5E8EB

Crystal structure of thrombin bound to an exosite 1-specific iga fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
229
structure length
229
Chain Sequence
EVQLIQSGSAVKKPGASVRVSCKVSGYTLTEAAIHWVRQAPGKGLEWMGGLDPQDGETVYAQQFKGRVTMTEDRSTDTAYMEVNNLRSEDTATYYCTTGDFSEFEPFSMDYFHFWGQGTVVTVASSTPVSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords IGA FAB LIGHT CHAIN
publication title Discovery and characterization of an antibody directed against exosite I of thrombin.
pubmed doi rcsb
total genus 48
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8eB02
2NY1D 1EEQA 3ULVL 5JDJA 2I60L 2VC2H 2W91A 3O6KH 4X7EC 1ZV5A 1JYVA 2UZIL 5ACZB 5I1LB 3OV6A 3BEVA 4QKXB 1JGEA 3PP3K 2ADJB 5LJYH 3VXME 1ROWA 3F6LA 2UY6A 1S7VA 4LL9A 5FYKU 4WV1B 4MA3B 5TH2B 3VGDA 3RDTB 3ZSTA 5IEKA 3HI5H 5DRZA 3QEQE 4PB9H 4XPFH 5KBNC 4QXTB 4EIZC 4Y4HC 1O5DT 1LDPH 3BW9A 1Q9LA 2AJSH 2DTSA 1BJ1J 2ARJQ 4X6FA 2GITA 2YPVH 1RUAH 1QSVA 3P77A 4W68A 5CWSB 2J1KA 4W4OA 1A3LH 3OG4B 2FSEB 3KPTA 4I4WA 5IM7A 4XNQB 1DSFH 1F4YH 5ADOL 3JWOC 1YEEL 3PGFH 1YEKL 3VWKB 4YUEH 4FMKA 3HCVB 5JW5B 2VDOH 1CGWA 4OGYL 4Z7UA 4EUPG 4FABH 3ZE2E 3D69B 2V7NA 1KJVB 1H0DA 3SBWA 1H5BB 3QQ3A 2IH1B 2QKIA 1I8IA 4GAJH 3MRGB 4P49A 5J4MA 1WT5A 3DMMB 3OJVC 5JW4M 5FKPB 5CIPA 2MOVA 1A14L 1FIGH 4NFCA 4XNUH 2P4AB 2E7LC 4AEHL 2FATL 4YQXL 4NGHL 1J8HB 4JANB 1E4WL 1DL7H 1T66D 2FB4H 3S36L 5HI3D 1MIEL 5I9QC 1FLRL 3FQUB 1ERNA 1PYWB 1CD8A 4U3HA 4NQDE 1VEMA 3O9WA 1NUDA 4LFHG 2Q8BL 4PJHA 4EQ3A 5BW7A 1BZ9A 1KIQA 5HHNB 3KYOB 4XCCH 4RA0C 4AJ0A 2V5SA 2VXVL 5KSAC 4M5YL 4IDLA 2FWOA 1CGVA 3RWEA 1L4IA 1R5WA 1QPPA 1U91A 1Z0MA 1W0VB 3VFSA 3MRNA 4QRUB 2M1KA 4Z8FH 4LKXA 3LQAH 5AZEH 3QWOA 4E41E 1S78C 2N7BA 1MWAH 5IB4B 4HXAH 3UJTL 1CLYL 2AV7B 4RWHA 4L4TE 1JWMB 4Y1AA 5GRZA 5FO7A 6CGTA 5H35B 5E00A 1OLZA 3BGFC 1S5HB 2VDML 1RK1B 4ORGA 5IMOA 2CJUL 3MRKB 5D2NE 2ESVA 4RFEB 3QPQC 4M93B 1T7XA 5KJRL 1LO3H 1KLGA 3LN4A 5AAWA 2XTJC 3GSNA 3IETB 4JVUA 3LSOB 3U83A 4PTTA 4OF7A 3P0YH 5E03A 4PGEA 1S7SB 2AEWA 5KVFL 3OAUL 3IKCB 2WBJC 3VWKD 4LF3B 3MNVA 4PY8J 1GGUA 1FORH 4MB4A 4Y5XB 5GS2D 4YDIH 4G80A 1R3LA 4DKEL 1MCBA 2EE9A 1ZAGA 4BM7A 4HS6B 2CDGA 1LK3H 1S7WA 1GZQA 5F7DA 3ECBA 4OFYA 3D6GA 4WO4C 2ZP0T 2HTLC 3DMMD 3VFNB 4PJ7B 1ZVSB 4MX7B 1A21A 1NSNL 1R3HA 1NEZB 3T3PF 2DLFH 5IROC 1F6LL 2V5YA 3V4UL 4Z5RA 1J8HD 3V8CA 3KHOA 3SJVB 4ODTH 5KS9F 3NFPB 1U8NB 1JTPA 4C58B 1Q9KB 1OAZL 3GB7A 2YS4A 3U7YH 2J12B 1I3VA 3BKJL 3QDME 1I85C 4KKAD 2X7LB 1DLFL 1LP9F 1G9NC 1T5WB 2Z8VC 2EDQA 3PQYA 5D5MB 2QLVB 1F11A 43CAA 3ARVA 4XGZB 3FQRB 2FDBP 2XPGA 4XNXL 4S11A 4WHDA 1EH9A 4PRPB 2FJFA 4YE4L 1ZK9A 5IW6A 4PBXA 3RZCB 1I7UB 4YXKH 1I8MB 2A74B 1JUFB 2XNAA 5GGSA 1ZHLB 4L8SA 5F8QC 2BZDA 5EZIH 4E5XA 2D9QB 2H45A 1NJ9A 1CR9H 5I6XC 5E8PA 1X7QA 3P4NB 5F96L 2Z0BA 4EVNB 5FCUL 1P7QA 4MQ7A 1NAKH 2R4RL 5SWQA 4LLUB 2QQQA 3GIZL 3QULB 3WIIH 5IR1B 3D3VD 1XCTA 4D9RE 5INCB 3U36B 3V5HB 1QSFB 4CMMA 3BZEB 3OKKA 1PG7W 4OIBA 3PHOA 1T22A 5GHWH 4Z78A 2IGFH 2Q86B 3H3PL 3W5NA 3KYAA 3MJ8A 3MRQB 3GSUB 3HAEB 4LCWB 2WUBH 4ELMF 4TQEL 1N6QL 1ND0A 2X4QB 5I2IA 1F3RB 5ISZB 5ERWA 5I1CH 3QI9C 3GMQA 1GGCL 1WVZA 5DT1L 4PGCA 4GSDL 1AQDA 5DJCB 2PCPA 5TQ2H 1FVDB 1AE6L 5L2KA 3JBG7 1B0WA 1GCFA 2BFVH 4GG6B 3HI1A 3ARTA 1D6EA 4F3FA 1K4CA 3WXWL 4K8RH 5EUKB 5K9KA 3HUJB 4X7DC 3NOIA 2NTSP 3EO9L 2F74A 5I76B 1U92B 2FZ3B 5T3XH 5IMLB 1MRFH 5ACMA 3DNKA 3GHBL 3MA9H 3WS6A 2CLRA 3OB0K 5ICYB 5HPOA 1P5UA 5E8NB 3V5DA 1RIUH 2DQTL 1IC7H 4UDTA 3MUGA 3UPAA 1RZJL 3X12B 1HHKA 3MZGB 2RFXB 1OAUH 3IS1X 4XPTL 4NC1C 3SE4A 1T3FB 4AYFA 3OR6B 1X5XA 2R2HB 3C5JB 4K3EH 4WWID 2IC2A 5LAXA 4NKOB 1MCHA 3D0LB 1MUJB 3RZCD 2FECL 5BOZG 4P2RD 1RV6X 4M62L 1U6AL 5I66B 4FQXC 3AY4A 4OM1H 3RVWC 4F7TA 1MRCL 4QRTA 5CJQL 5EULV 5HD8C 3QUZC 1YYLL 2R0KL 4PP2A 3NA4A 4P4KA 2JJVA 2Q8AH 4Y4FB 1OSPH 3QNZB 3V0VA 1B0RA 3TN0A 1AGEA 4IRSA 3VE0A 4HQQH 1F58L 5F6IB 5D6DC 2VL5B 4WGWB 1E28A 1H15A 4PJGF 3CUPA 2PW2B 3GSNL 1MLBA 3EYVB 4DOHB 5I19H 5EOCL 1MHHA 4K94H 2MPAH 3VXRB 2YSSA 4QXGL 5BRZE 4UOW0 3SHSA 5I18L 1BZ7B 4YHKL 5D2LF 3BIKA 4Y8AA 1D9KB 4UQ2B 3CK0H 3KYKL 1BQSA 1A7QH 3QCTH 4YWGH 3MXVH 2O5ZL 3IDNB 4OZIB 2Q3ZA 1BOGB 4I5BB 4HUUA 5DJDA 3CH8A 1MJJB 5F7WC 2X4RB 2JCCE 4Z95L 4OAWB 3KLHC 4LSUH 4R7NB 3TGXA 1NCBL 5TFSL 1BOYA 1N0LA 5DUPH 4LLYB 5LQBH 4M7KL 2X9XA 5I1JL 2X70B 1FL3B 3T1FB 4CVWA 3FMGH 1FZMB 1I7RB 1T0MB 3HZKB 4CW1A 4DVRH 2ZJSH 2G75A 1BM3H 3PJSA 1TVBB 1ZGLP 2BSSB 3SEPA 3SBWC 5FK9A 4BKLA 4X5WB 3MNZA 3GMOB 4M48H 1WBXB 1HOCB 1I8KB 4YGVA 4DKDC 3OAYH 2A77L 2B1AL 3GNMH 4QOKB 4P3CH 2VLRE 3GMRB 2YN5A 1F90H 5FYLL 3LEYL 1J18A 3LCYA 7FABL 3HNVL 3B4NA 5HVFB 4FA8A 4I0PC 1YPZA 4HHAB 3QSKB 5JA8B 3H9ZA 3VXUB 4XP4H 2A6JA 2J2ZA 1KB9K 1WEJH 4J8RA 3ILQD 4G9FB 4KHTH 3F65A 5GRYA 3SDAA 3O9WC 1FNHA 4I0KA 1MQKL 2PN5A 5D7KD 3HHRB 4LSDA 1QR1A 1HXMA 3OR7B 2XTJE 3S37H 3KVQA 3THML 4APQA 4ENED 4PJ9B 4JB9L 5T1DH 5JIIA 5JXEA 1RD6A 3C6LC 2ADGB 4MXVF 4Y4FD 4N8CH 5IFAH 2NY4C 3ZDXE 1M71B 2ZWLT 3AAZA 3ZSSA 1JRHL 5IF0B 4ACPA 1JJUA 1MCOH 1YYMH 3VXRD 4LEXL 1Z3GH 3MRDA 1VADA 1NBYB 5HDQL 4RMQA 3DV6B 3S37X 1D9KD 1UYWL 5DMIH 4JN1H 3BO8A 