5E8DH

Crystal structure of human epiregulin in complex with the fab fragment of murine monoclonal antibody 9e5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPLNDKTKYDPKFQGKATITADTSSNSAYLQLSSLTSEDTAVYYCSRGGGDPVFVYWGQGTLVTVSAAKTTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proepiregulin
publication title Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 216
sequence length 219
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8dH02
2F53D 1DBJH 4EKXA 4DVRL 3IU3A 2FDBP 4JQXA 3J7HA 3FN9A 3MQIA 2MMXA 3OX8A 4X9IA 4XP5L 5ILTH 4OD3H 4ZAKA 3RTQC 3BQUA 3LS4H 5I71B 1UFUA 4ZPVA 4NKQB 3QQ9D 3DO7A 3ULUC 1IQDA 5I0DA 4YHYC 4Y1AB 1RUAH 1FO0A 1UM5H 5CSGA 2WBJB 2I07A 3UX9B 3LB6C 4ZFZA 2VSCA 5I0ZA 3CH1B 1Z3GH 4LHQB 1KTKE 4E0RA 4MNQD 3UTSA 1U8MB 2ED7A 3I50L 4MAYB 4Z7QF 1I1CA 1OTTC 5K9QG 1KTRL 1A7OL 1A5FH 4QRPB 1ONQB 2R9HC 4O51B 4A6YL 3F7RA 2OL3B 1MHEA 3LRHA 3K1DA 1CGWA 3NCMA 4ZOAA 2Y07L 3QUZC 1QPPA 3T0EB 1CS6A 4JPIB 2J8UB 5FUCE 3BSZH 5DXWA 4KMTL 3KYNB 5AZ2L 1QLRA 1QQDA 1H3XA 4Y4FD 3D85D 4J6RH 3O11B 5JUEL 4X7TA 4HWNA 1YQVL 3CK0H 1MQKH 2ICWJ 1T66C 1FDLH 3EOBA 4YC2B 3WBDA 3WL9B 1XAUA 7CGTA 4YR6A 4F3FB 1JWSA 4TUJB 5CZXC 4OCXH 3C8HA 4XCFH 4Y19A 1MFEL 4NO3A 5DWUH 4R4FL 1AGDA 2DLFL 3ELAT 1I1FB 3WE6A 1TPXB 3TO2B 1MPAH 1RK1B 1N0LA 4MNQA 3DV4A 3VFRA 1UCBL 1Q94A 2VDQH 43CAA 1ZXQA 3V4UH 1RJLB 2D31A 5DRWA 2NLJB 4DKDC 3IFLL 3UJTL 4G43B 1F4AA 3VRLE 3BN3B 4KKAD 4P4KB 2GQHA 1W0YT 1G7QB 1EEYA 4NGHH 3QG6B 3P3YA 2UWEA 4NQSB 4OM0L 3B4NA 4WV1C 5LXGL 3CLEH 3JWOC 4F9PC 4AENA 4PRPD 2BZDA 5IG7A 5IJVB 1I8LA 5IKCA 4KKBD 4TVSa 4JRXE 4OIIH 2J88L 1TJIH 1LDPL 2R2CA 2W65B 1E4XH 1V5JA 3K4ZA 1KJMA 4U1MB 2ORBL 3QCVH 4HGKC 4UBDD 4YFEA 2YKLL 2HMID 4I5BA 4RAUA 5CBEB 3ARVA 4K3EL 1AGCA 2GCYB 5E5UB 3F6LA 3BXNA 1UVQA 4UUJA 1RZ8A 2IWGA 1AGEB 1G6RL 4OLZH 4DFHA 3O45A 1CR9H 2G5BA 4M00A 1BQHG 1WVZA 3MXWL 1PW3A 3B9EA 4K7PL 3NTCL 4ODBD 5CINL 4M6NH 4JFOB 2XWBB 3EOAB 1A7RL 3LIZL 4M1GH 2J8HA 3D85B 4JKPH 3EGSB 3GSUA 4FZ8L 1SJEB 3OKMB 2A6JA 12E8L 3U7YL 3STZA 4XBPA 1K5NA 1UCTA 3HR5B 1ACYL 4HCRL 2A74B 3CDFA 4X4ZA 1MIMH 3SGDH 1SYSA 3FCTA 4Y1AE 3G08B 4AIOA 1FZJB 2YMXH 3VXSB 2IH3B 1SMOA 2L7JA 4OCSH 4BQBA 4ZFFA 2DL9A 3LKOB 4YHMH 4W6XB 1T1ZA 4DK6A 1XF5B 3GB7B 1D7FA 4FQLL 1J10A 4D2NA 1P7KA 1OWWA 4PYGA 1GHFH 4PTUB 1G9ML 5GIRA 4MS8C 1NCBH 1J05A 4Y16B 4HJJH 3KLAA 1BGXL 3MJ7A 1HKLH 3QCTL 4NUJB 4QXWA 3TPUB 3E2HC 3BAEH 1IGFL 3IXAB 3WS3B 1JL8A 2VISA 1RUML 2CK2A 2XWJA 5EU6D 4JY5L 1VPOH 3VDCA 4N5EC 4MB5A 5C0GB 2DWDA 4LSQL 2EDTA 5HDBE 3TC9A 1DBML 4N8CH 4D9LL 3HE7A 3OWEA 1VSCA 2QADD 4MD5B 1IEBB 2ICWI 5F8QC 3CC5B 3DJ9A 5J11B 4XAKD 2IQAB 4UT9H 1ZLWK 4YHIA 5GS0C 3TYFA 3OZ9L 2JJVA 1Q9WB 3V7AE 3S88L 3BESR 1UWXH 3U7WH 3QPQC 2BK8A 2EDRA 2R1YB 5T3XD 4LOUC 3DX7B 1FO0H 5IJKA 1X3DA 2ICCA 2UWEF 3RVUC 4LNVA 1FZKB 4NNYB 4I3SH 4JAMB 1YEKH 1T7VA 1JYWA 2K3TA 2NY3B 3FO0H 4KKCC 4U1KA 5C2BH 3HZYB 4Y8DC 2WZPD 1FBIH 4E41E 5D1QD 3D48R 4PJHA 5JO5B 3SBWA 4OLVH 4D9RD 5C0DB 3TA3C 2A9NL 1ZLSL 5FYJE 1N2RB 3DX9B 4HFUH 5JW5A 5D2NE 4JFFB 5EPMA 1PDKA 4PG9A 1JTPA 3KXFE 1UG9A 1JPFB 3H3BC 4PS4L 5BS0D 1SVCP 3G6DL 2FD6H 2AVGA 3BGFC 2P5EA 3WMSA 1BFVL 1MFAL 3TIEB 2MTPA 4XGZB 1XGPA 1FCCA 4TPRH 4Z95H 5DC4B 5LQBH 4POZD 1TXKA 5E99L 3GHEH 5ERWB 5DYOA 5DRZA 5JPNA 1AQDA 2RR3A 1XGRA 4XP6H 4N8VA 2VUOA 2DM3A 3Q5TA 5EU6B 5HHVH 1EIBA 5T5NF 2OP4H 2RGSA 3KHQA 2FR4B 3IJSB 5D1QA 1DQQA 2NY4C 1YZZA 4XPGL 1LO3H 5CJ5A 4R6UA 2NY5H 4NCC1 4IOIA 1UXWA 1ERNA 1KIQA 4KZEH 2W9EL 4PJ7B 2L7UA 5KVFH 2PXYA 3DNKA 3BE1H 3QNXA 4UTBH 1CGUA 3C60C 5I1EL 4K3GA 2FBJH 2WQRA 4AJ0A 4DCQB 4FXKB 1HH9A 3L9RA 1JWMA 4GBXD 1UGNA 4JFYA 3WFEH 4PB0H 5ACZB 5BS0A 3GBNL 2CH8A 1XCQA 3MLRL 3VFMA 2C3VB 3DV6A 3H9SD 1S9XA 2AJ3B 3MROB 5H37H 5LWYH 1HXMA 1Z9SA 2VSDA 2ZPKH 3W39B 3F58L 3ORJA 1BJMA 4YHLL 1AXTH 5EO9A 4WFGD 3B9DA 3S3SA 4YDVA 4H26B 2EH7L 3C8DA 3WUWB 1AHWC 1OAXH 2AV7B 4ISVB 1A0QL 2AJVL 4LSTL 2NXZD 3WLBB 3FT4A 4TTGA 3SGJC 5HYEA 4F15B 2R39A 5DD0L 3GRWL 3U4EA 4L29A 4OLXL 4LAQL 5IVXF 1UKSA 5I8CB 5BXFA 5A1AA 2P44B 2ZUYA 4RX4D 1IC1A 5JLZB 1DSFL 2G60L 2OTWB 3MRRB 3CXHK 1XF2A 3QYCA 3RDTC 3B9KC 5DGRA 5ESQB 4F37F 5I66A 4QHKJ 1B6DA 3HRZB 3MBEC 3VXOA 3NFSH 3MRBB 4OD1H 4I3GA 4LVOC 3RA7L 2XA8H 1KNOB 1XGUB 2JCCA 1KCVH 1TNNA 2DQHL 4M8VA 4GBXA 4PJHF 3LQMA 3U0WH 4TUOB 4FTVE 2CDEA 3HZKA 5FECA 1KC5L 4KGJA 2D9CA 4IJ3C 3H9SA 3GHBH 5CGYC 3OG4B 2A6KA 4LGPB 4R96A 3V6FA 4YXHH 1IAIH 4K3DH 5C92A 2BSED 5FB8B 4XRCA 3G5ZB 1RJCA 5DRXB 3HC4L 4P57A 3NA4A 1TLKA 1BZQK 2AQ3A 4K23L 4N0UA 3BW9B 5L88L 2FYYB 1F58L 1G9NL 2HKFH 1NBVL 3S4SG 3A67H 5JA9A 5DJAB 1BX2A 3Q6FA 4MLSA 3T77B 3TCLB 2X2YA 4HUVA 4NO0A 4JFFE 4LSPL 4X6FB 4FQ2H 2OBGA 3GZKA 5IVZA 2JELL 4HS8L 4WO4D 3TWCL 1GGUA 5DD6B 3V52L 4OF8A 4QTHA 2VN4A 3RVTC 2GFBA 1GPOH 2XXMB 4YXKH 3ULUE 3DETC 3ZE1F 1VFMA 3C8KA 3K4AA 1MCCA 1T0PB 2RB8A 3C5JB 1FN4A 3I2CL 3IF1A 4NM8H 4UB0L 1KXTB 5A40E 2X1QA 3D69A 4YJZL 3V4VH 1TCMA 4RWYL 1QFWM 1Z9OA 2NXZB 1HSBA 2XNAB 3L3OB 4JKKA 2AI0L 1C12B 3QDJE 1M6OB 3E2HB 4L9LC 5JXEA 3WFHA 4OAWA 3V2AR 3MCLH 1AJ7L 4BFEA 3QFJD 3IJYB 1IC4L 4DKFH 3T2NL 3T4AA 