5E8OB

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oB00
5DI8B 1QBMH 2BNRE 1KLFA 2DQEL 2XZCL 2BDNH 4JQIH 4KTDL 1HHJA 4ODSL 1HHGB 4K7PL 3RZCC 2GSGA 4WUUB 2D0GA 4OM0H 5H8DA 4GS7C 4PTTA 3OPZL 4ZXBD 2R56H 4Y2DC 2NZ9C 1MJ7L 2ZG1A 3QFJB 3MFFB 1I9RH 4Y2OA 3QT2A 4FABL 1T4KB 1ONQB 4P46D 2A0LD 3BEVA 1HYRC 1XCTB 5DVOA 4L4TD 1S7QB 5GJSH 2DLFL 4HPYL 1RULL 2XZZA 3LKSB 5I1KH 2Y07L 3HUJA 2V5SA 5A16B 3EJYC 4F9LA 1H5BC 3RWEB 1LEGB 4DZ8A 4JO2L 5F1NA 3MR9A 2Y5TB 4YDIL 1CL7I 3LS5H 4HIXL 4I48B 1IGJA 5KSAB 1G84A 4KRMB 3CVHL 2JK5A 4PJ8C 4Y4FC 4YDJA 1NUNB 4JPWH 2C4XA 2C4FT 3O8XC 1GIGH 1VFAA 4WFED 5DEFA 3OHXB 4KKCD 2X4UB 2XN9D 4DGIH 1XF2A 4QXUH 4AJ0A 1MWAH 2Z31D 4RZCB 5KVGH 5C0RL 4ZMAT 4NHUA 3BN9C 5CP3H 5GJTL 1R3LB 4NC0B 2NY0C 1A9BB 2X4NA 5ENWB 5FA4B 4LLQA 3FFDA 4PJ8B 4PRIA 5AZ2L 1KN4H 2XZAH 4YEFA 5F6IB 4OF8A 1Q9KA 2B0SL 1YYMH 3IXTB 3PWUB 4W4OA 4R90L 3MV9E 5I1LA 4YNYB 2DWEB 5IW6B 4KK5C 4KGJA 3BH8B 3VG9B 2IFFH 3F58H 2QR0B 3IJHB 4G8GD 4XMPL 1N59B 3M17B 4E42B 1ZVHA 4NZJA 1LD9B 4ESKA 5EC2B 5IEHB 1DQMH 3WS6C 3WUZA 2XTJD 3BPLC 3JV4B 4JDVA 1EAJA 2HT3C 3KDMA 4FXKB 4PRNA 2YA2A 1C5BH 3LRSB 3T3ME 4Q2ZB 4QHNB 5TE4H 4IBLT 5JTWA 1QNZH 1FVCB 3O0RH 4IS6B 4AG4H 2LVEA 1PLGH 4LOUD 3E1F1 4GRLB 1QOKA 1MPAH 2D03H 2A83A 1CE1H 1G7JB 2FX9L 2I26N 3PP3H 2AV7A 2B4CC 4HUXB 1NBVH 5BV7B 3NGBC 4U05A 4C58B 1N6QH 4WV1C 2KQNA 4RA0C 3RVXD 1Q9OB 3SHSA 1N64H 1W0WA 1JZ4A 5E9DB 3ZDXE 2KUTA 4AYFA 1DLFL 3HB3C 5DMJB 4GAFB 4OQTH 4LF3A 3WE6A 3CPLB 2XG4A 5JDJA 5I8CA 1XGUB 3HZMA 5L2KB 3JWDH 4APQD 2V6HA 4M43H 4X6EB 5IW3A 4LARL 4Q74A 3I6LE 4FQIH 5ALCH 4LL9A 4RWYH 5HPMB 2AJSH 2VLLB 1NQBA 5I74B 5HYFA 4X5WB 2NY3D 4ZUVA 3OAUH 3RHWK 3DNKA 3K2MC 2ARJQ 3MOAL 3GJFA 2CLVA 2PF6A 4HLZG 4P57B 1CXFA 2QSCL 3KPNB 5SWZD 5JXAH 1JGVH 1LVEA 5DGQA 1RJYA 2ZCHL 2QTEA 3HE7A 2O5YL 1CBVL 3HC4H 4WUUE 4UT7L 5E4IA 1EEZB 3LQMA 5DLMH 1QHPA 4HWBL 3HC3H 4YK4B 3TYFB 4CVXB 4MAYC 4DVRH 4LVHC 4KK9C 5GS1B 3HR5A 1OLLA 2DI9A 3HPJB 4P3CL 4YHMH 3MPCA 3X13B 2HFFA 1YY9D 1ZGLP 1UZ8B 1D5XB 4BH7B 5J11B 5E8EA 3MLXL 1YEGH 5ALBL 4MAYB 4NQDB 4G9FB 3VA2C 3NACL 3GZKA 1MHCB 3UYOD 1T1YA 2AI0L 2RFXB 2CJUL 1MAML 1UXWA 4I18C 4OCSL 1GVIA 4Q9QL 4CVZB 3QRGL 2FBOJ 4HKJB 3BW9B 1FIGL 1RV6X 1MVUA 4KHTL 5D7LD 3RL2B 1ZSDB 5TDNA 5E08L 5DGRA 1O7VA 3LKRB 3RHWF 4UBDC 1D9KA 3FN0L 1BAFH 2YD5A 1RUPL 4U1IB 3O2DH 3GHBH 3DVNB 3G5XB 2APVA 3RA7H 3IRPX 2IPTH 3DTXA 3BWUC 1CFBA 4GW1B 2H6PB 3C08L 2VE6A 3OXSA 5LGKA 1FV1A 5IESL 1XGTA 5ID1B 1TJGL 2EDWA 4KQ3H 4OJFH 4JO3H 1U91A 1NLDL 4X4XA 5EIIA 3RAJH 2FGWL 3MRHB 4P2OB 1FE8H 3BDYH 5DK0A 3HAEH 5DDHB 5HI3C 5JLZB 1J1OL 1TQCB 2F8VA 1I1AC 5CD3A 3RPIB 4S1RH 3RRQA 1AJ7L 4LLDB 5FECB 1RJLA 3PG2A 3EDEA 1HNFA 4RDQG 3VGAB 3S96B 5B3JF 1N3NA 4Z78A 2JB6A 3B3IB 3L7EA 3BPOC 4PJGB 3NOIA 4XNXH 3SKNA 5E2JA 1AXIB 2JIXD 3G6DH 5IWLC 1VEOA 2YWZA 5DUBB 2Y6SC 3VXRB 1EZVY 4MD5A 4F3FA 5BXFA 2VDOH 2RHEA 4KVCL 5E9DE 4XAKE 3MUHL 1JNNH 1GGCL 4K07A 3IDGB 1V3MA 3WYRA 4L8SC 3RL1A 4Y5YC 3L3IA 1VDGA 5J1TC 4O5LL 5JNYA 3V0WH 