4JFFD 3FO2B 4Z7VA 1RJYB 3C5ZA 3DO7B 1QSEB 4NQCB 2BVEA 4JFHD 2NLJA 1RULH 3E3QE 4R96A 5B38G 5BVJB 3HZYA 3DUUB 3SN6N 4BA8A 3BKYL 2PTVA 4OGXL 2P5WE 3CFJB 4NCC1 4JO1H 5TDPA 4DZ8A 3UTPD 1N5YL 1HHGB 5FECA 3T2QA 3JVGA 3ARBB 3VRLE 1LK2B 1JHTA 4N0UB 5GRXG 1OGAE 4GW5A 5EIIB 4PRHB 4HMCA 1BJ1H 1LO2H 4U0RC 4LASL 1URLA 3B9KA 1YMMB 2BRRH 4ZYKB 1HINH 4PJEB 4M7JH 3S5LB 1CVRA 1TNNA 2V7HA 3QAZB 4QOKD 1LEIB 2AXFA 5IEHA 4YC2C 2DYPD 3HZVA 2R8SH 2JTDA 3RBGA 3ARPA 4KK9C 4JKWA 5FUOH 1CF8H 4PRIA 1CFVH 3VXUD 1IM3A 3UTQA 1KTRL 4I0CC 5DRNA 2YK1H 2BNRB 4G9FD 1FAIH 3E6HA 3DTXA 3CFKB 3ARDA 4HUWA 1KNOB 4FZEL 1U42A 5T1LA 3IXTB 4Y2DB 1BJ8A 4JPKL 4R90H 1KELL 5M7QA 4HUVB 1XGQB 2IFFH 2IPTH 1UA6L 3OGOE 4IOFC 5DF0A 5I8EA 4X5LA 4F58L 2XA3A 2FBOJ 3GSRA 3WD5H 1RUQH 2H32A 4PJ9D 4WNQA 3CSYA 5E08H 5IBLD 1IL1B 3OKOA 4NZRH 4P2OA 1VGKB 1GOHA 1MJ7H 5EZOL 5F21B 2LE9A 3AS2A 1NGZA 2DWEA 3D1MC 1A8JH 2HA1A 4CADA 3MOBL 4QRRE 5IJVA 2G9HB 3V52L 2UVEA 1U3HA 2CGRH 4HG4K 4JRWA 3ARYA 1CXFA 2H26A 4FQ2L 5GZOC 1YEDA 3ZLQC 5B39A 1ZT4A 1DUZB 3MCKA 2Y6SC 2XN9E 4R97B 3O2VL 5GS0H 2VDLL 5C2BH 4UUJA 1HHHB 1QSED 4XBGB 4NQCD 4FXGA 5DSCA 1V7MH 5HGDB 1YEHH 4RMRA 4UT7L 3QO1A 3R06A 5ITFA 1W8OA 5EOTA 1MVUA 2XRAL 5ILTL 2NY6D 2DQEL 2VR9A 3ETBF 1F4XL 2FEDD 5ESAB 2YUWA 4J4PA 4DN4L 4Q9RH 4QGTA 1YEKH 3ARBD 3T3ME 4WU7B 2X4OA 4NC1E 4OGYH 5ESVA 3LEVH 4JFEA 4J23A 1WFOA 4PRHD 3TC9A 5J89A 2DQDH 5AYQA 2EDYA 4PJFF 3WIHA 1JK8A 2ZCHL 2GK0B 4FQJL 1LNUB 1KEGH 5IB2A 2E9BA 1V3KA 2UWEA 5BV7B 3RPIB 1FBIH 2EYTA 3UJJL 4RISH 2LVEA 2OR9L 5IK3A 4ODVH 1YN6B 4L1HA 5CSZA 5GGVL 2NYYC 35C8H 3JTSA 4JM2B 4P46D 4BFGA 1IC4L 5M95B 4NO2A 3X13A 4JRXD 1OWRM 1DBKH 2DWDA 1U8HB 3AU1A 3PWPA 1JN6A 1Y6MR 4E0RA 1ACZA 4NM4L 3WFEL 4WY7L 4ZNEE 5LKNA 3WMSA 4Y2DD 4Z7OE 1I9JH 3GSOB 4LAQL 3I3BA 2F53E 1ZA3B 1ZVYA 2GQHA 4GS7B 1P1ZB 2HTKD 2Y07H 3C60B 3NCCB 4XCNA 5BCAA 3DX8B 2VABA 3TIEB 4OCMC 2I07A 2FIKB 2FL5A 5CP3H 1XCQB 2HT3C 2ZSVA 1K3ZA 5LCVL 2KPNA 2APXA 3WLWC 2DJSA 4X8XA 1F3JA 5E8EB 2I9LA 3D2UA 2DQCL 2VJXA 3GSWB 2AK1H 4KK5C 4Y19A 2CPCA 4ZSOA 3HE7A 3WNLA 1S9YA 3S3PA 3AY4C 3T77B 5FB8A 1TPXC 3DBXB 3HPJB 4C83A 4LRIC 3HC0A 5BJTB 1AGDB 2VLLA 4HFWB 5EU6A 1XF5A 5I30L 2GJ6B 3FTGA 2BOCB 4BQ8A 2VDMH 5INDA 4P4KC 1FVCB 5JHDB 5EWIL 3W2DL 3OPZL 3TN0C 1G7MB 4IRSC 5F7YC 3BPNB 4GRLA 5KJRH 3O6FB 2VDKH 5HHVL 1W8NA 4IS6A 1B2WL 1CL7H 2VLME 4QY8B 4LSSH 3D85B 2R69L 3TZVB 4F15C 1NBVH 2JB6A 4MD0A 5C0CE 1MCEA 5E8DL 3HC3L 4RIRA 1OAXH 5J57B 3BFOA 1WISA 3BSZL 4PJ7F 3TWCL 3P9WB 4KTYA 3O3EA 5C0EB 5EU7C 5EBMB 3WFBL 4I8DA 2JIXB 3KPSB 4PJHE 5CZXD 4ESKA 5CD3B 3HRPA 1SBSL 3VG9C 5KSVB 4LLVA 4YX2H 4S2SA 4Y4KA 4Z7WF 4GMTL 5IVXB 3LQAC 4JM2D 1BLNA 3L3IA 1MSPA 1U36A 3HNSH 3P40A 1RJLB 4RA3A 3C2AH 1MI5B 5D5MF 2WWKT 3MO1B 3RP1A 4GW1A 3H9SA 3NA9L 2V2TB 4OZHB 1DLFH 3C60D 1X6NA 3WKML 3BZFA 5DTFA 2XG5A 2IPUG 4QYOB 3BDYL 5DDHA 1PG7L 1T1WA 5F44A 1FG2A 3QIUB 3VXMB 5ALBL 1H3XA 1JZ5A 3SDAC 4HKZB 3QEQB 5F9WB 1Q38A 1N6UA 4YDKL 5C8JA 2AKRA 4AIZB 3C2SA 3G6AA 1FL5A 1K6QL 2HFEB 3C09C 3MV7A 2JLLA 2EECA 2LFGA 3MRLA 1R5IB 4YDVB 3Q2CA 4JPIA 4U3XA 5LWYH 2Z92B 5JHDD 3KJ6H 3BMWA 3FB5B 4HZLB 2Z31B 3RAJL 3O6FD 3B9DA 4XP5L 4LIQH 4X98A 3CSGA 4RBPH 3L1OH 1VERA 4G7VH 2VSDA 3D85D 4EI5C 1QFUL 2O93L 1PEWA 1ZHBB 4PRDB 4X7TA 4GAYA 3ALPA 2A6KA 1YEGH 2ITCB 3DI3B 4X6BB 3MOAH 1EHNA 2BCKA 5DRWB 1GOGA 1IGMH 3OF6D 1K2DB 3HNTH 2X4NA 2VO5A 1QYGH 1OAKL 2HT2C 3WIHL 2YXMA 4GG6F 3IYLW 1C5BL 4MLIA 4IRJD 4AT6B 4K3JL 1GZPB 2XFXA 3KPSD 3O6LL 5DR5L 2HKFL 1FVEB 2ZOKA 4G6KH 5C7XH 2GI7A 4PRNA 3WHXB 4H26A 1EFXB 4P5MA 1HSAB 4GO6B 3PQYE 3BXNA 3LRSA 4TNWF 3JVGC 1ZANH 1VFAA 4JHAH 1B6DA 1WWWX 3QA3A 3G9VA 4LOUD 3EO9H 2V9TA 3M1BA 3FN0H 1V7NH 5DI8B 1JYXA 1YEJH 4PY7B 3QJFB 3RWHB 1J0YA 1MI5D 2X4PA 1OP3K 5GGQL 3TCXA 5M94B 5FEBA 1A2YA 3B9KC 5T5NG 3SOBL 3BH9A 5HHXH 4H1LG 5IQ7H 3MNWA 4JKPL 3WLBA 4N5ED 1RZJH 2P48B 4IMLB 4E41B 5C9KA 5DJXB 3LKNB 4EN3A 3NCFB 3O8XA 3JUZA 3MZTA 2W0LA 3GIVA 1C12B 4YPJA 5H37G 5CJOL 1ORSA 1VEOA 1WAAF 4D2NA 3QIUD 1I3RB 2GUOB 2GK2A 2N56A 2E27H 2C3VB 2ZPKH 4UB0L 5GRVK 3ARDC 3QEHB 4ONHA 4YHPA 4JG0H 4ZD3H 4X99A 3QEQD 3NAAH 2VOTA 5D2NB 5J0BA 3RZWA 1ZMYA 5CMAA 1U8JA 2VZUA 3MGTA 5DJZB 4AL8L 4CAGA 5KVEL 2QSVA 2DM4A 1T4KB 3NIDF 3V5KA 1R6VA 5KS9A 4UAOC 1CTNA 3LB6D 4LKCA 2Z31D 4JAMA 4DCQB 4WIQA 2YMXH 4OFKA 2OSLB 1FYHB 5FA3B 4K8RC 2X09A 3SKJH 3CFIC 5FYKL 5LVEA 4LSVL 4Z7QE 3CFCH 4H88H 2GFBA 4KVNH 3GUTB 1DQLL 1AC6A 2H41A 1LP9A 2RQ8A 5D9SA 5D6CB 4QRPE 1F6AB 5EOQH 4K7PL 5BOPA 1N8ZB 4QHNA 4Z0XA 3GJFA 4HIEB 5C0RL 4GBXA 3HMWL 5J11C 4L8DA 3DX6A 1IAIM 2A0LD 2EDBA 1ZHNB 1NCBH 3L3JA 3IFLH 2H1PL 2OL3B 2Z35A 3QO0B 1DEEA 2XWBB 4NQDD 3ARGD 4AQOA 1NCCH 1MAKA 3B5TA 3DUSB 4ZO8A 4WJ5B 5IIEB 4J4PC 1UACL 1TQBC 5I8CA 3DVFA 4L9LA 3LD8B 3O2WL 3I9GL 4R8WL 2ATPA 4RGMB 5C0JA 1IGCL 5D72L 2W9EH 1SQ2N 3W11C 2YRZA 3BP5B 4X6CB 5MHSE 5JLZB 1B9ZA 1E6JL 3SPVB 2VLKA 3R1GL 1YJDL 1C16B 5TF1H 1Q1JH 3KJ4C 3JV0A 2HFTA 1DR9A 4FFYH 2BY1A 2ZUTA 4AY0A 4E41D 5SWZE 1JE6A 5B8CC 3VFOA 2FJGA 4GKZB 1OTSC 5MP6L 3NZ8B 3L3OA 3HAEG 1CFQA 1P4BL 5J6HA 4L4TD 5HYQB 4KGLA 4K94C 4ELMA 1JZ4A 2Z8SA 3RTQB 3WIFA 2ICCA 4JY6A 3QDJE 