5E8EB

Crystal structure of thrombin bound to an exosite 1-specific iga fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
229
structure length
229
Chain Sequence
b'EVQLIQSGSAVKKPGASVRVSCKVSGYTLTEAAIHWVRQAPGKGLEWMGGLDPQDGETVYAQQFKGRVTMTEDRSTDTAYMEVNNLRSEDTATYYCTTGDFSEFEPFSMDYFHFWGQGTVVTVASSTPVSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGA FAB LIGHT CHAIN
publication title Discovery and characterization of an antibody directed against exosite I of thrombin.
pubmed doi rcsb
molecule tags Immune system/hydrolase
total genus 48
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8eB02
1P69B 3HPJB 3BPNB 1SEQH 4PJ9C 1IGTB 1ORSB 2ENSA 4LSPH 3PDGA 5JQ6H 1PLGH 4NZRL 1TZIB 3W5NA 3RDTB 2Z91B 1G7MA 4OZHA 1KB5B 4KY1L 1T7XA 2VE6B 2A2QT 3X3GL 1JNHA 2P24A 3WKNA 1ETZA 2NXYC 1T1ZB 3EOBA 3TWCL 5KSBA 3C6SA 5FUCC 3GUTA 2NY4C 3WL9A 3C8KB 5JW4M 1DQTA 2YR3A 3BPLC 2NY7L 1OQXA 2BNRD 4XC1L 2C7UB 2AJ3A 1CT8A 3IU3B 4XPGH 3NIGF 1CVRA 4LCIL 4UU9A 1ODAA 2YWZA 2Z4QA 1RUQL 3L3HB 3BJ91 3KPMB 1G9NC 3TJHD 4C56D 3MRKA 5IWLC 3QUXD 3OZ9H 3WMSA 4LOUC 1TPXC 12E8H 3TBVB 2PW1A 3MRCB 3C09C 5C0BA 3HR5B 2EDNA 4WUUD 2JELH 5DJAA 2CGRL 4FXKA 5GJSL 3BPOB 4KK8C 4Z78A 1A9BB 4IMLA 1OP5K 3KPRD 1FFNA 5BW7C 3QULA 5CMAA 1DDHB 3CFDA 2F5AH 4X4YA 4ZO6A 5CBEB 4NZRH 5I1JL 4WTXA 4KV5F 4KY1H 5JPMA 5GIRB 3X3GH 2Q76B 3WXWH 1DEDA 3UJTL 4CBPA 1KLFA 3EAKA 2I07B 3I02B 5DFVD 3TWCH 5FYJE 3VH8G 4NT6A 3D39E 5DD6A 1WFUA 1HHKB 2EDYA 3EZJB 1QPPA 2F58L 1NGYB 1FL6A 5ICYA 3MBEB 2NY7H 4GBXB 3GMQB 3PHOA 1LMKA 3QUML 3JUZA 5C07D 2PR4H 5F9JB 1CD1B 4LCIH 4O2FB 4P4KA 2PXYD 5I1IL 1DLFL 3GJFH 4MAYA 5HYEA 1NCAL 1RUQH 5E95B 1RJYB 4EUPG 1EO5A 4ZD3L 3OWEA 1EEQA 1GGYA 4X6CF 5ISZE 3MOAL 3IJYA 4KKLD 4CUCA 4KJYA 5JLZB 1D5BA 4W6WB 2X05A 1MCDA 2DBLL 4Z7OE 2HKFL 4GKSA 4XGZB 4P46A 3N1PC 5INDB 3RHWF 2CGRH 4GLRH 4L8SB 5GJSH 5ESQA 4L8DA 2GUOB 5EOTB 5FYKL 1FNSL 3FO9B 2X4RA 3O3BA 1VFBA 1CD9B 3PWLA 2A9NH 3NIFE 3MA7B 5JDSB 1RZJL 3T0BA 2GT9B 3ROLB 1UWGH 4PJ7F 4X7SH 5HHNB 1Z5LB 3HLAA 4GSDL 4G43B 1E27B 3IVKA 4L29A 3UO1L 2YSSB 3VWKD 4PLNC 2FB4H 3R06A 1NGWB 3BP4A 2KQNA 4H1LA 3UJTH 4YX2L 1S5HA 2DI7A 4NUGL 4I0PA 1AXSB 4Z7WB 4JRYE 5DSCA 4TUJA 4KMQA 5LBSH 2VLKE 4NN6B 4CVZA 5HHQB 1J0HA 2ATKB 1UKTA 4W70A 5TDNA 1T5WA 1T04B 5CD5D 4D0DA 2F58H 1RHHB 4X7EC 2FO4A 3QUMH 1JZ4A 5JTWA 1IQDA 5EBMA 5H37G 2R1XB 4O4YL 5I1IH 1U8HA 1DLFH 1FAIL 1NCAH 1BVZA 4P2OA 4M93B 3GDBA 3U7AA 1EA9C 4P99A 4WFFE 4ZD3H 3TESA 3K3QA 3E8UL 3MOAH 5GS1A 2VXVL 2DBLH 5C2UB 1SJEB 2HKFH 3V8CA 4OLZL 2MMXA 3BP6A 4WRLA 2W0LA 3G04B 4FQXA 1DTUA 4FQ1L 5FYKH 5FDYA 2J12B 1FNSH 4LL9A 4LVHC 5F89A 2YC1B 1N59B 4JQVC 5FEBA 2GHWB 5JOFB 1RZJH 1CDBA 1KGCE 1P5UA 4JFFD 4FFVD 1AP2B 1HQRB 1AGBA 4G6KH 4GSDH 1R24B 3T0ED 4XP1L 1CE6B 3OKOB 3LVEA 4RNRB 4I48A 3ZKQD 5D1XD 3O81A 1JNNL 3GMLA 5EZOL 2J5LC 3LZFL 5SX5K 5C09A 4NUGH 2VLRD 3I6GA 2EDRA 5GGTA 4YX2H 4PP2A 1IZJA 4XP4L 1KOAA 5D93C 5HJ3B 5SWQB 4EZMA 5JXEC 4EVNA 5LKNA 5KZCB 5EU4A 1FPTL 1EFXB 1IKFH 4NUJA 4EI5D 2BNUA 1IGCL 4JO4L 3MLPA 1FBIL 4ZOBA 3VXME 3HMWL 4GS7B 2WIIA 5F7YC 2YUXA 5SX4I 2R4SL 2X2YA 5I1AA 2OK0L 4AH2B 4O4YH 2H3NA 4P57B 4X4XB 3ZT6A 1ITCA 2P5EB 2IBZX 4U6XA 4WTZG 3GBLA 1IT9L 2MHAA 5BRZA 1QSEE 4H26B 5F9WB 3WN5C 2VXVH 4O2CA 1NFIB 3VFRA 5MERA 3TBTA 1ITBB 1N0XH 4FQ1H 1JZ6A 5KSAB 3ETBF 2NY6D 3QG6B 1ZANL 4FQHA 1T83A 3HE7D 1KIRB 3FO0L 1KIUA 5I1LA 2I5YL 3QHZL 2ATPA 1A6UL 1A1NA 2ZG2A 2KUTA 4N5ED 1T0NA 5FF6A 5E8NB 3IGAB 2GSGB 2V6HA 1RAMA 3KXFA 3SDAD 1G9NL 1KPUA 4YC2B 1P2CA 3NAAL 2I9TA 3SKMA 4M7JL 4Y1AD 5BS0A 1KTDB 3MUY1 1BD2B 4XP4H 5L2JA 4P4RB 4Y5YA 3Q0HA 3F7QA 4U3HA 5ICXA 1KSRA 2KZ1B 3KPQA 4FFZL 1IGCH 4JO4H 1FBIH 3TCLA 2MKWA 3HMWH 3IXAA 4NKOB 4CVUA 2R4SH 4WGVB 5DRNB 3ARVA 3B9KB 2NNAA 4RAVB 4C59B 4OM1H 3T2QA 2QKIA 4P5KB 3PWUA 4LVNB 5CAYB 4HS8L 1IT9H 3DUUA 5HD8D 3BZDA 5IMLA 3S7GA 1D5MB 3ZDYF 3D0LA 1ZHBB 4LLMA 4XCEA 3L6FA 5H35B 2G9HB 4GAYB 2OM5A 2RFXB 1ZANH 1C12B 4KUZL 4QTIL 5T1KA 3AVEA 3FO0H 5FGSA 3HPJA 2I5YH 1ORSA 3V4UL 1XGUB 4NZTL 4HKXB 3RGVD 1TZIA 5F7EL 3RDTA 2HFFA 1BIIB 1TNMA 3DX7B 5GS2H 3QIBD 1KB5A 4U1HB 2VE6A 1G9NH 1T66D 3MX0A 3NAAH 4M7JH 1HHGA 4HIIB 1A8JH 1RUML 3ZDXF 1WBZB 2ARJQ 4Y4FD 1LK2A 1NEZG 4D9QE 4FFZH 3CFKA 3UTSE 3KYOB 4UBDC 1HYRC 4OD1L 4JJ5B 1JTTA 1KULA 1NBYB 2C3VB 2UZXB 4KC3B 3L3HA 2DKMA 1H0DB 3KPMA 3MBXL 4HS8H 1UH4A 3TVMC 4S2SB 1REIA 1U2HA 4ZUWB 1MFAL 5I74C 3RWHA 3TBVA 2HA1A 1U95B 3MRCA 4PGCB 5FYJL 4J3XA 1JGUL 3HR5A 3VU2A 2J7LA 5HHOD 1JNLL 4GOSA 2QL1A 2HTKC 2APWA 3HI5L 2E9BA 2XFXB 5GZNC 1EH9A 3D9AH 1A9BA 4QTIH 2QR0A 1DDHA 3D2UD 1XAUA 3UTZB 4QRRE 3V4UH 3B9DA 5H94A 4XCYB 4NZTH 4NBYB 5F7EH 1PD6A 5SWSA 4UZGA 2Q76A 1ZLUK 1S78D 1G6VK 1BX2B 1UYWH 3CIQA 2Q8AL 2I07A 1G7QB 2BJML 1RUMH 4LLWB 2BNQE 4XMKL 2DIJA 2QHRL 2I25N 3O6FC 3B43A 4PS4H 4WFED 4CL7A 1A7OL 1HHKA 4HLZG 4NHCL 3MV8D 4OSUL 4UV4L 4ODSL 3LRGA 4M43L 1NGYA 3MBEA 4GBXA 3GMQA 5E08L 3DX6B 4ODHL 4X6FA 3EUUA 5F9JA 3C5ZA 3QO0B 1RPQA 1RVFL 3MBXH 5ITBL 4Y4KB 1M7XA 5DFTA 1J8HB 1RJYA 2AAVA 4G8GB 1MFAH 4JE4B 4AEHH 5FYJH 1JGUH 2Z93B 2COQA 4DKAA 4XGZA 1JNLH 5INDA 2NMSA 4L8SA 5EOTA 3HI5H 3FO9A 4FTVB 2RJMA 