B 2V7HA 3V7MA 5CSZB 5F9WB 1WTLA 4ZUTB 4OKVA 1LO4H 1RU9L 1HEZB 3I02A 4LIQL 4Z7VB 5F7EL 3T2QA 3TBWB 3SDCA 3EW3B 5FYKD 3MJ9H 3CVIL 3V6FB 1JPTL 4C4KT 3C6LA 3JVGC 3FTGA 4G43A 4PGCB 5A3ID 4QRSA 1ZA3A 2BJML 1JPGA 4WI3A 4YWGH 3GMQB 2CDGA 2QV2A 1ZA6A 2Q7YA 4EQ2A 4JCLA 5KZCB 1BF2A 4I3SH 3HNSL 4M8VA 4P3CL 4WUKL 1LNUB 1MI5B 4WFHD 1A8JH 1S9KC 4JFDB 2AKRA 4LSVH 1B2WL 1TJHL 2WZPD 1DANU 4LU5H 1ZVSA 1XIWB 1JNNH 1I1FB 4N90D 4Y19A 2NY4C 5E70A 5IJKA 1LEIA 5D5MF 3EYQC 5KSAC 2P5WB 4PUBH 3T0WA 5A43C 2ZUQC 4DVRL 1CDYA 2NW3B 3MRCB 3S98A 2KL6A 1NKOA 3FOLB 3VFPA 3GSRA 3UTPD 2VXTL 4CMMA 1RUMH 2NY1B 2PTUA 5SX4H 3S5LA 1M1SA 5C2UB 4ZNCD 1NC4D 4OAWB 5FOBA 3UTZA 3NFPA 4S1QH 4MQXC 3S88H 3WKML 1FV1B 2VXVL 1DE4B 3C60B 3V4PH 5JA9A 1QFUL 4NO2A 3EYFA 1RZ7L 2EDQA 3QUMH 5T3ZL 3ELAT 1C7TA 2OL3B 1KFAL 5J1SC 3BDYH 3PGCA 4WJ5B 3IB4A 3QDME 4PJDA 4M3KB 3GSQB 5SWZA 3NTCH 4G9FB 1HH9B 1AGFA 4XMPL 5DWUH 5IMKB 3NIFE 1MQKH 1KEML 1DUZB 1T6VN 2ED7A 3M1BA 4UB0H 3O9WB 1BZQK 4RFOH 4DGIL 1QSFE 3S36H 1EXUB 4HUVB 3PWNB 3UDWC 1J5OL 2NY5C 1JL8A 2DF3A 1FL5B 2E7BA 3PXJA 4JG0L 1U6AL 3FONA 3TPUA 2NY0C 4J8RB 5E2WL 1ZANL 2IGFH 5ACLA 3WFBH 2DQFA 5DMIL 4C4KO 1IKNC 2ADJB 3D9AH 1J8HD 3WE6B 2NLJA 2A74B 4WNQB 4H1LH 4NQSB 2OTWB 3VI3F 2YS4A 2OZ4A 4OI7A 4F33B 4OQTH 3QFJD 2DN7A 2YPKA 2DI8A 4XGZB 5C0GB 4DN3L 2NZIA 5B4MC 2YPLB 3V4VH 1D5XB 4CNIB 5E6IA 4Q7DA 3QXWA 5E1HB 4P9ML 2Q3AA 2DDQL 3TBTA 4NQED 4KDVA 2Z31D 4KMLB 1DTUA 1I8IB 4S2SA 3WSQH 4Y16C 3GIZL 1NGPH 1JPFA 3VFUB 2W60A 3RDTD 1U8MA 2ZNWA 2YKLL 3VMNA 3QUZD 2FEEL 2R1XB 2X4TB 5I73B 1FIGL 2WSKA 1A6WH 5D9SB 2DM7A 5LGJA 2BCKB 5KTEL 4NHCH 7FABH 4GAYB 3WS6C 5DSCA 4CVXA 4JFDD 4LGRB 2X1QA 1CDUA 1CFNA 4Y5VB 4PD4J 5DURB 1UZ8B 1XIWD 2PTVA 3PGFL 2LVCA 4NWUH 1VEMA 3O41B 5JHDE 3IFOA 3HMWH 1QLEL 3I2CL 3I6LE 4P23A 4XWGH 1RMFL 5IEHB 4HC1A 2IG2L 5IVZA 4O2CA 1AO7A 1IILE 2MKWA 3P0GB 1EBPA 5IOPA 4YIQA 5I8CB 1BFTA 4ZUVB 4HKXA 4PGDA 4WWKA 4B41A 3MJ7A 4MWFB 3UYRL 2MPAH 3PHSA 4MQSB 3WIIH 4JHBA 3QDMA 5D6DC 3ULUD 4AQ1B 4M5ZH 4WEMB 4R26L 5CEZD 3OKOA 3TA3B 2YR3A 3VE0A 1KC5L 4R2GB 4JJ5A 2P7TA 2BSSB 1KB5A 1UWEL 4GS7B 5DJCA 5FUOL 5HPMA 1FG9C 2YD8A 1N8ZB 3A6OA 4Z7QE 5I9QB 1BOGA 5C0AE 2W9LA 1NCWL 4XMKH 3WFDL 4OGAD 2R23A 3ZSTA 1E27A 2Z8VC 4YGAB 4BQ9A 1YYLL 3Q6FB 3TZVC 3TJEH 3VFNB 1A2YA 1N6QL 4FFZL 2GJ6D 2FCBA 3IGAB 4F7PA 4OZ4A 3O9WD 1SJXA 4F8QA 3DECA 3ZE2E 2ADIB 3KWWB 4O9HL 4ZUUA 4KROB 4HCRA 1TFHA 5JMRA 4AH2A 4OJFL 4AJ0A 1U8NB 4D3CH 5E6YA 1I8LA 5EULV 1I3RA 2XA8L 4UAOC 4Z95L 4J6RL 2ZPKH 1ES0B 3MGOB 5DHVB 2FX7L 4Z7UE 3BFOA 2WIIA 1MFCL 1VA9A 2R1YA 1ZHBB 1KSRA 1FVCA 4EEEA 2JIXB 2FJFA 3STZB 1QRNE 3OR7B 3VFMA 2JJTC 1FZMB 3MOAH 4NYLB 1EUTA 4X7TA 5CILH 4K7FB 4BFIA 4XAWH 1AD9A 4WVRA 1RZJC 4PG9B 1UXSA 1R6VA 4JQVA 3VWJB 5BCAA 3VRIA 2GIYA 4NUJA 1QKZL 3BIAX 3CC5A 3VFRB 4GH7B 3UTSE 3AVEA 3GSNH 4Z76B 1OCWH 3S35X 2XTLA 4QRQB 4PTUB 5L8LB 2QKIA 5INCA 3SDAB 3NA9L 3W0WE 1SHMA 1F8TL 4PRIB 3TP4A 1A6UH 5GIRA 3PE9A 5GRYA 3JV6A 4KK8D 5DRWB 2FGWH 4LAQH 5B3JE 3ARGD 3DYOA 3WD5H 5D1XD 5JHDA 2VQ1A 3WO4B 3SPVA 4AZ8A 2IALB 3RKDD 4L3EB 4N0FA 1LEKA 1Q9WB 3O6FD 4DVBB 1HI6B 4HIJB 4XP6L 5TGBA 3GMNA 2ZWLT 2ADGA 5HDQH 1G7QA 1RZ8A 1OWRM 1WCBB 4LFHD 4JO3L 4WEBH 3F65A 5D7KD 5EZLB 4PGBB 4Q9QL 1YEFH 4K8RL 4LCYA 4ONHA 5IM7A 2YUZA 1R3LA 4X7SH 1YYMH 4U6XA 1SQ2N 3S7GA 3OGCB 2I07B 2X89A 3OR6A 4KUZL 3E3QE 2R2EB 4PJFF 2IC2A 3ILPA 1E6JL 3C6SA 4OZFG 4TYUA 3IXTB 4PD4K 3QH3A 3DX7B 3N1PC 5C0AA 4S1SH 1OARH 1RPQA 3VA6A 4UIMB 5FO9A 4KFZC 4LQFH 3QWRA 5IGXL 2MSPA 2CJUL 3AB0B 1I4FA 1ZT4A 2VN4A 4F57H 2K7QA 5ICZA 5I1HH 4ZXBD 1N64H 3P0YL 3T4YB 4P2RD 3KXFE 4CBPA 2JCCB 5TF1L 4LCCB 4LCWD 2BFVL 2UWEE 5I1CH 3NAAL 4B53A 5FIEA 5DXWA 4OCMC 2D31A 3QQ3A 1ACYL 2YC1A 3WV0A 1Q72L 1AC6A 5TJWK 3GJFK 2F15A 2XPGA 3QAZC 3O4OC 4NO0A 1PLGH 4N8VG 2D4DA 4CADA 1J1PL 1XZ0B 2FZ3B 3PWPE 2F54E 1BZ9B 1YEJL 4Z7UA 3QFDA 4X6FA 4BQBA 3EFFB 4QYOB 4WFGE 1KEGH 5C07B 5GS2D 4JQIH 2HFEA 2EDHA 4F7TA 2B1HH 5ITBL 2QTEA 4JFOA 3T0ED 5IFHH 1WLHA 1KJVB 4NNPL 5IMOA 4R4BB 2AJUL 1CBVL 4J3XA 4XX1G 4U7KA 4G80A 2J88L 4OCNC 5ESAB 3QT2A 3SE3A 1NFIB 5JW5A 3S36X 5D7JC 3IAPA 4LHQB 2J4WL 5KVFL 3MRIA 2MKLC 3C8DA 3T09A 2BNRD 1HQ4B 3D6GA 2XKUA 3X3GH 1T80A 5D70H 4DKDC 5CJ8A 3QIBB 3D39D 2XYCA 1JWSA 2OJZL 1FYTB 3DBXB 2R15A 3VGDA 3K8MA 1G7HB 2P42B 3QO1A 4NRYB 5I1LA 1KPUA 3BZFB 2VITA 3OX8A 5FYJD 4FQXA 1J18A 2X1PA 1UM4H 4I13B 4WHDA 4OZFB 4K3EH 5EOTA 2CLRB 1JYWA 1FN4A 2BVPB 5AUMA 2ZCKL 4YXKH 3BT2H 3TO4B 2VMFA 3TBYA 3T3PF 1RUKL 2AJZA 4P4KB 4NQCB 4X6BA 4HD9A 3GJFA 1AD0A 3IXAA 2EC9U 5DQ9A 4YPJA 4CKVX 4GJTB 3EDKA 5BXFB 3BSZL 4KJWD 5DD5H 3S8WA 3CFKB 1MLBA 1QA9B 4XZUA 3BISA 1IL1B 4D0DA 2JJUA 5FF6A 5FM8A 3RIFF 1CFBA 2GY5A 3QIUB 4GAGH 1EEUA 4N8VB 3OZ9H 3I6KA 4JZJB 3TBVB 4TNVF 1YEGL 