4HK0A 1VFBB 2ATPB 3P9MA 3TBVB 3ZTNH 4AEHH 4LMQE 4HH9A 5JW4Q 1YNKL 5EZOH 2JE8A 5T5FL 4Y5VC 25C8H 3SGEI 4JFEB 2X4UB 5EU5A 4XWOD 2OYPA 2VQTA 3WIIH 5D71H 4C57C 4XVSL 2P49B 3ARXA 1L7TH 5HHNA 1NC4B 1D5ZB 1N7ML 2WLZA 3CD4A 1S7QB 4PIRF 4C58B 5JOFB 1JUFA 2XZCH 4OZ4A 3ZT6A 1WCBA 1J0YA 1FNEA 3S9DB 1NAML 4DKAA 1BD2D 4UIMA 4P49A 4KDVA 4EN3B 4NBZB 1FSKC 3WXVH 4XC3L 1A6VH 2AXGB 1GAFH 2X70A 4ODVL 2BJMH 1X5LA 1PY4A 4B50A 5E8NB 2BERA 4K3HA 5E2WL 4JB9L 3L5JA 1YPZA 2I9LB 2PO6D 3GJFB 1KEGL 2JCCF 5H2BA 3MV01 1RMFL 3QDME 3GI9L 4JFXB 3ARBD 2JB6A 3BUYB 3TYGH 1NEZB 2V9QA 2DF3A 3ULVC 2FJFA 4WO4B 3NCFB 4QOKA 4PJAB 4QHKI 3BZEA 4GG6B 4NM4L 1Y6MR 3TNMA 2AAVA 2NPLX 3EYOA 3O3BB 1YEIL 1S9YB 2RJMA 4TUKH 4FN0A 2ZOKB 4JQIH 3MA7A 2ED8A 2F74B 2R4RL 2ZCHH 1NC2D 4LCCC 3S96A 3MO1B 3BZ4B 4G7VH 2IMNA 3GMPA 3JV0A 3ZMRA 4DZ8A 5HI4D 1BD2A 3KNBB 1LK2A 1INEH 4X80L 1A3QA 4P3DB 1ADQL 4LSVL 1LNUA 5FHAL 2W0FB 2DMBA 9CGTA 4FFVC 2E7LC 4G6ML 1J1XH 2PO6A 4H8WC 3WV0A 3MRKB 1N59A 3QFJB 3U6RA 2COQA 3O6KL 4HIEB 3CFCH 5E94B 2KZWA 4G6AD 2R15A 3KJ4C 5L6YL 5C71A 3OKLB 1CGSH 5TDPB 5TQ0H 5FF6A 5I1IL 4GRWE 4FFYH 4NT6A 1PLGL 3O6LH 4WUKH 5C3TA 4O5LH 4NNXB 1LGVA 2AGJH 1MCLA 4M7LT 5IMOB 1JGVL 3B6SB 2FJHA 3EHBC 3PGDB 1F45A 3D39B 4FMKA 4LSUH 3NAAL 1CVRA 4FS0A 4M4PA 3UJIH 4QF1B 1BF8A 4U1HB 3FQWB 4LVEA 5E8DH 1OP9A 3QH3A 4OV5A 3W0WE 1N4XL 1FJ1B 4GKZB 1RVFH 5C0AB 1X5YA 4JG1H 2QQKL 2HT2D 3DUSB 3O81A 3T4YB 5F1OB 3ARBB 5DUBA 1MCFA 2GJ6B 3FOLB 4KHXH 3QJHA 5C86A 4AM0A 2V2XB 5L8LB 5D7SH 5TPWH 1SJVA 4Y5YA 2OL3L 4OLYL 4OZFA 5K9JH 2R23B 2ICEB 3TH3T 3KJ6L 1WEJH 2I9TA 1F8TH 3MRHB 4GRMA 4M7KL 3OR7A 4KQ4L 1HKFA 5F7FA 3SDDC 1R5IA 2AJSH 3CZFA 4ZUWB 2OLDA 3B9KB 1MLBA 1G7LB 4JFEE 4R4BA 5FYLD 3DURA 1A6ZA 4X6CB 3MBEB 2OX5A 2DQIH 3OB8A 5EIQA 3P4NB 1BZ9B 1YPZF 3O6ML 1FVDB 1DQTA 4U6XA 3DYPA 3S37H 2C1PB 1NC2B 4GJTB 4NOFA 3NFPB 3D25B 3HZVB 3TT1H 2PTTA 4ONFL 3MV9D 4XBEH 3T1FA 3RWIB 4WHDA 1A6AB 3FB8B 3VD3A 4KKLC 3LZFL 3BH9B 4JO3H 1UWXK 3HZMB 5D7IE 4HHAB 1RZKH 3FHAA 3HE6A 3BGMA 2JF1A 2CIIA 3S36X 43C9A 4G8FB 3PV7A 4MD0A 4P2RE 1XGQA 4IEFB 5IB2B 5FGRA 4PRDB 5JOEA 1P7QD 1MJ7L 5GRJL 4ZXBD 3P0YH 2GKIA 4KK5C 3TBWB 2F8OA 2V6HA 3BD3A 5EOQH 7FABH 4Z7WA 1CLZL 4XPFL 5HGGS 4F7PB 3M8OL 3NABL 4JM2D 4LAJH 4QTIL 3H42H 1EO8L 3PP4H 2Q76B 1CLOH 4OF7A 3U4AA 4M1DH 3K2MC 4YPGA 4GMSL 3H7BB 3EFFB 1QLFB 3S5LB 3UTTA 5HVHC 4LLMA 3P4MB 4EBQL 3HS0B 3KYKL 1O7VA 3QRGH 4R97B 5T1KA 3MLXL 1AR2A 1LK3H 2N1KA 4OCMC 3VI4F 4Y4HD 3GMNB 2J5LC 3FT2B 4MYWB 5C07A 1TZHB 4Q2ZA 5TF1L 1EEZA 2AXJA 3BEVA 5CJXC 3TZVD 2YUVA 5GSVA 4M62L 1JFQH 2MQCA 4WWKC 2QHRL 4HBCL 4DTGH 3BPCB 5HVFB 2XV6B 4ETQA 5MP6L 4E9LA 4PBVC 4GMTH 4KRNA 2HVKA 4MXVE 1DP0A 2IAMC 4WHTB 3Q0HA 5ALCL 5E1HB 3GSNH 1OPGH 3CFKA 5BRZE 3MLSH 1TQBB 5GRUL 3HN3A 4RFNC 1TITA 4X6DA 1JPTL 2HLAB 4PRID 4L9LB 2VABA 4MJID 3MUGA 3QBTB 4ZXBA 2ZNWA 2YRPA 5C0FA 4DN4L 4KV5E 3RWDB 5FK9A 2J6EH 3QXDA 1SM3L 1DBBH 2RIKA 1HIMH 3MV8D 1QNZH 3EYUH 3IDNB 5ESAA 3QIBD 3IKKA 5IP4A 4JM2A 3EOYG 4ODXB 5KW9L 4Y5VB 3RPIA 3U30B 1FORH 5INCB 1TJHL 1NFDA 4X0KB 5K9OB 2X9WA 4I48B 2HJFA 1KJ2B 2YRLA 4OF6A 2BY1A 1C1EL 3V0AC 3LEXA 2Z8VC 5DRNB 3DVFA 1QR1B 1VACB 4Y4HA 1YC8A 5F1SA 5JW3H 1CFQA 2YR3A 3CFJB 4MJ5A 4YHOH 2Y9RT 4O4YL 5C0AE 3X14A 1D6VH 4QHLA 1ES0A 3TZVA 4Q9QL 1K3IA 3RWHA 4D0BA 1BVKB 1CICB 5JQ6L 4R0LB 3D18A 1J1OH 4JJ5A 4D3CL 3UJJL 1P7QB 1BWWA 4JRYE 3RY6A 4HUUB 1NCAL 1EJOH 1OT1A 1S7TA 2O26U 4MJIA 5DUML 1T3FA 2X1XR 4PJ9C 1V7NL 4XCYB 1J8HD 1R5WB 4NKDB 4KKNA 1MCOH 4LBEA 1NBYA 3NIDE 1YEGH 4P46C 4NPYA 5HHQA 5IB4B 2EIBA 4JPVH 5E9DD 4L3CB 4OD2B 5J89A 1NKOA 5D6CB 2V7NB 3WJLC 3BKCL 4MDIB 5EOCL 4X7EC 3LH2H 4Z7WF 1BOGA 4LIQH 1I3GH 5LKNA 4LCCB 1AQKH 2JTDA 1M71B 4NQCA 1OVZA 3B83A 2E6JA 5SWZD 4N0CC 4Y8AA 3SKUD 1VDGA 4KZDH 1IGJA 1JBJA 3EJYC 4ZPTB 4ZAKC 4ZOBA 3WN5B 5BW7A 5B38A 4PRIB 4UNUA 1WBYB 3AU1B 3JV4B 4PGDA 3TPKA 1BEYH 4H5SB 5E2UL 3HLAB 1LEIB 4NP4H 3PJSB 4WDIA 3UZEA 2HN7B 4KRMB 4HKJA 3MV8B 4WI6A 1I3RB 1CFVL 4PLJD 3BP4A 3QIBB 4KU1A 2B0SL 3MRMB 4XNXH 1JGUL 2BSSB 4XNMB 5B4MD 2Q7YB 4TVPE 3VFUB 1EO5A 2HWZH 3VRJA 4HMDA 1N6QH 5DA0B 5CILL 5DD3L 2R0WH 2CKBA 5E9DA 2YSSB 3IS1X 5H94A 4WW1A 4X6DF 1OB1B 5J6HB 1KCUH 3CPLB 1SY6L 3BP7A 3EDDA 1YYLH 1ZKAA 4PJEE 1NMCB 1LEGB 1NL0L 3O8XB 3JXAA 3VWJA 3WO4C 4DK3A 4H20L 3ZKNC 1NFDF 4RFOL 1EX0A 4QGTA 5FM5M 1ZE3C 5F44A 4JZNA 1AIFA 1MCBA 2KBGA 1JRHH 4HF5H 1MNUH 4F37K 4KI1A 3RNQB 3OKNB 2DWEB 4YDLC 3U9UA 2CLZA 3JWDC 5T1DL 2OTUA 1KTDB 4HLZH 4KRPC 2XQYG 5BQ7B 2V17H 1NCCH 2H41A 4P2QB 4BQ6A 3BN9D 5DVKA 3ISWA 4GLRH 1BFOA 5CHNB 5J1TC 1NFKA 4K7FA 2EXYD 5I8KH 4U3CA 4RISH 1NLDH 4NZRH 2NY5C 3EO1A 3OJDB 5IW1B 1VGEH 5T3XL 1A6TB 2W60A 5D9SA 3JTSA 5SWZB 3QB7C 2Y5EA 5E2JA 3Q3GB 3BGAA 1S5IL 2CLRA 3RVXC 1JF1A 2D0FA 4GAGH 4BSWA 1EERB 3IT8D 1I8LC 5ID1B 5DA4A 3WKMH 5CJOL 5ENWB 5SX5H 4L8DB 1FNSL 1TVBA 1WFTA 3OAUH 5AD0A 2AKRA 3KGRA 5I73B 3ULVE 1CL7I 3HHRB 1F00I 1JIBA 2H2PC 3GUTA 2BHZA 5GGVH 3VFOB 2CMRH 3HB3D 3WIFA 2R2HA 1QBBA 4EQ2A 4X83A 4NQDB 3FFCB 3QUMA 2R56H 3NIFE 5F7DB 1HHIA 3X11A 4HDIA 1GSMA 2VC2H 5HVHB 3RVVC 1YJDL 3MLUH 3HKFA 4HULB 2ZCLH 3L3IB 4PB9H 5BV7B 