3AREC 2P8MA 2QSCH 2WUCL 2A83A 1HNFA 3GI9H 3CX5K 1KJ3H 1E27B 2P8PB 1W72H 2R0ZL 4L3EE 3THMH 4QRSA 4PG2A 1Y18B 4HULB 3KDMA 5C6WH 2AQ2A 3P9MA 2DMBA 2Z4QA 3L7FB 2DQGL 1I7TB 4OQTA 1EMTL 4YIQB 2E9IA 3REWA 4YO0A 2AJYH 1G0XA 3QXVA 1FGNH 1S5IL 1UM4L 3I6GA 4KKNA 5D7IF 5DQJA 3SDYH 1HWHB 4NNYB 5FM5M 1H3TA 4LP4A 3ZKMD 3KYMB 3LPGA 3HE7C 1NFDF 1BVLB 5I71C 4G6MH 3P0VH 2C26A 3CLFL 5C07E 3F5WA 5L7XL 2EC9U 1IAMA 5DD3L 5FDYA 4TUKL 1I7ZA 5K59E 4JHWL 4LVEA 3MLPA 2P47B 4ISVB 4MJ5A 5JIKA 2V5RA 4I18C 1FNAA 4YBQD 1RMFH 3BPLC 1ADQH 3IDMA 3VI4E 3UPRB 1G7LB 1QRNA 5HYSB 3SDXE 2O61B 1K8DA 4OKVB 1A1MB 2A6IB 5K9QG 2J8UE 2OP4H 3PWNA 1GAFL 4R26L 3OX8A 1I9RH 3CH1A 1BX2B 3QDMD 4G6AD 4PJ8A 1A0QH 2FO1A 1UWEL 3IDGA 4Z7NF 3BP6B 1YPZE 5IBTL 5DK0A 4MB3A 3K8KA 1XF4A 4PBVC 4HV8B 4PJEF 4QHKJ 1I9IL 3RUGA 2G2RB 1SJXA 3QNXB 4PJGA 5DHYA 3WL9B 5IUSA 3TV3L 2GY7B 5E6ID 2PUQT 2OX5A 5DO2C 5FYJH 1I3GL 2QQLL 4TYUA 2B4CL 4OIAA 3BX7C 5D2LA 1CT8A 1NGYB 2IANE 4Y4KC 4Q9CA 4NWTL 1DUYB 2R2EB 4OV5B 4X9GA 3S3SA 3WJLA 3ULUH 1C1EL 1NFIB 1MAJA 4GKOA 3RTQD 5ITBH 4NO0B 1XR8A 4QNPF 5I8OL 1ZLVK 4HT1L 3KR3H 4KI1A 4RFNC 5SWSA 4RRPG 4YAQA 3KLAA 1OF2B 4F9LA 4F7MA 2YKLH 1EO7A 4CDGC 2BHZA 4PRAB 3DYOA 2W60B 1YJDC 3MCLH 4PPTA 4D9RD 4F57H 3MLVH 4AENA 5C70A 4D0CB 5JORA 2YBRA 4Z7VE 5BRZB 1MRDL 1AXTL 2C1PA 3O3UN 5E6ZA 1WFTA 4HPOH 2PR4L 4ETYA 4P59H 2VXSL 5EZOH 4X7FC 1A6TA 1UG9A 5CBAB 1DQQA 4XCEA 5ETUB 1KN2H 4H8WC 2JB5L 2QADC 4IEFB 3DGCR 3UYOD 2JCCB 5ICZA 4MDJB 3ILPA 2H2SD 4XNZB 3CXDL 3CXHJ 2D31B 1AKJB 5LBSH 5HSFA 1EHAA 3MPCA 3SE3C 2VDLH 1DBBH 4TVPH 4OF8A 1N64L 1DVFA 4H20L 3IRPX 1INQA 3AXLA 4KAQH 5KSAB 3RGVA 4WEBL 3FOMB 3NIGF 2DKSA 1SBBA 5ILTH 3FB7A 3IFPB 3W9DB 1A6UH 5D1QA 2VZ3A 3VJ6B 4KZEL 2IBGA 1CGSH 4HMEA 1CTOA 2EDJA 3L5XL 3QG6B 2VLRB 2BNUA 4U1NB 4D9LL 1AFVH 3NCJH 2Z91A 5HHOE 3P73A 2CMRL 4POUB 5C0IA 1CGTA 1EHXA 1FZKB 4FQJH 2Y5TB 3QCVH 1U41A 5IT2H 1KXVC 4JM2F 1MCQA 1MFCH 4Y4HD 1CLCA 1OQOA 4MXWL 2R4SH 3FKUS 2XTJB 5C0GA 2W65A 2B0SL 1MFDH 3ABZA 4PJAB 5BZWA 3VDCA 4F33B 4RAUB 4NO5B 4P57B 2KUTA 5CEXA 3NFSL 1FH5L 4NO0D 3ZHDA 1XGPB 4FHBD 1EO8L 3CDCA 3CDGA 4O58H 3WFHB 2Q6WA 1CDBA 4LBEA 4GMSL 4HUNB 3DX9A 3BD3A 4L29A 1D5MB 2PO6A 1NKOA 1HE7A 1DDHB 5F9OL 4EN3C 3MLSH 5C0FA 5SX5H 4KVCH 4WO4B 3GBLA 3TYGL 1VHPA 2B4CC 2NY0B 2CRZA 4OQTL 1DN0A 5EBWA 5BRZD 3DHJA 5T3XE 4O2FB 5MEQA 4M6MH 2MKWA 1NGWB 4P5TA 3MRIA 5L6YL 3QXTA 5C1MB 1D5XB 1QZ1A 3VI3E 1DLHB 1MIML 1QVOB 1RI8A 2EDNA 5GSVA 4S1DC 1E6OH 1EZVY 4G3YH 1TQCC 3EKCA 5IHUH 3S5LG 2Q76B 3TPUA 1T20B 4PY8I 1JGDB 2X1WL 4AEIH 5LXGL 4UQ3B 5AG8A 4AM0A 1NC2A 2OR8A 2C3XA 4MNGA 3QUMB 1AKJD 2P5WB 3K7UA 4EI6A 4LLWA 4M8QA 1NCUA 1SM3H 2UYLA 4X4YA 4X0KA 5EWIH 1QSZA 2DM3A 3KPLA 1I4FA 4ZQKA 1IKFH 5KSAD 3LRGA 1A6WH 2IG2H 4WI5A 1T1ZA 4LSQH 5DEZA 1QQDA 1LILA 3JZ7A 3WFZA 3BQUB 3U48A 1JZ2A 2KQNA 3VRIB 1Q94A 4B41A 1UXWA 1VFBA 1HQ4A 2H6PA 4HIHB 4OI8A 1S78D 1IAOA 3L3HB 4U1GC 2NY3B 1CGUA 3CZFB 2Q7YA 2ZCKH 4QXWA 2VLRD 1BVZA 4NN7C 5KOMC 1D5ZB 2FH6A 3PWPE 4LCCB 5I6XB 5ACZA 5I1LA 4GXUN 3REVA 4M3KB 3BZ4B 3NACL 2ADJA 2D7TH 2GTWB 3RHWF 5IVXF 3LIZL 3MC0A 4WV1A 4MA3A 5TH2A 2P49B 3RPKA 3K1DA 3SCMB 3RDTA 3TIDB 3DVIA 4L9LC 1N59B 4QXTA 2XTJD 1JGUL 2DMCA 4DKFL 1ETZB 4OZHF 5CWSA 4LSTH 2WBJD 2Q87A 4N0FB 1CL7I 1FO0B 1U2HA 2FSEA 1DP0A 2R1YB 1NCTA 4XNQA 4XC1L 2P45B 3VWKA 3NCYS 2I25N 4O5LL 2H32H 2X42A 4K23H 3HCVA 5JW5A 5DJ6B 2D0GA 1J5OH 1ED3B 2R29L 2OXGA 4UDUB 1B6UA 2C7UB 3WSQL 3D69A 4QRRB 3IF1B 1KJVA 4LCIL 4WO4D 4YGAB 1J0JA 2HTLD 1H5BA 3BDYH 1G6RB 3GEWB 2LVCA 4TRPH 3MRGA 4DW2L 3DMMA 5FKPA 2XN9B 3TBTB 3MODL 1ACYH 5CHNB 1WIPA 1YEIL 2CKBH 2ICWI 1OP9A 2BVPA 5E2VH 3PV7A 1J8HA 1K6QH 4JANA 4C4KO 1P4IH 3FQUA 1PYWA 1S9KC 2O5XH 4Y89A 4TNVK 3ZE2F 4MWFB 4KY1L 5IMMB 3MLYH 4XBEH 4L9DA 3AROA 3ZKSD 3VXTB 5HHNA 3KYOA 4WFFE 3BQUD 1OGAD 3MYZA 4B0MM 1QFUH 3J7HA 2YZ1A 3JV6B 2ORBL 3BIBX 1OP5H 1G7QB 1W0VA 4QRUA 4IHOB 1MCPH 4HPYH 1WFUA 4U6YB 2HKHL 4FQXB 1KB5H 3FONB 3VD7A 5EPMB 5IB4A 2K1MA 2XZQL 4NKMB 3F7YB 4PD4J 3LN5B 2AV7A 2WM0A 1JYWA 2VWEC 4K3JH 1JWMA 1M6OB 1OPGL 1D5IH 1NC4B 5H35A 4O4YH 1S5HA 1RK1A 2RIKA 1T80A 4MA1C 4NKDB 4KI5C 5DD1H 3MRKA 4RFEA 2F53B 3BRGC 1J0ZA 2EE6A 5HYIA 4FQIL 3K46A 1JGEB 4RMTA 3ARFA 5I1IH 1L6ZA 5FGRA 3MLWH 3IETA 1S7VB 3LSOA 5JHLL 4H1LA 4XMPL 4OIIL 5GGQH 1S7SA 1JPTL 2BY0A 3IKCA 4LF3A 3TJHC 2Q7NA 3OMZA 1RZGB 4HJJH 4ZS7L 3QI9D 1F5WA 3WJJA 3BKML 3BW9B 3GMPB 4Y5XA 5FDWB 4QRRD 1MH5B 3MV7E 1IE5A 1MPAH 3IJSB 1ZT1B 1OLLA 1Z6JT 1INDH 3RY6A 4ALAH 4YPGB 1LMKA 1MVFA 3VFNA 4PJ7A 1ZVSA 1TJIH 2XN9D 4MX7A 4YHNB 3ZHKA 1NEZA 3MROB 5IP4A 3LMJL 4F9LC 5J13B 5E7BA 2W9DL 1PSKL 2Z8WC 4XVTH 3SJVA 1YQVH 3NFPA 4EDWL 4OCSH 1U8NA 3BP7B 1Q9KA 2AEQH 2YXFA 3QHZL 4OM0L 3QXAB 5JUEH 3K1KC 4LNRB 5C0CB 2X7LA 4NUGL 4I0PB 3NVQA 4UU9B 4G43B 1CU4H 1T5WA 2BY2A 4ZNCD 1CD0A 2V2XB 5D5MA 1X5ZA 1WBYB 4XGZA 3FQRA 3S88L 3LPWA 1M7IB 4YNYB 1VPOL 1IGTB 1HQRB 4PRPA 2QEJA 4NSKB 1J10A 1QBMH 4FQXD 3H42H 3RZCA 1I7UA 4CDHA 3VGHA 1I8MA 3RVWD 4KJQC 2A74A 3C6LB 4XPBH 5DURB 4C55A 2WMPA 5HD8D 1JUFA 3RWEB 3BDXA 1ZHLA 4Q6IC 4WFGE 5GJSL 1L7TL 1NCDL 2YPLE 1INEH 1NC4D 4NKQB 1S8DB 1U0QA 4TULH 3P4NA 