5L2KE 3TA3C 2XY2A 3TWCH 1A6ZA 3EYUH 2I25N 3MNWA 1HXMA 4Z0XA 4Z7VF 1WK0A 1CG9B 1QBLH 3EDJA 1JPGB 2F53A 4UIKL 5MEND 2PW2A 4UB0L 4ZQKA 1I1YA 4PJDF 1NGQL 4AY0A 3EO0B 1HEZB 1VB9A 2DQDH 1T1WA 4GKSB 3DXAA 5IK3A 5DD1H 3VRIB 4L5FL 1KBGH 4YHNB 3W81A 4JGUA 1LP9A 4LLWA 1CD8A 1KLGA 1XIWA 3TFKD 2R23A 4CW1A 3FOMB 4HBQA 1AXTH 3WHE1 2C3XA 4CMMA 1KIUA 3CIQA 2IMNA 2W9LA 4OCYH 3WNLA 4DAGH 3X3FH 1BQUA 4DW2H 4LCCB 1KIQA 3ULVD 3C8KB 3LKQB 2GUOA 2ZJSL 3QXUA 5EU6A 4HJJH 1I7TB 3TNNA 4E9LA 15C8L 1E4XL 3NCJH 4HFWA 1Q9LA 3Q1SL 1KPVA 4LKCA 3MUZ1 2DS4A 1LGVA 3NIDF 5E70A 4NQDE 4G9FE 4AIZA 1MUJB 4M6AA 5GS3A 1DR9A 4Q7DA 4Q0XL 1GGTA 3H42H 3KLAA 4NFBA 5GRJH 4WCYH 1OQOA 3QEQB 2NX5A 4WW2B 3VWJB 2AJXH 3S4SB 2IPUK 2OR7A 1DBMH 2FSEA 3MYJB 4IRJD 1AE6L 3WS3A 4NWTH 4MQSB 1XF5B 4PJFB 3P73A 5EU5B 3VRLE 4HJ0C 4L8CA 3CFJA 5JOFA 5FHBH 3IFLL 5KTEL 5T3XE 3MLRH 3UBXI 4MJ4A 2XV6B 4M7LT 1DQLL 2EDTA 1X5ZA 4QF1B 5ICZB 5AYUL 5AUMB 5JOEA 1Y0LA 3ZDYF 4EVNA 5CHNB 2NY5H 3HC0A 1PW3A 5TQ2H 3PHOB 4U2YA 3H9HA 2QSTA 5FO7B 2P24A 4POUB 2YPVL 1MI5D 1R3JB 2Z8WC 4NGHH 2QQNL 3L5IA 4LEXH 4JM2B 1AKJA 1JGUH 4U0QB 4YZFE 3ULVL 5F3BA 3VJ6A 5FA3A 1FL6B 3U9PL 3E2HC 2BSED 4ZO9A 3GSNL 4ZSOA 1RMFL 1CLOH 5J12C 4PJGE 4M02A 3SE9H 4P2QB 2NXYC 1YEHH 4L3ED 1MF2L 3VXRE 2FR4A 1A3RH 4O02H 5HDBE 4XCYB 2Z35B 5IMOA 2CK0H 4O9HH 5ITBH 5J1AB 3FOLA 5D2LA 4HS8L 1J0IA 4HKZA 2V2TB 5GPRA 1AI1L 4L8BA 4X6DF 1Y6KR 3JTSB 3MACH 1XCQA 5IHUH 1U3HD 2C1OB 3MRGA 5DD5L 5HHMB 2FJGB 1XH3A 3EYQC 4PJEB 1XFPA 3RDTC 5DRNA 3CDGA 5DZLA 1MCOH 1F2XK 1VFOA 3NA9L 5CINH 1TZHA 1ADQA 2EH8L 3WLWC 2GT9A 3FT3A 1YMHB 4YQXL 4H25A 4PJIB 2QBWA 3T0EC 3VXPB 1ULVA 1CFQB 3MNVA 3FRPG 3B5HA 1JTTA 1U8JB 1GGIH 3AM8A 4XP1H 3VWKC 1Q72H 2J2ZA 32C2A 2C3VB 4EN3B 4Z7VA 3MUJA 3EYFB 1N6UA 2BSRA 4H5SA 2QSVA 4PJ5B 3P9MA 4PJDA 3S35L 4JFOB 4PGEB 2FWOA 4KRPD 1ZEAH 2WBKA 3OKLB 4DN3H 4GG8A 2DQUH 5JIPA 2GJ6D 5ISZB 2MCPH 1A14H 2OL3L 4P2RB 4HC1L 4CMHB 4E0RA 4U7SA 2AV1A 4PLKD 2HLAB 3KG5A 1ZT1A 4PB0H 2XZQH 3ALPA 3E6FB 1BX2B 5FHAH 3RUGB 3VXTA 1LO3L 4K7PY 5DMKB 2AK4B 4MNGA 3RTQD 4XPTH 5B38G 1PQZB 1R6VA 3QEQE 3CC5B 4X7SH 4QRTA 3QO0A 2J6EA 4YHKL 1IGCH 2NY7L 1Z3GH 3VXQA 4JPKH 1CXIA 3DX7A 4L3CB 5C3LD 1F58L 4G6KL 4Y5XC 4MQTB 4U1JA 1ZHBA 1K2DB 2M26A 1IGTA 5I1CH 5DFWH 3GIVA 4YLQT 1I8MB 4QLRA 3DPBA 3QG6B 4FFVC 5L8JB 2BNUB 1N4XL 4Y4KC 1NMBH 2H8PB 4XVSH 5GISL 3QA3A 5INDA 1TZGH 4KK6D 1V7NH 4EI5B 4HUKB 2OJEA 4ZOAA 1ORSB 2BOBA 4F2MA 1S5IH 5JW5B 4FQCL 4NWUL 2EICA 4Y5VB 4XB8A 4JN1L 1TMCB 2YRPA 4LLYB 5F9OL 1JUFA 2ZKHL 3FB6B 3UMTA 5DD6B 1JCKA 1P9MC 3FQWA 3BP5A 2VL5B 3GBNL 3M8OL 3QI9B 1AY1H 4HK3N 2NR6D 2XPGB 2VO5A 4NQCD 3C09B 2J3SA 3MV01 1I3VA 2EDOA 1PGRB 2VLJA 3MBEB 2ATPB 4LSTH 1Z0MA 1DQDH 1D6VH 4Y4HC 3WD5H 1UVQB 2OK0L 4PLJC 1NCAL 3HI6L 4D9LH 4WFHD 2ZSWA 3FQXA 2SEBA 3UC0H 4BSWA 4P2QE 5F7KC 3OAYH 3RJQB 4EBQH 1INQB 3PL6A 4KUZH 1W72B 2PXYA 1OL0A 3INUH 3ZDZE 1CICC 1QSFE 4ZOCA 1A6TA 3EYVA 2H1PH 4Y4HB 3S36X 5E6IA 5C2BH 2AK1H 1CE6A 4ZAKA 3NIFF 1GAFH 4RMUA 5I71B 3V7AG 1NBZB 5GGQL 