3DUHA 5DQJB 4I18B 3MA7A 5JDSA 5EOCJ 1LEKB 2HLAB 4W6XB 2GT9A 3ARDB 3IU4L 3ROLA 1Z5LA 4G43A 3WFDL 4XP6L 1WWCA 2YSSA 1NGWA 4WFHD 2NY0B 3O4LB 4KZDL 3BN9C 2BCKB 3PL6A 5AYUH 4PJFF 1AXSA 2Q8AH 1A0QL 1CFVL 4NCC1 4Z7WA 4QNPE 3F7VA 2BJMH 5HGBB 4JG1L 1YYML 4XMKH 3NZ8B 3BPLB 3G6JE 3K1KC 5HHQA 1A7OH 4I1NB 4FZ8L 2VR4A 2ATKA 4NHCH 4OSUH 5HPMB 4EJ1C 2Y5TB 4UV4H 1IVLA 5IM7A 4ODSH 1BVKA 4GAGH 4M43H 1TJIL 3GKWL 1AFVL 4M8QA 4ODTL 4OZHF 4PRHB 3ARZA 5DK3A 5E08H 1A9EB 5J1AB 4ODHH 5E8DL 2WBJB 5FYLD 4AT6B 2CO7B 5KSBF 1OP9A 3C2SA 5FO7B 1TPXB 1ZT1B 2LQRA 1RVFH 4MSWA 4LRIC 5ITBH 5IUSA 4FQLH 4WI9A 4Q9BA 5D7IF 1EHXA 1M4KA 4J3WA 1VACA 1NCBL 3ARPA 3SCMD 1EPFA 1A1OA 3Q3GB 1QFOA 2HFGL 4JDZA 3HZKB 4OZGB 2YC1A 1P7QB 1N59A 4G9FA 1D5XB 3SDXE 1FYTB 2IAMB 5HI3C 4WDIA 4M7ZB 3IU4H 1AP2A 1HQRA 5JORB 1U6AH 3WFDH 1CE6A 3OKOA 3PJSB 4RNRA 4KZDH 1OT1A 3TH2T 4NRYB 2J6EA 5FFLA 3V2AR 1AXTL 4UQ3B 1CFVH 5SWQA 5HJ3A 3K7UA 4BFEA 4JG1H 4HGKC 4Y5XB 4ELMB 1RUPL 2BRRL 1HZHL 1WBYB 5C0IB 4FZ8H 4PP1C 2QADC 2B7DT 3B5HA 4J4PD 1TJIH 3GKWH 1AFVH 1F3DH 4GJTB 4ODTH 3MROB 4QO1A 3GK8L 4AQOA 35C8H 5E8DH 5EOQL 3QEQD 4AH2A 4HKZB 2CKNA 2YD5A 4P57A 4RX4A 4X4XA 2P5EA 2B1HL 1JUFB 5H2BA 1G9MC 3VRIB 5K9KB 3DUSA 5K9QI 3VD7A 4M9PA 4H26A 4ODVL 3ZHLA 3MNWB 4N1EA 4J1UA 3AGVA 1NFIA 4KQ4L 3GO1L 4V1DB 1XGTB 3KJ6L 1NCBH 3T0WA 3MFGB 5KSAA 2HFGH 2VQ1A 3QG6A 5J6HB 3GJFA 1QHPA 2DM4A 3BIAX 1K2DB 4Z8FL 3RVWD 3SJVA 1VPOH 4RISH 1DE4B 3MO1B 2B1AL 5E8NA 1V7NL 3D39B 3V95A 3IGAA 2GSGA 3K0WA 4Z95H 5DMIL 2IMNA 1AIFB 3PGFH 1KTDA 3KPSB 1BD2A 1MFCL 4P4RA 3MZTA 3O8XD 4MB3A 5CZVL 1GXEA 3K80A 1EMTL 3AXLB 1L0YA 1RUPH 3S9DB 2BRRH 1HZHH 4PRDB 4H88L 4ZXBC 2P46B 3E6FB 1N2RB 3TM6A 2PCPA 3QIUC 4L4JA 4NN7C 1CXFA 1KC5L 4LCWE 1U8QA 2ESVD 5DRNA 3B9KA 4LRNL 3PQYB 4L5FL 5ISZB 1IGYB 3SHSA 3CJJA 5C0FA 1ZMYA 3MRBB 3SGDI 5L8LB 1W8OA 3A0OA 5KOVC 3FT3A 2YMXL 5I76B 4W81A 3V6OE 4OZ4B 2B1HH 1IGFL 3U48A 1P7HL 3DBXB 5TE4L 4JFEE 5JOEA 1CTOA 4LPVA 5TE7L 3CCHA 3QH3A 3ZKXC 2FNBA 3TZVC 1ZHBA 5L2KD 4FP8L 3QUMA 5H35A 2G9HA 4GAYA 5A3IC 2PO6D 2RFXA 2MPAL 1C12A 1CLYL 1X5YA 2QBWA 4Z76B 4BUGA 5BVPL 4Z8FH 3KNBB 4TUKL 5C6TL 3M1BB 1XGUA 4YHZL 2P8LA 3FRPG 1I85C 3QXVA 4JRYB 4OCRL 2B1AH 2GW5A 1V7NH 2Y72A 5SWZD 2XZAL 4CVWA 1BIIA 3OAZH 3DX7A 4U1HA 5DMIH 4OIBA 3GSNB 4WO4D 4FQIL 4LVOB 3LB6C 5J3HC 4HIIA 1MFCH 4FN0A 4UOW0 4U6YB 5MHSD 3FMGH 5CZVH 4TQEL 1EMTH 1CFNB 1WBZA 1YEFL 2YD2A 4H88H 4XNQB 2WWKO 1VFAB 3O3DB 43C9B 1KC5H 1HOCB 4GFTB 2JJSA 3MPCA 1ZVHA 4LRNH 5CINL 1UH3A 3ARFC 1PQZB 1QQDB 4JFPB 2X1QA 2MCG1 1NBYA 1VA9A 2C3VA 2X1OA 5TE4H 3UTTE 4S2SA 1FIGL 2DWEB 4TSBL 5DWUL 4ZUWA 1KTLB 4U0RC 2D7OA 2AP2A 4OF0A 4YEFA 4PGCA 1U95A 4MQXD 3MACH 4XVJL 3IDNB 2EDWA 2QQNH 1BQHG 4FP8H 4HC1L 4ZS6D 3QDJE 3EJYC 3CFEB 2XFXA 4FQQA 2MPAH 1CLYH 1R3LB 4OQTA 5BVPH 5DJ8B 1MEXL 4E41E 5T33L 2IBZY 3UTZA 4TUKH 5C6TH 5DHYA 4AEFA 5C3TA 1TVBB 2NXZD 1AHWB 2CK0L 4X0KB 4YIQB 3QRFM 2XZAH 1ZGLP 3DSFL 2HAZA 3RIFF 3IT8D 3J8F7 1BX2A 1J1XL 1BGXL 2VZ3A 4XCCL 5AG9A 1U8NA 4OD2B 1G7QA 1J11A 4TQEH 1A3LL 4PJDE 4LLWA 4TPRH 3A6OA 3GHEL 1YEFH 2AV1B 4HX1A 2YD8A 5EBLB 3C60D 1ZHKA 2YZ1A 4P9HC 2W65B 4YXKL 3OB0K 3X17A 2NYYD 3P4MA 4PGDB 5BVJB 1I8LC 4Y5VB 3AM8C 5CINH 4C58B 4OIIL 3DX6A 3N1FC 4W68A 2F8XC 3KAAA 4JFYA 3QO0A 4ORGB 4DWHA 3IDUA 3QPQD 1JYVA 4Y4KA 2A6IA 1J8HA 1FIGH 2L4OA 4RAUA 4TSBH 3FQNA 4G8GA 5C1MB 2A73B 3K81A 3WLBB 1UM6L 4Y8AA 3UPAA 3N06B 1S9YB 4YUEL 4F7CB 3JTSB 1MSPA 1F8TL 3LSOB 4LIQE 4ZUVB 4HC1H 5D6DC 4Y0GA 4DKEL 3KPNB 5T1LB 1I7UB 4FTVA 3QXWA 1KEML 4NZDA 4PJ9A 4IRJB 4NZUL 3MSPA 4QOKB 1U3HD 3DO3A 3NABH 1MEXH 3BKJL 5DQJA 4X5XB 4I18A 5A2LH 2PYED 4K2UL 1LEKA 3QJFB 2HLAA 3E0GA 3ARYA 2NQCA 8FABA 5IJKA 3ARDA 4XH2B 4M4RA 3BGAA 4JGJA 4PJ5B 4U4BA 2ZG3A 3OJ2C 2CK0H 3GKZA 3NTCL 4HPOL 4F58L 4KRPD 3DSFH 2AXHA 3O4LA 2UZIL 5HGHB 4QXWA 1G9ML 2BCKA 3VG9C 3KR3L 3BKML 2IWGA 4L4TE 1BGXH 4XCCH 1LQSR 2VB5A 5D5ME 1AE6L 4NP4L 2CH8A 1IC1A 5HGBA 2OZ4L 1A3LH 3GHEH 4NBXB 1K8DA 2AQ1A 4LPYA 4OTXL 1NGQL 5I1KL 3WJJC 1RJLB 1F4XH 5HPMA 1GZPB 5DQDL 2EEDA 2GIYA 4YXKH 2AEPL 3TEUA 1T21B 2N56A 1HWHB 2Z31B 4OIIH 4LGSB 1NCDL 2ICCA 4AT6A 4ZDHB 2OTPA 1NLBH 1FG2B 1ZT1A 2XI9A 1A3RL 1OW0C 4NWUL 3RWEB 2VO5A 4RGMB 5BV7C 1ZGLM 4OZIE 1UM6H 4HWUA 3WUWG 2DLEA 1MI5B 4JFQA 1F8TH 2BVTA 3FO1A 5HGDB 3QHFH 4K3DL 4HMDA 2Y6SD 4DKEH 1FL3B 5E56A 1YN7B 3Q3GA 2IQAB 1KEMH 1KACB 4NZUH 1JN6B 3HZKA 1UT9A 2F8VA 4KJQD 4S11A 5D1QB 1P7QA 3BKJH 1D5XA 3HCVB 4K2UH 2IAMA 1KCUL 3ULUE 2NY1D 2A1WL 4N90D 4U1NA 2BVPB 1J18A 2ITDB 4HPOH 3U4EB 3QUZC 4F58H 3QQ9C 4M5YL 2UZIH 1G9MH 4NRYA 3KR3H 3BKMH 3UTSB 4UQ3A 4NP4H 4ZAKC 2E7LA 3QNXA 4GMTL 1Q0XH 3IJSB 2OZ4H 4ELMA 1EAPB 4OTXH 1NGQH 3C5SA 5I1KH 1X9QA 5C0IA 3BWAB 1AD0B 2DD8L 5DQDH 3LEVH 2FJGB 2AEPH 3SDCB 5DGQA 3EGSB 3MROA 3S34H 4GW5B 1RUAL 3PABB 4QHKJ 1NCDH 2ZP0T 3EOAB 3FO2B 1OGAB 2C5DC 3WHE0 4HKZA 5C0AE 5FECB 4LSRL 5DUBB 1JUFA 5DDHB 2OR7A 1A3RH 2X42A 3AMKA 4NWUH 4XNXH 3U46B 3VRIA 4ALAL 3B9VA 5K9KA 3UYOD 3MNWA 4R7DB 4H25B 2DYPD 1F11A 1XGTA 3CD4A 4K3DH 4S1DC 2CUMA 4P5MB 3QFJE 3HPLB 4LCCB 3L3KB 2H6PB 4LPCA 3L95B 5JNYB 4XB7A 1PYWA 1UXWA 2ZPKL 3LY6A 1QRNB 3ULUC 4PJ8D 1QFPA 