2DM7A 4KKAC 1NGXA 4BZ1H 2IPTL 5JORB 3B2UC 3JWNC 4RGOH 2ZG1A 2VAAA 5AG8A 3GSWA 3JTTA 2R0KH 1X4ZA 4HPYH 1HI6B 3GK8H 5F3HB 3CLFL 4JLRB 2HLFD 5LG1A 3ET9F 5H35B 2IAMB 1JGEB 2EDLA 3KDMB 3IDUA 4KKBC 3TLRA 4ELME 4RFNB 4NUGH 4TSCH 2AJYH 2NY7H 1U8HA 4LDOB 1QSZA 1RK0B 1FC1A 2EYSA 4LL9A 1CXIA 1TVHB 4M02A 3SDYL 2E6PA 4TQEL 3KPSD 1MUJB 5KOVC 4LPYA 3DI2B 4C55A 1RFDL 3C6SA 5JHDB 1JNHB 4HG4K 4FQXD 4XBGA 2QQNL 1KJVA 1RIHH 4YAQB 5HYSG 1MH5A 1CD1A 5TE4L 4KMLB 5GGSY 5I2IA 4JRWA 1FNLA 5IEHA 3MNZB 4EIZC 1KFAH 2Z4QA 3OPZH 5CAYB 3DVNB 4G8GD 4H0HB 3HE7C 2VLJB 1HDMB 3OR6B 3B5HA 4JZOB 2ZSWB 3NIGF 4BZ2H 5E03A 4OFYD 5I74B 1YDPB 3GSXA 4XNUL 5I16A 4PJXA 3BDXA 1YEJL 1P69B 1CGVA 4LHUG 4XMKL 5DJXA 1DUZB 3QO1A 4PJFF 3C5SA 1QA9B 2QR0B 3QEHB 5C0IB 1OQOA 1W0VB 3K80A 4GG8B 5C7XH 1CXEA 2MQ0A 4P2QE 1T1YA 3WS6A 1SJHA 4NDMB 5IJKC 3OF6D 4B7IA 4L4TD 4XC1H 1CIUA 4JO2H 3S36H 1I8IA 3PGFL 2XOTA 2YA2A 4WNQB 2IANA 1NGQH 3GIVB 3O3AB 5DJDA 3OSKA 1WC7B 2VQ1B 4POUB 1PSKH 4MCZB 1MJ8H 4D0DB 4PRBA 4IS6A 1A7NL 5MEPB 1L9MA 3GMLB 3RGVD 5ITFB 3SBWC 1GL4B 1ZSDB 4M6ML 3VE0A 4S1RH 5BMFH 5DD5H 3WFZA 2BVQB 2J3SA 5E95B 3O3UN 1TZIA 4HKXA 2QQLH 3KPOB 4G8GA 5HYIA 4MB4A 1DDHB 3BP6B 3P40A 1QBMH 5KZCB 3IU3B 4Z7UA 4EI5B 5DUPL 2DS4A 4FOMA 1CK0H 3EFDL 5FKAA 5DMGC 4R3SB 3VFTA 2BRRH 4TTDD 4ZAKB 3OKKA 3BYYA 5FUOH 1C5BH 2MSPA 3EJJX 2F58H 1CQKA 4X5WA 4ENED 3KPSB 4R2GD 1CXLA 2I07B 1MVUB 2QKIA 4KUCF 3LV3B 4NQDE 2RFXA 4ODTH 4L4TA 2KKQA 3L1OL 1VGKB 1FL5B 2OCFD 3HCVA 4E0RB 3KYOB 4FQXB 2H9GA 2HT4D 3SJVD 4PLKD 3UAJC 4HWEH 1SYVA 3I9GL 5J9PA 3GSQA 4TRPH 2DLGA 3P11H 1MIEL 4NOBA 2HAZA 1RJYB 5F9WC 3V5KA 3CCHB 1SJXA 5BOPA 2MNUA 5BCAA 3L5XH 4OTXL 2BX5A 3OJMB 4Z7QE 5DMIL 2XXCB 4NRXB 2PXYC 3I3BA 2O61B 4KJWC 1U8PA 2P5WB 1Y0LB 3NZHL 4AEFA 3VRIA 5ICXA 2HKHH 1GGCL 1GOFA 3WSQH 3AS1A 4XPBH 4AT6A 3FZUD 2AK4A 2VL4A 4Y19B 1F90H 1T5WB 4GRLA 1WTLA 5HGAA 4KRPB 3WE6B 5I1AB 5IHZA 3QZWG 5EBLA 4YFDB 15C8H 5JHDE 3U4BL 3D9AH 3MODL 2EO9A 2W9DL 2WUCL 4PJXF 1QLEH 3RGVB 1NGPH 5F89B 4ZUTB 2EXWD 3IVKA 1GIGL 2VLME 5CZVL 4WUUB 5JZ7D 3U9PH 2Q86A 3B43A 1CE1H 3F12B 3N50A 3MPCA 3AGVA 4LPWA 4EZMA 3KVQA 3BYTA 4ZD3L 4KJPC 1AR1C 1U36A 3MXVL 5AYUL 5C0NC 2IJ0C 2YD2A 4UQ2B 1BZ7B 1F4XH 1DUYA 1KG0B 3AXLB 1BQLL 2QQQA 5IKCB 2XYCA 4N90D 1QFWH 4R2GB 3WD5H 1HWGB 3GMRA 1TNMA 4NJ9L 3OKOA 1RZJL 3FKUS 4HH8A 1DBAH 4HIXH 2YPLD 1T83A 2XKNB 4RBPH 4Z7UF 5HHPB 3FQNB 1KJ3H 2OJEA 2VZ1A 2D0GA 2FH6A 2HG5B 1GGIL 1I7RA 5J1SC 1YECL 1Q1JL 3B5TA 1CL7L 2WWMD 4YUEH 2BNUB 2D7MA 1A7QL 1OGAD 4H0GA 1FVEB 3GSUB 1H3VA 4K94L 4UV7H 2AK1L 4G5ZH 2EYTA 2C26A 3STZB 5L8JB 1QFUL 1CXFA 5CMAA 2ATKB 2BOCA 3L3DB 1MHCA 2UUDH 1E27A 1HHJA 3MJ9L 2VLLB 2IPUK 4OCRL 2PTVA 4ZTPL 1GCFA 4X4MA 3QXAA 1N8ZB 3SHSA 4WGVB 2J4WL 4QNPF 4JQVA 4KK9D 1L9NA 3F7PC 3KR3H 2ENSA 4ZFFB 5DJ8B 3V0WL 3MOBH 5L8KB 2VDMH 3UTSE 5I1HL 1RZKC 2AJXH 2D03L 4JN1H 1P7KB 4UNVA 1T1XA 2ARJB 1NDGB 5KBNC 1IT9L 5E2VH 4G9FB 1DVFD 1J05B 1WIUA 3I6KB 4DFIA 1FIGH 1R5VB 3FMGH 2WWKT 4OSUL 6FABH 1MCPH 1P53A 5IESL 2YPVH 5IQ9B 1N64H 4KVNL 5JXEC 4RGNC 1KGCE 4TSAL 4YDKH 3WDIA 4W81A 4PV9A 1A9EA 4P23D 3ILPB 2E3VA 3DYOA 3SY0A 5DEFA 1MJUL 4P3CH 4IRZL 1OGAA 4G6JH 3U36A 2VXUH 3L3HA 1OSZB 1I1YB 3IDGB 5DHYA 3OKDA 4Z7VA 4ZO8A 1IGTA 3ZDXE 5ISZD 1KLGA 3W9DA 2E9JA 5KSAD 4EDWH 4Y19E 1ZGLM 3DRQB 1KN4H 5LBSL 2W92A 3OJ2C 5IVXB 1MJJA 4I0CC 1MI5D 5JW4N 3V8CA 5D7JC 4DKEL 5CZKA 2YPLB 3RZWA 2RBLA 5KS9A 4YBLC 2ZNXA 2FSEA 5FYLL 3G6JB 1MAMH 1GZQA 2A77H 3TN0D 4EUPH 1DVFA 1G0YR 4NN6C 4WUUE 2Z35A 3WFBH 3VW3L 3TBTA 5KSBF 2WP3O 1ZHNA 1HOCB 1KJ2L 1ZHKA 1RZGA 4P23A 3FONA 5TH2A 4PGBA 2JJUA 2UWEE 3H3KA 3VGFA 2XZZA 3C5ZC 4WEMB 3MGTB 4MA7H 5BO1L 3FQRA 4NNPH 4CNIA 3GMOA 3SQOH 3DARA 4JDZB 1CFNA 4YHZL 5EPMB 5TQ2L 4K8RH 2CK0H 3VG0H 1WZ1H 5EO1B 1AKJA 4YQXL 4NYLA 4EDXA 5TE7L 2FEEI 1ZHBB 4PJ5A 5LGJA 5ISZA 5KSAA 4FFZH 4K2UH 4F58L 4DGYL 3GSRB 3NACL 1ZT4B 3SE9L 4XXDB 5SX5K 4UU9A 1MWAA 4DW2H 1JPSH 2P5EB 5EUOA 4GW5A 1RUQH 3IXTB 4RRPG 1XGPB 3VXUB 2OXGA 3RGHA 5KVMC 4DAGH 1ZLUH 2F5AL 3PNWA 2XRAL 3TN0A 4LCWA 5GQBA 1HYSD 2GK0B 4DUXA 4Q0XH 2PO6C 1SBSL 2EZ0D 1IKNA 2BFVL 5F88A 1RI8A 1T6WA 1INQA 1QO3B 1N3NA 5C0EB 5F9WB 1P4IH 4PGEA 1ED3B 5I8OL 3S34H 1VKXB 1JE6A 2ZCKH 1FNAA 4PRNA 5FV2A 3CVHA 1S7VA 4L3AA 5KG9B 3GKWH 5EA0H 4MSWB 5HVGB 1UKTA 1YN6B 3KPLA 5IMMB 2YHGA 5IOPA 1RZFH 5E4EC 4HIHA 1H3WM 1FH5H 4H1LB 3L9RB 3FRUA 1MI5B 1A4JB 4E42A 5K59F 1F4YL 3VJ6B 2W0KA 3D0LA 4MXWH 4M93C 4XB8A 3MLVL 1REIA 3HNTH 2DBLH 2D7OA 4BH7A 4MDJA 1K9TA 1A64A 3MUY1 5JDSA 1K8IB 2DAVA 1SEQL 1U95A 1W72A 3O3DA 5FUZL 2R8SH 5HI4C 4Z7VF 4YDVB 5C0BD 2YEZA 1BQHA 5T1LD 1GRWA 3K81A 4MCYB 3WLWC 4KTEL 5IUSA 5GZNC 2C3HA 1AD9B 2DQJL 4HWBL 2B4CH 3LY6A 5T3ZD 4OT1L 3U4EB 4Y5YC 2JKXA 3P2TA 3D3VB 4OCWL 2FLBT 3VXMB 5CIPA 4MB3A 1UA6L 5KN5A 4NCC2 2Q1EA 1XF2B 4ZUSA 5ITBH 4BKLA 3N85L 1DBJL 2VLKB 4WCYL 1R3JB 1HZHH 4QT5A 3VXOB 3K1KC 3LN9A 4J2XA 1HHGA 5CUSH 4R90H 1JHKH 5F3BB 1WZLA 2DKSA 4BYHA 4MJ4A 1I8KB 1CF8H 1EFXA 3M17B 5T1MB 3FO1B 4H25A 4O2FB 2AEPH 4YE4H 4FQQA 5GGRA 1Z3GL 2YD4A 1DN0B 4Z0BL 4GQ9H 2A6KB 3ZSSA 1GGBL 1QSFD 3KPRA 3HE6C 3T8XB 4NKOA 5I1KH 2HJKB 