3NCYS 3L5XH 2DJ4A 2OZ4H 4LIQL 4MVBC 3PNWB 4FQXD 5HHME 3RIAK 4I2XB 5HVHC 1NKOA 1CICB 5FUOH 4MNQD 5C0FA 3IFNL 1M6OB 1F11A 4PJEE 1XR9A 5IMLA 2O61B 5HYQA 1W0VB 2WP3O 3HG1A 4HAFA 4P23C 3SE3C 3ZKXC 2NPLX 2ZG2A 1AQKH 2QHRL 3O41B 5DC0A 4ONHA 4PJIE 4NPYB 4U6YA 2ZNXA 4WHCA 2E7CA 3ME0A 1RJCA 4P9MH 4X6DA 3IU4H 1S7RA 3ZTJG 5MI0B 4EOWL 1Q0YH 4HHAA 3MV7D 4G43B 5GGTH 4V2CB 3QNYA 4I13B 2EE9A 2F54A 1TQBC 4YWGL 5GIRA 4PJ5E 3ARWA 3MLSL 3VFVB 3U9UA 4WHYH 1OPGH 5JDSB 3CMGA 3ROLB 5L6YL 3P4MB 3VA6A 3D0VA 3SGDH 2VXTL 4RGOH 3IJYB 5F70A 3S5LG 1FL3A 3KR3H 2CGRH 3EYOA 1DVFC 5BO1H 5CMAB 1NCWL 1E4JA 1SY6A 4DQOL 4PBWD 5TGBB 4P2RE 4QT5B 5DJ6A 2BNQD 1S9XA 2H2PC 2UY7A 3FB5B 3S7GA 3WO4B 4C56D 1KTRL 3MJ8B 4D0CB 1QSEA 4UILH 1MCEA 5GGRY 3KPMB 3PABB 4EDXB 2P5WA 3SDXF 3C6LA 1RY7B 5KOMC 3FO9A 3BKYL 4HZLA 4UTAL 1GOFA 4ZDHA 4DWHA 2ZCLL 3MREA 1L0YA 2DJUA 3RIAF 5HYJA 1XR8B 2X9XA 5ADPH 3KPRA 3NFPB 4U6VL 5DQJB 1K3IA 1HWHB 4A6YL 2OTUA 4NDMB 4LSUH 3P11H 3WSQL 3VCLA 2YA0A 3S3PA 5FGRA 5B4MC 4LPWA 1NLBH 4XGZA 1HHJB 5I1DA 4WI3A 4X5LA 1NCDH 3CFEA 2DKMA 3ULUD 3S36L 1X4YA 3ZKND 5HGDA 4JFHE 4X9FA 2NNAA 5HGGS 3PP4L 3E8UH 3IFOA 5BV7H 2HN7A 4P59H 5I17A 2PYEA 2WQRA 1VA9A 1I8KA 4AEIH 4F7MB 5BVJA 3QUKA 2WK2A 5CD5D 3MRFA 3BEVB 4DFIA 4JKKA 1P6AB 1BZQK 3RX8A 3BKCH 3OXRB 3HUJB 5T1LA 2B4CH 3HMXL 3RWGB 1MAKA 3VFUA 5F72S 2X7LA 1OGTB 4DZ8B 5DEGA 2VZSA 5F1NB 3SO5A 5IBUG 4FTVA 3SKMA 2JK5B 1CGWA 1YEJL 4YDJB 4XCCL 1UZ6F 2DTSA 2G60L 4RDQF 3TVMD 5DEFB 4WI4A 3IGAA 1BWWA 1KELL 1YEEH 3GBLA 3FFCD 5E4EB 4NHUB 1EHLL 3HNTH 2Z92A 3SCMB 3F7YB 2X4NB 3BD3A 4U1HA 3WKML 4D0DA 1YMMA 4LLQB 3N50A 4JVWA 2MMXA 3FFDB 2J5LC 4LLUA 4I2XE 5GRUH 3UJIH 1JYNA 2UZYB 1WIUA 1KJ2L 3U0WL 3TCXA 3B2UD 3Q2CA 1OAKH 1YY8A 5DUPH 2WZPD 5HHXH 3SJVD 5H2BA 3LD8C 3TT3L 3L3GB 1MHHB 3C6SB 1TJIL 5K9JL 1CD9B 3FO1B 3HI5H 9CGTA 1BEYH 1KIPB 3KDMB 3ULUL 4PR5B 4PGBB 5BRZD 4M6NH 4M1GH 2V7NA 1Q8MA 4HK3J 5D6DC 5C8JA 4MX7A 4XP9L 2NY1B 3REVA 1FNSH 3C60D 5AZEL 1UA6L 3EO9H 3QDMD 3B5GA 4MXVE 4CJ0A 1KEML 2X10A 3KVQA 1T80A 1NC2A 1G0XA 2B39A 2DM4A 5C1MB 3SE4A 2DQGH 3MV8A 2IG2H 3QWOA 4JHBA 5I19L 1W0WB 5GXBB 1EJ6A 5CJBA 1WZLA 1V8HA 5DEZA 5T3XH 2OSLA 4NZTL 4XWOD 5TFSL 5IFAH 2QQLL 2Q7YA 4QRPD 2LFGA 1FNEB 1UXSB 2FLBT 2WUBL 1CGSH 3WE6B 3WIHH 1BD2B 4H1LG 2UYLA 4M8QB 3HZMB 3QCTL 3DYPA 4N1EA 2X1QA 3MJ9L 2F15A 4R0LA 4UTBH 3VFWA 4JRYA 3BVNA 1MCBA 1A6WL 1A0QL 1J7VR 2D3VA 3F62A 1XF3B 5K59E 1S3KL 2VXUH 3SDYL 4PJ9D 4JFQB 2D7TH 3HE7C 5F7EH 4ZUVB 4NUJA 5IG7A 5FK9B 1Q0XL 4G8EA 4KH2A 2ICWI 3T3PF 3GJFB 1TJHL 2IH1A 4KI5D 2UV3A 2DM2A 5DF0A 3IDJA 4JFDD 4XCFH 1RJYB 2BXZA 2E7BA 2W92A 3CLEH 3SDXA 1S9KC 1H0DA 1CQKA 1SEQL 4A2LA 2F5AH 2FX7H 3FO0H 5GHWH 2EDFA 2APWA 4Y88A 1DEDA 2C3HA 1X5JA 3IB4A 3VGHA 2VIRA 3WHXA 4BZ1L 4L29A 2QKIA 3ZSTA 3HR5B 3L95B 4MDJA 4TSCL 5LWYL 2VDNL 2DQTH 2CDFA 4JDZA 2HFFB 2PW1A 4UAOB 1OTTC 4QRSA 4K8RD 3HUJE 4FZEH 4XC1L 4ZXBA 3BISA 5AWNL 4JY4B 1OTUD 2J12B 1A1NB 3AMKA 1H3VA 3MRIB 2BHUA 3NIGE 4N1CA 4DGYH 4JZJA 1T1YB 1EO8L 3S9DB 1UXWB 