1KCUH 4O02L 2A1WH 1DE4A 4NQSB 3MO1A 1H5BC 1S7WB 3D39A 3QIWB 4TTDD 4M5YH 3BYYA 5DMKB 2VLLB 2V9RA 1AIFA 3KPSA 4G3YL 4LDOB 3CVIH 3OJVC 4GMTH 4K7PX 5DURD 3AXLA 4PJEE 3V4PH 4KROD 4PRDA 2PTVA 1OP3H 3KPLB 2YXFA 5TFSL 3E6FA 1DBKL 1N2RA 1TQBB 2H32H 4HS6A 2BNRE 2VNCA 1LK3L 3B4NA 3C2AL 1ZXQA 1RUAH 1VENA 2NY2C 5ISZA 1IGYA 4NQXA 3MRFA 3MRBA 4Z7WF 4FFWD 5I76A 4C56E 3V52L 1WT5C 4MZ2A 1WFOA 1YMHB 1Z3GL 4OZ4A 3DBXA 4K3JL 2E5EA 3K8MA 1C08B 4XP9L 2H9GB 4J23A 1Q1JL 2CDFB 5GS0C 1NUGA 5DLMH 5MENE 3P4OB 2QQLL 2D7MA 3S5LB 4JQVA 3V6ZB 4AY0A 5E2VH 4DVBB 2X4SA 3KPRE 1UWXH 1JF6A 1OVZA 1D5IL 2DF3A 4WTWA 3K74B 2ZPKH 4CU7A 3KNBA 3O3AA 4P9HL 4J8RB 1MAKA 3KYMB 1TTUA 3M1BA 3TT3L 1G9EA 3STLB 2P5WB 2E6JA 1JGDB 4ONOA 4JRYA 3OB8A 4MYWB 2XKSA 3IB4A 4NQCD 2F74B 1MCFA 5JXEA 4RGNB 4NN5C 3GSNA 4L3ED 1HXYB 2J8UE 5EWIH 4G3YH 1RY7B 4U6YA 2IBBA 3ZE2F 1EAJA 3MXVL 1ZGLB 2KL6A 1DQJA 4J2XA 1QLRB 4R4ND 5DHVH 1OPGL 4XNQA 3CFJB 2GFBB 3BP5B 5GHWL 5TFSH 1DBKH 3O3DA 2JE8A 4KKCC 43C9A 4HJ0D 5C07E 1HOCA 5LQBH 1LK3H 3C2AH 4G8FB 1IC4L 2VXSL 2QJDA 3TJHC 1SJVA 1NH6A 2FJFB 3O3UN 3V52H 1Z3GH 2LTQB 3Q5OA 3ZE0E 4PGEB 4K3JH 4TOYL 4G6AD 4AM0A 4FZEL 2DWEA 1G7HB 2R2BB 1KTLA 3GSVA 4NYLB 2V7NB 1AQKL 1Q1JH 2YUVA 3LKRA 3IDNA 2QQLH 4I3RL 5HGAB 3RRQA 3MRIB 1K4DB 2Q7NA 4JAMB 4QRUB 2DQDH 3GZKA 3T1FA 1IAKB 2EH7L 1R3LA 1FGNL 5DJ8A 1QEWB 2FJHB 4P9HH 3MTRA 3TT3H 1TVBA 1AHWA 3OKKB 4Y2OA 4P59L 4X0KA 3HC0A 2FLBT 2AVGA 5DFVC 3V9FA 3U0PA 4XWOD 5FKPA 2HMID 4PRIB 2FCBA 3SO3B 4RFNB 2ZJSL 3GGWA 4LIQL 5BV7L 4OD2A 4DOHB 5M94B 2X89D 1A64A 4GXVL 2WINB 3SDDB 2R0WL 1WBXB 5GHWH 2WZPD 4WI2A 1UXSB 2W65A 4HWBH 3WS3B 2ZOLB 2PXYC 3ARGD 4TNVF 5IQ9B 4P5TD 4PGDA 1IC4H 5BVJA 2VXSH 4Y5VA 1QSEA 4JHZA 3Q5TA 3VXRB 4U0QB 1J1PL 3ALWA 4MJ5B 3HE6D 4KKLC 4ORGA 4TOYH 4FZEH 3RVXD 4MJ6B 3L9RB 2A73A 1AQKH 1MELA 4PJCE 3TO2A 3WLBA 3JTTA 3FONB 1S9YA 3JTSA 3LSOA 5L0QC 4I3RH 4ZUVA 2HN7A 1IARB 1FO0B 3D0VB 3KPNA 5T1LA 5E6ZA 4IRJA 4QOKA 1FGNH 5K9QG 4X5XA 4JFFE 5GRVL 1HHIB 3HC3L 3VWKC 4CMHC 3QJFA 1PKQE 1OLZA 2WUBL 4OLWL 3T0EE 5HVHC 4XPBL 4JRXB 1JWMB 2D0FA 4PJ5A 4P59H 3O2DL 1CE1H 3FHAA 4Z18A 5D1ZB 3TF7C 2VLRE 4Y2DD 5HGHA 4LF3B 3GBML 3UBXA 4CW1B 3FCTB 2ZJSH 4LIQH 4LCWB 5BV7H 1UQSB 5CD5C 1RFDL 4GUPB 3SO5A 2WW8A 4GXVH 3LPWA 2R0WH 4HFUH 4JPKL 1RJLA 3EO0B 4YHYC 1GZPA 1NMCC 4M48L 3ARFB 1MCSA 2ICWB 1ZLVK 1XF3B 4KHXL 4N9GB 1KLGB 2A74B 2Z31A 3EIFA 3ULUL 3ARBB 2APBA 4YPGB 1J1PH 2VC2L 4BELD 4MJID 5E99L 4ZDHA 1CL7I 1FG2A 4PBVC 4KRLB 4GRLD 3RWEA 3AROA 2X10A 4NM4L 4YHIA 1MI5A 5E5MB 5C2BL 1G6RL 1TZGL 2H8PB 3IXTA 4WI3A 5HDBE 2NPLX 1FL3A 1YN7A 4IOSD 1FNHA 2MNUA 2NW3B 4HS3B 2X6MA 4KKBD 4FFVC 1JN6A 5BOPA 1YY9D 3MV11 5D1QA 1SJHB 5GGVY 4XNYL 3T0EC 3HCVA 5KOMC 3HC3H 3IDJB 2WUBH 2AJZB 4OLWH 5D1XC 4HMEA 3HKFA 3BUTA 1DBBH 3O2DH 5EIIA 2BVPA 15C8L 2ITDA 1T7YA 1AGFB 3U4EA 1YEIL 2E9JA 1FQ9C 3HUJB 1P84J 2FH6A 4M03A 3UTSA 3CUPA 4BFGA 3TN0C 4EI5C 3RHWK 3IJSA 1ZLWH 5GS0L 5K9OA 2J4WL 4BUHA 2EC9U 1EAPA 4GRWB 1SYVB 4XAKD 4HBCH 3BWAA 4LMQI 4JPKH 1AD0A 4M48H 2DWDB 4QLRA 1CFSB 2Z0BA 2ADIB 2FJGA 4KHXH 3SDCA 3EGSA 2X4OB 3L3GB 3PABA 4NPYA 4OCLC 3ULUH 2G75A 5F1OB 2VC2H 3EOAA 3FO2A 5FECA 5ETUB 3PF2A 2ZKHH 3TA3B 1KLUB 4PLJD 3S35X 3OJMB 5DDHA 5KVEL 4LQFL 2H2SD 4M1CD 3T3PE 1A6ZB 5J6GB 5EU3A 4R7DA 1XCTB 2DIAA 4K9EC 4H25A 5JIIA 3OJDA 4E41B 5C2BH 2NY6C 2MKLC 1TZGH 1X5FA 4P5MA 3MOBL 3HE7C 4FOMA 3HPLA 4D94A 4QRRA 4LCCA 1H15B 3L3KA 3NPSB 4GT7A 2H6PA 3AB0B 5I9QB 5JNYA 2C3GA 2O61A 5DC4B 1DLHB 4XNYH 4N5EC 1QRNA 4V2CB 1VGKB 2WLZA 3SDAC 4NQSA 15C8H 4HUVB 1G7LB 1MQKL 4H8WC 1S7WA 4PJDB 3QIWA 2NY3B 1YEIH 4HPYL 2CSPA 2EDLA 5DMKA 4MXQD 3BEVB 5HYJD 2KBGA 5BXFB 3I2CL 1MHEB 4XRCB 5GS0H 1JFQL 2J4WH 1HIML 1ZSDB 2F53D 4K71B 4Y89A 5IQ7H 3KPLA 4H0HB 4JPVL 5DMYA 4JDTL 3AY4A 4O51A 3G9AB 2VKWA 4XVUD 4UUJB 1A47A 4LRIA 3MJ9A 1XGQB 1PG7W 5HD8C 4OZFB 5C0ND 3MA9H 1YMHA 2M8XA 5KVEH 4LQFH 1U8KB 3W11C 1JPFB 3MRNB 2H9GA 4JY5L 2DBJA 2XYCA 5FAAA 5HHOE 2YN5A 2CDFA 3P4OA 4B5EA 5F9AC 3VXPA 3MCG1 3S5LA 1FRGH 5D2LE 2K3TA 4DVBA 5A40E 1UACL 1HH6B 1YEGL 1MRDL 2BVOA 1ZHNB 4M61B 5D72L 5AAMA 4DEPC 3RZCD 4ODBD 3RGVC 4R96B 4JO2L 1BJ1H 2OTWB 4J8RA 5ESAB 3KYMA 4WI6A 3QIBC 3P9LB 2ZNXA 2VQUA 4L4TB 3WBDA 5JR1L 3STLA 2P5WA 1T66C 1JGDA 3QWQB 3TYFA 5DEZA 3R8BB 2X9WA 2F74A 4HPYH 2GAZB 3UJIH 4XNZB 4L8CA 3GHBH 4QRSB 4NNYB 5ALCL 5I6XB 5GRJL 2APVA 3BAEL 2AJUL 1ZGLA 3S97C 3WIIL 1QLRA 1CLCA 2BFVL 3MV8E 3E2HB 5DUML 2GFBA 3BP5A 4ZSOB 4JPVH 1QBLL 4XBEH 4XWGL 4JDTH 1BFVH 4UT6L 2DQEL 1SYSB 3MCKB 2X41A 3EJZC 5TDPB 1YNLL 2CD0A 2FJFA 5DUPL 3WDIA 1E6JL 1NAMH 3CDCA 1CGXA 4PGEA 4ELMF 1KIPB 5JZ7D 4BQBA 4QHNB 2WUCL 1QOKA 4M02A 4L1DA 3DGGB 1G7HA 2R2BA 4JY5H 4NYLA 2DQIL 3VDAA 4X6DE 5IB4B 3UAJD 2IFGA 2XWJB 2EC8A 1RIHL 1CTNA 3G5YB 5HYFA 4X5WB 5HGAA 4JAMA 1K4DA 4QRUA 3T1WA 4RDQF 5IEKB 1MJJB 2ARJB 1IAKA 1YEGH 1WGOA 1MIMH 1QEWA 4JO2H 2FJHA 4ZTOH 5FGRA 5I8KL 1I1AD 3BQUB 5JR1H 2IG2L 3F62A 1S7XB 3OKKA 1W0WB 2GK2A 3K4AA 4PGZA 4WFHE 2P44B 1G7JB 3MXWL 5ALCH 3GNML 4QXTB 4PRIA 1BOYA 1OAKL 5GRJH 4OQ1A 1FGVL 3BAEH 2AJUH 4KDVA 4PTTB 2HKHL 3QIUA 3WIIH 2WINA 3SDDA 4UDTA 4F7TA 1JK8A 1M7IA 4MMZC 5DUMH 1WBXA 