4MDIA 4MLSA 2F8OA 4G8GD 3O3BB 4XCYA 4XNMB 1L9MA 1X6LA 4GOSA 2NY5L 4WHYG 5CAYB 1JRHI 1CWVA 3ULVH 1P2CB 3OF6A 2NX5E 3V6ZA 2VDNH 2XWTA 3IDNB 4X5WA 1J05B 1BBDH 1VGEL 2GSGA 5F89A 2EDEA 3TIEB 4PJ9A 3ILQC 3SGDI 5DDHA 4ODWA 4G7VL 1FGNL 1LDPL 1UCTA 3UTTD 1OTSC 4RAVA 1JTTA 3ARPA 4D94A 3NH7L 4U1HA 3RJDA 2BNUB 3QXAA 1ZHNA 5DFVC 4NQXA 1RJYB 2P49B 3CU7A 4RIRB 1UQSB 3KLHC 4PG2A 1BAFH 5HGAA 1YEEL 1ZLUK 1Q9KA 1HH6B 3K81A 1X3DA 4ZUSB 2HFGH 1R0AH 5F9JA 2AI0L 4WO4A 5DA4A 3IJHA 4X6CB 5GGUA 1JNLL 1XF4B 4YDIH 5B39G 1Y0LB 3G6JA 1IAKA 1AQDA 4WI4A 1GGBL 1UKQA 1A7BA 2DQJH 1G6RB 4O5LL 4PY8J 5GRJH 4HJGA 4NKIH 4JM2F 5HHNA 3CIQA 5F9OH 5C0FA 1DQLL 4LPXA 1TZGH 5GRXG 3RTQD 3LV3B 5HDBF 2DQUH 2HH0H 3ARDD 5FUZH 2AP2A 2J12B 1KPVA 4LBEB 3UJJL 3ULVE 5EUOE 5GRZA 2GHWB 3CZFA 3S96A 4RAUB 1ZT7B 1MAJA 5HGBB 3BH8A 1EHAA 5IQ9A 3FJTA 1ZGLM 4HX1A 2R56H 1S3KH 4IJ3C 1G7PA 1CGVA 5DI8B 5ISZD 4CJ1A 4K3JH 3CDGA 4NQCD 1D9KC 3MFFB 1I1AB 4BA8A 2R39A 4H5SA 4HH9A 4OZGF 2PF6A 2SEBA 4KH2A 4QXTA 4B0MM 5B8CC 3X12A 5IUSA 4JKPL 4FHBD 3UPRB 3MLWH 5D71H 3KPRE 2AXGA 2VLKE 1IEBB 4A6YB 3RZCA 4M6ML 3A6CH 3IJSB 3LB6C 3WL9A 1PKOA 3TCLA 1NCUA 3FO9A 3BPLC 4Y8DC 5LAXA 3U30C 4L8CB 2P43B 4WRLA 1SYSA 4PLJD 3JXAA 4WI6A 3L7EB 3W5MA 1X5XA 4XBGA 5LWYH 1CXLA 4OTXL 4XPGL 3L3OB 1CICD 3O6KL 1TZHA 4Z7NF 4QTHB 1I8KA 3VGFA 5B39B 5F7YC 3S37L 1JF6A 3A0OA 5DF0A 1QR1B 5ICYA 1FFNB 2HJFA 5FDWB 3IDMB 3CGTA 2VR5A 5F7KC 5F97E 4JFXA 2R9HC 4GRMA 5IHUH 3MRPB 4M00A 4QRRD 1G7LB 2BSTB 4KKLC 4WV1B 2P8MA 4Y5XC 4ZTPH 3ZE1E 4NKMB 1INQA 5DJZB 2YZ1A 2OP4L 3MBXL 1MCFA 2XZCL 1RZIA 1CU4H 3BI9X 4X9GA 5DQJB 5GZND 3DHMA 3LMJL 3ALWA 4FFWC 2EDJA 4WTZG 1W0VB 5I1AB 3EDDA 3H7LA 1K4CB 3QPXL 4MQ7B 3FO0H 1RZJL 3ARFD 1BQHA 3RZWA 3WJLC 4WW2A 2GUOA 1HCFX 3GSXA 4PJAE 2AV1B 3MV8B 2NR6C 4RA3A 3JTTB 3C2AH 1JK8A 4U6HB 3BW9A 3L3JA 3RWDA 5L0QB 4KGJA 5F7DA 2A0LC 4ZTOL 1MWAH 4MVBC 5EUOA 1F58L 3ROLA 1IAII 3QZWA 1GPOL 1EPFA 5GJTH 1S7VB 4XTRC 1KJ2A 4RISL 3KPSD 3ISWA 1I1YB 4TOYH 3I84A 3IU4L 4ZSOE 5T3XD 15C8L 3T2OA 1XEDA 2Y06H 3G5ZA 4DW2H 1LO4L 5H2BB 1S9VB 1EAJA 1MH5A 1H3GA 5C09A 4X8JB 1MRCH 4ZFOA 2V2WA 3BDBA 1B90A 2OR8A 3UBXG 1PYWB 2HLAB 3SCMA 4GKNB 3PQYD 4YWGL 1S5HB 1FLRL 1XCQA 1LK2A 5C0CB 1YY8A 3OXSB 5D1QC 5DD0H 5DVOA 3KPRA 3VDBA 3KLDA 2VLKA 4HHAA 3KG5A 4NKDB 4I3SL 4LLUB 5DC4B 5BOPA 1JWUB 1Z2KA 2ZOLA 1S7XA 5C0JB 4ZFGL 35C8L 3HAEG 3TV3H 5FGCB 1QO3B 4PP1D 3CVHL 2VISA 4LU5L 3VRLE 4Z7WA 1JNNL 2H2SC 3CXDH 1B3JA 5SWSD 2NY3B 43CAA 3ZTJH 1CLOH 2VC2L 5ITFB 1MCQA 1OW0A 1M4KA 1YN6A 1CF8H 3CAFA 3I6GB 4PUBL 1IFHH 4GAFB 2YN5A 4JKKA 4CGTA 3NCEB 1AQKH 5HHPA 3HCVB 5DTFB 1RUML 5DJ0A 2DLHA 4JY4B 4ODUB 3VD3A 4LEXH 5GGTH 3LKNA 1C16A 1D6EA 2UUDK 4S1QL 1EGJH 1VACB 4K71C 4PJXE 1ZK9A 5A40E 3S88L 4G8EB 1YUHA 5MEOB 5ALBH 2HVKB 3NFSH 1U8QA 3EGSA 3WNPA 3QUML 2IANE 3JV4B 3RWFA 2ZSVB 1ND0B 3BDYL 4HAGA 5D93C 1A1NA 4PJAA 4U6YB 1JGDB 2V17L 4QXUH 4HIXL 3NTCL 1YNLL 5I2IA 3V79C 1MQKL 4EI6A 4GMTL 4UB0L 1QHOA 4RFOL 3RWEB 4KK5D 1F11A 5JQHC 3QXDA 4L1DA 1WV7T 5F1KC 3UBXB 3MUY1 4UV7H 2IPTL 3ULVC 5FV1L 1AJ7L 3V5HB 1E4XI 1UENA 2AEIT 5EU7E 4XPBH 5TF0A 3MXWL 4X80H 4ZSOA 3WFBL 4UV4H 1G0XA 5DZLA 4XWOD 4NJ9H 3D9AL 3HAEB 1AI1H 4Y4KD 1FH5L 1MNUL 3TFKC 4OQTL 1HHGB 3H3PL 5E2JA 3D48R 1OB1B 5C08D 4PIRF 1WBYB 2EE9A 3B9KA 1S9XB 3B2VH 2DBJA 4R97C 1NEUA 2WBJA 4OCXH 4XH2B 4OZIE 1FG2B 4P3DA 1WJ3A 3FO2A 2BX5A 1KTRL 3EJYC 5I1EH 4GKSA 1HIML 3GB7B 4LEOA 4R96B 4OM1H 1ZEAH 3NIGE 3WSQL 5BQ7A 1HSAA 3HFMH 4Q6IA 1PAMA 4LPVA 1NGPL 1N26A 3LKQA 3I9GL 2IMMA 3V6OA 3I85A 1ZSDB 4YO0A 2AABH 4DJMA 3LKOA 5F6IC 5CBAA 2X4NB 3ARBB 1A6WL 3FN0H 3AU1A 1PGRB 2LU4A 2EZ0D 1NDMB 2EIZB 3DX9B 4NHCL 7FABL 3LS4L 4OZHA 4E41A 3E6HB 4G5ZH 4P59H 2AK1H 5CZVH 4Y8AA 3NA4A 5ICXA 1FBIH 4P5MB 4TNWF 2XWJA 5TPWL 4KV5F 1NGXB 2VE6A 1AGDA 4WFFD 4XWGL 1J12A 1FFOA 4NO5A 5DEGA 1JGLH 3K46A 3SGDH 1UJTA 1SEQL 1Y18A 2C1PB 2AGJL 2J8OA 3L3IA 5E8OB 3F7QA 2APTA 4HULB 2ZG3A 2ENSA 4OT1H 3K1KC 3ORJA 4NHUB 1MJJB 3V5KA 3BZEA 2IBBA 5HHVL 4M5ZL 4M4PA 3WN5C 5J11B 4U1JB 2Q76B 3ZDYE 1KJMA 4HSQA 5EN2A 2MMXA 3Q3GA 1T20B 3SE4C 3L1OH 3BOVA 5EU4B 3TVMB 4HXBH 1DR9A 4ZYKB 5IEKB 4K07A 4XMKL 1OGAE 4C56E 1KPRB 3D0LB 2G75B 3TJEL 2V2TB 3P4OA 3O6MH 5E6ID 3HZVA 3EDFA 2QQLL 3ZL4H 4N1HB 4YLQT 1UWXK 3G5XA 5HHOD 4GUPB 3K1DA 1MIEL 4S0SD 4WU5A 2PR4H 2BY0A 4ELMB 3U4BH 25C8H 4YX2H 5KW9H 4P46D 3NFNB 4D3CL 3P3YA 5C6WH 1HXYA 2MQ0A 2NY6B 4FQLL 4OGXH 4XXDB 4EXKA 2R8SH 3JBG7 3UTQB 1BD2B 1Z3GH 3PIQA 1NUFA 5C70A 1JV5B 3FT3A 4L3CA 3HZKA 3GUTA 3MJ8A 3U9UB 2YD1A 3CFCH 5CILL 3HI5H 4RFEB 1C08A 5DD3L 3OAYK 1FL3A 4CVZB 3LKRA 4XAWL 5K9QG 4ESKA 5HHMD 3NGBC 3PNWA 3ROOA 1W8OA 3FQNB 2FECI 2O5XH 1UJ3C 2DWDB 1GZPA 1CGYA 2EYRB 3LQZB 5EPMA 4WGWB 1OCWL 32C2A 5ABDE 3P2TA 3PWLA 1KLUB 4TUJB 5CKAA 