3F6IA 5I2IA 2M8XA 4P46A 5CLWA 1KN2L 4L4TA 4S11A 3W82A 1WC7B 1JNJA 3EW3B 4OLUH 5HDLA 5D70L 1KPRB 4HS3B 1D9KB 3TEUA 1RUQL 3QQ9C 5DUMH 3QIWD 1CR9H 1CS6A 4LASL 4OD3L 2P8LB 1LE5A 1S9WA 2C7UA 1NGYB 1UACL 1BF8A 4A2MA 1SJEA 2PTTA 4PRIE 3SDAD 4DUXA 3OXSB 4J6RH 3U0TB 3NZHH 3DVGA 5CZXC 4PV8A 5F88A 1KCSL 2XN9A 2EE3A 5JUEH 2Z31A 2GCYA 1A6UH 2D7PA 4JFZH 1V5JA 1F45A 5T5NG 1T20B 4X4XB 5EIIB 1U6AH 4RMQA 5JPNB 1KXVC 3UZEA 1KJVA 3IF1B 5DK0B 1NMAL 1B4JH 4JDTL 5F7WC 3T2PA 3ZKSD 3CFBB 1QPPA 3SN6N 4HWZB 4OF7A 4I3RH 5GGRA 4G8GA 1RZJL 3U83A 1FJ1B 5J0BA 3AB0C 2A77L 3GMOB 1N3NB 2QQKH 4ZPVA 4K8RL 4HWBA 5LBSL 5J13C 2A6KB 4R4NC 2OI9C 1PKQA 5EU7C 3B6SA 4MA8H 1E4WH 5B39G 4QOKD 1E4KA 3UZQA 3AGVA 1JF6A 3LKPB 1AGCA 3D3VB 4GKNA 5JNYB 2XTLA 5J8OA 3JV5A 3U48A 5A43C 1NJ9B 5FFLA 4UMGA 4FMFA 2DQHL 4W4NA 1G7QA 1A6ZB 3MNWB 1HINL 2FO4A 2OI9B 3TGXA 5L8KB 3CSBA 4PG9A 1BMGA 2F53B 2PW2B 4ZQKB 1JK8A 1I1YB 2XWBB 2N7AA 5J1SC 4JB9H 4NN7B 5E2TL 1J86A 1XIWC 1MJUH 1DFBL 3D1MC 4PJHB 3VGFA 3ZE2E 1HCVA 4YBHA 5EWIL 4LP5A 2HMID 1X5IA 5C07B 5IB2A 3SEPA 3DXAB 4APQA 4RBPH 5KVDH 2HA1A 1G9NC 3EBAA 1LP9B 2HVKB 4F57H 1KLGB 4MJ5A 3R1GH 4CW1B 4OLWL 3THMH 1E6JL 4FP8H 4U1NA 1P4BH 4CMMB 5IMKA 4JEGB 3ULVF 5DFVC 5TE7L 4WI7A 5A3IC 2X4RB 3HZYA 1FZMA 2BX5A 3BZ4A 3CU1A 5SWZA 3OKMA 4DJMA 4MJ6A 4KDWA 4FNLL 2VITA 1F5WA 2CMRL 4H0GA 4M3KB 4M6MH 3VE0A 5DTFA 5I1IL 2GUOB 2JJUA 4Y2DD 1OAXH 2NZ9D 5EU6B 3TLRA 4LHUB 1GOHA 3TNNB 1B6DA 4EIGB 3LPWA 4HFWB 5AG9A 1KPVB 4LKCB 1AO7B 1ZOXA 2CIIB 5L2JA 2JCCA 5I9QC 3LEXA 3WIIL 3SE8H 1P1ZA 5E1HB 4XRCA 4GJTB 3EJYD 3KLAB 1W8OA 2NX5B 1QEWB 2Q3ZA 4J3UA 4JFED 4TN9A 4LAJH 1X5GA 1R3IH 2YOCA 3BFOA 3WS3B 3P2TA 3P73B 4MXWH 5FO8A 2H32B 4L8CB 5F7DB 5DRXB 4YFEA 5JOFB 4HJGA 4R4BB 4OCLC 1QR1B 4JCMA 4R97C 2Y4SA 4H8WH 3MRBA 1LEKB 2BVUA 3R0NA 4WI2A 5M94B 4P3DA 1GGYA 4E41B 2NY0D 5D7LA 3DVIA 1JNHA 4NM8L 1KXQE 1Y0LB 4Z77A 4EVNB 2XOTA 3BYYA 2F5BL 4EI6A 1H3PH 1MCPL 1C08A 1QR4A 3BZFA 3HC0B 4X80L 5ELIA 4HKBA 3SGDI 4G7VH 1CL7L 3OKDB 4OFPA 4OTXL 1WBZA 1RVFH 4IMKA 3H9HB 1UJ3C 3MRLA 3GSVA 2QJDA 5FM8A 3U4AA 3BGFB 2FJFA 2P24B 3G04A 1WV7T 4S1DC 3VFMB 5HSFA 3GUTB 4BM7A 1YJDH 1EAPA 5FA3B 3ARXA 2VZUA 5IM7B 1NCUA 4MXQC 4ZSOB 2IH3B 5F1SA 5F9JA 5EIQA 1FBIH 2V2WA 5GZOC 1XGYL 4MQ7A 1SYVB 3LEYH 5H37H 1OW0A 1ZT4A 2DKUA 2FR4B 4YHOL 5EOCL 2Z4QA 2NZIA 1RU9H 1Z5LB 5FYJU 4ZFFA 2FEEI 5IMOB 5LGJA 1IEHA 2H3NA 5D2LB 4U6HB 1T0PB 5IW1A 1KEGH 4PS4H 3KYMA 1YNKH 4L8BB 1DL7H 4R4FL 1B3JA 3HB3D 3MRGB 3FRPA 2JIXA 3M45A 1TTUA 2F53E 2CR3A 1CIDA 3LZFH 1XH3B 3VI3F 1IILE 3LS4L 5DR5H 3CDGB 4LSVH 4PJHE 2WWKT 1J1PL 3DIFA 4HIHA 2L7JA 4GAGH 4JAMA 5C07E 3DXAE 4TTDC 2GT9B 3BHBA 4OIAA 5JQ6L 4DCQA 3DX9A 3PXHA 1Y6NR 2BVOA 4WEUD 1IAKA 5MENA 2ARWA 2AS5M 1LP9E 2BRRH 4HPOH 4NT6A 1CFSA 32C2B 5KS9F 1AP2A 2DDQL 4Z7VB 4O51A 2XYCA 3VG0H 4M03A 5HVWA 4H5SB 4K3EL 1CU4L 1FORL 3P9MB 4PJDB 3TO4C 1W72H 5EPMB 5JOPD 2VC2H 2JELL 3O3DB 4NCC1 4OCWH 4GG8B 3CFCH 2YD2A 5B38A 1KCUL 2R0ZH 1A21A 5EU6E 1S5HA 3K80A 4P49A 3CVIH 5LCVL 4E0RB 