2LE9A 2PTUA 1QBLH 1UXSA 4NQDD 3WS3A 2ZOLA 3TPKA 3UDWC 5IQ9A 2DQEH 4UNVA 1EX0A 4LP4A 5FYLE 1YNLH 3OF6A 5DUPH 3VFPB 3QFJB 2WUCH 4K7PY 1K4CA 3T65B 4MJ6A 3QZWG 1SY6L 3FONA 2H32A 2VZVA 1AXIB 5E2TL 1LEIB 4UT7H 4WCYL 1XR9B 2PF6A 3D69B 3D0VA 4Z7OF 2EDTA 3P40A 4F2MB 1IAIL 3MLTB 3RY4A 3GSOB 5E2UL 5LG1A 1HHIA 1I85A 4ZOAA 2IFFH 4JRXA 1MFNA 4ENED 4M6NH 1JWMA 4E5XB 2F19H 3NIFF 3SGKC 5AUMA 3VXQA 5DVOA 4JN2B 3QJHB 4D0CB 4PJEB 5D1ZA 4YNYB 3MXWH 4N68A 4LF3A 1HE7A 4GAJL 5F71A 4CW1A 2BNRB 4LCWA 3CDFA 4LLDA 1FGVH 1UQSA 4K9EL 5EC1B 1K8IB 4GUPA 1R5IB 1QLFB 4Q58C 4WHYG 4OCWL 4HWZB 3V6OA 1P7KB 3BPCB 1CIDA 1ZE3C 2H2PD 3MUHL 3ARFA 4R97C 2ICWA 3QUXB 1XF3A 4N9GA 5K59F 3HI1B 2A74A 4JFEA 3HAEB 5CGYC 3QEQE 1H8OA 4KGJA 5EO0B 3HZYB 3ARBA 1E4XL 3U4BL 1WZKA 4HULB 5MENB 5DJZA 1ZOXA 1JF5A 1XR8B 4I3GA 4H8WL 4WWKD 4AL8H 1JYNA 1MWAH 5DHVA 2G60H 3SCMC 5E5MA 2IPUG 2WBKA 5E2TH 4OJFH 4WCYH 2YA2A 1GOGA 2H8PA 3TLRA 3RNKB 4UAOB 3RTQC 5FCUL 3RBSA 3IDIB 5EDXA 2NW3A 4HS3A 3U1SH 1IAIH 1MCRA 1URLA 2C1OB 1NAMB 5E2UH 3RVTD 1FFRA 1C16B 1G84A 3IDJA 1ADQL 2AJZA 2AERT 2J8UB 1YEHL 3DV4A 4XX1G 5IBLD 1F00I 1AGFA 1BBJB 1X44A 5MI0B 1OP5H 3RL1B 4DQOL 1P4BL 1CBVH 3HUJA 4GAJH 1T5XB 4HGWA 1FN4B 3BFOA 5C07B 1NDGB 3QDMD 4K9EH 3U4AA 4J4PC 2IAND 5HI5D 1KJ2L 1MH5B 2YA0A 3VWJD 2PXYB 2FATL 1GCFA 1SYVA 1W72B 3P73B 1I8LA 2VQTA 2DWDA 1CFSA 2ESVE 2ADIA 2UV3A 3M8OL 5FXCH 2Y4SA 1CD8A 2R29L 2X4OA 4M1DH 5KSVB 3L3GA 2W91A 5B38G 3VGAC 1E4XH 1RZ7L 3BZEB 4I9WD 3U4BH 4GKZA 5ETUA 1JGVL 2HVJB 3TA3A 5JW3L 1KLUA 2IH1B 4AIZA 3DYOA 4H8WH 3QDJA 4FS0A 1VERA 4LEOA 5J6GA 3TO4C 3IKKA 1V5JA 1XCTA 3D18B 5D6DA 5L2KE 2FYYB 2XQBH 4KK5C 4WY7L 4HWBA 4E41A 5H37H 1SM3L 3Q5YA 3RVWC 5FCUH 1H15A 4PTUB 1U8MB 2BHYA 1A6AB 3OG4B 3CSBA 1I3GL 2JKXA 3L7FB 1DLHA 2XA8H 2WBWB 2XKNB 4NC1E 4N0UE 3FFDB 1OOAA 3QDGD 7CGTA 1JWSB 1VGKA 1Q9KB 1YEHH 4MA1B 2BERA 1CQKA 5SWZE 4LOUD 3TIDB 4HUVA 4PJDA 1QP1A 3QXAB 3O8XC 4XZUB 3WIFA 4DQOH 1P4BH 2HG5B 3BEVA 5MHSE 4DZBA 2BY0A 2VUOA 5BXFA 3PWPB 4D3CL 1MHEA 2Z8RA 1KJ2H 2I27N 4BSVB 2FATH 4HWEL 3MRDB 5EUOB 2BC4B 3B9AA 4R6UA 1EO7A 2A77H 5LGHL 3WNMA 1BIHA 3M8OH 4PGJA 3DPBA 2R29H 1ZHLB 4N8CL 3BGMA 4UUJA 1BZ7B 2ZUWA 1XGQA 3I75B 1ZT7B 3GRWL 1RZ7H 4PJCB 4OZFA 1JGVH 5JW3H 4GG8B 2OL3B 3SE9H 3EDJA 3Q1SH 1U8KA 1Q9LB 1JPFA 1XF2B 3ZYJA 1PY4A 2Q6WA 3L3OB 3I3EA 2PO6C 4WY7H 5CJOL 3SGJC 3CGTA 1SM3H 3PP3K 5D2NB 3T0EB 3CX5K 2VERN 1QFWL 2M2DA 2VWEC 1LVEA 1HH6A 4M61A 1ZHNA 4JM4L 1I3GH 5DXWA 3DROB 3IFNL 4HUKB 2VLRB 1NPUA 4MGXA 4AEEA 2OTWA 5ESAA 2OQJB 4YDVB 1MWAB 2OX5A 3P9LA 4L4TA 2VDML 2V5MA 3KJ4C 1RJCA 1NCWH 5B39B 1F3DJ 2GAZA 2IEPA 3EHBD 3LDBB 4QRSA 1FFPA 4NNYA 1MJUL 4KHTL 3KVQA 3GMRA 2B20A 2HLFD 4IDJH 4LPXA 1X7QA 4HWEH 1UZ6E 4ZSOA 5LGHH 2ZUQB 1Q9WB 5SX5H 3EW3B 3O2DA 2DJSA 3VJ6B 1CXLA 4N8CH 3GRWH 5TDPA 3CXHJ 3WEXA 1VGEL 1MCIA 4GQ9L 4QWWC 5J9PB 4OAWA 2DQHL 2IQ9L 1KIPA 4MQXC 2NY6B 4WHDA 3QB7C 4ESKA 1KFAL 3DGGA 5M7QA 4ZS6C 3QNZA 5IB4A 1LHZA 1ZT4B 3QWRA 2XWJA 1YPZE 1UCBL 3G5YA 4X5WA 4Z9KB 1MJ8H 1A2YA 3AS0A 4X9FA 2NX5B 5IEKA 2IADB 4PY8J 2ARJA 1QFWH 1YMMD 4LLYB 4JM4H 2PYEE 4JHAH 1QBBA 4P23D 2NXZC 4LHUD 3IFNH 1CWVA 1ZWIA 4HKJA 3BQUA 1PG7L 2VDMH 2HRPL 2EE2A 1FVEA 4RIRB 3VXTB 1K5NB 1G7JA 4UILL 3RWIB 4QXTA 4KHTH 3C60C 4EBQL 4PTTA 4JFDD 1CIUA 5IW1B 2AXGB 4XBGB 2NYYC 3VXOB 5ID1A 1WT5A 1F2XK 5BJTB 1KEGL 2ERJB 2VABB 1HINL 1VGEH 3N85H 5BQ7B 4J3UA 1NBQA 1JZ5A 4GQ9H 5C0JB 5IB1B 3QO1A 2DQHH 2IQ9H 3VFPA 3QFJA 1RZGA 2X4UA 2ZOKB 1J0YA 3WE6B 4ZFGL 3T65A 2HFEB 1HI6A 5FGBC 3T09A 3V6FB 3NFSL 5C0CB 5EU6B 1XH3B 4ORZC 5F1NB 1U3HC 3T2OA 5D7JD 1WTLA 3RGVB 4LLVB 4PRAB 1INDL 3H7BB 3D69A 3UZQA 4F2MA 3MLTA 4H1LG 1NQBA 4KK6D 3S36X 3SN6N 3GSOA 1CLOL 5FYLH 3SKOB 1YUHB 5JA9A 5I19L 4N90E 1LNUB 4KRPC 3VXUD 4GG6E 2HRPH 3U0TB 4E5XA 4G8EA 3QCTL 4AK1A 1JHKL 5TPWL 4ZPTA 4Y4FB 1MY5A 4FXGB 4YHML 4JN2A 3QJHA 3U7WH 4PJEA 4YNYA 3CLFL 3I50L 2AV7B 4U6HA 1Q8MA 3FQWA 2ARWA 3DXAB 2BNRA 4GW1A 4MCZB 3GMNB 5EC1A 1K8IA 4DGVH 2NZIA 1QLFA 3V8OA 2VSCA 5GS3A 2ZG1A 4XVTL 4M4PA 2LV4A 3H3PL 4HWZA 4QNPF 1DR9A 1P7KA 3BPCA 4P3WA 4GKOA 3QUXA 3HS0B 4ZFFB 1EUTA 4I13B 3HI1A 3X14B 5GGQL 3MRRB 3HAEA 1KEGH 1RQ5A 3HZYA 1P5VA 3REVB 4HMCA 5FM4A 1MIEL 1HINH 1OCWL 5DF0A 3NMEA 5MENA 1BFOB 3WS6C 2GSIB 4ZFGH 1VFOA 1MHHA 5C71A 1IRAY 2Y6SC 3NFSH 1Q0YH 4GH7B 3D2UB 1IC5H 1QG3A 4KJQC 3GFUA 2YPVL 1INDH 4POYA 4YHLL 2GK0A 3DETC 1U0QA 2NY1C 4Z7UE 2C1OA 1NAMA 3SE4A 5FYJU 3EJJX 3CK0L 3M45A 4PJ7B 5I1EL 4FFYL 2J8UA 4PBWD 3QCTH 4M3JA 1JHKH 5TPWH 5B22A 4YHMH 1N4XH 1BBJA 4Q6IB 4XAWL 3MV8B 2X09A 2XTJC 3I50H 4ETYA 3RL1A 4O9HH 3WNKA 5C07A 4OD3L 1MH5A 3BKCL 1C5BL 2PXYA 4XVTH 2FECL 3H3PH 2HYMA 1W72A 1CQYA 3P73A 3VMOA 3ARWA 1ZLUH 3IAGC 2VITB 5GGQH 2OI9C 5KSVA 2EYSB 2AI0H 2X4TA 3DVFA 4F7PB 2J8OA 1G1CA 1MIEH 1OCWH 3VXSD 3BZEA 5EB9A 2DM7A 2HVJA 4RSVA 2BHZA 1JJUA 2ORBL 2IH1A 5MEOA 5J13B 1C8PA 1CCZA 2FX9H 3VFMB 3D18A 4WI5A 2FYYA 1E4JA 3MLUH 1BBDH 2YPVH 4PJ8C 4YHLH 1AI1H 3VWKA 4PTUA 1A6AA 2AJVL 3BH9A 2DL2A 4KXZH 2BMKB 3L7FA 3GIVB 5I8EB 3CK0H 2XKNA 4AG4L 1IILE 4FFYH 1NUNB 4TTDC 1JWSA 1Q9KA 3D85D 4MLIA 1AGEB 1CDUA 4NQCE 3NCFB 4XAWH 3QXAA 3H0TB 4P2OD 4L3EE 