1JNLL 5C0BA 1YEDB 2ADIA 1J0HA 5T1LA 2DOCA 5D70L 4PJHE 4XTRC 3L5WB 1QYGH 1CDCA 2YWYA 2X4PB 3FTGA 5EIIB 4N0UB 5F9AC 3WIHA 5CEXB 3KLHD 4JY6A 1JNNL 3MMEB 3QXWA 3O4LA 3CFIC 4DN3H 4P59H 3U2SB 4LCYA 1AY1L 5BVPH 2DQGH 5HD8D 3MZTA 5IVZB 4HQQH 1JNJA 2EC9T 3W81A 3O41B 4PBXA 1FGNH 2DQCH 4PY7B 4TSBL 3MOAH 5MEQA 3QWOA 1LE5B 4XCFL 2P5EE 4XMLH 5DWUL 4JO1L 1L4IA 4KROC 4AEIH 3S7GA 5A16A 1R0AL 3BIKB 1H8SA 1IKFH 3F7VA 1NMBH 2HH0L 4O58H 4JG0L 4ODSH 3V5HA 3V6BR 2VE6A 1A1OA 1H0DA 2LV4A 5DJ0A 1MCRA 3PWNA 3WEXB 2VDQL 4O9HL 3BPNC 4TNVF 4OCLC 3ZE1E 4MHHG 4U1IA 1U0QA 3ZT5A 5DURD 4RWHA 5F96H 4Z0XB 1LO2L 4HKBB 3W82A 3BHBA 1UWGL 3LN4B 4RFEB 5BV7L 5E8EA 4NGHL 3T4AB 1G7PA 1S7WA 1ZAGA 4G6KL 5CEYA 3CLEL 5E00A 1FG2B 4NBXB 1D5IH 3RU8L 2NX5D 3QG7L 4KAQH 3UROR 1TMCB 3QHZL 1JK8A 4ZNEA 3TESA 2GTZB 1RUPH 5TGBA 2HFEA 1TQCB 3IDMA 3ZHKA 4NQED 2BNQB 4G8EB 1FP5A 1QRND 5D7JB 1QSFB 1LMKA 5CLWA 1WCBB 4G6FD 5DEGA 4NN7B 1M05A 2WANA 4N1CA 3GSNB 2H3NA 2K1MA 2LU7A 3EJZD 5I15H 4HBQA 4AK1A 1KPUB 3D3VE 3RY6C 3M1BB 2VXVL 1QSEB 4LPCA 5EWIL 2VKXA 3QA3A 5E5MA 4NWTL 3C5ZB 3HUJF 1DQJB 3REWB 2SEBA 2P47B 3BPOB 5IFJB 5J1AA 3CVHH 4J23A 4QOKB 2MQ3A 3TJHD 1D5BA 3CFDB 2EDQA 5DQJB 3BZEB 4ZYKB 2JCCE 2X4SA 1YN7B 5HHME 5C08A 4BFIA 3EYOB 4JHZA 5ADOH 4OZGB 2YMXL 3GBMH 4MXQD 2OSLB 5EZIH 3HI5H 5IW6B 3H9SE 4Y0GA 4YHML 2ARJQ 5DJ2B 4NQEA 1TCRA 3OTTA 1PKQB 1I1AD 1M7IA 1GHFL 2NNAA 1NCBL 3EDEA 1OLLA 1N0XL 3P77B 1JZ3A 2CIKA 1VADA 4K9EL 5BW7C 2X44D 1W72H 5DURB 4HX1A 4N0UE 4RBPK 2FH8A 4F7EB 1PD6A 1UQSA 4RIRA 3WUWG 2HRLA 4QRRA 5DTFA 1M7DA 1Z2KA 2BVUA 5GHWH 1I9JH 1EVUA 4YIQA 4HUWA 1YNTA 3MNWB 5D7KE 1CLYL 2ESVA 3TIDA 5B3NA 5MEND 1A3RL 5F93C 4Y2DA 1CDUA 4JPWH 4FXGB 4IBLT 5K9QI 2AW2A 2NXYC 2MPAH 3O2WL 2ZG3A 2HFTA 3KS0J 5GS2H 2UUDK 3U46B 3B9AA 2EYRA 1QRNB 1T0NA 3U7WL 3KAAA 3VGAB 3NH7H 3QCUL 5HDQH 1I1AA 1U91A 2DQTH 2FWOB 3VWJC 1KN2L 2DQDH 3OGCB 4V2CB 4JHAL 4KDTA 4ZSOB 1GOHA 3FO0L 4Z9KB 2V5YA 3Q5YA 1IAMA 2WIMA 4YGVA 4RGNE 4YDJA 5I1JL 4R26H 4NC1C 3S4SA 2FIKB 3BPLC 3VFWA 4DGVL 4ONGH 4AM0B 5SX4I 3E6FA 2IFFH 1QEWB 2ADGA 3W11D 5HYQB 1FNGA 3WIHH 3PQYD 3MV7D 1MEXH 4CVZB 2O5ZH 4HFUL 1NLBH 4MAUL 1IE5A 3DRTB 2GSIB 3LRSA 4FQJL 1R5IB 2XTJD 2DM4A 2A73A 3DIFA 1OM3H 1CD0A 4DQOH 1IEHA 3VXQA 3AS3A 2B1HL 2ARWA 2JIXD 2LTQC 3REVB 1U8OA 1P6AB 2R2EA 4H88H 2BNQE 1FE8H 3RL2A 5FAAA 5CP3H 4HV8A 5HYJA 5HXMA 2Q3ZA 3T1FB 2G5RA 5GISH 2Q8AL 2XZQH 3CDGA 4OJFH 4L9DA 4PBWD 4HXBL 2VIRA 4MGXA 5LQBL 3QI9A 1D6EA 4QXTA 1YPZE 2ERJC 5EOTA 1DBKH 4HJGB 1R3IH 3T2PA 2ZG2A 1MREH 4LVNC 1U8LB 3E8UH 3QUXD 2F19H 2F54B 4XP6L 3BIAX 1QSEE 2V7HB 3HPJB 1IGYA 2OP4L 4LSSL 1S78D 4XI5C 3LKNA 1K6QL 4XPAL 3WFCL 5J12C 4PRHD 2NY5L 4KUZH 1YQ2A 1OTUD 2YK1L 4QOKE 3PHOA 1KPVA 4X4YA 5GS1A 1EAPA 4KZEL 3K2UH 3BH8B 3QQNA 4UTBL 5AEAA 4LRNH 2FBJL 4P5TD 3O6FD 2UZXB 4NZTH 5CS7A 5BVJB 2JIXA 4ZO6A 1CD8A 3WFEL 3T08A 4OQTA 5T1KB 2N56A 5C6PB 3I6LE 3D0VA 1PKQE 4OM1L 2EEBA 5SWSD 1HH6A 5LWYL 4U6HA 4FFWD 1KT2A 1BD2E 1JZ7A 1AXTL 1S7RB 1X9QA 2P45B 3FO9B 3UBXB 3VXPA 3BEVB 1IBGL 3ZTJH 1G84A 2H1PL 3GGWA 5HDLA 4CU6A 3QUXA 4EXPX 3CFKB 1U8KB 1L7IH 5CGMA 3VI4E 1ZLUK 4L8CB 5FYKH 3Q1SH 1QACA 3MV7B 3PQYB 4JVPA 3FN0L 4WHYH 1KBGH 1T2QL 1KELH 3P73B 4BJLA 2XTJB 1X4YA 3L5HA 4PRHA 1S5HB 5FXCH 1YY8B 4UTAH 3L95A 4ERSH 3AFLA 5I30L 3SKMB 3GJEA 4RQQB 4M61A 4ORGA 1LD9A 1D9KD 4JR9L 3P30L 2XA8L 2QLVB 4LIQE 4Y88A 3KPNA 1JV5B 3P4LA 2X10A 3L7EB 4LFHG 3U0WL 3MRNA 1LWRA 5K9KB 1GVIA 4M7ZB 4XHJD 5HY9A 1G7HA 1IM3B 2AP2A 3EKCA 1CXKA 2R69H 3EYQD 2A6DA 5D7LB 1NCDH 4MWFB 1NJ9A 2CRZA 4OZIB 2NY0C 1IL1A 1HXYB 4XP4H 2Z92A 3RWHB 3OAZH 2E7BA 3ARGD 3KPTA 4JJ5B 1EHLL 2V9TA 1U8IB 3RWGA 2HKFL 3X12A 2FLRT 5JMRA 5L2KD 4P99A 2BSRA 2E6QA 4MQXD 5EC2A 4EVNB 2HTLC 1WICA 2W07A 3QEUA 4PG2A 4U1LB 1I75A 1NBYB 1F3DJ 2VXTH 4PJBA 5HHQB 4P5TB 3O6FB 2EEAA 2HT3C 1T0MB 1GPOL 1RV6X 4JFDA 4KXZH 1EBPA 2C1OA 5SWSB 4LP5A 2Q6WA 5D1XA 4BUHA 1XGYL 4ZMAT 2GSGB 4NM8L 2VLRA 3LEYH 4RGMB 5CEZH 2WQ8A 3F65A 2B8OT 4QRQA 3QO0B 4RMUA 2Z31D 2HFFB 4YHPA 3CGTA 3WFDL 4EQ3A 4RNRA 2O5YL 1JZ6A 4NQCB 4WU7A 5I19H 5I1DB 4EOWL 3ZL4L 2FECI 1HEZA 1XR8B 4U2ZA 3L3GA 5JNYA 3MRFA 1FL3A 4OB5L 5F7YC 2L4OA 3MV11 1FYTA 3UYRH 1CFTB 1RZIB 4Z7WE 5FO9A 3PDDA 4FQPA 1CDGA 3RQ3A 2R0LH 1K2DA 5I1CL 5L2KA 4DKFL 1BM3H 5FFLA 3SKNA 3ZTNL 4GKNA 3UTOA 5C0CD 1RIVH 3G9VA 1WISA 1D9KB 2ZSVA 4CU8A 3UTTE 3EUUA 5JOPD 5B39B 3QIWA 4E5XA 1CFSA 1OL0A 4YPJA 3T0DA 3QEQB 5D71L 5F8RC 4ETYA 1HCFX 2YZ1A 3PV6A 5CP7A 1FZMA 1X7QA 4OFPA 5C07E 5I18L 4C56B 3OKEB 3LKSA 5I9QC 5AUMB 4YNYB 3NZ8B 2XZCL 4QXGH 1YNLH 5DJ6A 2X9YA 2H6PB 3ARGB 1A6VL 1ZANL 3BJLA 1GAFL 2BJML 2DD8H 1J5OH 3ECBA 4XP1H 4NN5C 2R0ZH 4X6DE 2HRPH 1A22B 1OD7A 1QBAA 5FDWB 2DM2A 5AAMA 2R29L 1QKZH 1QVOA 4R8WL 3BPLB 4FXLA 3MR9B 4GRLC 3TYGL 4P2OD 3ZYJA 4U0QB 4JZJC 4KK8C 1HQ4B 1KIPA 2LFGA 3O9WA 5DT1L 1CT8A 1NFDE 4K7PX 5DJZB 1LEKA 3QISA 1KCSL 5DF0A 4Z18A 1ZS8A 3IKCA 3RWCB 4X7SL 5DK0A 5C09A 3DMMD 5EZJA 3QFDA 3SEPA 1FFNB 1MWAL 4XVUC 3JUZA 3S5LG 4UILL 4PJFB 2O5XL 2Z31B 4Z5RB 1UZ8A 4APQD 1KLUA 4NQXB 5D9SB 1WT5C 5KANI 1CE6A 1T1WB 3C87A 4PJBF 1INEL 1S9VB 4KJYB 2VDNL 2ERJB 5A2IH 1FFQA 