1MCCA 2OK0H 1EXUB 4KTDL 4EVNA 2XXMB 4F7CB 5D1QC 2P44B 2F53D 4LLUA 1A9EB 4ERSL 5CEZH 2NY1C 2HRPH 4R8WH 3QULA 5IR1A 1J88A 2EEAA 4LQ1A 5INCA 3U36A 3GHEL 3EO0B 1QSFA 3V5HA 2DQJL 3BZEA 4NP4H 2IPKB 5KVGL 1JWSB 2KH2B 4HH8A 5E56A 3T2NL 5I15H 2HG5A 1JTOA 4FQLH 2Q86A 1NKRA 2FRGP 5GSRB 4LSRH 3O11B 1TZGH 2D03L 4EBQL 3MRQA 3B9EA 3LS5L 3GSUA 3VXOB 1R24B 3HAEA 4JY5H 4LCWA 4DQOH 3KLHD 1KIUA 2FNBA 2X4QA 4V1DE 5ISZA 2AVGA 4WENB 3ARWA 1IM9B 3QCUL 5DJCA 4NHUB 1SJHB 3BP4B 5DJAB 5I1GL 1FVDA 1JF5A 1YEFH 4X83A 4GG6A 2ZUWA 4KMTL 3H9YA 3IDJB 1MAML 3L3KB 1ZLWK 5TE4L 1L9MA 4MLSA 2F58H 4U1SA 5EUKA 2PO6C 4LHUG 4NC2B 4ZDHB 5HTSA 3HUJA 2FR4B 2YRLA 4UINH 4ZFFB 2VLMD 2FJHB 3G5XB 5I76A 1U92A 2FZ3A 4LP5A 5E2UH 5T5FH 3VH8B 5KVMC 5IMLA 4KH2A 3GK8L 4U7MA 4EZMA 4TUJB 5ICYA 5E8NA 1F8TH 4JLRB 1VGEH 4P5TC 4I0PD 3DO3A 4I3RH 3UTZB 1J7VR 3X12A 2RFXA 4M61B 2VL4A 4WTXA 1BBDL 3MLTB 5DK3A 4D9QE 1TFHA 3AC0A 4NQEE 3AMKA 1T3FA 2C9AA 2IWGA 3O9WD 3OR6A 4JEGB 2HH0L 3BHBA 2R2HA 5JOPE 4MZ3A 5FAAA 1B4RA 2J4WL 5C6TL 4BFEA 4NKOA 4X9IA 5TE6L 3D0LA 1MUJA 5I17B 3D39B 2P5EB 1RK0B 5KAQG 1WAAA 2VMFA 3C6LD 5DURD 4LHJB 5I66A 1KBGL 3PABB 3R0NA 5AD0B 2W0KA 2NY4D 4ZUVB 3STZB 4KQ3L 3GMMB 5IHLB 4R26H 4Y4FA 3QNZA 1UWEH 2VDPL 1U8PB 3IGAB 43C9B 1G7PB 5GGSB 3DVNB 2VL5A 1RZKH 4X7SH 4D0BB 4YFLI 2PW2A 4ODSL 3KWWA 3EYVA 1CXKA 1KIPB 3O45B 2YWZA 4DUVA 3VXRA 3BGAA 1AR2A 1TITA 3RL1B 4PB0H 1BZ7A 4M5ZL 3X17A 1D9KA 1CXHA 2FO4B 4UQ2A 1E0OB 1X4YA 3CFDB 3QXDB 3IDNA 1BQHB 4OZIA 3RDTC 1BOGA 12E8L 4I5BA 4K3GA 1TLKA 4J7RA 2BY3A 1MJJA 4HWEL 3SGDH 2X4RA 4BFIB 5ALCL 1TCRB 5IKCB 5T33H 4OAWA 4BZ2H 2DLGA 1EJOL 2AQ3A 2PW1B 4R7NA 5FHBH 2BHUA 3WV0A 4LLYA 2X70A 1FL3A 5JXAH 3UTSB 3T1FA 5JDSB 2CUHA 1FZMA 1I7RA 1T0MA 3GDBA 1S9VB 3HZKA 5IESH 4YLQT 4P9HH 1AQDB 1TVBA 2BSSA 2DAVA 1OB1B 4MA7L 1J87A 1H5BC 4GAGH 1Q0YH 3RBSA 4RQQB 1RIHL 4X5WA 2NX5B 3I02B 3GMOA 1C5DB 3ZDYE 2B2XL 1C7TA 5HY9B 4QRPB 1WBXA 1HOCA 2JCCF 3GRWA 1I1FB 1U8MB 4KK9D 1I8KA 4YDJB 3GMRA 2VWEE 5HDBE 1UADC 5F6HJ 3BEWB 2ADFL 4HHAA 1JHLL 2PETA 1FFOB 3VXUA 2UUDK 2YA2A 4ONGH 4KI5E 4G9FA 1BQUA 1EDQA 3FFDB 1GC1L 4IOFD 1N64H 2Y25A 2AJ3B 2WQRA 3PQYD 4YK4C 4Y16C 3OR7A 3RUGE 4IBLT 3K2UH 1OL0A 4IOSD 2OJZL 4PJ9A 2D7PA 2ADGA 5JQHC 5KANI 1S7TB 3GMNB 1H8OA 5IMKB 4XX1G 1JPST 1NBZB 3U30C 3CD4A 1M71A 2Q1EA 1FZJB 1GJIA 4LIQE 3TA3C 5IF0A 5SWZB 1N5AB 1UWGL 5GZOD 5F93C 2Y6SD 1NBYA 3DV6A 1P7QD 4PFEA 3GO1H 3V0VB 2AJXH 3A6CL 4NOBA 3FO2A 2EZ0C 1UWXH 3QDJB 1RJYA 1U3YA 3DO7A 1BJMA 1QSEA 4NQCA 3TBVB 1DQJB 5ADPH 5HI5C 1T2XA 3U7WH 2CDFA 2MMXA 4L3EB 5BVJA 5E9DB 1CLZL 3DUUA 3ARFC 4JO3L 4LARH 3ZDXF 4NRXB 3UPCA 1HI6B 2WP3O 2X4SB 3CFJA 3DI2B 4JHZA 3S34L 5IGXH 3B8SA 5L8LB 1HHGA 3ZT7A 4HUUB 2APTA 2FEEL 1DN2A 1LK2A 4N0UA 1S7QB 1RUKL 4Y5XC 5F9OH 3BKCL 5EIIA 4PRHA 4ONFH 5HGGS 1HYSC 4ZG1A 1CLOH 1FNEB 3RY6C 1YMMA 4UBDC 4QRPD 5C07B 2WSKA 5L6YH 4PJEA 2ENSA 2NYYD 3S5LA 3NH7L 1N4XL 2G5BB 1LEIA 1FSKC 4MJ6B 3Q6GH 1MWAB 4OCWH 4OZ4B 5CEYB 1AGFB 3K81A 1BF2A 3P11H 1JBJA 1JF1B 3SDXB 2ZUUA 1PVHA 3IDXL 4QGYA 3VRLF 4X4XB 2BNRA 5L2JB 4AK1A 2J8UB 3CFKA 1KNOA 3GJFK 5JW3L 3IXTA 4Y2DA 1U3JA 1DQDL 4NQUA 1EFQA 2HFGH 3PWJB 3STLB 1XGQA 4HUVA 1EIBA 3TT1H 4LSPL 2HT3D 4V2CB 4NOFA 5E2TH 3WLWD 1IL1A 4RWYH 5MHSD 1JPSH 5CJ8A 1VGKA 5JOFB 4KK5D 3U0PB 3QXUA 4YDLB 1RQ5A 1L7IL 3IS0X 5SWZD 1A3RH 1HDMB 3V0WL 3C09B 1GC1C 2G9HA 2IANB 1AD0B 1OAQL 4M9OA 4DVBB 4P4KD 5F7MC 4JDVB 4IRSD 5E4EB 1DUZA 1ZTXL 3QDJD 1HHHA 5HI4C 4XBGA 2GKIA 1I8LA 4O00A 3S4SB 5HGAB 2R0WL 5HGDA 4EI5B 3QNYB 4DKFH 4L3ED 4JJ5B 1PQZB 1FQ9C 4LRNH 2R0LL 5FF6B 5AG9A 2I5YH 3RWDB 2NY5L 4XC1H 5ESAA 2BJML 5J9PB 5CUSL 4MS8C 4WU7A 3EFFB 3WFDH 5CZVL 2R29H 5H2BB 3V7AG 5J6GB 1CS6A 4LEOB 1YY9C 4TTDC 3IVKB 1C7SA 3GRWL 5TDPB 4OD1L 4Y8DC 2GK0A 3MJ7B 4NQVB 5C07D 3FRUB 1CQYA 1WWBX 2ZKHL 5AZ2H 1JHTB 3RPIA 4YHZH 2PTTB 1B90A 1YN6A 1PGRB 2MQCA 3QFJE 1OT1A 2MCPH 4JM2A 4ETQB 3B5GA 5L88H 2PXYC 5DQ9B 3T3MF 2J6EA 3GMLB 3QUKB 1U8HA 4WHCA 3LKQB 5GRJL 3VXQB 5FO9B 5DGQA 5EC1B 4U33A 4LPCA 3GSOA 2F5BH 1FYTE 4FS0A 1ZA3A 2FH8A 1P1ZA 3C60A 3I85A 3QDAA 3DX8A 3LKRB 1T6WA 3TIEA 4HIIB 2FIKA 4ODWB 5HHOB 3SDAD 3EJZD 1XCQA 2VDRL 1FNSL 3VDAA 5IHZB 3J8F7 5T1LB 1XF2B 3TJEL 3F12B 1R0AL 5D7JB 3TO4B 5E8EA 4WTZG 3T2OA 4OZFH 1QLEL 1RU9H 3GSWA 4DN3L 5F1SA 2IAND 4HS8H 3T77A 4Z7OF 4JFZL 4WUUE 2K3TA 3MV8B 3WDJA 3DBXA 3HPJA 4ENEC 4BH7B 5BJTA 1BFVH 1AGDA 4HFWA 4MVBD 2GJ6A 3X14B 2BOCA 4HX1B 5DHVB 1FVCA 3WFCH 1UCBL 5JHDA 1BQLL 2H8PB 2YD8A 5EUOA 5IJVB 1G7MA 4AH2B 1UXSB 4N0CC 4EI5D 3O6FA 4LU5L 3DV4A 3PP4L 1UFUA 2MHAB 4QY8A 1YNKH 3D85A 3ZYOA 4FZ8L 3TZVA 1EBAA 1JPTH 4G7YL 4XAWH 5J11B 2HT2D 4YHML 4XHQA 4ZS7H 1NGXB 3OF6A 4MMZC 2QR0B 4I3GA 2X89D 2EIZB 1OCWL 1EVTC 5EOTB 4ODHL 5T1MB 5C0EA 3OXRB 5EBMA 1N0XL 2JIXA 4EUPB 3KPSA 3MRBB 1TQBB 5FYJE 3RVUD 5CD3A 3DVGB 4HF5L 4HUXB 3QYCA 1OAYL 3LMJH 4ODXB 4L8CB 5KSVA 1T0NB 2EDDA 4F7PB 2E8YA 2NY5C 4M00A 3KG5A 5IVXA 1FDLL 2ZG2A 2BSED 5FA4B 1T1XB 4FG6C 5I1EH 3RWFB 3TBWB 1OT2A 5FV1L 1RJLA 4BQBA 2C4FU 3EHBC 3RWGB 3KJ4B 3SKMB 1MI5A 2B1HH 4MQXD 3MO1A 2QQKL 5B8CB 2V2TA 4PJDB 2C3HA 4PREB 4GXVL 4OZHA 1TJGL 3F6IA 2O5YH 4M4RA 2BVUA 