5HYJE 4DAGH 3RWGB 1EO7A 3VWKC 4O2FB 3KLAB 2PKDA 1UH2A 4M7LH 4HKBA 5IESH 1MCHA 1U3ZA 3ZHLA 1IC4H 5DFWH 5T1DH 4NC1E 1UKTA 2FGWL 4LAQL 4M3JA 3LN4B 2DIJA 4LL9A 3X13B 5DUPH 3WD5L 3M17B 1MCLA 2VXUH 5E8PB 5B21A 4Q97A 1ZLWH 1A7QH 5IBLC 3RY6C 2JCCF 2Y4SA 3ZMRA 5JZ7D 4Y4HC 4AL8H 1V7NL 5HDQL 1L0YA 2VJXA 3I3EA 3BQUB 4UU9B 2VLLA 1VESA 3IJYB 4NNXB 4RMVA 5DVKA 4KRNA 1K6QH 4WEBL 3FKUS 2HYMA 5EBGA 1GOFA 3W9EB 4J4PD 4X7SL 1YYML 4G42A 5CGYC 2OXHA 2ICWB 2ZSWB 3P11H 2PYEE 3WHXA 3QDHA 5I75B 5D8JH 4C55A 4JR9H 3SJVB 1OGAA 1DQMH 3O2VH 3CMOL 3MYJA 5IFJA 2EE3A 1GL4B 2W07A 2DTMH 5I1HL 4HWBL 3GNMH 3WIFB 2ZUYA 5DHVH 4HW6A 4Z0XB 4P2OC 5EU7C 5I1CL 3PV6A 2VLJB 5D7IB 3BGMA 3TN0A 3TVMD 2DLTA 2WK2A 4L9LB 4FABH 4BFGA 3PDOB 3VGBA 2R0KL 3LIZH 4QO1A 1CGSL 1N4XH 5E5UB 5JOPE 4ZO9A 1U0QA 5C0DA 1FDLH 1PLGL 4LP4A 4LCIH 3DMMC 2NQCA 1WFTA 1KEGL 1BZ7A 1IAIH 4AQOA 3VXTA 1ZWIA 3HMXH 2FRGP 2BOBB 2V9TA 2B1HL 3HE6D 4TN9A 4DZBA 2EO1A 5IMMA 5IFHL 2X4UB 5CKGA 3DRQB 1T2JA 2OTUB 3TNMA 1C5DB 1KLGB 4M43H 4KKAD 4PJBA 4IRSC 5F96H 3FFCE 3HUJA 5L2KE 2EKSA 5TDPA 5ACZA 3OL2A 1Z5LA 4MGXA 4LSSL 3THMH 2ATPA 5D70L 4KVCL 1OAYH 3HS0B 5E99L 4KK6D 5E00B 5HYJA 1IEAB 1EFXB 4FG6C 1RY7B 4WTXA 2WUCH 4N8CL 1WF5A 3T3MF 1JHTB 5EB9A 5AAWA 1NJ9A 3DETD 1DQQB 1RZGB 4QWWD 5CBEA 1M7DB 1UM4L 4K3EL 2ADFH 4D0CB 1FGVL 1UT9A 1KIRA 3H3KA 3C5JB 1A6PA 3KPOB 4YXKL 1YMHA 1ZGLA 3BT2L 3QWRD 3QUYA 4PJGE 1W72B 4LMQE 3GSWB 3CNKA 2P8LA 3VFGH 3O2DA 3HHRB 1HCVA 3MLUL 2IH1A 3U4EA 3T0VA 5D6DA 4HWUA 4U1MB 2BOCA 2XWBB 4QHLA 4EI5D 5JW3H 3REWB 3S4SG 1G7IA 1T2QH 5DD5L 3R8BB 4YGVA 1A7OH 4Z6AT 4ELKB 3CFDB 3F6IA 1PZUB 2RFXA 3OMZA 1KV3A 1NCNA 1I7TB 1E28A 1ED3B 1OF2B 3GMRA 4EUPA 1TNMA 4GAGL 5HYEA 2VXQH 1B0GA 3OZ9L 4R90L 2G5BB 1VADB 2QQNH 5HI5D 2BRRH 3P9LA 3TZVA 4BSWB 4Y2DB 2Z8SA 1S7SB 2NY1C 4L8BB 1DBJH 4FTVB 4NP4L 5IF0A 2HWZH 1V3LA 1A21A 2GSIB 2CRIA 2GTWA 4L29A 5DD6A 4G6AC 4ODBD 1K8DA 1QSED 4PJ5E 3T2PA 1QVOB 2A83B 4PTTB 3RWIB 1BX2A 2DS4A 3C60C 1OSZB 2X4RB 3HB3C 1LGVA 1SYVB 1BQUA 2E27L 2QL1A 2Z91A 4Y4FB 3SGJC 4UI2A 5E9DB 4IRJD 4P5TD 1QFWI 3QPQD 5CZXD 2E7LA 1MCOH 4NT6A 1I8MB 2H9GA 3SDXF 5I66A 2JJTA 2OK0H 2QR0A 1XGYH 3B83A 5MENE 2A9NH 4P49A 3ZSSA 4DOHB 1R0AL 5T1KB 1FZJA 1I3GL 4KRPB 3ZKMC 3RPIB 3INUH 4CJ0A 3D0VB 1R3HA 3L3HA 4OZFH 4Q9RH 1EDQA 2VH5H 3VXUD 1OT1A 4YDIL 3MBEA 4X9FA 5F6HI 3GBNL 4JPIB 3CFBA 5HGDB 2DQJL 5D6CB 1OVZA 3U82B 3HE7A 1XGUB 1UB6B 4XMLL 1OLLA 1OP3H 3PWUA 4XNQA 1JVKA 2EIEA 3S4SB 4QOKD 3HI1A 3S34H 4NKIL 1B88A 5KSUA 3QEQB 4OFYD 3RAJH 2RB8A 5F9OL 4YR6A 4GRWE 5GGVY 3J7HA 1PZ5B 3L3GA 3VXSE 5CLWA 4YXHH 4XVSH 1X4YA 2CSPA 4MS8D 1Q9LA 1U93A 4JFYA 4PJGA 3GSOB 3K3QA 5D2LE 5HJ3B 3VJ6B 3LOWA 3K74B 2VLRA 1WIPA 4TVPD 1ACZA 1IGIL 2VZSA 1P7HL 3PL6B 3BP6B 2FBOJ 5J06A 4X6DE 3GEWB 2IADB 3ZYZA 4JRXA 1ZTXL 4KGLA 3QIWB 3RI5K 2R56L 3OF6D 4Z78B 1AHWA 1LO5B 2DQDH 2VDPH 4MZ3A 3KDMA 4K3JL 5ESVB 5I73C 5DO2C 2WUBL 4MA7H 2XTJE 3HC0B 3QI9D 4PJEB 4GG6B 1JHKH 4UNUA 1R5VB 2PO6A 4OF7A 2AQ1A 3MLWL 5D71L 1EEZB 3CVHA 5C0ND 4Y5VC 2UYLA 5KS9B 1T7WA 3VXOA 3MV7E 3GJEA 2ZJSH 1J0IA 4YPGA 1F4YH 1BIIB 1RK1B 4OBRA 4OD3H 1AXTL 4PJ5A 5I30L 5F3BA 2MHAA 3IS1X 2P5EB 5DS8A 4X5LA 1P7QD 1R5WA 2VSCA 3N06B 4KZEL 5LWYL 3DXAD 3HLAB 4HIHB 4WO4D 2QADB 1W0WB 1AGBB 5J6GB 3WFHB 2JJWA 1I7ZB 3B8YA 1MJ7L 2B4CL 3J8F7 3KS0J 5KOMC 4QHNA 5DK2A 2AXFA 1MCWW 3W39B 1J88A 5D5ME 5IHUL 4DZ8A 2EDNA 3S3JA 3TA3C 4GBXA 2JJSC 4R2GC 1GRWA 5D96B 1CFQB 4GS7C 4KAQL 2YUVA 4ZTPL 3QBTB 4MD4B 5MENA 3W5NA 4PRHB 5I9QC 2F74B 1KT2B 2EH8H 4AG4L 1F4XH 3TYFA 3QUMA 4XBEH 5KN5A 4YK4C 3GGWB 4P2QD 2UZIL 4YQXH 1JF1B 2GT9A 4MXVF 1BVZA 3FO0L 5T33H 5CJOH 4MA3A 3P30H 4M61B 4GRLA 2UZXB 2VIRB 2WLZA 3H0TA 3C2AL 1S78D 2R1WB 4KROC 4B5EA 5IR1A 1N5AB 3FRPA 4WHYH 1F45A 3VXSA 3T8XA 1U8LA 1I85A 3C08H 1TQBB 1CE6B 3L5IA 2HT2C 4XCEB 4I77H 5D2LA 2JB5L 3O8XB 4PJ7A 2A6KA 12E8H 1LP9E 3SBWA 4CL7A 1FZKA 5D72L 5E03A 2Z9TA 3DVNB 3MLTB 1CLZL 2YD5A 4TOYL 4M9PA 3SGEI 4ZD3H 3RZCD 1A7PH 1HNFA 3TJHD 3R0NA 3QDGE 1FNEA 2V7NA 4NNYB 4CVWA 5SWQB 1MCDA 2Y06L 5C9JB 3U7YH 5LGHH 2YK1L 4A6YH 1TVBB 4RZCB 4PRPB 4HK3J 4L4VA 5JUEL 1VFAA 5CMAA 1AGCA 4L4TB 1IAOA 2DLEA 1WQVT 1MRCL 1NUGA 2XQBL 3C5SB 4NQDE 4X4XA 4YZFE 4F9LC 1OP5H 3QO0B 2Y6SD 1MFAH 4RRPG 3SDAC 3RVVC 1L0XA 4LCUA 3KPQB 4JHAH 5CP3A 1OTTC 2ARJA 2FJHA 3JV5A 5JPNB 4NKOB 3BPCB 1KJ3H 4OIIH 3GI9H 3MV7A 4G6FB 1XF5B 5FHBH 5J13B 2Z4QB 1EAPA 2ITDA 3WO4C 2X2YA 1G7MB 3TV3L 5A16A 5T3ZD 4IOIA 5JXEA 2ICWI 3CXDL 4KI5D 3GSVB 3IDIB 4JANB 4HFWB 3LCYA 2XXCB 4ZPVB 1CLOL 5ACMA 3U1SL 4S1DC 4GKZB 2ZCHH 1CF8L 4G7YH 5IV2A 1IFHL 1E4KA 3NIDE 1AQKL 5D5MA 1IGYB 5CP7B 4FN0A 3FL7A 5GZOC 1DQDH 3BWUC 1VEPA 3H9SA 5GGQL 2GK2A 3QB7C 3ALPA 4ISVA 1U8KA 2D03H 1EGJL 3BO8A 5FXCH 3RVWD 5K9QI 2AK4E 3IS0X 2JK5A 3AB0C 4KQ3H 