2KDGA 4P0DA 4MJIE 5DHVA 5F1KC 5D5MF 3FB5A 5GGTA 2I5YH 2VMFA 3TO4C 2C9AA 2AKRB 2K7PA 2YD3A 4U7KA 3WJJA 5C0CB 1G7JB 3VFSA 1GYAA 5IHBA 2YBRB 4PJIA 2G2RB 5J12B 2FB4H 1NMAL 4U05A 1T83C 4HS3A 2X89D 3GUTB 5FGCB 1A2YA 3MLPA 4ZQKA 4JPKH 2B4CC 2AGJL 4JY4B 1GH7A 2QEJA 3HFML 5DJYA 3IDIA 4NWUH 5F1NB 4A6YA 4M6AA 1MRCL 1K4CA 2X4TA 3DX8B 3UJIL 4S0SD 4TNVK 3H9YA 1UC6A 4NQCE 4Y4KD 3VH8B 2EKJA 4FQ1H 1OLZA 1A47A 3AM8A 1RJZA 5LGHL 1X6LA 5JXAH 1RIUH 4QRTA 3SCMD 5A3IC 1RVFL 4JG1L 4R4NC 3SO3B 4U6YA 3GEWB 1Q9LA 4KHXL 1QFOA 5F9JA 1AO7A 1I9RH 3ZKMD 4JQVC 4P2OB 2DMCA 3BVNA 3ZKXC 3UPCA 2VRAA 4HIJB 4HSQA 3KPMA 1OTSD 1EJ6A 4YEEA 2AJSL 3DXAD 4JDTL 4L8SC 3QPXH 3MUJA 2WW8A 4CVUA 3N9GH 3QUYB 4IRSA 2X89A 1EGJA 3E0GA 3DMMB 3EO9H 4JFHE 2VQUA 3C6SB 3ZO0A 1IARB 5IEKA 3P9LA 4G42A 1AE6L 1MLCA 1NFIA 3S37L 1CD1B 4APQB 1AXSA 5EORH 2PW1B 3BWAA 1NGYB 1WZKA 3MNVA 4XBEL 5ANMB 5HI3C 4QY8B 5D1ZC 3RL1A 4PUBL 5DSCB 3MFFB 2Y06L 1NDMB 2YXFA 1A7PH 3BRDA 5JIIA 4GRWF 5D8JH 1PX3A 3SCMA 3T09A 3UPRA 3ES6A 4GAJH 1VENA 1U92A 4K8RD 3UTZA 4NC1E 4Q6IC 1H3UA 2MHAA 4WI7A 3L7FA 2IG2H 4Y5XC 2EO1A 5EU4B 4R7NB 3EYFB 4KK9C 3AY4A 1AI1H 5IIEA 1BAFL 2XA3A 7FABL 5ALBH 1R3LA 3SDAB 3GSVB 3MRDA 2NTFB 5JIKA 3RZCC 4S2SA 4IMLA 1A1NA 5K93A 5D6DA 2M8XA 3H42L 4JN2A 4LLVA 3VXRA 1I8IB 1Q72H 3NIGE 2UZIL 4M1DL 4XNYH 4AQOA 1S9WB 4I9WD 1G6RA 4KH2A 2BOBB 1M4KA 3KPQA 5IR1A 2XPGA 3I02B 3VA6A 1Z5LA 4AZ8A 1NCUA 1OOAA 1ZT1B 5EH1A 4D8PA 2FX7L 2NY1C 2P42B 4IS6B 1LK3L 2FGWH 1MCJA 5J56B 2ZUQC 3INUL 4ONHA 1S7XB 1MRDH 4P23C 1DLHB 1E6OH 4Y4KB 3I6GA 2E5EA 4PJIF 3QEGH 2OI9B 3TH4T 5FYJU 1WFUA 2LVEA 2FEDD 1TZIB 2XFXB 4ODWA 4WY7H 3Q48A 1T22A 2X1WL 3ESUF 4GMTL 3LCYA 4JFZH 4Z7UB 3UO1H 3F7QA 4M48H 1LP9A 1AP2B 4HCRA 2BNRD 3GSNL 5JW4M 4V1DA 1RHHA 5KSAC 1XR9A 3O2VL 3UTQB 4JGUA 5SV3A 3EO0B 1GC1C 2QJDA 3IDXH 3V4PH 3DVGB 5D2LA 4U1NB 5DFVC 1T5XA 3MRGB 4QRUA 1P7HL 3DROB 3DXAB 4OLUL 4X5XB 3HG1D 1FRGH 1H8NA 4WFHD 2J6EL 1P1ZB 1DBBL 4C83A 3IAGC 2FECL 5JIPA 5FGBA 4EUPB 1T6VN 3MRCB 3C6LA 4IMKA 4WU5B 3QQ4A 1SYVB 1OAYH 1NANI 4GRWH 1DEEA 4YO0A 1IKNC 2HFGH 5J9PB 3CVIL 3BKJH 3CSYB 5IBTL 3FFDB 1ZK9A 3SDCD 1EZVX 3V6ZA 1DTUA 5I9QB 4YHOL 3X17A 4MNHA 4IDJH 4M9PA 2I25N 1A9BA 2VDLH 2J2ZA 3IRZA 1ZVYA 5FA4A 4MLIA 1I7TB 3OG6B 4HXAL 1HCVA 1GZPB 4P5MB 4XP5H 1AGBB 2EE2A 3A6BH 5LAXA 1MCOL 3BWUC 4NO5A 3BIBX 4JZJB 4JANA 1EV2E 5IBUB 3PABA 3T65B 3OV6A 1LO0H 5GZOD 3QDGD 1BIIA 4GW4A 3RWEA 3QQ3B 2V2WB 4MXVF 2A83A 3N1GC 2H32A 1A7OH 4S0TD 3PWVB 4BSVA 1KV3A 1JWUA 1X5AA 3LH2L 5TDNA 4CADA 4X7FC 4A6YH 2Q86B 5F7LB 4OF0A 2VXSL 5IMKA 2WAHA 5BJTB 4JREB 3IJHA 2G9HA 3BEWB 4KMTH 4IRJC 4PJXE 5AZ2H 4GAYA 3ARUA 4N0YL 2ILLA 2P24B 5IMLA 5DFWH 1X5XA 1RD6A 2HJLB 2R1WA 3OAZK 1JMXA 1YQVH 1G7IA 3PWLA 2RAMA 5KSBB 4OBRA 3HG1B 4XNZC 4NP4L 3RFZC 5F7UA 4BZYA 1J0ZA 3TO4B 1X5KA 3CU7A 2WSKA 3AVEA 1MFEH 1CVSC 3DYMA 4XNXL 1ZVSA 1IAOB 2IANE 4XNQB 4JO4L 4R4FH 2DLFH 4XVTL 2DIJA 5CSZA 4IHOA 1N6QL 1XCTA 2EKSA 1LP9F 3QDGA 1AXIB 2DTSA 1KYOJ 1D5XA 4QWWD 5HYSA 3ARFA 4F7MA 1U3HA 2LAAA 3HA0A 2H2SC 1KCUL 4OZHA 3SDCB 4AG4L 5JPMA 4OUUA 4GXUM 3FB7B 5IF0B 1F11A 1B3JA 1YYLL 3LKQB 3IETB 1F6AA 4GKSA 3IFLH 4LVHB 3RKDC 3RNKB 1F42A 3UDWA 1L0XA 4Z7UE 3TT3L 5IFAH 2EYTB 4LEXH 2JJTA 1I9IL 1JPGA 3N1QC 4LHUA 1NGWA 1JRHL 4HF5L 4Z7NF 3L3JB 5ICZB 4U3HA 1FGVH 1U3JA 2J88H 3VG9C 2V17L 2GJZA 1LE9B 1F4WL 1LDPH 3O2DH 2ORBH 3LDBC 1W0WB 1IEAA 5CD3A 1S8DB 2YKLH 1T1XB 4L8SB 4UDUB 4NSKA 4K3EH 4XB7A 3TH2T 3SE3A 4L8BB 4X4XB 3U0PB 4FG6C 1S7SB 4QNPE 4NZRL 1GJIA 2YPKB 3IFPB 1DQLH 1JGLL 1YMHB 3H9ZA 3GRWA 3UYPA 1CDYA 3FQTA 4XCNB 4AH2A 1QFWI 4PJDB 3O4OC 2OTPA 2UVEA 4K7PH 3NCJL 3NTCH 1BVZA 1FLRL 5D1ZB 4F9LA 4PD4J 3LIZH 4HUKB 3U36B 4U0RC 3RAJL 4PREB 4FZ8H 3OHXB 12E8H 3HC0B 5FO7A 2AK4E 1LO4L 3F5WA 4Q6IB 3RVWC 3OAUL 2EDBA 1H9VA 4Y5XB 4AY0A 2IFGA 2NTSP 3TM6A 3UZVB 2IMMA 2FO4A 4PJEF 4NKIL 5EO0B 4WFFE 1A4KA 3RZCB 2DI7A 2FL5A 4MVBC 4OGZA 3D2UD 4EI6A 1G9MH 4OQTL 4I1NB 4CN6A 3DTXB 3MLUL 1BGXH 1U8JB 3FB6B 3DUUB 4I18A 3QCTH 5HHOA 1ZHKB 1FLTX 3ARWA 2ZUQB 4BZ1L 3MRJA 3FONB 5TH2B 2FO1A 3F6IA 1X44A 4WRLA 5E8OB 4RDQG 1HQRA 1RUMH 4HPYL 2UYLA 1TZGL 5B22A 5DHXB 4PP1C 1ZLWH 4JFQB 4WFED 4KMQA 4YHKL 1DE4A 1DBMH 4D9LH 3RJDA 3AB0B 1U41A 1WBZA 2NZ9D 4PJ5B 2QSCH 4OZHF 5CBAB 5E6ID 1P2CB 1YEFH 3X3FL 2XY2A 3BZFB 3KWWB 4CUCA 3TFKC 2FX9H 5DK2B 3OZ9H 3QZWA 5JHLL 5JW4R 3S88H 3LPGA 1IFHL 5DD1L 1UH3A 3NVQA 3LOWA 4HC1L 4BH8B 2VDRL 4XCEB 1AC6A 4DOHB 4X6BA 2OR7A 3ROLB 3ARQA 3KYMB 5I1LB 1W8OA 4LCWB 5KSUA 1RSFA 1R3HA 2DQFA 3VFVB 2CR6A 1JYVA 4CN4A 1LVEA 4GFTB 1KFAL 3BT2L 3M45A 1NUGA 2BSTA 3OPZL 4TULL 3ULVF 2EDXA 4NQVB 2ZOLB 2B2XL 2A9NH 4Y2DC 2W9LA 3FO2B 4X4ME 1B90A 1P9MC 4BZ2L 5FO8A 1BP3B 3QAZC 2LABA 2XACC 1FZOB 3V7MA 2NYYC 4QHUA 2IALA 2X4NA 4MJ2A 4PS4H 4ODHH 2VL5B 3G6DH 4JRXD 1IC5L 1MCNA 4XC1L 3OL2A 4JO2L 2XN9A 2APVA 3X3GL 1BFVH 1NAMA 3RIAF 1TDQA 3D2UB 5TDOA 4IIQB 4KDTC 1NGQL 3FOMB 4LLYB 4P9HL 1KB5L 3LQAL 3MRPB 3H0TB 4O02L 4ODUB 4U1SB 3BO8B 5E99H 5F7EL 2WINA 5E0QA 1D5MB 1XIWA 5F6IC 5I8EA 4HGWB 1OGAE 5DD5L 1NQBA 3LHPH 4XPGH 4Z7VE 2QQLL 1RU9H 4QHMB 4ZUSB 4PJ8A 1UJ3C 3PWUB 1QBML 3J8F7 4XMPL 