4JE4B 3DVFA 4Z5RB 3BP4A 1QLFB 5D7IF 3WNPA 2R2HB 3VXTB 3G6JF 3GIZL 4KROB 4P9HC 4F58L 2DF3A 2CIKB 5CJXA 2UWEB 5CUSH 2NX5E 3GSNA 2FZ3A 3QO0B 3NFSL 3GK8H 3VXQB 3KJ4B 3DX7B 4QYOA 5L7XL 4U1JB 1ZHBB 3WN5C 4GMTL 1IGTB 2W0FA 4FS0A 4YAQA 2A2QT 1BFVL 3SOBL 3MZTA 1I7UA 2W07A 5IHLB 3QA3B 4N8VB 1M7IA 5INDB 7FABH 2X70A 5C0EA 3AY4A 1T22A 1NGZA 2VXSL 3O3EA 4KJPD 4E41E 1KPUA 2OJEB 4IRJA 1PAMA 2BVPB 2M1KA 4WFFE 2BOBB 3OR7B 3L1OL 4OCXH 5CS7A 2RJMA 3GMQA 2BFVL 4R7DA 1P7QD 2J8UB 1LK2A 3QULA 1HQ4A 2ITCB 2AJZA 3PF2A 3RY4A 2FJHA 3SQBA 4WFGD 4OQ1A 1K8DA 3RIFK 1ED3A 3O4LB 3BP5B 3NH7L 5IJKA 3MJ6A 1IEAA 4OD1L 4GQPH 3IXAA 1OHQA 3VFGL 2A6JB 4ZNCD 3K3QA 2PXYC 4Y89A 4WTWA 4XP6L 3AXLA 4GKZB 1I1AD 1DLHA 4QWWC 5E6IC 4ZSOE 1P84K 4JREC 4ZAKC 5SV4A 5EU4B 4H26A 2EDHA 3FQXB 1MIEL 2SEBB 2J88H 3FT4B 5J9PB 1PYWA 3CMOH 3PL6B 5DT1H 1MI5A 2MNUA 4FRWA 1YEFL 4C59B 1EEQA 2CO6B 1A6TB 3Q6GH 3QXDB 4KV5F 5D2LE 4AM0A 3EYVB 2MKLC 1H3WM 4RISL 5E6IB 2DICA 1BM3H 3LH2L 1CE6B 2OL3A 3MLUH 4ZAKB 4HC1A 2FO1A 3LMJL 3FZUD 2H9GA 2B2XH 4CU8A 1FFQA 2FATH 3ZYIA 1OP3H 2A73A 5B3JE 4L3EA 1RFDL 1A1OA 1S7UA 1N0XH 3QHZH 5C0FB 4NQED 2EKJA 2P8MB 1T03H 1XR9B 3TA3D 3HHRB 4DOHB 1VERA 4MA1B 5HYQB 5IV2A 3HG1B 5HJ3A 1X5XA 5BMFH 1MFNA 3X11A 2MQ0A 4KJYA 1MCWM 1QFUL 3DETC 2HJKA 4ONHB 1U3HA 2WIIB 1XGRA 3P77A 4U6YB 1LDPH 5FUCC 4BUGA 3S5LA 4TSBL 3V0VB 1IKFH 4X6DB 3RIFF 4QHLA 5L9DH 2AABL 1NGWA 1V7MH 5B8CA 1TVBA 4S1SH 2YWYA 2X4OA 4HHAB 1RURH 2I60H 4UQ3A 4Z7VE 4BFIA 5FKAA 2OXGA 2F54B 3MYZA 4HX1B 4MD0B 1O7SA 4ZUWB 1QYGL 2WNGA 4PJDE 5DRZA 5F1OB 5DHXB 5IB4A 3U9UB 5HDOA 4U7KA 1ZHLB 4ELMF 1C16A 3D0VB 2H45A 4JZNB 3C6LC 1MREH 4XPAH 3TT1L 3QDHA 1J1XL 1BBDL 4NNPL 5J4MA 1T2QL 1UH4A 4GXUN 4U1GB 2BXYA 5I1HL 1S9XB 1OF2B 2X41A 3ARBD 3D6GA 3QHFL 2ADJB 2PR4H 3I2CL 5KS9A 4WNQA 2UVEA 3BESR 2P5WB 2IAND 5EH1A 2R1XA 3MMEB 3DHMA 3T8XA 5SX5H 3FO9B 4MNGE 4NRZA 1T1ZA 1A9EB 3DJ9A 2GJ6A 4HZLB 5FYKU 3N85H 4ZDHB 4YFLI 2AAVA 2YKLL 3MREB 3PWLA 1MRCL 2EE2A 1A5FH 5EORL 1RK0A 4KPHH 5C0IB 5CIPA 3MODH 2ORBH 5D7JB 1Q9WA 4LNRB 2OTUB 2C3WA 1HDMA 2E9BA 3K74B 3RTQA 5D7IA 2HVJB 3ULUF 2K3TA 1YEKH 3G6JA 4HJ0D 4XGZB 1FAKT 1Y6MR 5KOVC 3NABH 2AQ1A 3QDGD 3CFEB 4XCEA 4XC3H 2O5ZL 1FDLL 3HN3A 1OLZA 5HGDB 4Z76B 3ET9F 3SGEH 2WANA 2HN7B 3SQOH 1UB6B 4CNIB 2PYEB 1JHTB 1I8KB 4M62L 3H7BB 2FHFA 1BQLH 1FFPB 2DMCA 1MFCL 1MFBL 3BQUB 1YECH 2CRZA 3MRFB 4LCIL 3A6CH 4DVBA 1NAML 3GSRB 5T5NF 3P4OA 4WWKB 5L8LB 3QIUD 3HE6D 2VLJE 1KCRH 4HCRH 1YEDB 3T4YA 5CJQH 2IAMB 1OTSD 4GSDH 3PWJA 4HG4K 4KRLB 1OP5K 4WDIA 2Z91A 3MQIA 3SKMB 3VW3H 1N6VA 4LCWB 1T7XA 2DMBA 3GJFH 4NQCA 1CF8H 1QRND 5H94A 3T4AA 4AMKH 4LP4A 4XCNA 2P49B 3GFUA 4GXUM 2R0WH 1I85A 2FBJL 4OAWA 3RVTC 2RB8A 3CLFH 5DWUL 2Z92B 2XIDA 4IRSC 3WLBA 4D0DB 3BT2H 1YMMB 1S7TB 2LU7A 4F9PA 4YHLL 1F4HA 1SVCP 3Q6FB 4H20L 4LLUB 4GT7A 5IBLC 3WJJA 4DOHE 3HG1E 4XPGH 2VLRD 1FLTX 3QCVH 5LGHH 3GMRB 5D8JL 5EZIH 1F3RB 3TO2A 5LXGH 3GRWL 2IBZX 2V9TA 5DHYA 1EO5A 3P0YH 3LQAH 4FQXA 4KY1H 4A6YA 4M7JH 3MLVH 5IF0A 4WGVB 4TVPE 4X6DE 