4ZAKB 5EOQL 3BP4A 3NFSL 2CLVB 2YSSB 4POYA 4APQD 1INDH 5B3NA 4ZFFB 1JNJA 4IEFB 2CMRH 1HKLH 3I50L 4LCCC 5GS0H 3LKPA 4X4ME 5E8DH 4RGMB 4FXGA 4LLDA 4QXUL 3HG1A 4NC0B 2P24A 2BNQE 2DM2A 4U1GB 5TQ2H 4PJ8B 3V7AE 2H32A 2X9WA 5C09D 5DRZA 4HK3N 3STBA 1EV2E 5HYQA 3SCMD 4UV7L 2EXWC 5GRWA 2R0LH 3SDDB 1XF2A 1HHJB 5BVJB 4F15B 1F2XK 3AREA 5J1AB 5IQ7H 4X80L 4KJPC 4UV4L 1FVDA 3CUPB 4PJIF 1BFOB 3GK8H 4ZQKB 4D8PB 2W0KA 4JO1H 2CKBB 4Q0XH 1O0VA 5DYOA 2LFGA 5CEXB 1HZHH 1PJ9A 1AI1L 3SKNA 4YBHA 1KG0B 4MNQD 2P44B 3CCHA 3HC4H 1M6OB 1VERA 3QIBC 4NQDA 3UXFA 5C0BE 2XTJC 1A6ZB 2XA3A 3B2VL 3QG6B 4OCXL 5IROC 1FVEA 3V6BR 5D2NE 4NN7C 4LASH 5I1EL 4I5BB 5CWSA 5EO1B 3DNKA 1R24A 1HN1A 1ZEAL 3GRWH 4L8DB 1BVKA 2I25N 1DVFB 5IVXF 2DLFH 3HFML 5BOZG 3QRFM 1P5VA 3IDYB 2X70B 4WUUD 3LPGA 2AABL 5AWNL 4P5KA 4FZ8H 2ESVB 4P4KC 1OTUC 4JZNA 5C0IB 2V9RA 3MLYL 4YHZL 2EXYD 1GHFH 4TTDD 1XCTB 2W65B 1IEHA 3FN0L 4PV9B 3KHQA 1A1MB 1EX0A 5TDNA 3P4MB 2X7LA 4P59L 2JELH 2AK1L 5CZVL 1CFTB 2OL3L 1TVDA 1JRHL 3TESA 1FBIL 4D9QD 5F1IB 5FECB 2FWOB 4PRAB 1KN2L 5DRXB 3MMEA 1LE9B 4JZJC 1WIOA 3DWTA 4E5XB 1LE5A 1FNGB 1WIUA 3QEHB 3DVIA 2G9HA 4G8FB 1EHLH 4AENA 4ELMF 3P4NA 4WU7B 1OQOA 3WJLA 2W38A 3DV6B 4I4WB 1QFWH 4OT1L 4LLQA 2Q1EA 4RGND 1GGCH 2I5YH 1YEDB 2IAMB 1MHPH 2BNQA 3LQAL 4DUWA 4PV8A 2HN7B 1WWWX 3QUXA 4ZAKD 4IRZH 1OHQA 3OTTA 4HWBA 1U8PB 1IGCH 2AEQH 4CW1B 1NAKH 1QBAA 1U3HA 2A6IA 4HXBL 3MRNB 3FCTB 4PJFE 3PXHA 4XVTH 1RD6A 2A9MH 5EBWB 5FYLD 1BJ1J 1FO0A 3B9KD 3ET9F 2PCPB 5MEQA 2HT4D 2WBJD 2JB6B 1FZOB 3LN5A 4AMKH 2NW2A 5KSAB 4IIQA 3ZL4L 5H94A 2C3HA 5A2KH 4E42B 5C6TL 5CEYA 1QPPA 1K85A 3U4BL 3TT1H 5L88L 25C8L 4YX2L 3QUKA 4LVEA 3T65A 4EBQH 5TE6H 2YD3A 4PJCE 3AMLA 1MCIA 4DUXA 4V1DE 2VB5A 1ZHKA 4OCYL 3VXME 1Z3GL 5D1QA 4YHOH 3IYLW 4EJ1C 1HSBB 5GISL 5J3HD 3RGVA 5CFHA 3FB6B 2GTZB 2XOTA 4JFFD 3CFCL 1ZS8B 3REVA 2VR9A 1MLCB 3U46A 5FKAA 5I16A 4NSKB 4ZUWA 1B0WA 1WBXB 1F6LL 4AT6A 4KJYB 1AKJA 1KTDA 4IDJH 3S5LG 2X40A 1DJSA 3LD8B 3LRGA 5CHNB 5HY9A 3MR9B 5HI4C 4K8RD 1KCLA 4RMUA 3U36B 1L4IA 3HNTH 5DJ2B 4BELD 2Q6WB 4C57C 4NM4H 3L6FA 4JY6A 2XG4A 3H42H 4TUOB 1BVLA 1DQJB 4M7LL 5HYFA 1PQZA 3LSOA 1S7UB 1KULA 5BS0D 1IC4L 4WDIB 4I0PA 2NY0B 3CDCA 4UDUB 4HV8B 4IMKC 2XRAH 5D1ZB 4BUGA 2VXUL 1I1AC 5BRZE 1NGWB 1R3IH 2BVTA 2V7HB 1A7QL 4OKVB 3UAJC 5D7IF 4OLWH 3SDCB 5GS3A 3UO1H 2DM3A 3DHJA 3AMKA 3C6LB 4OD2A 4G43B 4HWEL 4BQ6A 1K6QL 5FYKH 5MP6H 5JIPA 2A6DA 2F53B 4KRLB 1ZA6B 1M05A 3AY4C 2Q7YB 2YD2A 4JLRA 3P11L 3CFJA 4CUCA 3ARUA 3N1MC 3U79A 2L7UA 2X42A 4JFPB 4Y16B 4PJFA 4JR9L 4MNGE 3K8KA 1DQML 3O2VL 2AKRB 3IDGB 5F88B 4JN2B 5E1AB 2J2ZA 3NABH 4F7MA 1A4KA 4KJQC 5FHAH 2DTML 3GNML 4JGJA 4Y19B 2NXZB 2E9WA 1LEIB 1EMTH 2CUMA 3D3VE 4YHYB 2W9DH 2NY2B 1E4JA 2QSVA 2PTTA 2NYYC 4OUUA 3VFPB 4HZAA 3LIZL 4JRYB 4V1DA 1MCWM 3S5LB 1DCLA 4QGYA 2NY4D 4JM4H 3UTZB 3VXMA 5TQ0H 3NFPB 3QCVH 4ZDHB 3B3IA 1IAIL 3GMOB 3HMXL 1IAIM 2XFXA 4NO2B 5L2JB 3EYFB 3QEUA 4HGKC 1CD9B 1PY4A 4N1CA 1NFDB 4M43L 3RIFK 4MQXD 5F96L 4PJDB 2VZVA 4LSTH 2O5ZL 5SWZB 1I7UB 4TNVK 5FYKE 5GS0C 3OKNB 3M1BB 3THML 4JPWL 2C3VA 4NUGH 1EO5A 1H8SA 4J3UA 2WUCL 2E9BA 4EN3A 4M7ZB 1EIBA 3RUGF 5CIPA 2Y36H 5TH2B 2CXGA 4WCYH 3FONB 1IM9B 4C54A 2H3NA 3G5VA 3JSSA 5HVWA 4WFHE 5LJYH 1S5IH 3WJJA 2DQFB 1U9KA 1N5YH 5BRZA 1CL7I 4JPVH 4JDTH 2VL5A 3NZ8A 4N90E 4UTAL 2NLJB 3MRFA 4FQPA 2LAGB 2QQKH 3FQXA 3WXWH 4UAOB 3VFGL 1UG9A 1K4DA 3CSYA 1OD9A 4YHNA 1IARB 2YPKB 2YEZA 2I9LA 2ED9A 4HFUH 3MRHA 1T2QL 3IAGC 4POZC 1OWWA 3OKLA 1EK3A 4KZDL 4FQ1H 3BWAA 2PW2B 2NY3C 2R29H 2W1NA 3TBTB 4QRPA 1JYXA 1P6AB 4DKFH 2ARJQ 4MNGA 3HNVH 3TPKA 2PXYC 3DYPA 5B4MD 5ANME 2QSCH 2F53D 1U8MB 5EZJA 4OZGE 2C4FU 4NRXA 3D3VA 3A67H 3GIVA 2HWZL 1U91A 5E2UH 2Y5TA 2VLMD 5E94A 4FRWA 4RNRA 4W4OC 1XGTB 5DSCB 2AJ3A 4RCAA 3ULSA 5K9OB 3FQWA 4NCC2 4JKLA 2DM4A 3IFOB 1MCOL 3EHBC 2BSRB 1QLFA 4P23B 3GI8H 3IVKA 3CFEB 5IVZB 3O45A 5E7FA 1JCKA 1P7KA 4F2MB 2OK0L 5IOPB 4YIQB 3E2HC 4Z77B 3MV9A 4G6ML 4JRYD 2DRUA 3OAUH 3BPOB 1LO2H 2A9NL 1MJUH 2EDFA 5M7QA 3QDMB 1YQ2A 5EU6A 5JMOC 1J8HE 4GMSH 5DJDA 3L3DA 3VE0B 2W92A 2P7TB 3PHQA 2VH5L 4O00A 3ULUH 1KB5B 4LHJB 4UMGA 4H8WH 4L5FH 3FO1A 4ORGB 5HPMB 1QSFB 3QFJE 2FX8H 1ZOXA 1BOGB 3FFDA 1RIVH 3BKCH 1W72H 1YJDL 2R23B 3MRMA 1CLYH 2FJGB 1FL6B 4LARL 3DUSA 4PJHE 4R3SB 2V5MA 5T1LB 2C1OA 4Y1AA 4NM8H 4KHTH 4P57A 4NQEE 1A2YB 4CAGA 5IW3A 3LQMA 4F7PB 1NGYA 4OZ4B 4YXHL 4PJEF 4LNRA 4XVSL 2HJKB 2Q86B 4JM2A 3T0XA 3LKSA 4BUHA 4ZUUB 1BFVL 3F6LA 2IF7A 3IRPX 5C0RH 5KS9F 2Q7NA 3QAZB 2VDLH 4Y4HA 3TZVD 2X4OA 3VG0H 4MDJA 3ZYJA 2WIIB 3IFPA 2E6PA 1CDBA 3T2NH 1FVCB 1ZLSL 1FJ1A 2DQDL 2VDPL 4FNLL 2VQUA 5C6PB 2FJFB 5HYSG 5FO8B 3RA7H 3VFMB 1NBZA 5GGSY 4HS8H 2HVJB 4R8WH 5EC2A 2Z93B 4KXZI 4MA7L 2HP4A 4XBPA 1T89C 3AS3A 2RQ8A 1ZE3C 1C5BH 