1CGUA 2ZWLT 2HTKD 4KROC 3VGDA 1F4HA 4Y4HD 3C5JA 3UP1A 3PWPA 5GZND 4OD3H 5CD3B 4HV8B 4QRPB 3BKCH 3G6DL 1C5BH 4BSVA 3W9EB 4FXLA 3JWDC 4FQXD 3MLYL 3QPXL 3THML 2BC4A 3KLHD 5F21B 1IEBB 3GSUB 3LD8C 3WSQH 4FFWC 1ZHLA 2GJZB 3C6LC 3OKMB 4ZPVB 3D1MC 1BZ7A 3I75A 1ZT7A 4PJCA 4XVSH 1FYHB 1IGML 2ORBH 4GG8A 2OL3A 2JCCE 2UWEE 1Q9LA 1XF2A 1TNNA 3CSYB 2FR4B 3L3OA 3O6FD 1XGPB 5HHME 2RAMA 3HC4L 5C09D 4JFFA 3UYRH 3CDYA 1WEJH 1J88A 1I9JL 1PKQA 5D2NA 3T0EA 4XCNB 1HSAB 1I9IL 1S7SB 4QXGH 4DCQA 2AJVH 5D1XA 3DROA 4JREC 4AG4H 2VLRA 1MJ7L 1QA9B 3ZKMD 2ZUYA 3MREA 4YDVA 1EHLL 1MWAA 4CMMB 4HFWB 3ZYOA 2OMNA 1HCFX 4LAJH 1JRHI 5B39A 2CUHA 2KH2B 5D71L 3S4SB 5AZEL 4R4NC 2V2TB 4HJ0C 1U58B 3G6DH 3ZKND 5DVNA 3THMH 1Q9WA 4M7KL 2YPLE 1EO8H 3VJ6A 5ANME 5DRXB 4PFEA 4KTEL 5EU7E 3KGRA 3HUJF 1AJ7L 4G6AC 3BN9D 2X4PA 1IGMH 2WQ8A 5J9PA 4OKDA 5CWSB 5HDQL 4GRWF 4EIZC 3VGGA 1D9KB 3V6BR 4PR5B 1QFUL 3HE7A 3STZB 3KXFD 4F33A 1ZT4A 3LMJH 4JQXA 4PJHB 3S3SA 4PV8B 1U3JA 3G5XB 2IADA 4MX7B 3A6CL 4LLYA 3LQAC 5CSBA 1T89C 1KJMB 2P47B 1MJ7H 4KDTA 4U7SA 1TJHL 4UOW1 1M71B 1PDKA 4MA7H 1MCJA 1EHLH 3O8XB 4JJHA 5BZWB 3V0VA 3ZMRA 4RIRA 1U3ZA 2FX8H 2R1YB 3BE1H 2HMIC 3C9NB 3VXTA 3ZDZF 1K5NA 2IALA 3WFBL 1X5HA 2E7HA 3MRGB 5AYQA 5AZEH 3P3YA 3I9GL 1SHMA 4ZS7L 3RWIA 2VISB 2ESVB 3MYJB 4D8PB 2G5BB 3IJHB 5IW1A 3ARGC 2V5YA 2AXGA 4XBGA 4P5TC 5BO1L 3SKUD 3T2NL 5L9DL 1F3RB 4LSSL 4IMKA 5EU7C 1VFMA 2OJZL 4G7YH 4M7KH 4PJDF 2EDJA 3RU8L 5KVFH 3LEXB 4KTEH 3DI3B 2OTUB 4MJIE 5BJTA 1CXHA 1AJ7H 2F54B 1B6DA 2VABA 4K8RD 5BQ7A 5EA0L 4G6FD 2X70B 1UCTA 3Q6GL 5C0JA 3VGBA 5HDQH 5J4MA 2PO6B 2ZOKA 2RIKA 5I75B 3T3MF 3WE6A 2HFEA 4ONFL 3DX9B 1WUNT 4YZFE 3V6FA 4X7CC 4PP1D 5C0CA 5EU6A 2QADD 2LVEA 2VRAA 3VFGH 2N4IA 1U42A 3WUZA 5F1NA 3DECA 3RGVA 5FA3B 4PRAA 1GOFA 3H7BA 3A6CH 1DVFB 4WI7A 4XC3L 4YFLF 3WO4C 3QIBA 3I84A 5CILH 5L6YH 2DMKA 4WO4B 1TJHH 3HN3A 1V7ML 1YUHA 3A67L 4C4KO 1LNUA 4UNUA 4Y2DC 3U0TA 1W2KT 5IV2A 2P8PB 1NC2B 3B5TA 4Y4FA 4FXGA 4Z0BL 2AV7A 2P8MB 2W0KA 1WZ1L 3I9GH 4ZS7H 2R1WB 4WTZA 1JV5B 3DXAA 2MOVA 3FTGB 1EFQA 4HD9A 4IHOB 4MCZA 3GMNA 1TTFA 4YFEA 2AJSH 1N26A 4XAKE 2XQYK 1HKFA 3EOTL 1XIWC 4NSKB 3T2NH 5L9DH 3V5KB 4FQCL 1OT2A 1D5ZB 1DQDH 1I7RB 3HS0A 4ZFFA 2YHGA 3RU8H 4QHMB 3B3IA 4H0IA 3MRRA 3P30H 4PYGA 4KUCF 2VDQL 4GRLC 3REVA 1EHNA 2W07A 5HHOA 3AS1A 1S7UB 3Q6GH 3VFVA 4BZ1L 1N6UA 2GSIA 1DZBA 3P77B 4MNQB 3DX8B 4ONFH 1LP9E 5EO1B 5IHBA 5ADOL 3LN4B 3D2UA 4KKBC 1A02N 4DN4L 4JO1H 4R26L 1YY9C 5MEPB 5CJ5A 2NXZB 3U79A 4QEGA 2C3XA 2H45A 4XC3H 4Y16B 1MVUB 4TNVK 1GRWA 3PGDB 3JWDL 1SVCP 1ZLSL 4PY8I 2VLMD 3BUYB 1WWAX 2UUDK 4IIQC 1V7MH 5SX4H 2R0LL 3MBED 5ACMA 1KCKA 4M8VA 1KNOB 3ME0A 4HT1L 4S1QH 2BXYA 3FN9A 5TGBB 1K6QH 4MD5B 4Q6IA 2F8OA 3MV8A 4Z0BH 5HYJE 3ULUF 4ZYKB 1XF5B 4ODWB 3QXDB 1WZ1H 3CVHH 1GGBL 1F6AB 3I6KB 5E5RB 5E4EB 3JV0A 4MXWH 3WIHA 3WDJA 1V3JA 2CUIA 2F53E 3EOTH 3MV9D 3UDWA 1JMZA 3OR6B 4FQCH 1MFBL 4PG2A 2VITA 2GY5A 2EYSA 3UEZA 3H6JA 1E6OL 4PLJC 2VDQH 4F7PA 1WITA 1CK0L 4F37K 2H2SC 5CJ8A 5M95B 4WV1C 9CGTA 4JPWL 5J3HD 2VDRL 4KKNA 3OB0H 5DR5L 3AU1B 1U3HB 4HW6A 3U36B 4OUUB 4PD4J 3VFMA 4OLUL 4A6YH 5ADOH 4DN4H 4R26H 4YXLL 1DFBH 4NWTL 4UU9B 3SKNA 5C9JA 2DQJH 5CEYB 5DMGD 5LCVL 2Z4QB 2VYRE 2XY2A 1S9WA 3MRKB 3JWDH 3V4VL 1JBJA 2BMKA 1KB9K 3GIVA 3UROR 3QEGL 4GMSL 5KS9E 3BMWA 4JVWA 1HDMA 4HT1H 1AGEA 4P0DA 2E8YA 4HG4K 2V2XB 4OGAD 3H0TA 3UPCA 4YHNB 2QSCL 4F15C 1GGBH 1T7WA 3EJYD 1BVLB 5CMAB 4BZ2L 3CFDB 1GIGL 4R0LB 3WHE1 2PW2A 4HV8A 3VW3H 4NCC2 3FFCD 4TRPL 4KV5E 3W9EA 3O41B 1IM9D 4LVEA 3X3FL 4XVUC 4IOIB 4N5UA 5FIEA 4E0RA 1CXEA 1WWBX 3GSUA 2E7BA 3LQAL 4PJEF 2GJZA 1E6OH 4CN1A 1CK0H 3SQOL 4O00A 5DD6B 4JPWH 3SCMA 3O3EA 2VDRH 5JXAL 5DR5H 2MQ0A 3CSYA 2CR6A 2FR4A 5T5FL 4YFDB 2DS4A 4OLUH 1XGPA 3PHOB 3EFFA 2UYLB 5B3JE 5FOJA 4YXLH 4NWTH 3RZCC 4PRBB 4XMLL 2HH0L 4MAYB 5LCVH 4XCNA 4QT5B 3V4VH 1EFXD 1CDJA 3HI6L 2W38A 4KJYB 5F8QC 1QA9A 1LO4L 3RI5K 4GMSH 4KAQH 5TJWK 4P46B 4HFWA 1N5YL 4PB0L 5ESQB 3MLSL 3HNVL 4X99B 4RX4D 5IB3B 4Q9RL 2X4RB 2QSCH 3O3BB 5A16B 3S4SA 4J4PA 3RWFB 4HSQA 5J1TC 2K7PA 2WV3A 4BZ2H 1GIGH 1IL1B 2V2TA 3L3DB 2VDPL 3QEQA 2DB8A 3HLAB 1U58A 4TRPH 4FRWA 3IVKB 1R5VB 2J8UF 2EH8L 4NQDE 3EDFA 3R06B 1AY1L 3ZE1E 1F6FB 2CLRB 3BP4B 1B2WL 1B9ZA 1N64L 3LQAH 2GYSA 1S5HB 4I0PB 5DRXA 1UJ3C 1MCKA 3BW9A 2DYPB 2VLJE 5JZ7C 1TZHB 3CVHB 3MLZL 5DSCB 1FSKB 2IMMA 2AS5M 3VD4A 3STBA 1QSVA 5CWSA 3UAJC 3QEHB 2GTZA 3W0WD 4JGUA 4QCIB 2EXYC 5ALBL 5T5FH 4PR5A 2DI8A 3STZA 2FO4B 1R3JB 3MJGX 4PJ8B 4Z7UB 4OF7A 1CICB 1DANT 1IQDB 1BD2D 2B2XL 4XMLH 4PV8A 4U1IB 4DK6A 3U83A 3MV01 2WAHA 3G5XA 1G7IA 1I1AC 4MX7A 2IPKB 2FEDD 1RIVL 1BP3B 1CF8H 3HI6H 3MUGB 4N0CD 1KJMA 1PW3A 2JB5L 1M71A 3PV6A 3QSKB 3O8XA 3N50A 1N5YH 4PB0H 5BZWA 4A6YB 3ZT5A 5I30L 1RUKL 4L9DA 3HNVH 4MWFB 3HHRB 1WLHA 4Q9RH 4R9HA 3MRGA 4W4NA 1D6VH 5E6YA 4BFIB 2VISA 5FHAH 4Q74A 2ESVA 3MYJA 4JZJB 2VDPH 2P48B 4D8PA 1AGBB 2G5BA 1RURL 3IJHA 3RKDD 2EH8H 2D4DA 1AY1H 5C86A 1H3PH 3I6LD 1B2WH 3K2UL 5C6WH 3LEXA 2OTUA 4DKFL 3QQ9D 3BISA 2F54A 3MLZH 1JI2A 4U1GB 5EU4B 4U1SA 4U6VL 4NUJB 2PO6A 4JQIH 4F7EB 2DI9A 3DJ9A 1BJ1J 5ALBH 5EUOF 2WIIB 3SGJA 3O4OC 5D9SB 4DAGL 