4IRJB 4LLUA 1FVCA 2BRRL 1NUDA 3IDJB 1R3KB 3KLDA 4FQIL 4DVBB 3B3IA 5FUOL 2W9EH 2F58L 1Q9OB 4ELKA 5I1EH 1J87A 2Q8BL 5KS9E 3UTPE 3VFNA 2CLVB 4Y1AD 2Y72A 2G75B 3MJ8B 3SKOB 1FFPB 3BKMH 1Q0XL 3GBNH 3MLRH 4JRXA 4J3WA 4MQTB 5T5NG 1WGOA 4HLJA 4QRSA 3QI9C 4U1JA 1EEUA 3HUJB 1JPST 4U7SA 3ULVH 4IOSD 1PKOA 4MZ2A 4YHLH 4MAYD 5KJRL 4G80A 3ILQC 2NCMA 1ADQA 2EH7H 1OAQL 1PGRB 1LO5A 3TBSB 2F8VA 4HZLB 1A0QH 4Z6AT 2HP4A 3N0PB 1T4KA 2Z91B 1AD0A 1BIHA 3GI8H 4HUXA 1XZ0B 3SPVB 5DD0H 1DLFL 3GRWH 4OLXH 1OAZL 5GS1C 4N8PA 5E08L 2UY6A 4I2XA 2YUZA 2FHBA 2BVPA 4LASL 4PJ5E 4XCYA 3TVMA 3W5NA 2CR3A 1UEYA 4M03A 3JVGA 1FYHB 1FAKT 1BFSA 1PG7L 5DZLA 4H8WH 3RA7H 1YY9D 1DQDL 5TFSL 2A0LC 2DQHH 3ZLQC 5I75C 2WBJA 2VE6B 15C8L 1H0DB 4DOHE 1KC5H 3ARDD 3D9AL 4ZS6C 3CH1A 4LCWE 3AAZB 3PWNB 2ZUSA 5E4IA 5E8PB 1U8MA 4MAYA 2C4FU 1DEDA 1IC7L 3QUXC 1G6VK 4N9GB 4U1IB 4X99B 4M3KB 4FNLL 4M1CC 3HC4H 4LKXB 1ONQA 4QRPA 4O51A 1BLNB 2OL3A 4MJ6B 4K23H 4UQ3B 1NGZB 1PYWB 5B21A 1G9NH 4E41D 3T0EA 4P48A 3KPPB 2B7DT 2J8UA 2NR6D 2VNCA 4ZUVB 3RJQB 4GS7B 4U0RB 1ETZB 5FYJD 4U31A 4D0CB 1IILE 3O11A 5J7CC 2JELH 4HS8H 2GK2A 5GGTL 1QFWL 4ZTOL 3TWCH 3WD5L 3V52H 3WL9A 2XZAH 1OQXA 2HFEB 1E6JH 4F3FA 4TUJA 3KXFD 3A6OA 4LKCB 4RRPA 4UB0H 3I2CH 1DBAL 1I1FA 1JZ2A 3MGOB 4XH2A 5DEGB 1U2CA 1YMMA 2WMPA 4I4WB 5ADPL 3TO2A 3CZJA 1RK1A 2H3NB 3QIUD 3ZYOA 4RWYH 3C9NA 3LS5L 3AREB 5HSFA 1RJLA 5MERB 5GRZA 4UNTA 4HIIB 3LQZB 2AI0H 2NLJA 4G43A 4NZUL 4PG2C 1ND0B 3MREB 4P4KA 5DVOA 2WK2A 3QA3B 5E5MB 1UB6B 2F53A 1G7QA 1IC4H 3QG6A 4GUPA 1S7UB 3BMVA 3R4DA 4NQSA 3EOTL 1YNKH 5C08B 4QCIB 2NW2B 1BREA 5D1XC 1T21A 4J12A 5IJVA 2DJ4A 3VXSD 4ZS7H 4H1LG 4XVSH 2DLTA 2VDML 2W65A 3HUJE 3ARDB 3KPRE 1EGJL 3P4OB 5C0BE 5CBEA 2NNAB 2AQ2A 4GSDL 5CJQL 4ZFOL 2GCYA 2GHWB 1OY3B 4Y16D 5LJYH 6FABL 1MCPL 1JYNA 1AGEA 1N64L 4HX1B 5GGVY 4XC3H 1SBBA 5T3ZE 4ODVH 3DGGB 4RIRB 4OGXL 3O4LE 1M7DB 5E2WH 5L2JB 4JB9H 5SWQB 1JGDA 1KUMA 4YIQB 4E41B 4LLQA 2E7CA 4MQXC 1RMFH 4JFOA 2XWBA 4M8QB 3EOAA 4GH7B 4F33B 5MI0C 3GI9H 5L7XL 3G5XB 4G6JL 4B5EA 5GGSB 2ESVB 3VU2A 5MEOB 4Y4FA 3D85A 2HTKD 3EGSA 1I4FB 4OFVA 1WV7T 3LD8B 5D2NB 1SJEA 3OKMA 4P4RB 3QIWC 3RKPA 4ZNCD 5DMKB 3X13B 32C2B 3HR5A 3QAZB 1KN4L 3KXFB 2A74A 4NM4H 5ACLA 3S3JA 3WCYA 5DO2D 1OARL 1YEIH 5EN2B 3PGCB 3G08A 1FZJA 1ZHLB 3VXSA 5KTEL 4JM4H 2IH3A 4OGAD 5IWLA 2X7LB 4K71C 4X6EB 1HHHB 2YUXA 3MYJB 1XF4A 2J8UF 4D94A 3MBXH 4OIAA 2R4RH 1U91B 1XF5A 3QIUB 2A77L 4IDLA 5J8OA 5DMJB 4P9ML 2NY2D 4PTUA 2NY3D 1UYWL 2R1XB 1OCWL 4Y16A 5EB9A 3WFBL 4X80H 4NUJA 3TPUA 2BCKB 4LSVH 3PL6C 4F2MB 1I8MB 2MKLC 4G6MH 4YX2L 5HHXH 4LK4A 3O6KH 3UC0L 2BMKB 2IC2A 4S10A 2FATH 3O9WC 1JMZA 1XMWA 2Q87A 5L6YH 4I0PD 5C0GA 4N9OB 1UJ3B 4JFFD 4W6WB 4K8RL 2CK0L 4LLWB 4B41A 4PRPA 3VXQB 3VG0L 1WZ1L 5B8CB 4ZNEE 3ROOA 4MD5A 1IEBA 1P84J 2XY1A 2KQNA 1PLGH 1JI2A 1A8JH 4PGJA 3IAQA 3RTQD 2P7TB 1E4WL 2IQAA 1Q38A 4GW1B 5GJSL 1RZ7L 1JGVH 3ULUD 1Q9WA 2GTWB 4KI5F 1OAKL 3NAAH 1WBXA 2R1YA 3L3KB 4J3VA 3LB6D 3DX7A 5JQHC 5FYKE 4DAGL 1FZKA 3RBSA 4NNYA 4JAMA 4PD4K 4Q0XL 5C70A 1OTTD 3ZDXF 1PQZB 4N0FB 2KH2B 3EAKA 2QQKH 2WIIB 3HZYA 3LKNB 2R9HD 3WJJC 3QDJD 4Z78B 3Q6GL 4M5YL 1FFOB 5JO5A 1RQ5A 5I17B 1BJ1J 5C0DA 2OL3H 4OLYH 1KPVB 1N2RA 1RULL 3KJ6H 3DX9A 3T0XA 1EAPB 5C08E 4BFGA 4M7KH 1SEBB 4M3JA 3BDYL 3PXJA 1BQSA 4RMQA 4PV8B 1FH5L 1K8DB 5DC0A 5L0QC 1T66D 3O6MH 1M7XA 3S3PA 3D0VB 5CZXD 4M6OH 2YN3A 1SY6A 2CUMA 4U2YA 3Q5OA 4FTVB 2BY2A 3RHWF 1KT2B 4ONFH 1HILB 3AM8C 3TIEA 5D93C 2R8SL 4URTB 2NY2B 2OK0L 4XGZA 5EZLB 2AJZA 3E1F1 5IB1B 1CBVL 5EU3B 4HFWB 4AEEA 1ULVA 4QRRE 3WNPA 4YDIL 1EPFA 5ERWA 5HPMB 1C5CL 3V5DB 2B4CL 4KVCH 1TETL 5HYFA 5EU6A 2ESVE 2FR4A 1J8KA 3IJSA 4I0PB 1MJ7H 1H5BB 5GRJH 1JZ8A 1UT9A 2EH8L 4CAGA 4IRSC 1CLZH 4XPFH 5DR5L 5IB3B 3U79A 3M8OH 4LCIL 2CDGA 3GJEB 5JIHA 3NABH 2CUIA 4R90L 1ZA6B 5CEZE 1EO8H 3ZDZF 4PJ7A 3RTQB 3TV3L 5HTSA 3I84A 1LHZA 4GMSH 4DCQA 4FXKA 4EBQH 2YN5A 3G04B 3KYKH 4YHYB 1ZGLB 5ACZA 1G7HB 4RAHA 3WHXB 3MLXH 1R24B 2C3XA 3JWDH 1AFVL 2C3VA 2EIEA 2Y6SC 3MROA 2AJ3A 4GQ9L 2Y5TA 4C59B 5CWSB 3W39A 1ROWA 2YA1A 4LARL 4X98B 5I1KL 3MGAA 4KTYA 4JHWL 4NHCH 5TF1H 5C0RL 4H26A 4M62H 3IAPA 2QHRH 2YD5A 3NN8B 5MP6H 1QYGL 2AV7A 4ISVA 1KULA 5ALCH 3QDJB 4OKVB 3WLBA 3AY4C 4S1DC 3QUZB 5JMOC 2APWA 4G3YL 1MFDL 4NBYB 2NY6C 1IM9B 1JPTH 2ADFL 5I8CA 4O00A 5D6DC 5JLZA 2OTWA 3MRRA 2Z9TA 2XT1B 4HQQL 4TOYL 1NAKL 5ESQA 1B0GB 1A1MA 1SM3H 1FGNL 2HVJA 3HC3L 4IOFC 3HRZA 4JKLA 1F97A 3EYVA 1Z6JT 1DQML 3MRBA 5KW9H 2GIYA 5A2JH 3MACL 5HYJE 2Q6WB 2OQJB 1KNOA 1TJHH 4XZUB 4LF3A 5D5MB 1XGUA 3CH8A 4HWZB 5KVGL 1NMBL 2IPKB 3IFNL 4TUOA 4ODSL 2P8LB 1C1EH 1F2QA 5I76B 3QJFB 3FT3B 2UV3A 1PBYA 3I85A 4RMTA 4AIZB 4O4YH 4MQ7B 4MS8D 5EC1B 35C8L 5FB8A 2WBKA 3G5ZA 3W0WD 2GT9B 3H8NA 5DRXA 4Q7DA 1FYTB 3UJJH 3BW9A 3QDMB 2FYYA 1EMTL 1NCAH 1CG9B 4J7RA 5DJAA 5EOCJ 5KANG 3T77A 1V3KA 5MI0B 5FGBC 4N5ED 4WV1B 4CMHC 4PR5A 1G9MC 3C6LC 2ZSVB 2I27N 4IMKC 4X6FA 2BXYA 3JV5A 3VXNB 4E5XB 4CJ0A 4KAQL 5IQ7L 3OKYA 1QOKA 4JFED 4GXVL 4RZCB 5DD6A 1RUPL 3RIAK 2DTML 2X4OB 4DJMA 1FV1B 5CCKH 4UZGA 1NC4D 5GS0D 5IGXL 3LKSB 1ZT7B 3FQXB 3BKCH 3QPQD 4L4VB 2FEDC 