1JHKL 3VRIB 4NUJB 4OZGA 2A6JB 5EBLB 3ULUE 2ILLA 1HINH 4OCWH 2ZJSL 5CEZE 1RQ5A 4OD3L 4M48H 1BLNB 5GIRB 2ARWA 1GIGH 1E6OH 3MBED 2KQMA 2D7MA 2ZCLL 3MNWB 5JHDB 5CZKA 3PABB 2CGRL 5KOVC 4C58B 5J11C 4AY0A 2A38A 1Q94A 1CXKA 4PFEA 4HLJA 2GJ6E 1LEKB 4EVNA 1IMHC 1G6RL 1KIQA 1N6VA 4YDVB 2ADGB 4W6XB 2EH7H 4OI9A 3MNZA 3D2UD 4IRSA 3MV11 3I3DA 4XBEL 2XKNA 3ZZ1A 4LCYB 4ONHB 5IM7B 4NC2B 4U6XB 1I75A 4I3RL 4YQXL 1ZXQA 3OR6B 5T3XL 1JPST 5EC1A 3C6SB 3QFJA 2BVOA 3QH3B 2VLRD 5CJOL 5IVNA 1JYNA 5C0AB 1J87A 1T0NB 1H5BC 5SX5H 3VD9A 4PJHA 1N3NA 4JO2L 3CSBA 3BX7C 4LQ1A 4K2UH 3TBWA 2Z31A 3O11B 4FMKA 2NMSA 3LS5H 5HYSB 4K7PX 4D2NA 5E95B 5JTWA 2DQGH 1IE5A 3ES6A 2R69L 3RDTA 2FECL 4I77L 5GJSH 1H3UA 2D31B 3QQ3B 4FMFA 2GAZB 2OJEA 12E8L 3QUZA 5L9DH 1S7TB 3S9DB 1UM5H 1SEBA 1V3KA 5ADOL 4HBCH 1T4KB 2PO6D 1EVTC 4NO0B 1LNUA 3OB0H 1UA6H 4CADB 4Z7UB 3U0PA 1K3IA 3QFDB 4X6FB 1A7PL 3V0WH 4JFDA 6FABH 4UNTA 2IQ9H 2HFEB 3KYKL 5DR5L 2FL5B 1UH3A 2JF1A 1X4ZA 4EKXA 3VI4F 4A6YL 1XIWA 5DD1H 1QRNB 1U3JA 5IMOB 2P5WA 4G80B 2NW3A 2B20A 1BJMA 1YNTB 1YZZA 3C5ZC 4JDZA 4M4RA 4WGVB 5JW5B 1NCCH 3G08B 5DLMH 3T0AA 4O58L 5GGRY 5F8QC 3UTSB 4GBXD 1WT5A 1UM6L 1KJ3L 4OAWA 4OIIL 2J7LA 5D7KE 5C7XH 1JWSB 3QR2A 4LRNH 3QDJD 3W0WB 1XR8A 3QO1B 2WANA 1KPUB 5D7JD 1DE4A 2VITB 2NTFB 3QWOB 3IETB 3WHE1 4FQXB 3DURA 2H26B 4XT1C 2OL3A 5EZIH 2ZCHL 5EOTB 1NUDA 3BQUC 1XAUA 4G7YL 4WJ5A 4HMEA 2HTKC 4FQ2H 3GSQA 4G9FA 1HH9A 4K23H 3BRGC 1DQDL 2P45B 1DUZA 1NMBH 5CSGA 3O9WA 4P2RE 1WZLA 1EXUA 4X6BB 1OSPH 4LCWE 3WFZA 4HUVA 1AD0B 3PWNA 3OGOE 3IXAB 5I75C 2G2RA 1A47A 4OF3A 3PUCA 1XGPA 4R7NA 3TNNA 3QDAA 4Z5RB 4IJ3B 3RKPA 1FL5A 4MX7A 4F9PA 5I1JL 4KQ3L 4N0CC 3VDCA 2D7TH 4OCLC 4UUJA 4OB5H 1F3DH 2ZUXA 5FF6B 1D9KB 1HKLL 2MOVA 4MJ2A 5L8KB 4YFLI 4KVNH 4DFIA 5E8DL 2ADJA 2VXSH 5B8CB 3FQTB 2AJSL 3T0EE 3WE6A 2R2HB 1F02I 4WNQA 2XIDA 3VXRD 3LEYL 3WNKA 5TQ2L 2X9YA 3KXFB 2DBLH 4L4VD 4R7DB 2FHFA 2UWEB 3O3DA 5C0GA 3U30B 3O0RH 1MCBA 3V6ZB 4QXGH 3GSNB 2XWTB 1D5XA 3ZT7A 1T0MA 1FAIL 4CNIA 2AS5M 2BNRE 1ZLWK 2F5BH 5F89B 1LEGA 2R0LL 3D39E 3E0GA 4PJ9B 4YHML 4W81A 1PKQE 3PWPB 2F54B 1RUQH 5DDHB 3RFZC 1JGVL 1MY7A 1BF8A 4RAVB 4TNWK 1A0QH 4U4BA 1NH6A 4JJHA 4HAFA 4Q0XL 4U1HB 5FYJE 3QXAB 3DROA 4ONOA 1HZHL 4BZ2H 1KELH 3CDFA 4I0CC 2R1XA 3ILQD 3HC4L 4K9EH 1A3RL 3WMSA 3FRUB 1OTSD 2BCKA 5F9JB 3O6FA 3IJHB 2ID5A 5DFVD 2BVEA 2FR4B 1WFUA 4M6NH 4DWHA 4Y5VA 5GGUB 4XB7A 4LASL 3KLHD 4XI5C 1NQBA 3L7FA 1Z0MA 3GRWL 3H9SD 3ULUC 1DFBL 4H8WC 2OI9B 5CINH 1UVQB 1RHHB 3KPPB 1JF5A 4ETQA 1ZLVH 4LVHC 1MY5A 5TE7L 5I8CA 3BEVA 4Z7OE 2C5DC 5C0FB 2WWKT 4MWFA 4H20H 5LKNA 4XAKD 1U2HA 4OGAC 3VGGA 3CD4A 3ZLQC 1YPZE 1XGRA 3Q0HA 1NAMH 1VGKB 1NBVH 1KPVB 4G8GE 2N1KA 2JELL 3W0WD 3HG1D 4K3HA 4P2RA 5EO0A 3CZFB 4R4ND 3S96B 2X1WL 4LCWA 3SGKC 1BQHG 4NQVA 1P9MC 2WBKA 2DKSA 4Q6YA 4X0KA 1DL7H 3HN3A 4HX1B 1EZVX 3Q6FA 1QZ1A 4Y2DC 3VFVB 3VRJA 1EHLL 4LSPL 1FFQA 3O6LH 3UTTE 1QFWL 1A64A 1KBGH 3LVEA 1QFWM 2H41A 3KWWA 5IB4B 4HH9B 1GGCL 3QZWG 1TZIB 3T0EA 2SEBB 4QXTB 1MHPL 4DKEL 4K7PY 4OV5A 4ZODA 1A3LH 4JFED 5EIQA 4IRZL 3ZE0F 2D0HA 1GGIL 2CKBH 4XVJH 1IGCL 2AEQL 4LOUD 3MGOA 5DHVA 2NX5B 3TCLB 4Y4FC 1D9KD 4K3DL 3FO9B 3T0BA 4TVSa 4X6EB 4XXCA 2A9ML 1DBML 2DAVA 1ZHBA 1F90H 1R3KA 4XBGB 3D39A 3STZA 2COQA 1QG3A 1FZMA 3DGGA 1TZHB 4M5YH 4AMKL 4NYLA 4RBPK 3FT4B 3OKKB 5H8DA 4MB4A 4W70A 1I8KB 4K7FA 1S7WA 2OBGA 4OD1L 3LB6D 4NQUA 5HI3D 3O3UN 4XP9H 2HG5A 4OM0H 5FM5M 4YBLB 1T1WB 4KRPC 3TT1L 3VWJA 5KSBE 4MJID 3N1GC 5TE6L 3EFDH 2P8MB 4U1SA 3ARGC 1T7XA 4PR5B 4HIIB 4HLZG 2F54D 3G6DH 4YHOL 3V0VA 3BVNA 4WFGD 3IKCA 4F3FB 4U1LB 1EH9A 1MCSA 4Q9CA 4HUNB 5GS1A 5EOCH 3R8QA 2WWMC 1BQHB 4S0TD 2WWKO 3RNKB 2UV3A 3GSXB 4PPTA 4MHHG 4BSVB 1FLTX 4AEHH 5ISZE 1ZGLP 4YXLL 1NUNB 5DMGC 1Q9WA 4FFWD 4DVBA 4HIJA 1T1XB 3BW9B 3D18B 4HG4J 1WCBA 3HNTL 5SV4A 3HZYA 3PL6C 4NM4L 3QNYB 3H42L 2IFGA 3F58H 5EUOB 3VFSB 2B1AH 4YHKH 2I07A 2J6EA 2VNCA 3QZWB 2R2EA 1C1EH 3VD5A 1KJ2B 4DGVH 1FP5A 1WK0A 2XRAL 3UPAA 4M1GL 3VFOA 3A6BL 2J8UE 1N2RB 2A0LD 3MJGX 5CUSH 1YEKH 3BUYA 4RSVA 5FOJA 4OLWL 4XTRD 3UTTA 3T4YA 5F70A 3ARVA 4ZFOB 2JCCA 1MCKA 3O4LD 3E1F1 4HGMA 1XCQB 4QRRE 1LK2B 1OP3K 1F4WH 2JTDA 5E8NA 3KPLA 3LEVH 5FM4A 1HKFA 3KPRB 2VLKB 2QADC 4YFLF 4F80A 3MRRB 2GCYB 2FZ3A 1HWHB 4QNPF 5JO5B 5K59E 5JW4R 4LAJH 1S7XB 4ETYA 4RQQB 1YY9D 5I76B 3CH1B 5IB2B 3OJ2C 1E4WH 2D3VA 3EYUH 3LN9A 5D1QD 4UILH 2VISB 5FHAL 1NFDF 1KENL 4HKJB 1KJVA 3RGVD 4R4BA 5CJXC 5D96C 4PJDF 1UEMA 1JZ2A 1H3PH 1EMTL 5IFAH 3DIFB 1YN6B 4R0LC 1IC7H 2W9DL 4U1IB 4XPHH 5I0ZA 1ADQH 2WP3O 2NX5D 3HR5B 4XP5L 1F3RB 1JBJA 3U7AA 1T5XB 5DJ0B 3RTQA 1IGJB 5DQDH 3U7WH 2H2SD 4N1EA 3ARDA 1MSPA 2BP3A 3R06B 4JM4L 3DBXA 3AUVA 4BYHA 4ODSH 2ZP0T 1G7HA 3NMEA 3S6CA 1JGUH 1YUHB 4KUCD 3KPSE 3RBSA 1U8QB 3EGSB 4EIGB 