4HGWA 4GXUM 1ES0B 4PJHF 4ZFOB 1UEYA 4QYOA 1CI5A 1YECL 5HHOD 4LPWA 4OCXL 1DQML 3C6SB 3ARDD 3S88H 1BGXL 3AREB 1OOAA 3G6JE 2D7QA 4LLMB 5T1LD 3QIUA 3VXMA 2V9RA 3DXAE 1UM6L 4Z76B 4HC1L 3SGEH 5I1KH 3VGEA 1DBJH 3MLRH 5C3TA 3BESR 3QRGH 4HKZA 3TNMB 3QEQA 4U7KA 3V95A 4AIZA 2HFEA 4XNMB 4UT6H 1NCDH 2AJVL 1JGVL 1OHQA 5H94B 5ANME 3EYOB 4J6RH 1R5IA 2BVQB 2XA8L 4YDVA 1KENL 1JMXA 1H3VA 3L5IA 2Z92A 1EV2E 4K8RD 2B39A 3FB5A 1LEGB 1XEDA 4HZLA 4AEFA 4UIKL 4BUHA 3IJYB 2Z31A 2CUMA 5I1HH 3MACL 5I71B 4R3SA 5E99H 5J1AB 4UTAL 2OJEB 3MXWL 1BF8A 5T3XD 1ZHBA 4GG8B 4PRDA 3PUCA 4P2CG 2XQBH 2ITCA 2F8OA 2WANA 5GS2H 4I18B 4X6BA 5DFTA 2VISB 3Q5TA 5DRWA 5GPRA 5J1TC 3UAJC 1K2DA 4GQ9H 4RZCB 3SJVE 4U3CA 1J1PH 5A2FA 3C8KB 3D18B 3SDDC 4FNLL 4WCYH 3I2CH 1SJEB 1WZ1H 4AT6A 4J4PD 5T1KB 5BV7L 3EO1B 4HFUL 1FVEA 4DGYH 1FAKT 1RHHB 1NMBL 3WHXA 4PYHA 1EFXA 1HSAA 2E6QA 4GRWH 4JFED 4N0YL 5SX4I 2NY2B 3W11D 2J6EL 5JOEA 2NCMA 2WP3T 1T7YA 5J56B 4JPWH 1TZHB 3JWNC 5DI8A 2WK2A 4PRPE 4PY7A 4TSCL 25C8L 1MNUH 1PJ9A 1C08B 4CJ0A 3RWHA 4OFPA 3GK8H 3SQOL 4XMLL 2D7NA 4HKXB 4HLZH 3FHQA 2QSTA 1OTSD 3HZMB 5E1HB 4HK3J 3QAZC 5IB3B 4IMLA 4E41A 5DJXA 4LFHD 3LKNA 2OQJB 4R4NC 4G42B 5EORH 3PWPD 5FGBA 1C12A 4G6JH 3I75B 3BAEH 3ARED 1E4KA 3MJ9H 1OARL 1ZS8B 5MEPB 1I3RA 3ELAT 2GUOA 5FGCE 2J4WH 5E5RB 1G7JB 4NO3B 2C3VA 2XWJB 3X3GL 4QHKI 5EA0L 4FTVE 3INUL 3QEHA 2DBLH 1WTLA 2EDTA 1QSFE 3N1GC 3D0VB 5D2NA 2A9MH 4U6VH 4NM8H 4UV7H 4XXCA 1MJ8L 5DJZA 4KUZL 3LS4H 3QZWB 4ZFZB 4TVSa 4DZBB 1HHIB 2RB8A 3AVEA 2VXQL 2DQUL 1T4KA 3D2UD 5DFWH 4LCWE 4NZTL 2VDPH 1B0GB 1D6VL 1A6ZB 3HE7D 5EO0B 4DCQA 2OSLA 5FA3A 1X5YA 4IRZL 4AG4L 4KTEH 2J7LA 2R23B 2VDQH 4HCRH 4WW2C 3GUTA 4QRQB 5D6CA 4Z9KB 1F6AA 5EB9A 2IPUK 1KFAH 4M1DH 2VZ1A 1IZKA 1N8ZA 4HIEA 3HUJE 1QFHA 5CGMA 1OTUC 4OI9A 5DJYB 2DJUA 3IJHB 1ZHNA 3NIFE 5T1KD 4S1RH 4JE4B 3EJYC 4ZTOL 1KXTB 1X5FA 2OL3A 2QHRH 3QO0A 2XWBA 4XBPB 4JZOB 2AJUH 1ZXQA 3GI8L 1AQKH 3DUSA 4WJ5A 1M7DB 4HUKB 3LH2H 4Z7QF 1FFQA 4MQTB 1V3LA 4TOYH 3AB0B 5DXWA 4NBXB 2VB5A 3PF2A 4WFFD 3HC4H 3QPXL 4YFEA 4W6WB 4PS4L 1A4KB 5DO2D 3BP5A 4UOW1 1RIHH 4X6CA 5JLZA 4GLRI 1QD0A 4PRNB 1PY4A 2WLYA 3BXNB 4PV9B 3SPVA 3DX7B 1C16A 1JHKH 5K93A 2CK0L 1SJVA 3MBEC 4GKZA 1MFAH 3K8MA 3NZ8A 4JM4H 1RZKC 4YHOH 1JHLH 3SGDI 4CMHC 5DGRA 3T4AB 1KJMB 5HYQA 2XZAL 3U6RB 4KDVA 2AEPL 4I3SH 2YPLB 3RTQA 4CRPA 1IRAY 3G6DL 3FT3B 5AWNL 3UJIH 1UC6A 4DGVL 1FL6B 4DOHE 1Q72L 2P8PA 1E27A 4GS7C 5DVNA 1I3UA 5GIRB 3QT2A 1Y18A 2C3GA 1A6VH 2OZ4A 2Y06H 3D5OF 5DZLA 1AR1C 3L7FA 3CMGA 1I7TA 4KROC 1F2QA 5FUZL 4KGJA 4YIQA 2QADD 4Q9QL 3VH8G 1M7XA 5D8JL 1VDGA 1JFQL 1KXQE 1BFOB 4NNYA 3MV7D 2DRUA 3KYMA 4V1DB 2GCYB 4RGOH 3NPSB 1QKZH 4MXQC 1BVLA 4OLEA 3PXJA 3NABH 4K3DL 5BVPL 4QTIH 2FHFA 1OW0C 4ISVA 1Z9LA 3QG7L 4Y5VC 1DFBH 4OB5L 5J12B 1I1AA 4O9HH 1G7HB 4OLWL 3VGBA 3OKEB 3UPRA 1G7LA 5HYSA 4JVWA 1F4WH 4OZGB 2O61A 4HBCH 4OKVA 1A1MA 2A6IA 4U1GB 3O6MH 2VIRB 1QTYT 3TZVC 3O0RH 1BX2A 3NN8B 4NN7B 3BRDA 3TBSB 3BP6A 4BQ9A 1HHJB 4NWUH 2E6JA 4ODUB 4L3CB 4YXHL 3DUHA 4HV8A 2VN4A 1RZ8B 2EDWA 4HSQA 1RVFH 3CU7A 3FQTB 2G2RA 4NQEB 1CG9B 3QNXA 2BXYA 5D1ZA 1NFKA 2HVKB 3WL9A 3U4BH 3VI4F 2EDOA 1N26A 4LPUA 3SDXF 3MLZH 2J8UF 1NGYA 3U46B 1DUYA 1LO0L 3O81A 4NKIL 2R2EA 4CU8A 4OV5A 3F7RA 4WFGD 1RZFH 3RNQA 5LG1A 1NFIA 2Y36H 1QNZL 2YPLD 4JR9H 1YPZF 4NO0A 1T1YB 2NNAB 5GS0D 3MUJA 3WUWG 1P9MC 4JFYB 4EN3D 1WGOA 1EGJL 3RWCB 3VA2C 4PGBB 2FCBA 1PEZA 4PRAA 4N5EC 2W60A 3OAZH 5SX5K 4H25B 3A67H 1E4XH 4D0CA 5JMOC 4JQVC 1FPTL 5BRZA 2ADIB 2BMKB 4S1DD 1U9KA 2E7LA 4EIGB 3U0WL 5CBAA 4F37F 1KJ2H 2KDGA 2CRYA 3IKKA 3OJDB 5ETUA 2DIAA 2GYSA 3OBAA 4B7LA 4N1CA 4V1DD 2JCCA 2R15A 5TPWH 4MDJA 3DRTB 5DZNA 3HKFA 5HHQB 2EIEA 5K9JL 3VFMB 2ICWB 2D31A 2F15A 1QLFB 2MSPA 3F58L 3A6BL 2YHGA 2FLRT 1BECA 5KSAA 4J3WA 4Z7VF 4TNVF 5BMFL 2OL3L 2HVJA 3FOMA 1F00I 1BVKB 4WI2A 1YMME 3GKWH 1D7FA 1V3MA 3IFPA 3R8QA 3W9DA 3HN3A 4ZMAT 5L8KB 2IADB 3VMPA 4N8PA 3VJ6A 5B38B 2ILLA 4K07A 5CEZE 2GJJA 1I9EA 2XV6B 1KCVL 2VLRA 1ZLUK 2GW5A 3U9UB 4U1NA 1Y6NR 3MOQA 3EFDH 4ZO7A 4D9QD 1Q0XH 1KN4L 2A0LC 4I77H 1AI1L 3IU3B 2I24N 4MA1B 2Y5TA 4N90E 5CJXC 4ZUSB 4UTBL 5JOPD 2R9HC 3IDGB 1IILE 1YN7B 3VFUB 4LQFH 3RY5A 2A1WL 1PLGH 2VAAB 5FM5O 1XGYH 1Q9WB 4PJAA 2N1KA 5ESQB 4F33A 1ZA6B 3EDFA 4RAUA 1MEXL 1PZ5B 4NO5A 4P57A 4J12A 4KQ4L 1V8HA 1XGPA 1PAMA 2BDNH 5DUMH 4XWOC 3WFHA 5DD5L 1F97A 1UH3A 4OD3H 1D5MA 1HILB 4FXKB 5TQ0L 4PJCE 1M1SA 1QBLL 1YY8B 1DDHA 2OZ4L 4HIXH 4WO4A 3KNBB 4MSWB 4KK8C 1TDQA 1K5NB 5FGBC 5GRUH 4MA8L 4N5UA 5A2JH 5E2WL 5EFIB 4O2FA 5DVLA 4ZPVB 5EIQA 1E4KC 4X6EA 3UX9B 4WTZA 5IROA 1RZ7H 3MV9B 4R0LA 1NGWA 1SEQL 3FB6B 1G9ML 1RIVH 3CLEH 1IC1A 1D5XA 5DQDL 1KB9J 3UCRA 1DLHA 1QVOA 2W59A 4NCDA 1NGQH 5CLTA 5KZCB 2BSTB 4EJ1C 1F42A 2Q76A 1T20A 4JFZH 1JGDA 3P3YA 4HAGA 4P5KB 4UQ3A 4OT1L 3BYYA 1YUHB 3QUMA 1I85A 2P5WA 3WNKA 4PUBL 1XF3B 3WXVL 5A2KH 2ZNXA 1H3UA 4XC3H 1BFSA 3PP4H 3U1SH 1MHEB 1QA9B 2Y72A 4XP9L 3BQUA 1JMZA 2YUXA 3VRIA 3VI3F 1OP5K 4HIHA 4OLXL 1OY3B 4G8IB 3L3HA 3VG0L 2CIIB 3CZFA 15C8L 3PV6B 4Q6IB 1D5ZA 4LCCA 3BZ4A 3MBXL 3N85H 4KI5D 2I9TB 4M1GH 5KSUB 4HF5H 5FM8A 4CUCA 5IB1B 3SCMA 3LZFH 4EXKA 2YN3A 