4LOUD 2XQBH 3RVUD 4EN3D 5INDA 1T20B 5IV2B 1MCKA 2ZJSL 2BVOB 3KHOA 4PJ7F 5A43C 4KKCD 2XICA 2XNAA 1CU4H 4OCNC 1C12A 3T0BA 1QVOB 1M6OA 3PL6B 1WJ3A 4RX4A 1WAAA 3RY4A 3ZDYF 1N5AB 3VA2C 5C0JB 4P2RD 4HLZG 1WTGT 3IJYA 2IBZY 2A2QT 4LGRB 4WENB 2ATPA 2C5DC 5EBMB 5JR1H 4GRWB 2IBBA 2B0SH 3WNMA 1JGUH 2VITA 5IM7B 1TENA 4LFHD 1I3UA 3RUGA 4JFEA 2X4UA 3NBNA 1P4BL 5DD3H 1MCQA 1BF2A 1D5ZA 1MCIA 3JV6B 1S7QA 1WLHA 1T89A 5DZNA 2AEWA 2OJZL 5JOFA 5EFIA 5HJ3B 3NCYS 1NL0H 3UBXG 4EN3A 5C8JB 3W0WB 2AXGA 1W2KT 3HRPA 3LMJH 1MHHB 1CDJA 4YFLI 3GKZA 2I9LA 3GJFA 1I9JL 4RFOH 2VUYA 2XWTB 4PJCA 4OCYL 5BRZD 4JFXA 2NY4D 2CXKA 4PJBE 5DQ9B 3K8MA 1K4DB 3BUYA 4W70A 5T1DH 4KQ3L 2V5MA 4JFDE 4WO4A 2MPAL 3TGXA 4PJAA 2DKMA 1IGML 1XF3B 3ARFC 1T7ZA 1U3HC 5D5ME 3B8SA 2YD6A 4GG6A 2EDNA 3GO1L 3O3BA 2VLRE 3C60D 5L0QB 4KTDL 5FKPB 4A6YB 3T0WA 2ZOKA 3D39D 3ABZA 2PKDA 4QHNB 3NH7L 3B5GA 2ITCB 2F74A 2RQ8A 5T3XH 2DQDL 3MO1A 3BZ4A 5D7IB 2Z0BA 2JJTC 2X4RB 3KNBA 1ITBB 4X9HA 5C0AD 1FYTE 4U6YB 1IAKB 4J1UB 4P3DA 5DQDL 3AROA 2W0FA 1DN2A 2GJ6D 3VD4A 4P2RB 3MRKA 2DLIA 3F7YB 3QFJA 1FNSH 1WQVT 3TA3B 4HIEA 4YBQC 4JRYD 5E94A 2O5ZL 1NLBL 1NCWL 2DL2A 5TDPA 3B9KD 2M26A 5C2UB 1BBDH 5J6GB 2O93L 3MBED 1JHLL 4MHHI 3CFEA 4PRAB 4NNXA 1FE8L 3BKYL 2AABL 1NFIB 1VEOA 5IMOA 1EXUB 3BWAB 5IHUH 3MNVB 3B6SA 2OZ4L 3BGFB 1WAAF 1YJDH 4L4VE 3WNOA 3PGDA 5M95B 4F9LC 3CMOL 3VWKC 3D39A 3OXSB 2QBWA 5AZEL 4U1HA 3S35L 5DVLA 3FQWA 2IPTH 2VTFA 4KWUA 5CGYD 4F80A 2H26B 5H8DA 1R3IL 5CJBA 1MREL 3T3MF 3E8UL 4NO2B 3K46A 1FJ1A 2HYMA 3QXVA 4KJQD 5C0AA 3RUGF 1A6WL 4DGIL 5BRZB 4U6VH 4UI2A 4B0MM 2F5BL 3PXHA 3DUSA 3T4YA 3V9FA 2NY4B 3ARBA 2GJ6A 3FOLA 3QULB 3BD4A 5IIEB 1DJSA 2V2XA 4FP8L 3RPKA 4KUZL 2NY6B 3LN5B 2IGFL 2LU4A 2R23A 2ICEA 4S2SB 1A1NB 1QHOA 3VXRB 3MRHA 5C09E 3B9KA 4TQEH 4LRNL 1G7LA 2A6IB 1Q9KB 3C60B 5IVOA 3RBGA 5BZWA 4TVPD 3MBEA 1MCHA 4X6CA 5IB5B 1RFDH 3P4NA 5B39G 1YEEL 4NIKB 1BZ9A 4D8PB 3RVTD 1G9NC 2BHUA 2EC9U 1FVDA 3DETD 4XWGL 4PJCF 2BHYA 2C1PA 1NC2A 3HNSL 3JUYA 3NFPA 5TE4H 3STLB 3HZVA 2K7QA 1A6AA 3FB8A 3MCKB 2F9BT 3BH9A 1PZUB 3HZMA 3U0TB 1C08B 4LNRA 1AHWB 4P5KB 1EA9C 4HHAA 2AJUH 2PW2B 4PJAF 3MJ9A 1JZ4A 4GG6F 1MAJA 4O2CA 1CTNA 4LMQI 3Q1SL 4HS6B 4G8FA 4XNUH 4JRYB 1H15B 5EBWB 4PJIE 1KSRA 5FIEA 5IB2A 1YEJH 2DLEA 1KELL 1BJ8A 4PRDA 2P8PB 5IK3B 3GMQB 4XMKH 5F9DC 3TBWA 2RCSH 4UTAL 4C83B 4N68A 3RDTB 1BBJB 4ERSL 4F7PA 3ALXA 4NHUB 1BWMA 1TTGA 3DX6B 4L4JA 4XP9L 3MRIB 3C6LB 3BFOA 1T04B 2Q76A 4LVOB 4N1HB 4J4PC 2P1YA 2AV1A 3H7BA 3EFFA 1QLFA 3O3EB 3S5LA 3P4MA 4HMCA 4JDVB 3L6FB 3TJEL 1X6NA 1I7UB 4X7DC 3HI1B 1A7NH 4IJ3B 3V6ZB 4L3EB 2R69L 4O2EA 4PTTB 4FZEL 4D9QD 2V5RA 2YA0A 3GMNA 1F3JB 1NCDL 2ZWLT 3FT2A 1TZHA 4JVUA 1OGTB 2CO6B 1UH2A 4G8IB 5DJCB 3SGKA 4CMMB 4G9DB 3P0GB 5FA4B 2IH1B 1AO7E 3PWJB 1CICD 3BPCA 5GRVL 3FQUB 4F8TA 4MX7B 2CDFB 5DUPH 3EFDH 3CUPB 1NBQA 5AWNL 4JJHA 2HLAA 4L9LA 1MF2L 3GJFH 4LEOA 5JTWA 2JB5L 3FRPG 3RWDA 1WITA 4JANB 5F70A 3RWJB 5FYJL 1UXSA 3W9EA 1H3GA 3IDNA 4KK6D 2YD9A 4DZBB 4ODXA 4Y5VA 2FHFA 3KG5A 5INCA 3CFBB 4XX1E 4NRZB 4X0KA 1MAKA 5K9OA 3I9GH 4F7TB 1XIWC 1KJ2A 3MV9A 1MIEH 4NZJA 4Z76B 3QXTA 3IGAB 4FABL 1QR1A 1VACA 4PJEB 4PJ8C 1KPRB 5IMKB 3CFJA 4OTXH 1Y18B 5I19L 3SOBH 3MRQB 3VH8G 5C9JB 4OLWL 5MHSE 1BVKA 1PG7W 1CICA 1XGTA 2EIZA 4R0LA 5DMIH 2R1WB 3UYRL 4FQHB 1P7QA 2X4QA 4FFVD 3NZHH 4OQ1A 2R0LL 1U8NB 4HUUA 1I7ZB 1BM3L 3VXRE 2ITDB 5DI8A 3ULSB 4F7CB 1RIVL 1R5WA 4NKDA 3CXDH 4PP2B 1F13A 1BVLB 1HINH 5IB4A 3D6GA 4JGMA 3RHWK 1ORSB 1NSNL 4F7MB 5SV4A 1U3HB 3DOSA 1OF2B 2W9DH 4OZHB 4L3CA 1CCZA 5JPMB 4OD2A 2R2BB 1MELA 4ZODA 5FEBA 4ZO7A 2V7NA 4MDIA 1GIGH 1YNLL 2YC1B 1L6ZA 2ID5A 1MVFA 4K3JL 1FSKB 1LP9E 3O8XD 4V1DE 3TVMC 1J5OL 3M07A 1M71A 5F1IB 1INDH 5FM5O 4XP1L 1T03L 2R0ZL 1RPQA 2DI9A 2HRPL 4ZD3H 2IQ9L 3JVGC 3MXVH 4ZPTA 2OXHA 3WN5A 2OMNA 4UINH 4PRIA 5I71C 1WBYA 3GIZL 3AU1A 3JV4A 1DANT 2E7LA 4H5SA 5E56A 3HLAA 1LEIA 4YHNB 1U58A 2VOTA 2WBJC 3PJSA 2CJUL 2HN7A 4LLDB 4NJ9H 3MV8A 1I3RA 5FGSA 4ZUUB 3QIBA 5FA3B 4I9WE 4P2QD 2W38A 3MRMA 2BSSA 4XNMA 2P48B 3G5YB 4MAYC 4QKXB 3VFUA 2H8PB 4Z7NE 1MRFH 4X8XA 4Q9BA 2E9IA 3HAEB 3R1GL 2P8MB 4EIGB 4HWBA 4LCUB 5HGDB 4L3EE 1GGIH 2YSSA 2FZ3B 3FQTB 1OB1A 4QXUL 5AAWA 1NUFA 3CPLA 2VDKH 3HI6L 3OXRB 1Q1JH 2AXFB 3T0EC 1CL7H 2W91A 3VWKB 3K8LA 4JQXC 1HHKB 4KKLD 1LEGA 2OS7A 5ID0B 1A7QH 1G0DA 1KCKA 3L5IA 1G7MB 5HGHB 3O8XA 3BQUC 2AK1H 4CDGC 1EUTA 3UP1A 1QFUH 3V0VB 5GGRY 3F5WB 2B1AL 3MJ9H 4OCRH 4MD4B 4ZTPH 2GY5A 1JHTB 4ELMB 3EZ8A 3RNQA 2FBOJ 1J8HA 1C5DB 3KJ4B 4XCCL 4OZFH 4KK5D 2FO4B 1GXEA 1IVLA 3E6HA 1U8QB 1KTDA 5GSRB 5IT2L 4M7LL 5BQ7A 3V0WH 3SDXA 4HJ0C 5I1HH 2MWCA 2FJGB 1U93B 4P2QA 2D03H 3MLZL 3G5VB 3E3QC 4NQDD 3FFCD 4EUPG 1IT9H 2YS4A 5CHNA 4NWUL 3PIQB 5CKGA 1IZKA 5IESH 4JE4B 4OSUH 5HHOB 3HMXL 3ULUL 4KVNH 2JJSA 5HI5C 4RCAA 4TSAH 4CW1A 3MRJB 1IGCL 3OJDA 4M5ZL 4P4KC 3HPLB 3VCLB 5ETUB 5IW1A 4KI5C 5I1GH 4JM2F 1A6TA 4XXCA 5JXAL 3OB0K 1CFBA 2GITB 5SWZA 4IRZH 4WWKD 3BRFA 3Q3GA 1DE4B 2GY7B 2CKNA 3QQ9C 1WBZB 3B8YA 1I9RL 2IAMD 5ID1A 2DYPD 5ENWA 4NRYB 4L8DA 4GAFB 2DJUA 5KVEL 4M7JL 4OF3A 5LBSH 1NPUA 2V2TB 5I6XC 2IBZX 1LQSR 4BA8A 3SDDB 