4LAQL 5A1AA 1P9MA 4LARL 3E3QE 5I1AB 2YRLA 4N0UA 2B2XH 1IGJA 2B0SL 2FO1A 5FA3A 4PJCF 5CJXC 1DVFA 4NQCB 5SWZA 5JUEL 3B8YA 1IC7L 4R4FL 2JB5H 4WO4A 3TT1L 4KVNH 3GSXB 5EZIL 5TQ0L 1JYXA 5ILTL 4OI7A 2VUYA 5I30H 2JIXD 1RUKH 1E0OB 1ES0B 1NC2A 4KI5E 3TV3L 4UTAL 3SPVB 5E00B 2P8MA 3R0NA 3KLAB 3QDME 4IM8A 4JKLA 2R1WA 1JV5A 3PWJA 2IANE 3QI9B 3FTGA 1IZKA 4IHOA 1A1NB 3BGFC 1RURH 3CLEL 3MNVA 2E9WA 3B6SB 4NSKA 3DYMA 5TH2B 1D5ZA 1I7RA 5CSGA 1KPUB 3U0WL 1EK3A 3K2UH 4QHMA 4XNMB 2JCCB 3MLVL 2XN9D 2UWEB 1C1EL 4DKFH 4I9WE 5L2JB 4BH7A 4XCFL 1S9KC 5HHMB 2AXJA 1S7UA 3FQTB 3JUYA 2DM2A 3H8NA 4Q2ZB 3HG1E 5IESL 3KPQB 3P77A 3DX8A 3E1F1 5IT2L 3E3QC 4LAQH 5EO1A 3VFOB 3LN4A 2NNAB 5MEPA 2RBLA 2B0SH 3RVTC 3MLRL 5K9JL 2NY2D 3MRLA 4Y16A 1IBGH 1MVUA 3PGDA 5DK0A 5JUEH 1KPRB 1IC7H 3QDGE 4WI4A 5T3XL 3BUYA 4H20L 5IHUL 5I1CL 4ZFOL 5TQ0H 5IHZB 5ILTH 3EYSL 1KNOA 4XCEB 2RB8A 5AD0B 4FQPA 5TGBA 5EZJA 3NCJL 1Q9OB 4MD5A 3EDDA 5I2IB 3TV3H 4UTAH 4ZYKA 5HI5C 1XF5A 4ODWA 3QXDA 3VWJC 2KQMA 3DMMB 1F6AA 4C83A 3W39B 4RDQG 1JHTB 2YPLB 4LHQB 4JZOB 1AR2A 3HE6B 4PJGE 3OR6A 2HFFB 1NEUA 3X13B 4ZUSB 3RX8A 3G9VA 1CGTA 3T04D 3MLVH 1BM3L 1C1EH 1HHGB 3ZDXE 1HN1A 1GZQB 2NLJA 4XCFH 3NACL 4X80L 5IESH 1LK2B 1MCEA 1J87A 1YPZA 1KTKE 3IRZA 3CFKB 3AU1A 1U3HA 5F1SA 3U36A 4OUUA 5IT2H 5IB5A 1AD9B 2PYEA 4EN3C 1EVTC 4KKCD 4LSVL 4KTYA 2ZSWB 3T3PF 3LEYL 5CEYA 4OFIA 1T03L 5K9JH 5CIPB 2ICWI 5IHUH 4Z7NE 5I1CH 2AK1L 3RWHB 4YJZL 3VFNB 4PRHD 3EYSH 3V79C 3ISWA 2FL5B 2PN5A 3JV5A 4NO5A 5CP7B 3SGDH 2WBJD 3V5HB 3NCJH 2V2XA 2ZUXA 4YHNA 2QR0B 4APQC 1BVLA 1HILB 3T4YB 4R0LA 5H94B 2OJEA 4YXHL 4GQPH 1OTSD 4MJIB 3O41A 2P45B 1PX3A 1PVHA 4IOIA 4X8JB 5SWSB 3ORJA 5IP4A 3OQ3B 3W5MA 1CDCA 4BH8B 1BM3H 1P7QD 3WS6A 3X11B 5AZ2L 3C08L 1A6VL 1FYTD 3NACH 4CJ1A 4X80H 3TFKD 2LAGB 5ESVB 1ZLVH 3G5VB 5KTEL 1ACZA 4M6AA 5INCA 4XC1H 4HUUB 2QLVB 2ZUSA 2NZ9C 2UYLA 4L4VB 4X6FB 4X8XA 5D7KD 3U30B 2A9ML 4LSVH 4PRBA 1OM3L 3IKCB 3C5ZB 3LEYH 1YMME 1T03H 4GG6A 1UZ8B 1J1OL 2I9LA 4KPHL 4QT5A 3PHQB 2E7CA 1U8PA 1IQWL 4CGTA 2AK1H 3TNNB 5GRUL 3D87B 1B6UA 3Q6FA 5SV3A 5IVXB 4X9HA 3LS5L 1E4KC 3EHBC 4YHOL 4JVUA 3ZLQC 1R3KB 4X99A 5IB3A 2HLFC 5A16A 4KH2A 3RWFA 5IJVA 2I26N 4F9LC 5ACZB 4NKMB 4JFDE 1IL1A 3L3DA 3IDYC 4YXHH 4V1DD 1ED3B 1R5VA 5I1JH 4FQJL 4HQQL 1ZA6B 5TF0A 5ADPL 3NH7L 2CLRA 1BLNB 3PL6B 1IEAB 1SMOA 4NQTA 5AZ2H 1LP9B 2DYPA 3F7VB 1KN2L 1TZHA 3CVHA 4WJ5B 1WK0A 3RP1A 1X5JA 2R2EB 3QEHA 3ULSA 4OZHE 3LKQA 4QCIA 5IM7B 3OKNA 3D39D 1BVKB 2Q20A 4M8QB 3TYGL 1EHAA 3V0WL 1R3JA 5MEQB 4Z7UA 3MRMA 4PJ8A 5GRWA 1CICA 1CGVA 2A9MH 3KPSD 4P23C 4JGMA 1OM3H 4U1IA 1J1OH 4MSWB 1PFCA 2IPKA 3DOSA 1WIPA 5IROC 1IQWH 5D7IE 5EORL 3MUGA 3VXUE 5HYJB 5GRUH 4D0BB 3LS5H 3PHSA 4YFLI 4B50A 4YHOH 3PQYD 1VACB 1X5KA 4A6YA 5ISZD 2A6KB 1A1OB 4GXUM 1Q94B 4MWFA 4JDZB 2XXCB 1V3MA 2VSDA 1TETL 2C3HA 4G9FB 4XHQA 5F7NC 4BFIA 1ROWA 4WDIB 4JZJA 1RZFL 3JWOC 3WUWA 3O9WD 2HT3D 4FQJH 3BIKB 4HQQH 3UO1H 2YOCA 5ADPH 3VRLE 4G9DB 2A6JB 1KN2H 1MCCA 4HZLB 1S8DA 4JM2D 1U8JB 3QAZC 4KKAC 4M62L 1JZ3A 3TN0D 3OBAA 4YLQT 5DO2C 4F7EA 5C0EB 5KVGL 1KJ3L 2QTEA 5D7JC 3TYGH 2XIDA 5D9SA 5HY9B 3V0WH 1T20A 2NTSP 3V7MA 4KK6C 4UB0L 5KS9B 1FAIH 3ZT7A 3DO7B 3FB7B 4ZUUB 5H2BB 3TC9A 4NQCA 4Y19B 3DUSB 4PJAE 4YO0A 3E8UH 2J8HA 4J1UB 4L3EA 4S1SL 3GSXA 2P1YA 2VZSA 4OLZH 2JB6B 4XHJD 4H5SA 1ERNA 3T0AA 1ES0A 2AW2A 5IW3A 2EIEA 2VQ1B 5HBBA 5IFAL 3OMZA 3LRHA 1TETH 5DZOA 3GJFB 3SPVA 5E00A 1MPAL 3ULVF 3KLAA 5IOPB 3SJVB 3QI9A 3QQ4B 1KT2B 5CLWA 1NCCL 1RZFH 4RMTA 4XP1H 2Z92B 3B6SA 4NNPL 3GJEA 3DRQB 1JNNH 5EZOH 5TH2A 4NJAL 3LZFH 3JV6B 1NMAL 2X9XA 2XWTA 1M1SA 4LMQE 5D4QA 5E94A 4XNMA 4K7FB 2JCCA 2UWEA 2DQGL 3VXSE 3L5WA 1IKNA 2R9HD 3FQTA 4JKMA 2R56L 1FPTH 4Q2ZA 1S5IL 1MAJA 3MJ8A 4FG6C 2PCPB 1MF2L 5KVGH 2CXGA 1KJ3H 3WFZA 1U8QB 3VFOA 1I1AB 1YNKL 3JV4A 1WV7T 5C0FB 2C3WA 3VFSB 2OK0H 4UB0H 1FLRL 3FT3B 4YK4C 2Z35B 4YDLB 3R0MA 5D70L 3DVIA 3S3PA 4ELKA 1FVCA 1KPRA 2CLVB 4LKCB 3CCHB 3H42L 3QH3B 1A1MB 1UADC 4HXAL 4NHUB 4S1SH 3RX7A 4P4KC 5IHZA 3VI3E 1L0XA 3W11D 2FX7L 1E4WL 4OV5B 2X89A 3QUMB 5I17B 4I4WB 4PJHF 5AD0A 1Q9OA 5I2IA 3RNQB 2V17L 1MPAH 3DMMA 5DJDB 2DLGA 3ARGA 5C3LD 3W39A 4P5TA 1FC1A 3QHZH 1JHTA 2YPLA 2N7BA 1A6UH 4JZOA 3W82A 2SEBB 1Z2KA 2P8LB 2VLJB 3HE6A 4NNPH 2CDGB 4WVRA 3CU7A 1OARL 1M05B 1EGJL 5T1LD 3VGEA 4NJAH 2OS7A 4KK9D 3X13A 1NMAH 4ZUSA 2YD1A 2EEAA 1KCVL 4QOKD 2DQGH 1CD0A 4EIGB 1GZQA 3RIAF 2UZYB 2QEJA 4YHKL 5ACLA 5IG7A 2D4FA 4PJ5D 5EULV 1FC2D 2JTDA 3FQUB 5C09E 1AD9A 3S8WA 4YBHA 4U7MA 4RZCA 1TENA 3KWWB 1YNKH 3FAWA 3CMGA 4X5LA 2ZSWA 2EZ0D 5CIPA 2NY5C 5D70H 3EJZD 4LSUL 5F96L 3PIQB 3H42H 1RSFA 4D9LL 3H9SE 3VFNA 3S98A 3SE8L 1N6VA 2DICA 4P2OC 2WP3T 2FX7H 4MQTB 1E4WH 2FL5A 4QRTB 5CP7A 1U36A 2F5BL 3V5HA 2W9EL 2YEZA 4Y4HC 3RL2B 4FQQB 5GS1C 4Q7DA 2C9AA 2QV2A 4IJ3B 4RRPA 5BZDA 3Q2CA 4KUZH 5DS8B 4PRNB 1QFHA 1HILA 4FQXC 3T4YA 5DHYB 3KLHC 1AC6A 1MI5D 2YBRB 2Y1VA 4MJIA 3ARED 1F4WL 4R3SB 2HJKB 1OARH 4MVBC 4X8JA 1EGJH 4WWKB 1X5GA 2AQ3A 1QTYT 2CKBL 1CU4L 3O6ML 4IDLA 5I16A 4BH8A 1XF1A 5D1QD 5L7XL 3X11A 3DIFB 1T6WA 3PDOB 5IVNA 1KYOK 1U8NB 3S5LG 1MY7A 5J11B 5GZOC 4S0SD 5E9DB 4HX1B 3U82B 3BRGC 