4S1QL 3TIDA 3MMEB 3KPOB 4NJ9L 5DS8B 3PP3H 2UWEF 3LD8C 4XWGL 2OTPA 4JGJA 3QFDB 3RKPA 1ETZA 4RGMC 3S4SG 3CVIH 3TJHD 4N0FA 1FO0A 4D8PB 5I75B 2R1YA 2QQKH 2HYMA 3EYSL 5E5MB 4M03A 4OJFL 4GKSB 5DJ6A 3WDHA 2F5AL 3WO4B 1ED3A 4UDUA 2C7UA 3NGBC 5AYUH 4QRRA 3IF1A 4U4BA 3MA7B 4KJYB 3F7PC 4HXBL 3JXAA 2W9LA 1G6RA 2GJ6E 4OTXH 1BGXH 1JNJA 2ZCLH 4S1SH 1SYVB 2R56H 2D4DA 5JIHA 3QEGH 5EUOE 1UM6H 1AD9B 5LGHH 2XN9A 3TBTA 4M6OH 5CHNA 4RFOH 4YZFE 3E2HC 3L9RB 4RNRB 5DJ2B 3AFLA 3HTLX 1RUML 1T2QL 4C57C 1NCWL 2VE6B 4KKBC 2Z9TA 1IMHC 1TXKA 4PG9B 4MWFA 4FQCH 5IB5B 5IMMA 3BH8B 3UO1H 1W0WB 3DETC 1CFBA 4GKNB 1KV3A 3VXTA 1KC5H 1CZ8L 3OSKA 1P69B 3HE6C 1FGVH 1G9MC 1LO4L 1X5GA 3SGKC 5GISL 2V17L 3DSFL 1KLFA 3JV6A 2EH8L 4X4YB 5C0BE 4DEPB 1G7QA 4JFXB 4KJQD 4PJ5E 4HG4J 1KYOK 4IHOA 2J8HA 4FQ1H 4U6YA 4FQXA 2G60L 4JREC 3FONA 2B20A 3SGEI 5EPMA 3ZL4L 4NKMA 3QFJB 3F7YA 1I1AC 5KVDL 3LN5A 3GZKA 3BD5A 2H6PB 3MLXH 5D1QD 1M6OA 4RX4D 3CPLB 1NC4A 3FO0L 4LGRB 1NAMH 1NMBH 4HH9B 5D6DA 1MHPH 5EZLB 4ZNEA 2DB8A 4NKDA 5GRWA 2IBBA 4YXLL 2DQIL 3VXNB 4NFDA 4N0YH 5DWUL 1R3JB 1IKNA 1FYTB 2F53A 1J86A 4EOWL 1W72B 3REVB 2VKXA 4ZFGL 3C08H 3OKNB 4U2ZA 4X6DE 5J06A 2YEZB 4TSCH 25C8H 4XVSL 4U49A 1VACB 2FGWH 3P30L 1CK0L 3TYFB 5D1ZC 5C9JB 2EXWC 4OCRH 1RZGA 2AI0L 3GMPA 5FDWA 1U8KB 3I50H 1MH5A 1V05A 3IJSA 4H0GA 4DTGH 1KEML 1WBZB 1ZT1A 4O2CB 4WUUB 2PNDA 5L9DH 3W82A 3FFCE 4L3AA 5FO8B 3PE9A 2RBLA 4YPGA 3X3GH 4WRLA 5EA0H 2D7OA 4YHNA 2PO6D 2X4UB 3HPLA 3MROA 1EHLL 5D7SL 4WFEE 4Y7MA 4NHCH 1EAPB 2BRQA 5CBEB 4IIQC 3UDWA 3I6KB 2J5LB 1IBGL 3QUML 1N7ML 1GSMA 4N68A 2DLIA 3BP7A 3V4PH 1G9NL 4P5TD 2VXQH 3IDIB 2I27N 1VB9A 2OI9C 5C0AE 4NNXB 1F3DJ 2BVPB 3QXAA 4LNRA 5C0CA 1X5JA 5F1NB 4I0PA 4UU9A 4G43A 1OM3H 3BE1L 2V2XA 1NC2D 2VH5L 1WBYA 4NZDA 5FHAH 1M7IA 5JNYB 4YNYA 2IMMA 4XNZC 1IGTA 1HQRA 4U1LB 4YK4B 5TE7L 4Y16B 4NSKA 4CN6A 4LDLB 4FMFA 1FFNB 3HMXH 3QUXB 4HWNA 1S3KL 5JQ6H 4LAJH 3QFJD 2C3WA 3C6LA 4MHHG 1A5FL 3QR2A 1NUFA 4E42B 1FE8L 1MCIA 1HKLH 5BQ7B 1IVLA 3U30B 4TSAL 1S8DA 1EXUA 3TA3B 5KSBE 4F7CA 4FRWA 4A6YH 2B5IC 5HYJE 4A2LA 3MFFB 1FYTD 3GSQB 1A9EA 2VZSA 1MFBL 1U8QB 5DYOB 1X4XA 1FO0L 1T7VA 3EO0A 5ID0B 2IPKA 1SMAA 3CMOH 1JWSA 3IU4L 3OB8A 4M02A 3RDTD 3VFPB 5GSRA 3G6JB 3O11A 1NCAH 2EIDA 5IFHL 3DXAB 4YHIB 3VXOA 5IWLC 1R24A 1JF6A 1GIGH 1G6RL 1KPVB 4L5FL 4UILH 5D71L 3ARFB 3EUUA 3MGOB 4P99A 4H1LB 2XKNB 1IM9A 4LPTA 4WUUD 3RWJB 4OLUL 4YHLL 4Q9BA 2HMIC 1WWCA 4NHUA 1A6PA 1SJHA 2EDXA 3BP4A 5DJAA 4NJAH 4Y5YB 5ANMB 1NLBL 1Z5LB 4CU6A 3FB8B 3IDJA 3L3KA 3Q1SL 5F1IB 1Q72H 4D3CL 3RNKB 5DD0H 5ECJE 4ZDHA 1L0XA 2FYYB 2FR4A 4UMGA 2CXGA 2XWTB 4ZFFA 3OJMB 6FABL 2FJHA 3G5XA 2NY0C 4XZUB 2HJKB 3VH8A 1BP3B 1BAFL 1IAIH 2HWZL 1FSKB 1S7UB 3G5VB 4TUJA 2N4IA 4R0LC 5IOPB 4JLRA 3UTTE 4FFWC 3UTZA 4OFIA 4JO2H 1CE6B 1P7KB 4HMDA 4M61A 1GPOL 3MLTA 2JELH 4POYA 4ZS6C 1ZGLB 1BIIB 3OB0H 4KHXH 3SGJC 3E3QC 3ZO0A 3NMEA 1CCZA 3FT2B 4Y16D 3GSXB 5DRXB 4ZOEA 2R1XB 1FCGA 5C92A 4PTUB 3S35L 5I17A 3BJLA 2P5EA 1RK0A 3D39A 3QG7H 2QHLA 3UYRH 4J3TA 3BUTA 4OB5H 2OM5A 4M1CC 3UBXI 4X6CE 5CINL 2DD8L 2GY5A 3PABA 4FFZL 4G8GE 3BQUC 5GRVL 5AD0A 1CIDA 2E7HA 1EUTA 4ZUVA 3STZA 3KPRB 3GMMA 5TGBB 3ZTNL 3TA3D 3QZWG 5I16B 3RHWK 2NY3C 1U8PA 3IGAA 43C9A 2R1WB 1G7PA 3DIFB 5JA9A 3DVNA 4D0BA 1DE4B 4WW1B 3EAKA 1SY6L 4J3OC 3O45A 1KIPA 4JFDE 5A40E 4U1IB 4LCCC 4HAFA 2EZ0D 3RL1A 4Z0BL 2VXTH 2FO4A 5HI5D 4Q7DA 5FGCB 4X5XB 1T03L 1UM5H 3CFDA 3DXAD 3QXDA 4K9EH 4FTVB 4ZUUB 1BQHA 2B8OT 4GJTB 5BO1L 3SCMC 3RI5K 4C56E 3ME0A 3TT3H 1HKFA 3ARFD 4XX1E 4BFIA 1TCRA 3IDYB 5IKCA 2HG5B 4X80H 2PW1A 4XVJL 1RPQA 3F7VB 3FN3A 5L8JB 2FBJL 4G5ZL 4BZ1L 4XP6H 5CGYC 3RVXC 1XT5A 3VD5A 4RGNC 4OLYL 2EDHA 3TBYB 3UTSA 4OLZL 5JDSA 3MV11 2FX8L 2ZUYA 1S9VA 4IDJH 1Q9OB 4LNVA 4I2XE 1HYSD 4KZDL 1IEAB 2AGJH 3QHFH 4MJIA 4UBDD 3IXAB 1GGIH 1OB1A 1FPTH 4RQQA 3R0MA 2NX5A 3I02A 1C5DA 3C8DA 4FP8H 5HY9A 2FX9H 4QRPA 1I1FA 1TTGA 1U8MA 4U1SB 3OTTA 4YDJA 3RA7H 3SJVD 4JRYB 4OCYL 5F70A 2PXYB 3BIAX 2X6MA 4DAGH 1A7RH 5C0NC 2QQNH 3BEWA 4KU1A 3VD9A 4EEEA 3ZDZE 1FFOA 1AY1L 5K9JH 1CBVL 4OKDA 5B3NA 3P2TA 4KRPC 2BERA 3T0VA 3FFDA 2YA1A 3A6BH 1QACA 1TCMA 3CDFA 2AJ3A 1LQSR 1MFEH 3ZDYF 1S9XB 5CILH 2NTFB 2VDNL 4ELKB 3UC0L 3BHBB 4PRPD 4U6HB 1ZGLM 1E4XI 3OWEA 3WUZA 2PYEE 1S7TA 2OBGA 5HDBF 3GMNA 2WINB 4P9ML 5IMKA 2VZOA 3N0PB 3E1F1 1NBZA 3JWDH 4IMKA 1FZJA 1VSCA 1DTUA 4KI5F 5SWZA 4PLNC 1N5AA 4HGMA 1XGUB 4LRIA 4O02L 2NZIA 1J12A 2ZUXA 4MAUL 1AI1H 2E6PA 5HI4D 5FUCC 4JO4H 3RUGF 4XP1L 5JR1H 1SVCP 4HLJA 1JWUB 1IQWH 3QDJA 4FTVD 2CKBB 3U0TB 3TBVA 2EO1A 1DQJA 3KWWB 4QXUL 1QSFD 4F8QA 5KW9H 1IKNC 3U9PH 5T3ZH 1NL0L 4MZ2A 5JO5A 2ZUVA 4ZOBA 4JDTL 4OFVA 4R4FH 2LAAA 4L3EA 2DM2A 5E9DA 5IBUG 1KLUB 3X3FL 4NRXA 4MS8D 4X4ME 1DBML 3STBA 1HI6A 2X4SA 4LCWD 4GRWE 1YY9D 4TTDD 5ISZD 1LHZA 1A1NB 4XPAL 1S7QA 5C86A 3M8OL 4OSUH 2X4TB 2MQ3A 2Y7QB 4PP1C 3O3BB 3BPCB 4WGVB 4C59B 2AEIT 1FNEA 1IFHL 1BZQK 3MRRB 4JKMA 5A16B 3QUYC 5C07A 1PY9A 3W9EB 4HJGB 1QEWB 3CGTA 1RUPH 4R4BB 1ONQB 5GJTL 1ZEAH 1KB5B 2G5BA 4MJ6A 1F6FB 2EH7H 1BBJB 1MWAA 2L7JA 2PXYD 4OZ4A 5CEYA 1AGFA 3BN3B 3VFGL 2FX7H 5J13C 3UDWC 4WU5B 4GQPH 4OT1H 1JF1A 