4LQFL 3WLWD 1CXLA 4MNQA 1K9TA 2AGJH 3UXFA 4QHKJ 2V7NB 2IF7A 1QQDA 3SE4C 5MP6L 4BK4A 3MBXH 4MA3B 2F54E 2NW3B 4S1QL 5C8JB 4MX7B 1QBML 4TQEL 4GAJL 2CRYA 2ZWLT 4J3OC 1T7WA 5FUCE 3ABZA 4H1LA 4LSRL 4I3SH 5EZLA 2NY6C 1XF4A 4G8FB 3TBSB 3WNNA 4PD4K 2MCG1 4OM0L 1J87A 4R0LC 1U95A 2CLRA 3MV7A 12E8H 2HKHH 5HHQB 4NZUH 5C9JB 4IJ3B 1QSEE 4G6AC 1I9RL 2P5WE 3DUUA 3V52H 3HMXA 2R4SH 2XRAH 4YR6B 5SWQA 3F7RA 5C0JB 2EYSA 3BPNC 1X5FA 3OKEA 4JRYB 3BVNB 3RWHA 4ELMA 3Q0HA 4PRPB 2EH7H 4YHZH 4WO4C 4FMKA 1VPOH 2BNQA 2G2RA 3KPRE 4NUJB 2ZOKA 4KI5F 3KYNA 4PBVC 4C56A 4HWNA 4K94C 4KWUA 1NDMA 2IH1B 1K6QL 3K8KA 4EKXA 5TPWH 3RQ3A 5E2UH 1TFHA 4JPWL 2DOCA 3LEVL 1RZIB 1IAMA 5EOTB 4DGIL 4QXUL 1H8SA 3WKNA 3FB7B 1IFHH 2E27L 1KLUA 1GZQB 4QXGH 3KPPA 1MJJB 2X4PA 1N0LA 1KJ2A 4OSUH 1DJSA 2PYEE 3ELAT 1X9QA 2VIRB 5EZJA 1FZKA 2XZAL 5F96L 3WHXB 3DARA 4JZJC 2QQQA 4MDJB 4WUKL 1FYTD 4M6OH 1AGDA 3VD7A 4XNUH 2PW1B 4P46C 5F3HA 2E5EA 4QRSB 3MCKA 4ZTOH 4R2GD 4U49A 1IQWL 1DQML 1EEYA 3OJDB 3O4OC 5FYLH 3FRUA 5GGSY 4ZXBB 4YC2B 3QNZA 2A6DB 4KDTA 3TIDA 3LVEA 4M48L 3UYRH 4HUWA 1XGQA 2DD8L 2COQA 2X4QB 5I2IB 4FTVE 3O0RL 4AG4L 3H3KA 4LCWE 2OBGA 3O4OB 1D7FA 2VR9A 1MPAL 1RZ8A 2YSSB 3MRKA 3MRNA 4NN6B 2P46B 1NBVL 3O6MH 4HUUA 5I8OL 1LE5B 1YMME 4PRBB 1SJEB 4EIZC 1N64L 4M7LH 4PRHD 2VN4A 5IJVA 4I4WA 3HMWH 3EHBD 4OQTL 4PV8B 2VQUA 3DO3A 3TVMA 3MJ9A 3P4NA 3BUTA 4MVBD 4NRYB 2XN9B 4DN4H 3JWDL 2Z31B 3GSXA 3FFCA 3MC0A 1GPOH 2PYFA 4FQIL 5ALCL 3QH3A 1JHKH 4GXVH 1ZHNA 3B83A 5CGYD 4PTUA 3NIFE 3C5SB 2VDPH 4HULB 1J12A 2CD0A 4UV7H 3FQRA 3QDJD 2GY7B 4OI8A 3CFKB 5B39A 4KQ4H 4P5KA 1RIUH 3DUSA 5GGRB 3SJVA 4G8GB 3U2SB 1E4KC 5BOZG 1VFBB 2CDGB 4V1DB 2EDKA 2XTJB 1F3DJ 2VDMH 4LOUC 3IJSA 3U7YH 1LE9A 1H15A 1SEBB 1UH2A 2P5ED 4PJBB 3K0WA 5BRZA 1JGLL 3I6GA 4F7CB 5K9QI 2H32H 4ACPA 3L7FA 3HC3L 3VFSA 3B6SB 3QXVA 1ZMYA 1L6ZA 2C26A 2VRAA 1N8ZA 5FCUL 1V3KA 3VFNA 2ILLA 3IDXH 1U8OA 4LSSL 5FOBA 4Y19D 5ICXB 2A74A 2HRPH 4X7CC 2VSDA 3C60A 2PO6B 4W6WB 2F8OA 5C7XH 3QDMA 2GFBA 2H2PD 1YN7A 4APQC 2FO4B 4NYLA 4P4KD 4JRYE 1K5NB 2C3GA 2Z8SA 2FH8A 5FXCH 3PIQB 3SDCD 1JK8B 4MD4A 1Y18B 5JHLH 2LTQB 2PNDA 1R5VA 5IVXF 1H9VA 4G3YH 4RGND 3REWB 4QRPA 1XGPA 3B9EA 1YQVH 2OJZH 5SWSB 5IB2B 1T04A 4APQB 1ZT7A 2YUZA 4CADA 1E0OB 2AEQL 4XBGA 1MRFH 3QQ3A 4Y1AB 2Y72A 3SDXE 1G7HB 3U4EA 4PJ9A 2A6IA 2AQ2A 1FPTH 3PQYD 2NY3B 1P5VA 3EKCA 2K1MA 3O6FC 4Q6IB 3GHBL 3RA7L 1JIBA 2VJXA 2XXCB 2YD3A 3HZYB 3RWJA 3BMVA 5I76B 4MB4A 1FIEA 3QUML 4JFDA 1KGCD 3X3GH 2VITB 1U8KB 1WSST 1WZMA 3RY5A 5HDQL 4KZDH 1ITBB 4OZGB 1Z9OA 4IRZH 2HFGH 4KQ3L 1YY9C 2XG5A 3PGDA 4NKMA 1OCWL 4KKBD 1B9ZA 3CX5K 3WFEH 4P5TC 4DUWA 2G5RA 1A7QL 1JE6A 2JCCB 3BDYL 4JKPH 3LEXB 5D2NA 2A9ML 1VFMA 1P1ZB 2C9AA 1JYWA 2XKUA 4U1LA 4XRCB 4S1RL 35C8L 1Z9SA 2I27N 4F15B 2XWJB 1FZOA 2R4RL 1ZE3C 3MRCB 1MCLA 1ADQH 4L4TE 5A2JH 4UU9B 5HTSA 1OT2A 4ODTH 4H88H 4OD2B 3CK0H 4LSDA 1VACA 2WLZA 4HJGB 1MAJA 1GXEA 3G6DL 4QTIH 3TV3H 1DEEA 2BCKB 3WFDH 2PUQT 1CDGA 2VDOL 4ZTPL 4P3DB 4IMKC 2GKIA 3LAFA 1JNNL 3W9DB 