5ESVA 1ZHKB 3OV6A 2YD7A 3G5VA 1A5FL 3KXFE 5IIEB 1CVSC 4OD1H 4KGLA 3P4MB 4HH8A 4HUUA 1EJOL 4L4VA 3BRFA 4NKIL 4PRPB 4DTGL 4HZAA 3IKCA 2ZNWA 4JFYB 5GGVL 1UZ8A 5JHLL 4IIQA 2M26A 3ZKMC 3MODL 3PHQA 2A6IB 3JWOL 5F96H 4RAUB 3FQNB 3H9YA 2MQCA 1JZ7A 3TNNA 2A38A 3SE8H 2MCPL 1J7VR 3C8HA 4XPHL 3RBGA 5CHNB 5IVXA 3QDMB 5D7SL 3EO1B 2F5BH 2W9EH 1OGAD 4PJ9B 1R3KA 1J05B 1NMBL 3ZKNC 5FUOL 4F3FB 5JPNB 3W9DB 5ACZA 4NKMA 3MV7D 4IBLT 3SE3A 8FABB 2ZCLL 1ED3A 1F4WH 2NXYB 4J3VA 1ZA6A 1I3RB 5IB2B 3P4LA 3HG1B 1BLNA 1CU4H 3O6MH 4HHAB 3A6BL 1IEAA 5JHDB 4OGYL 5L7XH 1UZ6F 2NY4B 1LP9A 1QRND 4WJ5A 5B8CC 4F8QA 2QHRH 1K8DB 1ZS8B 3U2SB 2R2EA 4TSAL 4PB9L 3QIWD 3E6HB 3UTPD 3NA9L 2JJWA 3H9HB 2BSRB 5MEQA 4Y5YC 1EJOH 2LAAA 5D6CB 4NKIH 3K8LA 4MD4B 4YBLC 4DTGH 4HIXL 5GGVH 5JHLH 1ULVA 3S37L 5CGYD 4A2LA 3JWOH 3C09B 1X3DA 4G8IB 4FNLL 4N8VB 1YPZF 1F2QA 4KFZC 4MZ3A 4LFHG 5HYJA 4D0BA 2MCPH 4I3SL 3CXDL 4XPHH 4JFQB 1IE5A 3FO1B 1Z0NA 2Y06L 1JGLL 1Y18B 2YZ8A 3H3BC 3DSNA 2A6KA 4HIEB 5DGRA 5HI4C 1Q94A 2F53A 1CL7L 1TQCC 4PJGB 2B39A 1WICA 3B8SA 3RTQD 4U1JB 5E1AB 4DN3L 3S3JA 4G5ZL 5E2WL 3B5GA 1FZOB 4U1NB 4XP6H 5T1DL 4K23L 3BIKA 5I1HL 4PIRF 3BPNC 4K8RC 4OM0L 3A6BH 1GGIL 4OGYH 1U8OA 1A0QH 1RMFL 4G9DA 5FO8A 2A6JA 3QNXB 2ZCKL 2A6DB 3RDTC 1N3NB 1T22B 1X5XA 3WO3B 1FH5L 1I8IB 1YYMH 4HZLA 1U8JA 2L7UA 3C5SB 2P5WD 4PPTA 1EZVX 4UI2A 4PB9H 1WZMA 5C0EA 3NA9H 5HY9A 1A14L 4RGND 1OD9A 2BOCB 4ONHA 4NFBA 1EDQA 1OGTB 2Z9TA 3SGEI 3DVGB 5KS9A 4NO0D 2CRMA 4FA8A 3S37H 3DO7A 3MYZA 3FB7A 2CO6B 2FSEB 4M6OL 4ZUUA 3QISA 5BOZG 2VLME 4Y19A 5CZKA 1MCQA 3CXDH 1F11B 1P1ZA 3FB6B 2JB6A 2FHBA 1SEBB 2Y06H 1JGLH 3PP3H 3TO4D 1YECL 4R90L 4I77L 4KK5D 5FB8B 1CL7H 4WW1B 3OKDB 1XGYL 3IDYB 1PYWB 1UXWB 2HT2C 5IOPA 2ADJB 4DN3H 4G5ZH 3O6LL 5E2WH 2R2HA 5HYQB 1TXKA 3BPOC 3MV9E 3QQ4A 5DK2B 1KT2A 1MLCB 2Q87A 5T1DH 1FAKT 2Z92A 5DFWH 5I1HH 3DRQA 1TTGA 4JKWA 4RBPK 3QR2A 2NY5L 3JV6A 4OM0H 4CRPA 1GGIH 1AXTH 4K7FA 4W4OC 3QCUL 2FHCA 1S9XB 1GPOL 1FH5H 4NZJA 1YMMB 4HS6B 1CZ8L 4P23B 4NC2B 3GK8H 4LHUB 1A14H 4OCYL 3U7YL 1I1AA 5EOQH 4NQXB 3MRFB 4PRID 3VFSA 1O7SA 3SEPA 4LFHD 2Z35A 4M6OH 2EIDA 3MBEC 4GBXC 4EI6B 4M3KB 5DVLA 4LCYB 2CLVA 4LKCA 4ODVH 1EEYB 1A1MA 3CNKA 4NHUA 4KQ4H 3GO1H 4LVHB 3KJ6H 4Z7UF 4OV5A 3VXRD 5I17A 3OF6D 4I4WA 2MFNA 4R90H 2X4SB 4I77H 1XGYH 3OXSB 1CDIA 4H1LH 3RNQA 1S7RB 3T0VA 4L9LC 5GGTL 4TYUA 5DJDA 3O3AB 4WENB 3FFCE 3O6LH 4L8SC 3QHTC 3TBWB 4DZ8B 2WK2A 1YQVL 1K85A 2SEBA 4P3CL 2J5LB 4LBEA 2VLJA 3MOQA 4NKQB 2CDGA 1UM5L 5D93B 1M05A 2W0FA 4E42B 2NY5H 2VLKB 2CIIB 3MQIA 4MB4A 4MB5A 3ZE2E 5DJYB 3QCUH 1GPOH 5TQ2L 1KPVB 1DQJB 1H3VA 4U6TA 4JRXD 3G08A 1VB9A 1BEYL 1CZ8H 1UFUA 4BQCA 5KW9L 1H3UA 3FQUA 1IJ9A 3P9MB 4OCYH 5DMGC 1J9CT 2XY1A 2X4NA 2GQHA 3U7YH 3ABZA 3KWWA 1WCQA 4L5FH 1EERB 5CSZA 5CJXA 3VXUB 3EDKA 4XNUL 3MJ6A 2YMXH 3NCYP 4XXDB 1UB5A 2YN3A 3WN5B 2J88L 1IGFH 4AM0B 3PIQA 5TE7H 3GSVB 4WW2C 4QWWD 1FCGA 3LKRB 4OGAC 4GXUN 4QRTA 4P2YA 3ARBD 4OF5A 3T1FB 2QHLA 3RL2A 1L6XA 5IFJB 4CJ0A 4WNQB 4WGWB 1K3ZA 5DS8A 4PRNA 5L8JB 4OZFG 1YQVH 3OXRA 4RFOL 4QTHA 4P3CH 3FT2B 4YHZH 2YBRA 4LK4A 3KDMA 3V5DA 4OCRH 1OWWA 4R3SA 4Y88A 3HC0B 2HJKA 1UM5H 1ZLWK 3QYCA 1B88A 3U0PB 4WWKA 1H3TA 5HDLA 5FKPB 4FQIH 3HMXL 1WQVT 3VXMB 3DIFA 3PDOA 3GGWB 3FOLA 4P3DA 5TQ2H 1QBAA 3W0WE 4GKNA 4TULL 5FOBA 1Y6MR 2EICA 5E9DA 5LWYL 2XICA 3TNMB 2BVYA 1BEYH 5KW9H 1RZ8B 5IIEA 3F58L 4Z7QF 4PJAB 5HVWA 4EXPX 1BD2E 2EDBA 1QSEB 1NC4B 2CRYA 1XMWA 4AZ8A 4EKXA 3LN5B 2JCCF 2UWEF 1I9RL 1TFHA 4PRPA 4XNUH 5D8JL 5DZLA 1O5DT 2J88H 3QEUB 4GS7C 1G0DA 5DWUH 1YYLL 2XTLA 4K8RL 1FZJB 3TO2B 3JTTB 2WNGA 1VKXB 3R8QA 4XVJH 1PAMA 5CHNA 5LGJB 3QDMA 1KN4L 5TE6L 4CVXB 1A21A 3EO1A 1GHFL 2HN7B 3VWJA 1Q72L 5IBUB 1KB5L 3HZMA 2EDXA 1J05A 2PYFB 1Z0MA 4ZFZB 1RIUL 3O0RL 1A3QA 4F3FA 5JPNA 5T33H 3LPFA 3W9DA 1F4AA 4LLQB 1H8NA 4RFOH 3QZWA 3CSGA 2OR9L 2IF7A 2J3SA 3I6LE 1I3RA 5IB2A 1CFBA 3O2VL 3G5ZB 3HG1A 4L3CB 4HHAA 5JHDA 1JIBA 2APTA 3HMXH 3UBXB 1J1XH 2IBGA 2QSQA 5EBWA 4OFYD 3BXNB 4TULH 2D7QA 1ZS8A 3U2SA 4YC2C 4Y8DC 4QGYA 3E6HA 3F58H 4ZQKB 2NY3D 3H9HA 1JWUB 2BSRA 3VI4F 3T8XB 3B2VL 3QDGA 3V0AC 4Z7VE 2FEDC 5D6CA 2FZ3B 5D8JH 3TVMB 5IWLA 1YN6B 3D85B 4MD4A 4N0CC 4HJJL 3EBAA 3JWNC 5I74B 1KENL 1WVZA 3V7AG 4YQXL 3QA3B 2D0GA 4G8IA 4N8VA 3B9KC 3WD5L 3IS1X 1M7DA 3ES6B 4JKPL 4KQ3L 4YHIB 4K8RH 4YUEH 4Y4HB 1BMGA 5F6HJ 1KN4H 4LVNC 4HAFA 5TE6H 3QXTA 2DJUA 4BA8A 1Y18A 1X4ZA 3IXTB 1Q72H 4U49A 2BDNL 3RA7L 4HIEA 5BW7A 4ERSL 2ZCHL 4X6BA 1OTTD 4PJGA 3RKDC 2W0PA 1RIUH 3O0RH 1JYWA 4U1JA 5E1AA 3TIEB 4HUWB 1FZOA 2B8OT 3DETD 3KLSA 5IMOB 2OR9H 3CZJA 5EIIB 4DW2L 3NTCH 1GL4B 3LS4L 3O2VH 2XN9E 4K3EL 2VH5L 3CUPB 3O6FB 1AE6H 4U7KA 2A6DA 2XTJD 1N3NA 1U3YA 5K9OB 1T22A 1I8IA 1OSZB 4IEFB 4NFCA 3D3VD 1SJXA 4OBSA 1I4FA 5ELIA 3UC0L 5FM5O 4JRWA 1UENA 2IJ0C 1OD7A 1J0ZA 1NGXB 5HXMA 2BOCA 1EGJA 4KUCD 4NPYB 1OGTA 4JFXB 2G75B 1NDMA 3H9SB 32C2B 3DVGA 2EYRB 4YZFF 3OR7A 4YBQC 5F3BA 5C0GB 1KENH 2FSEA 4KZEL 1UVQA 3BI9X 2JJSC 5F6IC 1E4KA 3WD5H 4ZNCD 2CLZB 3BHBB 3CFBB 4JKPH 5EU3B 1BOGA 3OJDB 2DLFL 2X5PA 1VFUA 4MS8C 3FB6A 2VXUL 1SEBA 3FB5B 2BDNH 4QRRB 1Z9MA 3RA7H 1TJGL 4F9LA 2ZCHH 4ZG1A 5FB8A 