3CX5J 4YR6B 3SDXA 3V7AE 4N8VG 1QUNA 4X4XA 1CD1B 5L2JA 3LRHA 5DLMH 2J8UA 5EZJB 4NYLB 1UZ8B 5A43C 4KKCC 1RFDL 3PWJA 3STLA 1DBAH 2VXUL 1CD9B 3E8UL 4M6NL 4WHYH 4MCYB 1F2XK 1ZLSL 3MLUH 3D3VE 5JOFA 3WN5C 3U0PA 5EOCJ 5KTEH 3N1PC 5EU4B 2FHCA 4PJAE 3PXHA 1IT9H 1QFWI 1HDMA 3SE8H 4DJMA 2IANA 1AD0A 1WIUA 2A9NL 1JI2A 4DVBA 1A7OH 1NLDL 4TPRL 3KPNB 4JDVA 4AMKH 1KOAA 3TVMC 1J1OL 4N0CD 4NT6B 4O51B 3IAGC 2UVFA 4JN2B 3S4SA 5HGAA 3JWOH 4EI5A 3QNYA 3LDBC 1AO7E 1JGLL 3I3DA 5E7FA 4JJ5A 2OTWB 1PQZA 5FF6A 5E6YA 3RWDA 4I13B 5D70H 4I9WE 1LE5B 4JQIH 5E4IA 5J9PA 3SDDB 1HZHH 3N9GH 4HS3B 3EFFA 5EU3B 2CDFB 2X89A 4Z7WE 4M7LL 5H2BA 5J6GA 5ENWB 4LEOA 4OLVL 1P84K 4M43L 3IVKA 4OQ1A 1A1OB 3MRMB 1UB5B 3MJ7A 4NQVA 2VC2L 3FRUA 4UV4H 4R2GC 5I8KH 4Q0XH 3O6KL 3CVHH 3HFMH 2E7CA 2PTTA 1OTTC 2EYSB 1CICC 4FG6D 3DLQR 2FD6L 3VXSE 1RUMH 1PBYA 1U2CA 3EHBD 3T8XB 4ETQA 3BISA 3OGCB 5DQ9A 2HLFC 4NNPH 3GMLA 3QUKA 3Q6FB 1JP5A 4ZXBC 4XPFL 2ED8A 3LHPH 2CSPA 3LKQA 3V4VH 3VXQA 5FO9A 1LDPL 5EC1A 2AJSL 2YPVL 1RUAL 2RCSH 4LLQB 3SY0B 1A3LL 4Q2ZA 4LGPB 4XCYB 2AABH 5DEFB 3LKRA 5JPNB 1DSFL 5BS0E 1F4YL 4HIIA 4ODWA 4HK0B 5HHOA 3PGFL 4YUEL 5IHZA 2VDOL 2XY1A 1XF2A 3FQWB 4FABL 3F12A 3PDGA 5D7JA 1VEPA 4OBRA 4XCFH 3TO4A 2DQHH 1QFOA 2BVOB 1F3DH 3ZTJH 4F2MB 1IEBB 1WCQA 4GAJL 4RGNE 3MV8A 2NY7H 1FIGL 4OFDA 3QIWB 4BH7A 1JYNA 2OXHA 3X14A 3ULVH 4HX1A 5DHVA 2I60H 4YXLH 4JZJB 2FB4L 2H8PA 4AH2A 4EOWH 1UXSA 1UKSA 2UZIH 1U95B 4PJCB 5CFHA 3K74B 1BWWA 4WW2B 4YFLF 4M7ZC 4XVSH 2MHAA 2G5RA 4BK5A 3UAJD 1CK0H 4NRZB 4XCCL 1J05B 2DS4A 3SDDD 1TVHB 5I73B 2YUZA 1NGXA 1RAMA 1XZ0A 2QR0A 2EIZA 3ARUA 2EDRA 3V6FB 5DJ8B 5T1MA 3OXRA 1LDSA 5FV2A 4Z8FL 3LVEA 4XHJC 3KPMB 5ADOH 3LQAL 5AZEL 5F8RC 1YEEH 4EUPA 3MRBA 1MWAL 4HXAL 1LO5B 3FQXB 3DVGA 4HUXA 1D5BA 4L8CA 4ODXA 1KT2B 1T0NA 2ED7A 4F7PA 2ICEB 3RX7A 2BNQB 3QUMH 5IVZB 1ZHKB 5FA4A 1T1XA 3RWFA 1YMMD 3TBWA 1G9NH 5C08E 3RWGA 3FO1A 1A14H 3SKMA 3OKLA 4MYWB 2Q20A 5I74B 5B8CA 3MBEB 1EEUA 4R4ND 4PJDA 1LO3L 4PREA 4QT5B 1OD7A 4AEHH 5CEZD 2FATH 4PLJC 4YQXH 4NGHH 1E4WH 3S36H 4CMHB 3VWJC 1MIEH 1ES0A 3OZ9L 1FLRH 3P0YL 4ZFOA 5FUCE 1CWVA 1VA9A 2BNRD 3DYPA 1J9CT 3C6SA 3T0EB 3AREA 5ABDE 1FORL 4LLMA 2Q8BH 3VMNA 4N90D 2X1PA 4YDIL 2FLBT 4Z76A 3OHXB 1EEYB 1S3KH 1LK3L 2VXVH 4D94A 3TNMA 4M5YH 1U8IB 4RCAA 1FE8H 4XNMA 4KROB 3S36X 5H94A 3HI6L 4MGXA 3EYOA 1QLRA 2ZNWA 2BVQA 3HRZB 4GW4B 5BZDB 3UJTH 1CLYH 5LGJB 4ODTL 9CGTA 1LEGA 2R39A 3IJYA 4IMKC 3ULSB 3G6JF 3U7YL 3MSPA 5J1AA 4OV6F 4LDEB 2OJEA 5I1DB 4X7CC 5FIEA 3K8LA 4GG8A 1MY7A 2CJUH 5T5NF 2ED9A 4I18A 5EUOB 4Y5VB 5IFHH 2VISA 1OTUD 4PR5B 2WV3A 2X44D 1JNNL 4RZCA 3QDGE 3C8KA 3DV4B 3D18A 3EJYD 3VFRB 4HW6A 4K2UL 1SJEA 1T89A 2C4FT 1W2KT 4X8JB 3ZYJA 5KVFH 1EEZB 3OAUH 4FQHB 5T1KA 3EO1A 1B3JA 4YXKL 4WWKB 3SO5A 3EDJA 1RHHA 1HXYB 4DKEH 5EZIL 3ZKXC 1CR9L 2B7DT 1G7IB 4YEEA 3ZYIA 1TZHA 3VFWB 1NAKL 1C08A 3QH3B 4ZPTB 1NSNH 2ZZUT 3G9AB 3V7MA 1WC7B 4HKXA 4LHQB 5C0BB 3WIIL 3MBED 3V4UH 4PJ5B 3HZMA 3HR6A 3UMTA 5IB3A 2IGFL 2OQJA 2GSIB 4G42A 2NPLX 1OP3H 1OAZH 2GT9B 1CXLA 3I75A 3BKJH 1ZS8A 5MEPA 2WUBL 1G7JA 3O4OC 4NO3A 2XWJA 1MELA 1GRWA 2VZTA 5D1XB 5I1CL 1UZ6E 4HGWB 5IW1B 2YD1A 5MENA 2HN7A 3D0VA 3BI9X 5GS1B 5TQ2L 4XNXH 1AR1D 2BFVL 4MB5A 4X6DB 4KROD 3QZWA 4ZFZA 4DZBA 3TO2B 4YE4H 4NDMB 1HHIA 2H3NB 4K8RL 3ZTNH 3EJZC 1S9WB 1B0GA 3ROOB 2ZSWB 1FP5A 1IAII 5DMYA 1A6ZA 4YDLC 4J3SA 5EO0A 3HB3C 4MXQD 2XACC 5T3XL 1MRFL 3FO9B 4KRMB 1CDIA 3MRFB 1RIUL 2GJ6D 1CFTB 5F96H 2R23A 3SE3A 1PKQE 3RX8A 5FCUH 1SHMA 2VQUA 3WO3B 2KL6A 3FFCB 3DGGB 4QRQA 2R4RH 3T09A 4CNIA 3B9VA 5E4EC 4MVBC 1OAUL 3GIZH 2XQYG 4J1UB 4R3SB 1IGJB 4K3EL 5DJYA 3K80A 3TZVD 4XVJH 4MAYB 3H3PH 3IJHA 2FBJH 1VFMA 3EGSA 4XBPA 2M2DA 4JZOA 5IJKC 4OLYH 5C0AB 2FGZA 4OLZH 4TQEH 1M7DA 1N6QH 4OM1L 1GGCH 4PGZA 5DT1H 4GSDH 2ERJB 3RQ3A 5CIPH 1KPRB 2JIXD 1REIA 1OSPL 1AE6H 1A4KA 5F88B 3HUJF 4HQQL 4P48A 5KANG 2P5EE 3D39E 4LHUB 5C0BD 3WXWH 5DMKB 3BDBA 4PV9A 4PJ5D 3SDCB 1NBQA 3DX7A 3RVUC 5I19L 4ZFOL 4U1KB 4K94L 3NIFF 3BRFA 2K7PA 3L3GB 2LU7A 3AS0A 3CK0L 3Q5OA 1A7QL 4GRMB 3QCTL 4YWGL 3GHBH 3MXVL 3C9NB 1KJMA 3T4AA 3U6RA 2AXGB 4DGIL 1FNLA 2YPLA 1J0IA 2DQTH 4KJWC 2VUYA 1A9BB 2XI9A 5MERB 3FT3A 5D1XD 5TDOB 5KSBB 4MQXC 1XH3B 1F45A 1FL6A 4LSUL 5HYJB 5CAYB 4XPTH 1CFSB 4HKJB 5DUPL 1SEBA 5GIRA 5LQBL 5F1OB 2DI9A 1GL4B 3VXMD 1JNLL 3FMGL 1U58B 4P9MH 4DVRL 2ZJSL 1BM3L 4BK4A 4M62H 1U6AH 5D7JC 3TO4C 4XB8A 1BFOA 3AS1A 4W81A 3QIBC 1MRCH 1Z9MA 5CJQH 4V1DA 2GCYA 4M48L 2HLAB 1YYLH 4LVOB 2Y23A 2R0KH 1ITBB 3UTSE 3FFCD 3GNML 2WWMC 4P3CL 3GJEB 1F90L 2BVYA 5EO1B 1F58H 2WAHA 2AV1B 3MRJB 3GSNH 2Z8RA 4PGJA 4QHUA 4MJIE 4WFED 3L5WB 5D96C 4XP4L 5EOCH 2QSQA 4QXGH 1WEJL 4OZIF 2GAZB 1G7HA 4KHTL 5I18H 4BH8B 2NX5E 3OKEA 4YHKH 3HR5B 3KYKH 4OZGA 4C54A 3PL6C 5F97E 3W0WB 2VIRA 2O5ZH 1KTLB 4JPVL 2CUIA 5C0AD 3SKNB 3EOAB 3S37L 4CJ1A 1GYAA 3NN8A 4QEGA 3SO3C 3UTTB 3TBSA 5T1DL 1S7XB 4Z95H 5FXCH 3R8BB 1F13A 1HHJA 5TFSH 4ODUA 4L3CA 4N8CL 2R9HD 1RZ8A 1XIWB 4M7KH 5CP3A 3FQTA 5I1JH 5IFAL 4NQEA 1CG9A 2LABA 4NPYB 1EFXD 4LHUD 1P4LA 2HVKA 2D0FA 2J88L 1MCOL 4OZFB 5HVGB 4U6XB 3NCMA 3U46A 1AXIB 1HN1A 2P43B 5DMIL 4JN1L 2LQRA 