1N7MH 4PRDB 3L5XH 2CLRA 4X7EC 3RWFB 3RX8A 5T3XE 3SDXE 1DSFH 1TQBC 3WN5B 3QJHA 2EDKA 4PJAB 3TO4A 1ETZA 4LSTL 4OLYH 3H9YA 2FH6A 1EEQA 4LHUG 4XCNB 5I2IB 5J1TC 4NQCA 4NUGL 1F11B 5DK0B 4LLVA 3PQYE 3QXDB 3BPNB 2BHUA 4UDTA 1KIPA 4MJ6B 2Y36L 3ZKQD 4HF5H 4WCYL 3EDEA 4WI2A 1IL1A 3SE9H 4FQIH 2FEDD 3ZDZF 1S5IL 4N8VA 3QIUA 4LRIA 4ZSOB 1AY1L 1N5YL 1EZVY 4JZJA 5TFSH 3TBVA 1T22B 4JDTL 2OXGA 4PLKC 5SWSE 4LNVA 3WXWL 1J9CT 4XNMA 4HT1L 3TWCH 4HG4K 3UJTL 2B5IC 2D0FA 1CCZA 1UWGH 5J13C 1V3MA 3IDNA 4QRRA 2NXYB 1RUAH 4UT9H 4K9EC 3FQUB 4P3DB 2XNAA 4FQ1L 4PBVC 4JZOA 3QWQB 2R29L 4GKSB 4QXWA 4LEOB 4OLVH 1IJ9A 3TFKD 5BQ7B 1HSAB 1KGCD 4Q6IB 3NGBB 4I48B 2ITCB 4JE4B 1TCRA 2QSCL 3EOBB 4I9WD 4RIRA 1UQSA 5M95B 3DVGA 3ARFA 5GHWL 4DQOH 1HILA 3LKOB 5CBAB 3FT2B 1GCFA 3A67L 3VU2A 4G3YH 4YHLL 5D7LD 3NIFF 1HH6A 2L4OA 4KTEL 1B0RB 3VWKB 5BZWB 3AU1B 1BFSA 3PGDA 4BZ1H 2EICA 3IT8D 4OIAA 4ALAL 1G0YR 5T5FL 2AVGA 3RRQA 1MWAB 4LHUB 3KJ6H 1ORSA 1Q0YH 5HYIA 2DMCA 3RWHA 1G6RA 2AJVH 2FD6H 2XZAH 3MRLB 5ELIA 4PJXB 1AGDB 3LAFA 1T5WB 1FFOB 4NO5B 1IAMA 2OX5A 5DEGB 4J3TA 4JEGB 2WV3A 5FDYA 3X3FH 1Y18B 3MV01 1RJLA 1B4JH 3L3IB 2IANB 4BK4A 5DVNA 3LV3A 3OAUL 3SQOH 1LMKA 1LO2L 3SDXA 1MJUL 3WDIA 3BZEB 2QJDA 5BZDA 1ZVHA 4EDXB 4GMSL 4LBEA 2H1PH 5BV7B 4OIBA 4RAUA 1KJMB 5EN2B 3F12A 4H8WL 3SDDC 2FX8L 3PQYA 5C08E 3BKCL 5DFTA 1W72L 4I18B 1SVCP 2J5LB 2OZ4H 4NM8L 5DI8A 4HK0A 2C3GA 3DX8B 3P4OB 4ONGH 4LPYA 4N0UE 4P2OB 3ZKXB 5ENWA 3RWCB 2MCPH 3MFFA 4Y5YA 3PDDA 4PLJC 3L95A 4QRPD 4NJAH 3PJSA 5SWSA 5C0RL 2XN9D 2OYPA 4LLMA 3UPRA 1CICC 4U3XA 2VDLL 5F6HJ 1HXYB 1IEBA 2E5EA 4RFNC 5C0EB 3G04A 3G9AB 3DMMB 1UH4A 4M1CD 3VG0L 3MLSL 1X5LA 3MNVA 2Y23A 1DVFC 1HDMA 3CLEH 4LSRL 4WIQA 3LDBC 3TH4T 1XH3B 3T2NL 2W91A 4KQ4L 4OZIB 3L3OA 3FT3B 4L3CB 1CDCA 5I1IH 1MREH 4NIKB 4HS8L 5B39A 4R8WL 2N7AA 1O5DT 4WFFE 1ZVYA 3IDMA 2LU7A 1FL3B 4OLUH 2DYPD 4L4JA 3MRPA 3ROOB 1C5BL 1BOYA 4BSJA 4YHPA 4GSDL 2BSTA 4NKQB 4WV1A 1GZPB 5CD5C 4HKZA 4MNHA 5DJZA 4XPAH 1S8DB 3DRTA 4OF8A 3MV9D 1HINL 3QQNA 4U0RB 4HC1H 1LHZA 4Z7QF 5B38G 1ZHLB 1MCRA 2GEEA 4HKBB 5EU6D 3CXHJ 2Y07H 5I1AA 1UACL 5H37G 1A02N 3NZHH 3SO5A 1T3FA 3RWJB 1P6FA 1E6OL 3Q1SH 1IZKA 1K3ZA 1LK3H 2AV1A 3OKMB 1KB5H 3MV8A 2R0WL 5J12C 3ARZA 3JTTA 1Y6MR 4HMDA 2IAMC 4U6HA 1FAKT 1B6UA 1H15A 3H9ZA 4P4RA 3MUGA 4Y1AD 1MF2H 5HHOE 2MFNA 5DEZA 3VFWB 3IDJB 3C2SA 3OSKA 4X7FC 2I9TA 4JM2D 2FBJH 1FNFA 4Y4KA 4IOFC 4Z7UF 1S7VA 4O4YH 3QHZL 3ARQA 4NBYB 4ZS7H 4PY7B 4Y4HD 3WHXB 5C08A 1HOCB 4ODVH 4H88L 4F37F 2IAND 4HCRH 1UEYA 1A7NH 1OGAB 1P4IH 5IBUG 4C56B 3MRQA 4X99A 2IMNA 4K2UL 1S9VA 5I15L 5CGYD 4N0UA 3LS5L 2YHGA 1X5KA 4LDOB 5JR1H 4RGOH 1YDPA 3ARTA 1JTPA 1PYWA 1WC7B 2YA0A 5HHME 2LTQC 3PV6B 1S5HA 3MC0A 5JW4M 5K9KB 2YD7A 3GMPB 3BGMB 5GJSL 1DEEA 2O61A 5LQBH 1I9RL 5KJRH 5L9DL 4ZPTA 3QHFL 5GSVA 1BQLH 1AO7E 2ZG2A 4NKDA 1CTNA 4HBCL 4LLUA 4D9LL 4FQJH 5C0JA 3V0WL 3VXTB 1ZWIB 5B3JF 1U92B 2YD9A 1ITBB 1WWCA 5AAMA 2BRQA 5B38B 4DZBB 4OBSA 2J1KA 4PJIE 5DD1L 4PP2A 3LD8C 3PF2A 4EOWH 3TNMB 3LY6A 4PGEA 1QEWB 1JMXA 1CGUA 5LGKA 3GRWA 5CJQH 4Y0GA 1NCCL 2K9UA 4HZLA 5DTFA 2EKSB 5DLML 5TDPB 3VGAB 4JY4A 3NCMA 4QLRA 1NBQA 1Q0XL 2YPVH 3FB7B 5I8KH 5HYJB 2X05A 5C7XL 2F58H 5D1ZC 1VACA 4LRNL 1OAUH 2HFTA 3WFCH 1NJ9B 4IRSD 4NZTH 4PRNB 5IVXE 3B5TA 1RFDH 1YMMD 3OWEA 3SDCC 1JZ7A 3JV4A 3UC0L 1CR9H 2JJVA 2ZSVA 3DJ9A 1QBML 5EZIL 1P4BH 3C6LC 5CJBA 4U6YA 2I60H 1KIRB 3CPLB 3T4AB 4N0RA 1YMHB 1DQTA 3AS2A 1PSKH 4K23L 5IBUB 3ZKNC 2UWEF 3D25B 1FC1A 3V52H 5HHOA 2BHYA 5MI0C 1OSPL 2DLGA 2IH1B 3U4EB 5FFLA 4QHLB 2YD4A 2Z35A 4P46A 5DMYA 1B6DA 2ICWJ 4YGVB 4MHHI 3CXHK 4CU6A 5I8OH 5KZCD 2RFXB 4AK1A 2PYEB 4OB5L 2NXZC 2FYYA 1J86A 5IJKC 1E28B 3G6AA 3GMRB 4A2MA 4KVNL 3W9DB 4LKXA 4YHYC 2C3XA 1MFNA 1MI5D 2NY2C 3R1GH 3DTXA 4GW1B 3W2DL 2OTPA 1P84J 2IQAA 3HAEA 1AR1D 2NNAB 4HDIA 2DBLL 1CFSB 1HHGA 2KDGA 3O0RL 2P5WD 4L29B 1DEDA 4QXGL 5DD6B 2YA2A 1K8DB 5MERB 2F5BL 4XH2A 1FG2A 1G7JB 4LPTA 1RJZB 1PG7W 2NY1D 3CZJA 2HLFC 4I1NB 1RUQL 1S9WB 5BMFH 1G9ML 2EZ0C 3U83A 1MJ8L 3CK0H 3ZYIA 1MPAL 1ZSDA 2HT3C 4PJIA 4HBQA 2BMKB 4BZ2L 4HUUB 1KELL 3C60D 2QR0B 2X4NA 4UTBH 4W6WB 2YMXH 3ARBA 5KANG 1F6AB 3AROA 2IWGA 1CL7L 4YK4B 5HXMA 1EEYA 1T89A 1F00I 3FFCB 4M7ZC 1U2CA 2EIZA 5L2KB 1NMAH 1R3HB 1C5CH 3L3HB 1A14H 4G9FD 3X17A 4P99A 4U1KB 3F62A 1A6AB 3M07A 2FSEB 5J7CC 4J4PA 5CINL 3HE7B 1S9YA 3DI2B 3PWUB 1DLHB 5IVXA 4N5EC 1BQSA 3EYSH 1PG7X 1XGQB 5KSUB 2AJXL 1YEHH 5ERWB 5E7BA 2GJZA 3OKEB 4QHKI 5J0BA 3L3GB 4H20L 1MJJA 3SY0A 4Z8FH 4JY5H 3KYNB 3OPZL 1U93B 5FAAA 3DSNA 3OAZH 1NBVL 4PJGB 1T0PB 4U1JA 3BDXA 3IU3A 2Y1VA 5E6IC 4NWTH 1T20A 5FYLL 4TPRH 1CGXA 3OXRB 4U6VL 3ZT6A 3TVMA 4LF3B 4ZYKA 1QSEE 4TVPH 1DL7L 5JHLL 1D5ZA 4FP8L 4L9DA 1KF9B 1KPRA 3WNNA 2FIRT 2YPLD 3FRPG 2G75A 1AHWB 