5B38A 4WW1A 4JDVB 1A22B 3OKDA 3CX2A 3HAEG 2O61B 2V5TA 5CKGA 2Q8BL 2ADJA 3T0DA 4QYOB 5IKCB 4BJLA 5HYQA 1LO3L 1AQDB 5DK2A 5KBNC 1MLCA 3LAFA 5IVXF 2R2CA 3QWRD 1JI1A 4DW2H 4MXVE 3IFPB 2WWMD 2BNQB 2XXMB 2I24N 3LS4H 1VDGA 3DYPA 4K3EH 1P4IL 3CC5B 5F72S 2W9LA 5EC2B 1BF2A 1S9XA 2D7PA 4KRMB 3BQUD 2BVEA 3UC0H 5D7LD 1YMMA 2DD8H 4P23A 4YBLB 5T5NF 3IAPA 5CCKL 4KXZI 4O51B 4LHUA 3FN3A 2AEIT 4U31A 3QUKB 2E6QA 3RVVD 4QXUL 1LP9F 1WCBB 4LSRH 3MC0A 4XPGL 4KZEH 3C6LD 4OF3A 4EI6A 2VTFA 4ALAH 1C7TA 3S35L 3WHXA 4LCYA 1OAUL 1EEYA 2EEBA 4PRHE 4MA3B 5FV2A 4WUUE 2DLFH 5DC0A 1YEKL 2VXUH 12E8L 3VXPB 1CLZL 3ILPB 3PP4L 4JFDA 4MCYA 4NIKB 1TJGH 4PUBL 4OB5L 4PLKD 2BVOB 1AGCB 1VESA 3OXSA 4YE4L 3O45B 1S7RA 2G2RA 2J6EL 2AXFB 2VXTL 1T2JA 5KAQF 1HYSC 1DEEB 1VEOA 4JANB 4F9PC 3TBWA 2GEEA 3EYFB 5KJRL 4O02H 4DZ8A 1LO3H 2CK2A 1BPVA 2C4XA 3P0GB 2F5AL 3WJLC 3TYFB 4G6FB 5JOPD 3CZFB 4I18C 3G6JB 3GEWB 4OZGE 3OKYA 4NRZA 4L8CB 4E42A 1HSBA 1LE9B 2VLKA 2CIIA 5DYOB 5IJKC 3ARDC 2YUZA 1FYTE 1P4IH 4GRMB 1MCNA 5DJYA 1PY9A 3WXWL 2VL4A 2QADB 5DJCB 3KG5A 1KPVA 5D7JA 2NY0C 5EO9A 5JW5B 1EEUA 1NCUA 4HDIB 4YDJB 5CCKH 3P9MA 5D7KE 4F80A 5D7IA 3VXUA 4QXUH 2YUWA 3EYQC 1JE6A 4ELME 4XXDA 2PR4L 3WN5A 3VCLB 4UV7L 3P0VL 3S35H 5I71C 1OAUH 1QO3B 4XP9H 2WBJC 4G80A 3I85A 4X4ME 4DKDC 4P2QD 1YEKH 1EZVY 3SDXB 1CLZH 3PP4H 3BVNB 5IVOA 2WSKA 4PUBH 5MEND 5KS9F 4OB5H 4UT9L 5IFJA 1WWWX 1D5IH 4HIHB 4HK0B 4WNQA 4YE4H 2J6EH 1OTSC 2VXTH 4U3CA 5KJRH 1JPGB 4V1DE 2X44D 2A9NL 3M07A 3FT2A 3MRHB 2DAVA 2LFGA 1WC7A 1S7QB 2W9DL 2J2ZA 1UWGL 4X7SL 4NBZB 3U6RB 1KG0B 4CNIB 2IAMC 4M7ZC 3LH2L 2FLRT 5J12C 4NC0B 2FB4L 3DURB 3TFKC 3VXMA 5F7FA 1GSMA 4ZXBB 4CDGC 5DJXA 3QIUB 3MXVH 1W8NA 4NN7B 5GSRB 5DQ9B 1MCWW 4UDTB 4F7TB 1OPGH 3ALXA 1JK8B 1M7IB 3TNMA 4MMXC 4QHUB 5LBSL 4F57L 1RZ8A 2E7LC 4Y5XC 4PJAA 3KPSE 3S96B 5E03A 1NC4A 5IGXL 3LN5A 1GGUA 1PZUB 3RWJB 5B39G 1LDPL 3ZKXB 3QEUA 3TZVB 4PJIE 4UV7H 3P0VH 5ECJE 5B3JF 5J89A 1K4CB 4YHPA 1P4LB 2GTWB 1BAFL 1FZJA 1VKXA 2H32B 3PQYE 5E6ID 5LGJA 2Y9RT 3UZEA 4CVXA 2EKSB 2Z8WC 4I0KA 4L9LB 4J12A 3O6KL 3RZWA 1LDSA 3MV9B 4UT9H 2EH7H 3ZHDA 2PYFA 4N0FA 1I7TB 2UUDH 3CFCL 4ZFZA 1UKSA 4JEGB 4ZODA 4LLQA 1A4KA 1TLKA 3VXSA 3I3BA 2W9DH 5AUMB 3VXQB 1VEPA 4G6KL 3T08A 3G5ZA 3LH2H 1NANI 1UC6A 4L3CA 4Q97A 4D9RD 3L3JB 1QUNA 2G5RA 4LLDB 3ZE1F 1FZKB 3BXNA 2YS4A 5ITFA 5FM5M 5K59E 2C4FT 4NO2B 4XXCC 1F42A 4F57H 4JY4B 1A6PA 4ZQKA 1IKFL 4JFEB 1JWUA 1XIWD 2CDEB 3T8XA 1DANU 5IGXH 2FZ3A 5F8RC 3TVMA 1C5DB 1YN6A 1TCRB 3D85A 3PWPD 4R4BA 3VMPA 3WXVL 3TPUB 1LDPH 2V9TA 4XI5D 4U0RB 2H1PL 4WW2B 4XP5L 5DJZB 3BX7C 4OQTL 2R0KL 1AKJB 3QA3A 5DHVB 4Q9QL 3ES6A 1BAFH 4Y4HA 1NSNL 3HNTL 4BQ8A 2D2OA 3FFCB 3NN8A 1OF2A 2DRUA 1MCPL 3O6KH 2BHUA 1IM9B 2JJUA 1N0XL 3SY0B 2VAAB 2VJXA 5F7WC 3CFCH 4PJBE 4UINL 2NTFB 3O9WC 2HT3C 3UYPA 3TIEA 1IGIL 1HCVA 4HUWA 4UTBL 3RY5A 4XPBH 1CXIA 5IMOA 3DV4B 3OG6B 1B90A 4A2MA 3T77B 4EDWL 2VOTA 5I1DB 4Y1AE 1XF4B 3GBMH 4JM2C 3O6FA 4HGWB 3RFZC 1UWEL 5GGRA 1RFDH 3BN3B 1OSZA 1YQ2A 3HB3C 3WNPA 3PXHA 3TGXA 4Q9CA 1UEMA 4LVOC 4MD0A 3UTTB 1ND0B 1NGXA 4JFXA 3H9SA 32C2A 3VFTB 3WXVH 4GKZB 2EYRA 5E99H 4WHTB 4OM1L 2H1PH 4XP5H 5C0GA 2XG4A 3N1MC 4AIZB 4OQTH 3DRTB 2R0KH 3QDJB 4XHJC 2CLZA 4LEOB 2GJJA 3BHBA 3CFBA 4NM4H 4Q9QH 1RJZB 4HIJB 1AO7D 5CJQL 1NSNH 3RX5A 3HNTH 4OFVA 1G6RH 2EDFA 3FB5A 1MCPH 4LSDA 2BX5A 4FHBD 2WANA 4JDVA 2D03L 4UINH 1IGIH 4KI5F 4QYOA 4UTBH 5IKCA 3L3IB 1AQDA 1JP5A 1L4IA 1LE5A 4MNHB 3VG9B 2ED7A 4BK4A 4XMPL 3IFPA 1AGDA 3W0WB 4MDJB 2BNQA 2NX5D 1CDHA 4EDWH 4QOKE 5B3NA 4HC1A 4HUNB 3WIFB 2R9HC 5B8CA 4DZBB 3M17B 1AHWC 3GM8A 1UWEH 3CC5A 4X7TB 5EC2A 5KN5B 3DHMA 4PJ5E 1IM3A 5TF1L 3OAUL 4HLJA 3X12B 3HR6A 4U33A 4C54A 3BGMB 3FB8A 3OGCB 5T3XD 3QUKA 4CN6A 1D7FA 3HMXA 1WCBA 5BV7B 3LPGA 3AMLA 2OXGA 4WI8A 4Y5VC 1NFDE 4KJWD 2Q6WB 5CUSL 3PXJA 4MA3A 5E0QA 5CJQH 1FDLL 4ODXB 4HBQA 3MOBH 1D6EB 3ILPA 5F6HI 2EIZB 5LGKA 2D03H 1AGCA 3K46A 3MFFB 5HTSA 3O45A 4X9BA 2AXFA 3D9AL 1DEEA 5LAXB 1MI5E 3ILQD 4JANA 3QUZB 3EYFA 4QHLB 1QACA 4KK9C 5C0CD 5D5MB 5EU6D 4IRJC 1IGTA 5F88B 3RKPA 3CZFA 1MQKH 4XMPH 1LGVA 1G0YR 4ZAKB 3G6JA 1PEWA 1LE9A 2Z91A 3NOIA 1FFPB 5DYOA 3FQRB 4GRMA 4PJGF 3I2CH 5T3ZD 4JHWL 3GMRB 3IDGB 1T1ZA 1JFQH 1UYWL 3WFHB 1H3XA 1HIMH 4WFEE 5DJCA 1X7QB 4B41A 4Z7VB 5F7DB 5JW5A 2ADGB 5HHVL 5HYSB 1I8MB 1SMAA 4HDIA 5TF1H 4PS4L 3OAUH 2RR3A 4YDJA 1JRHL 3T2PA 2AEQL 3C8KA 4BM7A 2EZ0C 1QZ1A 1I3VA 3DHJA 5J57B 3DXAD 3TCXA 5F6IB 3WEXB 1FZMB 4OZIB 2C7UA 1JL8A 3IU3A 1H3WM 2JIXB 3EYVB 4QHKI 5AAWA 4OAWB 3VCLA 2OZ4A 4B7LA 3IFLL 2Z31C 1QO3A 5CUSH 1E28B 3QNZB 3HRPA 3JBG7 4V2BA 1OWRM 1FDLH 3SDXA 2EXYD 1OGAE 4MLSA 5DC9B 3BDBA 3OKEB 4AEHL 3BYTA 4Z7NF 1A2YB 3BVNA 1YC8A 1UACH 4RGMC 2D9CA 1MRDH 5D72H 2F9BT 4HIHA 4HK0A 1F6LL 2OBGA 3MV7E 2CJUL 3AREC 4LQ1A 1JMXA 1H5BB 2XN9B 1ZWIB 4HKJB 1JPGA 3MRHA 1S7QA 1FVEB 5D1QC 3U6RA 5CBEA 4W4OA 1KG0A 4CNIA 1G6RB 1PBYA 2DDQL 4LP5A 3ARXA 4TVPD 3HFML 1QRNE 3DURA 5GIRA 1CGYA 1FL5B 4JHWH 4ZXBA 2GJ6D 5AYUL 4X4ZA 3I02A 2ADFL 5DQ9A 5GSRA 2BFVH 4R2GD 1RV6X 2ICEB 1JZ2A 5HHVH 5E8EB 2NY2B 5C0AB 3UTPE 2FIRT 4QHUA 1JRHH 4XWGH 5ID1B 5HVGB 2AEQH 5CEZD 4UT6H 1N7ML 1KCRL