3QPXL 2X1PA 3N9GL 3QDGE 4WTZG 3VFOA 1FAIH 5IBUG 4OZHE 3WNKA 2BC4B 5JHDD 1I85A 3FFCA 5A2LH 5KSUB 4J8RB 1F3RB 4W6YB 2DQFB 2Z93B 3DWTA 2J1KA 3L3IA 1EAJA 3H9HB 1KJ2H 2VLMD 4Y4FC 3G6AA 1A7PL 5JORA 1CN4A 1MFBL 2VLJD 1GGTA 4GAJL 2AQ1A 3W2DH 4X7CC 1AGFB 5CJXA 1HI6A 3PDOB 5F3HA 5TQ2H 4JLRA 2IG2L 3PWPB 4AMKH 2IALB 4YQXH 2X4NB 2IAMA 1JGEA 4XVJL 3CXHJ 2MFNA 4DGYH 3NACH 3SE9H 4PJ9D 5ICYB 4AL8L 1RK0A 4XNYL 1ACZA 2ICWB 2Y36L 1MUJA 2DQUH 3JWOL 4P46D 4Y16C 5HDOA 4RA3A 5J06A 5JHDA 2WNGA 2F5AH 2Z8RA 1E6OL 2C7UB 4YAQA 1WCQA 4X5LA 1SBSH 3TNNA 2BFVH 4KHTH 1ZTXH 2J5LB 1OT2A 4YWGL 4R7DB 3TP4A 5DS8B 3MNZA 5I8OH 4WY7L 4WWKB 3SDXF 2DLHA 1KIRB 4QYOB 4Q58C 2VLJA 4M48L 2YD1A 1HDMA 5KZCD 3OR6A 1U6AH 4LLUB 1FVCB 4EI5D 2DYPB 2ZSWA 4N0CD 1N26A 4ZAKD 1YDPA 2VJXA 3V4PL 1HSAB 5J11C 3ARRA 3K74B 4UBDC 1DUZA 2HMIC 3VFNB 3MZGB 3QEHA 5C0IA 1W0VA 4GG8A 1YUHB 1F4YH 1P4LB 4NDMA 3ZHDA 3MLVH 3RWFB 2VZUA 3MX0A 3UTSD 3PHQB 4WNQA 2D2OA 2B39A 2HFGL 5HHOE 3GIVA 3O3AA 4XPTL 3BKJL 1WC7A 1L0QA 2VQ1A 1C16B 3LPWA 4MCZA 3IFOB 4PY8I 4KTEH 4HMEA 3GMLA 5MEPA 5LGKA 4HWBH 1KGCD 4OT1H 3D5OF 2E8YA 4MA3B 4W4OA 8FABA 3HMWH 4OCWH 1UA6H 2BVQA 2JK5B 5C6TH 1DDHA 3BP6A 1FL6B 3N85H 4WCYH 1U9KA 5JDJA 4EI5A 2P5WD 5DFTA 5F7NC 3ZKND 4R3SA 3A6BL 1MFCH 1XH3B 5F72S 3QUKA 4G7YL 4PJ9B 4Y19D 3VFGL 1JF6A 3QNZA 1WF5A 5IBLD 4MZ3A 1BHGA 1QBLL 1T7WA 3KPSA 4KRPD 2D4FA 4P46B 1MVUA 2NW3A 1LO0L 3T1WA 1H8OA 3LV3A 4JFPB 1OP5H 2DDQL 1VB9A 2I26N 1VGKA 1FL5A 1RHFA 2PYEB 4LQFL 4LSRL 4Z0BH 3KYOA 4FQXA 1GGBH 5FHBL 2CKBH 1JNLH 2X40A 4ZFGL 2AEIT 2Y7QB 5D70H 2PYFB 3MSPA 3EDFA 2ADJB 5GS0L 1RJYA 4WUUD 1DCLA 3GSOB 2XKUA 3CCHA 4HKZB 5D96C 4WWID 4I3RH 3PE9A 1JNNH 4Q9RH 2QADC 4WFEE 2I60L 5BOZG 3OX8B 4P2CG 3ZZ1A 3PWPE 1AY1H 4OFYA 1CGYA 3BQUB 4NRXA 4ZPVB 3RVXD 2O61A 3DO7B 1IQDB 2P5WA 1Y0LA 4TSBH 1FO0B 2VZOA 2FRGP 1DL7L 2XN9E 4ZFZB 3NFNA 4JO1H 3OF6A 1T5WA 1F2XK 3UMTA 3UTSB 3GJFK 1R0AH 5I1AA 2HH0H 4JG0H 2H2PD 4XH2B 1YMMB 1B4JL 1ZGLP 4BFBD 3C9NB 2AEQL 3EYSL 2EE9A 4O9HH 5D1QC 1MHEB 2UZYB 3RGVA 5F89A 5CSBA 4F15C 3RVVD 4DWHA 4YZFF 4ZUTA 2WBWB 4WUUA 1LO2H 3BUTA 1QLRB 1QQDB 5IFAL 1UWGH 3B2UD 4X7TB 2F53B 3WO4B 3F12A 4CU7A 5BV7H 4LEXL 1KCRH 3IU4L 4GUPB 2FX8L 5EULV 3EOBB 4G6KH 3B2VL 3SE8L 3GM0A 4YR6B 1MHPH 1JWSB 1ORQA 1YJDC 4UQ2A 1BZ7A 4NO3B 4YDLB 2F15A 1T21B 1KG0A 3RU8H 3AXLA 3QG7H 4PGCA 1AGDB 3QHZH 1FGVL 1PAMA 3ZSTA 4S11A 3DSFH 4N5UA 3O2DL 4OI9A 5I6XB 3MCG1 3K4DA 4POZC 4RMRA 1MY7A 4MNQB 4P3WA 3DV4B 3VFRB 1Y6NR 1Q94B 2MCPL 1A3LL 2D7TH 43CAB 3SJVA 4G9FD 2XKNA 3NOIA 3QUMH 5HHPA 2D31B 2PN5A 2EICA 1CTOA 3FQNA 4NFDA 5DRWB 1DQLL 2HG5A 3G9AB 1A6UL 4ZOCA 5J3HD 4WJ5A 1AC0A 2WUBL 1JGDB 4LLQB 4X9FA 1EEYB 1H3PL 2VXVH 4I2XE 2UWEB 2BNUA 5EWIH 2XTLA 4Y4FB 4AENB 1FVEA 1DFBL 3QHTC 4NWTH 3HE7D 1S3KH 4BUGA 5IG7B 1A02N 2E27L 2ATKA 1KACB 2OMBA 3L3DA 4GBXC 2VLLA 1QSVA 1J12A 1KJMB 1OSPH 4S1SH 3C08H 1N8ZA 1V8HA 4RDQF 3LRGA 4I5BB 4RAUB 1AGCB 1VFAA 4LP4A 3ZYZA 5DJ8A 3BXNB 1FPTH 1UVQB 1RZ8B 1XF4B 1W8NA 2PYEE 2VH5L 4UUJB 4BK4A 1LILA 3O45B 2G5BB 5T33L 2ARJA 1NDGA 3TEUA 2NXZC 4G9FA 1HNGA 1N0XH 4QRPE 3I6KA 1R5VA 5IQ9A 4K9EH 4Q6YA 3T0EE 1KENH 2J8UE 3ILPA 3PG2A 4CN1A 2A6JB 3NA9H 4XBPB 2IBGA 1K5NB 1CLYH 1CZ8L 3QDAA 4KRLB 1A3RH 4PRPB 1OSZA 1SYSB 1I1YA 1T80A 3IDGA 3FCTB 3ROOB 3MYZA 2QSCL 4YXLL 2C4XA 4P2YA 5DMGD 1YEFL 4NC2B 3O2WH 5EUKA 3DRQA 2GUOA 2FX9L 1T1ZB 4BQCA 3I3EA 2P5ED 5IVXA 1T89C 3ARTA 1YMME 1WBXB 2YPLA 3VGEA 5GIRB 2CRIA 3KLAB 5KVDL 3E3QE 4XAWL 3VXUD 3QCUH 4CKVX 4EN3C 3MJ7B 3WXWL 3G6JA 4TVPL 1KN2H 4OI8A 3R0MA 4JHAH 3UAJD 4KY1L 4F57H 3SN6N 2VISB 2XWJB 5I1JH 1E4XI 4KI5E 1HOCA 4DGVH 2F53E 2DWDB 3LEVL 4RSVA 3HE7B 3MJGX 3MGTA 3TF7C 4WO4C 3S37X 4MAUH 4FA8A 4FQJH 4JDZA 5DGQA 2GAZA 4XPHH 2PXYD 1IQWL 2DIAA 4KJWD 4YHIB 5EO1A 5LCVL 2B1HH 3TYFB 1CGXA 1ZHBA 1CGTA 3GSRA 4ODHL 1ZT4A 4XXDA 4MNQE 3VD9A 5D72H 3WHE1 2Q8AH 1ZEAL 3IXTA 2AJZB 5FOJA 3BISA 4HXBH 3ZTJG 4U1KB 1UWEL 3VXUA 3BP5A 3SKJL 3VXTA 3SGDI 1KEML 4PJHB 2GK0A 2V9RA 4QEGA 4WHYG 1QO3A 3D3VD 4LSSH 1U3YA 5C0EA 3VXMD 5JW5B 3LHPL 1ED3A 1K6QH 4XPAH 5D96B 4UIKL 3WFCH 1VKXA 1RU9L 1MCEA 3ZE2F 1V3MA 4FQCH 4UDTA 2PR4H 1N6UA 4PG9B 2YK1H 2QADB 3OAYK 3THML 2VLKD 2CDGB 4I77H 3ME0A 5KG9A 4MSWA 4XWOC 4KJPD 1AR1D 2DQEL 1XF1A 1YN6A 5C0ND 4U4BA 5IMMA 4L1HA 1E4JA 3VXSE 3EZJB 3RRQA 4H1LA 5HHMD 1MI5A 1A4JA 4HEME 3BKML 3VJ6A 1PVHA 3WUZA 4OM1H 5A2FA 3V7AG 2Y5TB 3ULVL 1PY9A 1K8IA 3H3PH 3ZDZE 5DYOB 5DRZB 5JPNB 1AQDB 1IBGH 1QTYT 1XGRB 4N8VB 2H1PH 5FCSH 4MCYA 5D1QB 1DQQB 3ARBC 1AD9A 1MQ8A 1A14H 1E4KA 3VGHA 3GI8L 2QHLA 4IOIB 4YLQT 4NQTA 3D3VA 1RZJC 4HT1L 4WI2A 3VXMA 1UXWB 3FN0H 4NO0D 3N06B 1T2QH 4PRPE 1KIQB 5DVNA 4JHBA 5D7KD 2PXYB 3QNXB 1A1MB 1UZ6F 3G6JF 2HVJB 2VLKA 1IGIL 2A1WL 1PFCA 1R3JA 3UYOD 5I30H 1HH9B 5IFHH 3EYVB 2GW5A 1JWMB 4JFYB 5BS0B 5F3BA 4JR9H 3P30H 1XCQB 4H8WL 3VFMB 5C3LD 4LF3B 3DV6B 1S9XB 1I8KA 3GNMH 1HXMB 2BRQA 3C2SA 3M17A 5E2TL 3MLWL 5T1MA 5EO9B 3FO1A 4O2FA 5GJTL 1MCDA 4K94C 1Q0YL 2OR9L 4YEFA 3OQ3B 1DN0A 2BDNL 2QSTA 3FT4B 5EDXA 3T8XA 4ALAL 2HJKA 4KJQC 1YEDA 5DLMH 4L29B 3DGCR 5BXFB 1EHLH 1JP5A 5JXED 3L5WA 4RGND 4G6AC 2X4PA 5CEXA 5EIIA