3FB8A 3VXQA 4A2LA 4KUCF 3RVTC 3EIFA 3TBSB 4XP1H 1WITA 4GUPA 2EC8A 1KBGL 3HE6A 2GI7A 2M26A 3DPBA 4MAUH 3NFNA 1VPOH 5F8RC 1L7TH 3MRKA 3OJDB 5ESQA 1A3LL 2CKBL 1T04B 1RJCA 3GJEB 3VXOB 5DO2D 1BD2A 4PJ5B 5EORL 5F3BB 1F90L 3VXUE 2FH8A 3B8SA 4P23C 1EFQA 3ME0A 4XVUC 1IZJA 1NC2B 4M5YL 3U9UA 3PWVA 4W68A 5DURD 4WWKC 3BPOC 4QHNB 5I1GH 1OAKH 4F58H 2AXFB 3QCUL 4XP9L 5KVDH 4QOKE 5FCSH 2KKQA 4DZ8B 2VDRL 1P84K 3EFDL 4GQ9L 3GKZA 1DANT 2EYRA 2YWZA 2ZUVA 3FN9A 5MENB 3ULVF 2VDQH 5BVPH 1NGZB 1QLRA 3RWGA 2DKUA 5KN5B 4N0YL 1FHGA 3G6DL 3KLAA 4URTB 3MLZH 4TVPE 2B0SH 3TA3D 1JPSH 4R2GD 4EI5A 3LN4A 1QQDB 1TJGH 1T7VA 3X13A 3AC0A 3M17A 1IBGH 4MA3B 5E8PA 5C71A 2CO6B 4GRLB 4ACPA 5DZNA 1SJEB 5DJ8A 3M45A 4RWHA 4AEHL 3H0TB 1RU9H 5E5RB 1I8LC 5IMLB 3VXSB 4U7MA 1U8LB 1TTFA 1A9EB 4JQXA 2IPKB 5DGQA 5T5NG 1VDGA 1GZQA 1P4LB 1U8IA 5D2LB 3GO1H 3F58L 2EIDA 3EUUA 2B1AL 4KROD 1C1EL 2ICWA 5HPOA 5J89A 2PW1A 1AXSA 3HNSH 3MRBA 4P3CH 3RUGE 3U0TA 3R0MA 3BP5A 5E08H 2R4RL 2C7UA 1QSEA 3B2UD 4HS6A 4X6DB 1FNEB 2V7NB 3SE8H 1F2QA 3DXAE 1TJHH 2HT2D 1RK0B 3QULB 1A4JB 2DIBA 4JQVC 1YEKL 3RY4A 5CMAB 3WFEH 2JIXD 3G6JE 1MOEA 4Z0XA 4IRJA 4XCFL 4P5TA 5C9KA 2XTJB 5D4QA 1SY6A 3MRDA 3ZE1F 2RAMA 4J7RA 4L9LA 3PDOA 5L7XH 3LEVL 5EIIA 1T83A 4NN7B 2ARJB 2FJHB 3KYMA 3VWJD 1R5IA 1EO8L 2VZ1A 3AXLB 3MV7B 3GDBA 5FB8B 1CI5A 4P2QE 1EAPB 1CT8A 2ITDB 4WWID 3VXUA 3WKMH 2Y25A 5A16B 1E4WL 3RVVD 3SDAD 3U2SA 3EYUL 3GMMA 1RVFL 4JPKH 2X4UA 1OTTD 4PRID 1RZ7H 4PJAF 2B7DT 2YZ8A 4TSBH 2OTUA 1C5DA 4LIQE 3U6RB 1H3PL 1KFAH 5IFAL 3NN8B 5IV2B 3DETC 5F7WC 1ADQL 2FATH 4QOKA 1LWRA 1CYGA 5D5MB 5INDB 4OFYA 4XMPH 3CX2A 5EDXA 1G9NH 3BGFB 2H8PB 2YD6A 5DQDL 2CK0L 4L3ED 4DGIH 4KY1L 3HS0A 1JZ6A 5E00A 4ISVB 1EFXA 4FQQA 3RBGA 4S1DD 5IW6A 3BO8B 1JHTA 4ODSL 1DQQA 1RZGA 1X5FA 1U6AH 3EOTH 1H3XA 5GZOD 1HYSC 1MFEH 3BKYL 2FB4H 2AJYH 2H2PC 1N7ML 1X5YA 2E8ZA 1DSFL 3CSGA 3U4AA 4D9RD 4U7SA 1A22B 1FPTH 4FOMA 4FXGB 1KJ2H 4JAMA 4Z9KB 3DX6B 3MGAA 2P24B 3GSWA 3NPSC 4ZFZA 3BD5A 5JW4N 5DJAA 1OP9A 2H32B 1QD0A 4U1MA 2XWBA 4J1UA 3MRJA 5DRZB 3REWA 3QI9A 3MACH 5HI5C 2QSTA 4M62H 2Q87A 4MCYA 1L0QA 5HYQB 3L9RA 1LP9B 4ELKA 1R3JA 1Z6JT 3QA3A 4L8SA 1RI8A 1QFOA 1NL0L 3LH2L 1S7RB 4I3GA 5K33A 3SE9L 4FQIL 1T6WA 3RUGA 1XF2B 1P9MA 3AREB 1ED3A 1I7TA 1OF2A 3VRLF 2DD8H 1BBJB 5IJVB 1FVDB 1P7QA 3QDGB 2G5BA 3W11C 5EFIB 5HDOA 5T3ZE 1J7VR 3DXAA 1DDHA 3SE3C 4M02A 4U33A 1V8HA 1G84A 5C07D 4N8PA 5HGHA 3UJIL 4KI5E 4OLXH 5DYOB 2EXWD 4FZEH 4N68A 3V7AG 2YKLH 4L8BA 3OHXB 5KBNC 1FRGH 4FTVA 2K1MA 1KCRH 3N50A 2GSIA 4HLZH 3ESVF 3QPQC 5SX5K 1UWGL 4KJPD 3RP1A 4QHMB 1RUAL 5KTEH 4UT9L 1QVOA 1FVEB 3WIHL 4OF6A 1OSZA 4HIEB 4NN5B 4PJXF 5F3HA 4G9DA 4FQXC 1SYVA 5CWSB 1R24B 4OLVL 4PS4H 3QIBD 4FQHA 4P2QA 1FYTD 1QLEH 3LRSB 1RMFH 2LQRA 2BERA 1GAFH 4P5KB 3BKJH 2DMBA 1XF3A 3KYOB 5JOFA 1GGYA 1T1ZB 3KPNA 3EYVB 4S10A 4M6AA 1SJHA 4H26B 4OCRH 4HPYH 2CRMA 4JVUA 3RPIA 5DEFA 2X7LB 5IHZB 3D0VA 4MAYB 3GMLB 3NPZB 3TO4D 3E3QC 1I9EA 1AP2B 1Q0YL 5C09E 4P4KD 1OTUD 4ZOCA 4MS8C 4KHXL 2FD6L 5F7FA 3WFDH 4QF1A 1UB6A 4ODHL 2AK4B 2FGZA 3HI6H 3S4SA 1LDSA 1LE5B 2XXMB 3X3FL 3QEQA 3FB5B 3P4NB 1INEH 5F1SA 1NPUA 3QIUD 5E5MA 5HJ3A 2D0GA 2CRYA 2BNQB 4MNQE 4Z7WE 3FQRB 4PV8B 3KPMB 4PJ9C 3QUXB 4WENB 2VN7A 4DGYH 2EEAA 1KTLB 4OZIF 2A6IB 1U3HB 2X4QA 3QIWA 1TTUA 1MHCB 2AEPH 1FO0B 2HRLA 3NIGF 3BEWB 3LN5B 5ESVA 5GGSB 4ONGL 2NW2B 4L3AA 1IQDB 1X6NA 4IIQB 4OF0A 4PG2C 1A9BA 2MCPL 2KBGA 4WUUE 5CEYB 5EU5B 4WY7H 1A3QA 4PJEA 4LSUL 4WO4C 5IB3A 1QKZH 4GO6B 1UZ6E 1ZHKB 3RGHA 5KS9A 1T7YA 2OR9H 2RJMA 4Z7VF 5C0BB 1BIIA 2OI9C 3WHE0 3TO2A 2EYTA 2NPLX 3FMGL 2D7QA 4D0BA 3O2WH 3OG4B 5J4MA 1W8NA 5D2NB 1W0WA 1AGBA 4D9QE 5I1IL 1MREL 2YA1A 1KOAA 3N0PB 1XT5A 3KJ4B 5I16B 3BHBB 3MCLH 5HVGB 4ZUWB 1AKJB 4ZO7A 3S35L 1PEZA 4APQA 3RVXC 2LAAA 4XP6H 2WIMA 4MD4A 1DBBL 1CN4A 3JZ7A 1BGXH 1FC2D 3ZDYF 3L6FB 1I9IH 4JY6B 4RGNE 2D4FA 4HC1L 4Q9QH 4GW4B 3MA9H 1OAXH 3GGWA 1BVLB 1S78C 1WCQA 5GGVH 4KUZH 2Y07L 2E7MA 4NCC1 4I0PB 1E6JH 1JN6A 2ZUSA 4CDHA 3MJ9L 4NFBA 3NZHL 5HI4D 1K8IA 5KANI 4F7CA 3Q1SL 4JFQA 3BIKA 5BV7H 1KB5L 1UXWB 1MUJA 5JPMB 4OLEA 1XMWA 1N5AA 2OMNA 3HZMA 3WXVH 4KKNA 3RZCC 5TF1H 5E0QA 1CE6A 4OD2B 3K4DA 4BM7A 3NAAH 3DV4A 3O8XA 1ACYH 1I1AD 4HQQH 4LSVL 2FBJL 3V6OE 1X5HA 1M05B 2AK4D 4MNQA 1WGOA 3DVNA 3UAJD 1QFHA 4LVNB 3PHOB 4ZS7L 3CFJB 2X5PA 4ODVL 5BJTA 4PJFB 4HCRL 2UVEA 2PXYB 3IDXH 4GW5A 1A7NL 1P4IL 2EC9T 3VG9B 5C9JA 4YBLC 4BFEA 1TVBA 4JFFE 4OZHE 4RZCA 4E41E 3BJ91 1A4KB 2O26U 3JTSB 5JA8B 3NCCB 4NFDA 2V6HA 4NNPH 1WEJH 2AJUH 5AZ2H 3C5SA 4RGOL 2CDFB 3MPCA 1ZMYA 2J88H 4WUUA 4AEIH 2PTTB 1HHIB 1HK6A 5LQBL 1EHNA 3KPQA 5KJRL 4KI5C 3V4PL 4PJCB 1BQLL 2M2DA 5JPNA 5GGRB 4V1DB 4KJQD 4NKOA 1V7MH 4I2XE 5HBBA 2OJZH 3VXMB 1G9NC 2Z4QA 4FQJL 2ZZUT 1DP0A 5BS0E 