2EXWD 3K4ZA 4WFEE 3U82B 5A40E 1JNHB 2XN9E 5FGBA 1F6AA 4YDKH 1XZ0B 3TWCL 5C0CD 1UZ6E 4U31A 3QIWA 3EYUL 4EI6B 3BZFB 5TDOB 4HKBB 2BHYA 1WITA 4JFPA 1YEIH 4RCAA 3SDAA 1OARH 1WGOA 3GSVB 3BKJH 2P8PA 4HZAA 2FJFB 1OW0C 3G04B 1IMHC 2DQDL 4G8GE 5D1ZD 3FCTA 4C55A 5DD1L 1IBGL 4LU5H 2Y36H 2XTJE 2J6EH 4MNHA 1AXSA 1G7IB 3C2SA 5F9JB 3GI8L 2ADIA 3MUGA 4MQ7B 4PJAF 4BZYA 3QEGH 5JA9A 1AXTL 1PKQE 4DKEH 1DUYB 3DV4A 5C0GA 2Z4QB 4FQPA 2P45B 4PJCB 5E5UB 3SKJL 3V5DB 3WXWH 3V6ZB 4YHYC 1QFWM 2FECI 2H3NB 4OCYL 3WO3B 4DAGL 3ECBA 3X3FL 1C5CL 2Y7QA 4DW2L 4K7FA 3KYMB 1FHGA 4JHZA 5JHDB 1TLKA 1U8HA 2IQ9L 1KJ3H 2L4OA 1UWEH 2JIXB 4OGAD 4NO2B 5C70A 3RX7A 2DLTA 5HI4D 4QOKA 4JFYB 1AC6A 5A1AA 4ZFGH 1NFIA 2KH2B 3SGEI 2AJ3B 2BNRD 4JAMB 4YDLC 1MCHA 4UT6H 5I30L 5GRJL 4WCYL 4DCQB 3DX9B 2NTFA 2AJXL 4GRMB 4OFKA 4Y1AE 1DBML 4ZS6D 3HAEG 4F33B 1J9CT 4J3VA 1AR1C 1GJIA 4RX4D 3WUWG 4NWTL 4ZD3H 4X8JB 5GGSA 4NT6B 5ANMA 1GC1C 2ZSVB 3TFKC 4U2ZA 3WFCL 5E03A 4JFFB 5I18H 2ERJC 4M1CD 4YDLB 1JWUA 4NJ9H 5IVXA 1OSZA 1CZ8L 5SWZE 1FNFA 3MCLH 1DQTA 3T3PE 4N0UA 2JB5L 5B38B 3HZVB 4YXHL 4KXZH 4OZGE 4Q97A 5CJXC 5I66A 1IGIH 3S37H 1MCCA 3D0LA 3HR6A 5CJ8A 4N0YH 2Q8AH 2CLZA 1YUHA 1OSPL 2NXZD 1WEJH 5F93C 2JCCE 1AGBA 4JFXB 5TQ2L 3UCRA 1I7RA 1W2KT 1INEL 4HIJA 2EIZB 4N90D 5FUZH 3L3JA 1D5BA 1U2HA 1AGEA 2VWEC 4Y2DA 4NGHL 5IT2L 1JF5A 2FZ3B 2FNBA 3AY4C 5DA0B 4QYOB 2BJMH 4IRJC 5I75B 3LSOB 2DWDA 1BP3B 3KJ6H 4TVPH 4YAQB 3BUYA 3RP1A 3T1FB 1CLOL 4EUPG 5HVFB 3OJMB 3SE9L 2YK1H 4NO3B 1MFEL 3MV9D 1KB5L 4XHJD 1JP5A 3JWOC 1M7DA 5IROA 3QQ9D 2X70B 1AD9B 5C0EB 1T22B 4JFEA 1A3QA 1K4CA 4O9HL 5ITBL 1H5BA 1KPUB 4IRJB 4Z7QE 5C0AD 1UWXK 3F7VA 4U1SB 5IJKC 4XVUD 1NH6A 3MXVH 1GZPA 1HIMH 4GW5A 4NQXA 5E2VH 5DQDH 3GMQB 4R7DB 3QULB 2EYRA 4G6ML 4PY8I 3V6FB 1SY6H 1JZ2A 2AJZB 5KVMC 5T3ZD 3QPXL 2FJHB 2QADD 4NO0D 3AAZA 1K8DB 4OCRH 3MLZH 2NY4D 4LQ1A 1MCOL 3ZHKA 1IEAB 1CTOA 3I02A 3L3OA 2QSQA 2AEPL 3IXAB 3KPSB 3VDBA 3T08A 4O2CA 4NNXA 5HPOA 1JMXA 1AGFA 2R0LL 2N1KA 3ZTNH 2J8HA 4H26B 1Q72L 3BAEH 3RNKB 5D93B 3T0AA 2ZUQC 3DI3B 1FLRH 1PYWB 3TIEB 1O0VA 3UROR 2R1WA 3IKKA 1R3KA 3QJHA 3LY6A 4X4ZA 3OBAA 3D9AH 1ZAGA 1EFXD 1IGMH 4R4ND 1CQYA 1T3FA 1ZEAL 3QEHA 3U7AA 2O5XH 1BZ9A 4DN3L 4OLVH 1FH5H 3U30C 4YUEH 5HYIA 3I6LD 2H9GB 1FVEA 4KMLB 5IP4A 2E7HA 3HNSH 4BSJA 2MCPL 1U3HC 5T1DH 2EECA 1A14L 2Q1EA 5D71H 5ITFB 43CAB 3KYOA 1A1OB 5T5FL 5MHSD 4Y8AA 4PD4J 4PB0L 4PJAA 2XZQL 5B8CC 5IV2B 5FHAL 3RY6A 5HJ3B 3LN5B 3O9WD 1EX0A 1IC7L 1CI5A 4AEFA 3X11B 3KS0J 3BZEB 4WI8A 1XGRB 3P77B 4X7SL 2LV4A 2YUXA 2ZOLA 1IGCL 3AUVA 3HNVL 1EA9C 1Z3GL 4U7MA 3TESA 3H0TA 2YXFA 3U36A 2GI7A 1NGWB 1TVBB 2BZDA 2KL6A 1ZK9A 2X4OB 4UQ3B 1PG7X 5T3ZL 4BFIB 3QFJD 3RWDA 2YR3A 5E00B 2Q8BH 1NMBL 5DRZB 3PJSA 1TZGL 1V7NL 2C1PA 2VOTA 4JG1H 1FFRA 4KRPC 1DSFL 1QG3A 5ETUB 1UEYA 1S5IL 3MRMA 2ZUVA 4M7ZB 2EEBA 2VDKH 3OKYA 2YBRB 2VXQH 3WNOA 2F74B 3H3BC 5IVZA 4PLKC 5EO1A 5E8DL 3RPKA 2VXVL 3KWWB 3BDXA 4MCYB 4WNQB 3HCVB 5KSAD 2R1XB 2GHWB 1AY1L 5HI5D 3ULVE 2EEAA 2Z93A 3FTGA 1A7BA 