4XWOD 1PZUB 4G8GB 1GGYA 4CU7A 1RJZB 2A77H 1T1YA 1T6VN 2NNAA 2B1AH 4LVHC 3LAFA 1RULL 3AM8C 5FYLH 7FABH 3LEYH 3G08B 3NGBB 4JFYA 3HNVH 4MHHI 5HYJD 3RWCA 4PGBA 4KK8D 3UXFA 4JO1L 1QBBA 4H25A 1ZLVH 4LLDB 4JFDB 2ZUQC 4JGMA 4H8WL 1MQKH 2EEBA 2ADIA 2BMKA 3EDKA 1NDMB 2ID5A 3E2HB 3RJQB 4C56B 1IAKB 1MCKA 1JCKA 3OJDA 5E9DE 1LO2L 1OD9A 2V5TA 4JB9H 3MTRA 3PHQB 2V5MA 2BRRL 2K7QA 2VYRE 4YHYB 3DRTA 4M7JL 2YUVA 5HHQA 2P8LB 3BVNB 2NR6C 4P23C 5FGSA 3VFMA 2ICWA 2R8SL 2X10A 5HJ3B 5CSBA 1JRHH 5FUOL 1CF8L 1QLFA 3HE6B 1GOFA 1CFVL 4LEXH 2YK1L 1FAIL 4I2XB 5HDQH 4F7EB 1BVKA 1KSRA 1UYWH 1Z9OA 5JMRA 3QJHB 4L4VE 3EYQD 1IGFL 4R90L 3KAAA 2IPTL 2IFFL 4U1HB 2IADA 2WQ8A 4JREB 5B38A 3WD5L 1RUQL 3OL2A 5E0QA 5A3IC 1I1AB 5DVMA 5E08L 1J0HA 3U9UA 3BKYH 2SEBB 4NZRL 3ZYZA 4OGXH 3WNNA 4KK6C 1FJ1B 1SYSB 1MJ7L 1AIFB 1JPFB 1T89C 3PNWB 3IU3A 1N5YH 4H5SB 3ZE0E 3VW3L 4ZUSA 1YN7A 4K55A 3VFUA 2CGRL 1FFPB 2FD6H 1O0VA 4HDIB 2VAAA 4XMKL 2NY2C 4ORZC 5EG6C 4FFVC 1Q9WA 4LASH 5ESQA 1ZA6A 4G8GD 5D1ZB 5GS0L 3VGGA 5C2BL 1PZ5A 1V7ML 2AJZB 5B39G 2CIKB 5HHME 4NN6C 1MJUL 2PYEB 1YEHL 4CVUA 1HILA 4FXKA 4GAFB 1YY8A 3FZUC 3BUYB 3RNQB 1ORQB 3KNBA 4JFDD 4MSWA 1K5NA 4Q9RL 3G04B 2COQA 4QO1A 5EFIA 4ZPVA 2GTZB 4FZEH 3UZQA 4P2QE 4JPKH 4KMQA 3MV9A 3S96B 1KELH 2WIMA 3F62A 3LEVL 1UA6H 3FB6A 4IIQB 4WUKL 4F58H 5F89B 4C56D 1WQVT 2DQDL 4KKBD 2BSTA 1KEGL 5DJ0B 2OI9B 4P5KA 2W1NA 1FBIL 1UKTA 4RISL 1Z9SA 3DETD 1YUHA 4ODVL 4PJFB 4PJCF 4WW2F 3D48R 3T4YB 35C8L 1K3IA 1V3JA 1XF3A 3HE6D 3MOBH 4PV8B 4GRWB 1G6VK 5EH1A 3L5HA 3V52H 1DBKL 3P4OB 3W81A 1EPFA 4FQ2H 1MHEA 1QA9A 5GZNC 2CRMA 1I9JL 4S10A 4PYGA 5C09E 3O2VH 3L95B 1X5KA 2Y07L 1JV5B 1HSBB 4G8IA 3EYUL 3P9LB 4G8EB 2CIIA 1I1AD 4KDTC 1QPXA 2QBWA 1ODAA 4UT7H 2HVJB 1Y0LB 3PV6A 4Q6IA 2EDLA 4V2BA 2EXYC 2XRAH 4U0QB 2DQEH 1QBAA 4JZNA 1F4XH 1QG3A 2DQFB 4DN4H 1K8IB 2B5IB 4RX4A 2WLZA 2D4FA 2I9TA 3ZZ1A 2AK1L 5KSUA 1IGYB 5IB1A 3MMEA 4ZUWB 3KPOA 1BEYL 2VTFA 1AHWB 5DS8A 1UJ3C 1KCUL 5GGUB 3RIFF 3V6ZB 5D7LE 3AB0C 4JFQB 3ES6B 3QFDA 3TEUA 2ZCHH 5D1ZD 2EXWD 2XXCB 5GGVY 4DFHA 4PJIA 4D8PA 3UJJH 2PYED 2OR9H 4CKVX 3H8NA 3D3VB 5GGVH 2VDKL 1FN4B 3ULVC 2ITDB 1CL7L 5E5MA 1FNFA 4GKSA 2CD0A 1UJTA 1IC4H 1EERB 4LSSL 3OZ9H 3MV8E 4UZGA 4M4PA 1KF9B 1NBVL 3MA7A 2M26A 4IM8A 4KJYA 4NM4H 3WFEH 4WY7H 1RJCA 4MD5B 4NBZB 1SYVA 4LVNC 4LAQH 1OAXL 1BIHA 3BGMB 3L3DA 1AD9A 1PW3A 5GS0C 1QFPA 3L9RA 4RNRA 5DJ2A 1H8SA 3TCLB 1AJ7L 1AO7B 4X6EB 2X1QA 5LCVH 2VE6A 3HI6H 4R0LB 4OGAC 4YX2L 3TF7C 3EOBB 4PG9A 5IB5A 2DQCH 3BH8A 1W0WA 3NTCL 4YBHA 4GKNA 3HNSL 1TJHL 3C2AL 5DUBB 4Z7WB 4KWUA 3C87A 5EUOF 5I30H 3NPSC 1JZ8A 4CVXB 1JPGB 4YZFF 3W2DH 2IAMC 1MCDA 3OPZH 4JFXA 1YZZA 1JNNH 1GH7A 5HHVH 4MNQE 1B2WH 3QFJA 2L4OA 1VKXB 1LGVA 3VXSB 4K2UH 5J12C 3H7BB 3N1MC 2R69H 3O4LE 5ID1B 3B83A 2P42B 4LGSB 4P2RB 4PJDE 3CPLA 1TNMA 5E8DH 3HC3H 4HH9A 5EZLA 4JDZB 3UBXB 3CFBB 3VXNA 5T3ZE 3BSZH 3TWCH 1R3JA 1FYTA 1W72A 3WFBH 4Z77B 4P3DB 1PDKA 3OKNA 3CAFA 5LWYL 5BS0B 1PKOA 2YEZA 1VENA 3KJ6L 1QHPA 1SBSH 1VACA 4NQXB 3TYFA 2BSRB 5C9JA 1DZBA 4LIQL 4GMTH 4RSVA 3LV3B 3L1OL 2IH3B 4G7VL 2ICWJ 2HMID 1U8KA 1BFTA 1YEGL 1WBZA 4O2CA 4HIJB 3RI5F 3MOAL 1X5LA 4WUUA 1IGML 4RGNB 3D9AL 1ITCA 3HNTL 3NA9H 5IVOA 5FO8A 3M07A 4XTRC 1QYGL 2BC4B 1TVDA 1H9VA 2AERT 2X4UA 4X6DF 3WKMH 1IZJA 2W38A 1ADQA 3DSNA 1EAPA 5CBEA 2NY0D 4F37K 3I6KA 1AO7D 1PG7H 4G6KL 5C7XL 5DHVH 1G0YR 5ALBH 4R9HA 5EU5B 3TLRA 4FFWD 2HFFB 1ZANL 3IDIA 4EXPX 4JHAL 4I9WD 4NNXA 4Q74A 2VUOA 4YDKH 3PGDB 3T0XA 3FN0L 1V7NL 4ZS6D 1YEJL 5F1NA 4AZ8A 3H2WA 4M9PA 1PD6A 1OGTB 3EJJX 4U1MB 1QP1A 4KRPB 2F54E 1U8LB 2P5WD 5HHXL 5IQ7L 1VFOA 4KJPC 5JNYA 2YPKB 1PG7X 3KLDA 4U1LA 3WCYA 4Y16A 1A7NL 2VR5A 4ZAKC 3RAJH 4M1CD 4XP5H 1U8OB 1RZIB 1FFNA 3QUXA 3VXSD 3DECA 4EUPH 2VAJA 2VLJE 2E27L 2ZPKL 4E42A 3RIAK 4JG0L 3BYTA 5BQ7A 4ZD3L 3DURB 5C08B 2NY3D 3NAAL 3TA3A 4OF6A 1OAKH 3WIHH 3MFFA 4XT1C 3MR9B 5JTWA 3GSQA 4IOIB 2APVA 1C5BH 4TUOB 1U8QA 3Q0HA 5DYOA 3O6LH 5DR5H 5BS0D 5ID0A 2HKFH 4R7DB 1T04B 5DMGC 3QQ9C 4JVPA 1MCJA 4OBSA 3SCMD 3VFPA 3G6JA 2MNUA 4NN5B 2YMXL 4NQSB 1KJ2B 5MENE 5HGHB 3DXAA 4YHIA 3SKJL 1KPVA 2M8XA 3CFCL 4H88L 4KVNL 1MLCB 3MGOA 5CGYD 5EOQL 5KSBF 4JFFB 3RVXD 4U1JB 2XKNA 3RWJA 3RJDA 4RGND 3SOBH 4DGIH 5AUMB 1A7BA 4Y5YA 3DJ9A 4I1NB 4TSBL 4JKPH 5ANMA 1Z5LA 1C5CL 3FB8A 5KAQF 5F1IA 3VXPB 3IFLL 5SV3A 3RNKA 1JZ3A 4Z18A 4W4OC 4RMWA 3EYFB 3M17B 5CJOH 2FYYA 1WLHA 3FN9A 3I84A 3KHQA 2ZOLB 1NCCL 1JNLH 2XWTA 3B3IA 3QUYB 4HUMB 5F9DC 4UB0H 1ZLWH 4XZUA 2HJKA 2WWKO 2KZ1B 3HPLB 1S7UA 3G5VA 3EDEA 5D93C 5IOPA 3E0GA 5C0ND 4XI5C 5L0QC 2W9EL 2XOTA 2JE8A 1CE6A 1P7KA 4PJBE 4AL8H 3QDGB 5KVEH 5GGRB 4KRPD 1WT5C 1ZGLA 1BIIA 5TF1L 1Q1JL 1BD2E 4FFYL 1AP2B 2DYPB 3FT2A 3GSXA 5BXFB 5DRXA 1A7PL 3FL7A 2R1XA 4PTUA 5MI0B 3TFKC 3CSBA 4EDXB 3K0WA 5FYKH 5A2IH 4LSVH 4K7PY 4GT7A 1JTTA 4LK4A 1DQLH 2QSCL 4K7PH 3WN5B 5C08D 1L0QA 3ULVE 5BW7C 3GI9L 3KPRA 4JPVH 5TGBA 1KJ3L 5C0RH 3HMWH 1W72L 2FECI 5I16A 3RFZC 2R1WA 3DIFA 1RZJC 1JZ7A 3JV5A 4WDIB 5HYEA 1DE4A 4DWHA 4WW1A 4HWZB 2H1PH 2A6DB 4U1IA 5E8OB 3TVMB 1S7RB 4CL7A 2LTQC 5B4MC 2AJYL 1FGNL 1QOKA 1UACH 1M05B 2O26U 3SDYL 4X6CF 4X5XA 3O2WH 2J88H 5HGBB