3MZTA 3TC9A 3MUHL 5DMKB 3F5WB 5DWUL 2NYYD 2CDEA 2XFXB 4WI7A 3E2HB 3QXUA 3GSVA 3S36L 1IVLA 2AAVA 4EOWL 3QEUB 4Q2ZB 3RVWC 3VXPA 2DOCA 2ZCKH 1RUPH 2CD0A 2ICCA 3V4UH 5JIIA 3MV8D 2PYFB 4KKCC 4WW1B 2L7JA 5IWLA 5I8KL 2IGFL 5IIEA 4DK3A 2F58L 2VAJA 4G6KH 4EN3B 3BSZH 2ZUTA 3PP4H 4CMHB 1MHHA 2V9QA 5CIPB 3PP3H 3F7YA 4ZAKA 1U95B 2H3NB 3G5VB 1RFDL 1NBYB 2X41A 4ZFFA 3ARYA 2DWEB 1OAZH 3ARSA 4IHOB 5H35B 2I60L 5BRZB 1LO3H 3V4VL 5E8EB 1PSKL 1YEGH 3NZ8B 4J3WA 3MRFB 2QBWA 3PWJB 1K4DB 4YNYB 4EZMA 1K9TA 4HUXA 4PJ8A 5LXGH 1MELA 1T1YB 3CSYB 3OAYH 1KCVH 2GK0B 4YHNB 2FLBT 2YEZB 3BGAA 3BZ4A 4RRPA 5C0CD 3OKLB 3UZVB 5I8OL 1OM3H 1HHJA 5BVJA 3BYYA 43C9B 1OW0C 1FGNH 2F19H 4YBQC 3CUPA 4ZQKA 4D8PA 4MNGB 1S7QA 1RZFH 2CR3A 4JFFA 4CU8A 2GKIA 4HPOH 4UBDC 4N9GA 4POZD 2W9EH 5EZJB 1PVHA 1M6OA 4OV6F 2NY3D 3D3VB 5K93A 2YUWA 4UT6H 3GIVB 5F7HA 4MCZA 4NWUL 4ZS6C 2EYSB 3HMWL 5E94B 2AI0H 2V2XA 2PXYD 5KAQG 2AJ3B 5H37H 4PLOB 1QRKA 1U58B 4I5BA 3TIDA 4I2XA 5EO1A 3ULSB 2EXYC 1GGBH 4PRBA 1CFVH 4L8DA 2IH3B 4IDLA 2MPAL 3WIIL 4O5LH 4X98A 5BS0A 2X70A 3CK0L 1QLFB 4E9LA 2ICEB 5A2IH 1CGWA 1P7KB 1ODAA 2I26N 5DZOA 5IB5A 2ESVA 4HWNA 3DLQR 2WQRA 5E56A 5E4EC 5FK9A 2YN3A 3QNXB 2R2BB 2W65A 4FFVC 2WINA 3BPNC 4PV9A 1A1MA 1UFUA 2XT1B 8FABB 3UJJH 3QJFA 5DJDB 2WNGA 3L3DB 4BJLA 2FHCA 5EO9B 1C5CL 1CFTA 5FKPB 3EDJA 1A14L 2W0FB 3PHQB 5FGBA 4KKBC 3MLXH 5L8JB 3ZDXE 3FFDB 5DJXA 1H5BB 1DUYA 5T1MA 1WZ1H 4YDJA 4RGNC 2A73B 5ETUA 3V8CA 1LE9A 3O2DH 3DUSB 3QNZA 2C1OB 5DT1H 3EYSL 5CCKH 3JVGA 2BC4B 2ZPKL 4WU7A 4G8IA 5I0DA 3NBNA 4I4WA 4Z8FL 5IHLB 3LKSB 2NXYC 3B9KC 4PLNC 3BKMH 1CIDA 1FIEA 2HT4C 2IAMA 2WBJC 5FEBA 2FIKA 2HN7A 1U8OA 4EUPH 3MOAL 4NWTL 9CGTA 4TPRL 1RIHH 4CW1A 1U8PA 2X4OB 1WAAF 4X7CC 3MRNA 2VLME 3FCTA 4MDJB 2VUYA 1NLDH 4PJBE 4Q6IC 3MRGA 2P8PA 4LLYB 3HUJE 5EBMA 3V6OC 1FJ1B 3P77B 4OTXH 1NC4B 2VQTA 5DUBA 2JB6A 4JCMA 5HHQB 4X9IA 1U42A 5KSAA 3T77A 3GSNL 3QISA 5EC2B 3S37H 4XP1L 3C5ZB 4M8QA 2HKHH 5DC9B 1IGMH 2QLVB 1TVHB 4XBPB 5ANMB 4QRTB 1A6UL 5DJ6B 3L5WB 1VPOL 5SV3A 1L7TL 1D5BB 1T7ZA 4OZGB 4OFKA 2NZ9C 4GFTB 1FFPB 3BESR 3MBXH 2AV7A 2KH2B 2XZCH 3ARBD 1WFOA 2QQQA 1HSBA 4OGYH 4PBWD 4U49A 3UTOA 3FB6A 5GRUH 3X14B 1YC7A 3K8LA 4K94H 3FOMA 1ZS8A 3QXVA 1MLCA 5EZOH 1JMZA 1WBXA 3B43A 4JVPA 5I1GL 1YEFL 5KVDL 1IGFH 4KJYA 1NCAH 3Q6GH 3EO0A 5A2LH 5BV7C 3IF1A 3IRZA 3RIAF 1I1CA 1KIQB 2AEWA 3MR9A 5D2LF 4S1SL 1OARL 4EQ3A 3UDWA 2CIKB 3H3BC 4LQFL 1J8HB 4ZTOH 5FUCE 1F58H 4I18C 1S7UA 2DI7A 4F57L 3MCG1 4WDIA 2J5LC 5DHXB 4X6DF 2HJLB 1JPSL 1N64L 3QFJB 5CD3A 4HV8A 4YEFA 2BVOB 2EECA 4BH7A 5J9PB 3ZKXC 1IKNA 2HMIC 1FFRA 4LKCA 4ODXA 1NGWA 4PJHB 1N3NB 3G5YA 2YWYA 3BE1H 3WBDA 2ZOKA 1IC5H 3T08A 4NQEB 2Z31B 5GQBA 3HTLX 1FORH 5LBSH 3V0AC 4U3CA 1FCCA 5JW4Q 3JUYA 5MHSD 1L6ZA 3ES6B 4HJ0D 4YC2C 4JQIL 3RDTB 1FLRH 2BVQB 2F53A 4BH8B 3GO1L 4HH8A 3OG6B 2OJEB 2OSLA 1CXEA 3MCKB 3QUZB 3QG7H 4WFED 1SEBB 4U0QB 5I74C 1PDKA 4JFPA 5J8OA 4Y16A 4MA1B 2NY6D 5E08L 3U0PB 1RIUH 1JNHA 1TENA 3G9VA 3OQ3B 1FNHA 3SE8L 4ZFGH 3IDGA 35C8H 3DO3A 4MJ5A 5F88A 5HVHC 1BD2D 4JN2A 3CVHH 5E1AA 1WWBX 3ZDZE 2N4IA 1UYWH 2AQ3A 3X3GL 3WFEL 2VC2H 3WIHA 4NRZA 1A6VH 2X4SB 1HQRB 5HGGS 5F7UA 4U0RC 4JDZB 3WS6A 1NANH 5K9JH 4JFHD 4KDWA 3P73A 5L7XL 4LK4A 4JRYA 4MD5A 5DRNA 3VW3H 4TSCH 5T5NF 4DCQA 1KN4H 4ZDHA 1GXEA 2X4PA 3GMOA 3KR3H 3C5ZD 1XR8B 4LVHB 1C7SA 1CD1A 2FO4A 4H0GA 4JPKL 3P9MB 1VKXB 2VLRE 4ENEC 5L2JA 5AG8A 4TSBL 3DURB 1N59A 4RDQG 4JKWA 1NFDA 1DBAH 2FATL 2V17H 2VRAA 4TRPH 5IG7B 4JRXE 4HIXH 1I7UA 1YNLH 2GFBA 2GJ6B 4LFHG 1KNOB 1NEZG 3AGVA 2F8VA 1G9NL 3OKNA 4GMTH 2Q8AH 5JDSB 4U2ZA 1LP9F 5EUKA 2G2RB 4NZRH 4N9OB 1XGPB 3BQUD 2ATKB 4LSQH 4R7NB 3TNNB 1MVFA 3MO1A 2IPTH 2HTKD 5TH2A 4GRWH 4CDGC 4MX7B 3EOTL 3ARRA 3MLRH 1AJ7H 1IM9A 2D2OA 2J3SA 5E24E 1MFEL 4O51A 1AIFB 4UUJB 1H0DB 2FB4L 2AJYL 3QQ4A 4R6UA 3L5JA 4X6CF 3MXWH 3ULVL 2DIAA 5HD8D 2VDNL 1FPTL 1KJ2L 3DO7B 3TN0C 3SJVD 4J2XA 1BBDL 4YZFF 2D9QB 4UINH 1ZT1A 4N0CD 4KK9D 4OSUH 1CIUA 1FH5H 1MNUH 3O3DB 3H3PH 1MCNA 3UBXI 1UKSA 3MACL 3O3EB 4M62L 2A77H 4U1NB 2VLJD 1T0MB 4X4YA 1P1ZA 1QPXA 5F7NC 3BUTA 4XHJC 4ZFOL 3U0WH 1LEGB 2PW2A 4EDWH 1HIMH 1BAFL 2ERJB 2VZUA 2DD8L 3CLFH 3QDJE 2MCG1 1U36A 5D7SH 2HFGL 4M93C 5ADPH 5CP3H 3I9GH 4QT5B 4QKXB 3N85H 2X1XR 4HUMB 4AEFA 3DROB 4OLXL 3NIDF 4FZEL 3VGAC 2CIIB 2B39A 3ARGB 1FRGL 2GYSA 3RVUC 5D1XB 1KCRL 3KNBB 5FGSA 5GRJL 3LS4H 3O6FB 3T1FA 1XGTA 1J8KA 1KIUA 3X11A 2DLIA 3MA7B 3D1MC 3D2UA 2YBRB 4NC1C 1NEZB 3B4NA 3RHWF 5K9OA 3MYZA 1YQVH 1TZGL 3L7FB 2DQUL 4PS4L 2HH0L 4RMWA 2VSDA 5FUZL 5TPWH 4C83A 4JHZA 1EFXD 5C8JA 2BSRA 2XZQH 1BWMA 4ETQB 4PJ7E 3CFEA 4YFEA 1NGQH 3QUYC 1GAFL 4F2MA 2BZDA 1SEQH 3BEVB 2AGJH 4Z77A 3BKJL 2K7PA 4XC3H 4XI5D 3AAZA 3MJ9A 3RL2B 1VFOA 5HHVH 3SOBH 5KG9B 1XGRB 4OCRL 4HPYL 4MMZC