3DBXB 4NRZB 1T1ZB 2GK2A 2ZUXA 3QIBD 3RTQC 4KZEL 1AR2A 4CJ1A 4HF5H 2DTMH 3PWLB 4E5XA 1INDH 1F42A 1ZANL 4LSTL 2W60A 3KLDA 3VXUB 4LVOC 1Q9WB 2NLJA 2K7QA 3GMPB 1BIIB 3SBWC 5FO9A 1CLZL 4B7IA 3UC0L 5JW4M 1OAYL 3MJ7B 5I1EL 2XZCH 5GS0C 4KTDH 4NC2B 4ODSH 3D85D 2ZZUT 3G6JB 3INUL 4IIQA 3SDDB 4K7PH 3BMWA 4KK6C 2IBZY 2H1PL 4Y16D 2HWZH 5C2BL 2AK1L 4IDJL 4OZHF 2WUCH 5EU3A 3EIFA 1NAKH 4KDVA 4LGSB 4Z7WA 3PE9A 3ARGB 4UINH 3DSFH 4X6BB 1SBBA 3KPLA 3MRDB 2E9JA 3QFDA 4FABH 1NCBL 5FUOL 3T0BA 4IHOA 2ZUWA 5E8NA 2R2EA 3EYSH 3ZKMD 5HHPA 1JPFA 1PD6A 2F58H 2JJTA 1AQKL 4UI2A 3KPSE 3MLYH 2R29L 2NR6C 4Y8DC 3P4OB 2N7BA 4Z0BH 3MOBH 1P7QA 4OI7A 3D2UB 4AK1A 4P9ML 4ZYKA 4ZUSB 4K55A 1I85C 1U92A 2WBJC 4JO2H 3IU4L 4L1HA 1RIHL 3B4NA 3GEWB 4AQ1B 1JPSH 2OXHA 1KB9K 4RQQA 4DEPC 2Z91B 1PZ5A 5E9DD 2APBA 3OF6D 1VGEH 4NCC2 1PG7L 3W39B 3KHOA 4NQCB 3WJJC 3MTRA 4ELKB 4C83A 3KNBA 2AKRA 4JO1L 1OPGL 5H94B 1I1AA 3L9RB 4XCNB 1RZFL 3U4BL 1KOAA 5C0RH 5GJTH 1FG2A 1BFSA 3KR3L 1JYXA 3WLBB 1RZ7L 5AZ2H 2DBJA 4QXTB 2EXYD 4DGVH 4FQXC 4L3EE 3D18A 4R90H 1KCVH 4BQBA 1WAAF 4QEGA 5EOCJ 3TZVC 4I5BB 5D96C 3T0VA 3TO2B 4JQXA 4BZ2H 4U1MA 2DBLL 2DQIH 5DHYB 3EDKA 4L8SA 3BXNA 4Y5YA 5IB1A 4NQEA 4TTDD 3TA3A 2FEEL 3OZ9H 4KHXH 1QQDB 5D96B 3RU8L 3VI3E 3CZFB 3P11L 1L9NA 4ZNEA 3MJGX 1J0YA 3GMNA 4H1LB 4UQ2B 4BUHA 1Z9LA 3ILQD 2FX9H 1BVZA 4WI9A 4X5XB 3QWRD 5FYJE 3OX8A 1G6RL 4HSQA 3TO4D 3ARDC 1QA9A 3HRZB 3MV7B 2WM0A 2EIEA 4G9FD 1IAIM 5BV7L 6FABH 1DLFH 5ABDE 1KTDA 2IPKB 4M9OA 2UUDK 1J05B 4MB3A 5GS2D 4LPUA 1YNTA 3BRFA 1A22B 1NAMA 4XNZC 1CFTA 2EYSB 5CEZH 3QUYB 2X4TA 3ZE1F 2GJ6E 3OKEB 5C08D 3RWHB 2BNQB 5GRZA 3LRGA 3VFRA 2G2RB 4C56B 1IVLA 4NBYB 3ARBA 4P99A 1T0MA 4M3JA 3MOAH 5T3XD 4PJ7F 4F80A 1NDMB 5GSVA 3CX5J 1VSCA 4EEEA 2IANA 2QSCH 2V7HA 2E7LA 5TDPA 3N1QC 5K9KB 1N5AA 2DIAA 2ZCHH 4P4RA 1KJMB 3NPZB 4O58H 4HH9A 3G6JE 2YD6A 2O5YH 1CBVH 1HSAA 4UT7H 4LIQE 1FRGL 3K1DA 4F7TA 1IJ9A 4HWBH 1YEEL 1KLUB 2GJZA 1P7HL 4P2OD 1QP1A 4WJ5A 3TBTA 4TUKH 3ZKNC 3UO1L 4F7PB 4KDTC 5EZJB 4WHYG 1FZKB 3IDYB 4Q6YA 5EOQH 3UJIL 4M8VA 1AGDB 4ZOBA 1GGBH 2D7NA 3GRWA 4B5EA 5CD5C 5C71A 2LU4A 3QDGA 2ESVD 1IRAY 4N8CL 3MLXH 1S7SA 1AHWB 1HI6A 3FRUB 1IAOA 2HJLA 1BEYL 5K9OA 2GAZB 5DJ2B 4OZHA 4C4KT 4Q9QH 3W9EB 4M6NL 5KBNC 1FIGH 3O3AA 4KHTH 1WBXA 4UNVA 3FQNB 4NQCE 4J4PD 3QIUA 3HTLX 3HE6A 3FN0H 3TVMC 1RUPH 4S0SD 5CKAA 4L1DA 1RZ8B 4MAUL 4PGDA 3MRKB 3T09A 2P43B 1BREA 5E24E 4WFHE 4HUUB 2DQGL 3C08H 2IG2L 1A3LL 4ERSL 1MHPH 5T3XL 3BP7B 5ILTL 4K71B 1QRNA 3PGCA 3WIHL 5D1XB 3B2UC 4TULH 5F6HI 3GSXB 1NLDH 4HIIB 5BVPL 3V4VL 4UTBL 1A4JA 1J18A 1U8PA 4D9RD 1ZHNB 4ONGH 5IFJA 4KXZI 5DJYA 1J1OH 2D7TL 3EJJX 3FQRB 4ORGA 4X6FA 5HGHA 1AJ7H 3LHPL 2VLRA 2I07A 1QLEL 4XNYL 5D9SA 3SJVB 3KYKL 5DC9B 3B2VH 1WAAA 3T2OA 1JGDA 5I6XB 3OQ3B 4XCFL 5DJ8A 2C5DC 3EGSB 3IJSB 3CLEL 1LE9B 1RUKL 4CBPA 3FB8A 1ZVSA 5KVFL 3FO0L 3AFLA 3PUCA 3T65A 4HH8A 5HY9A 2YPLD 3MV7E 4KVCH 1SJXA 1N8ZB 2WQ8A 5FOBB 1U8OB 1HN1A 2A74B 2VZ3A 4O5LH 3C60B 5BZWA 1WBYA 3QDMB 3QEQD 3GNMH 1YN7B 3VWJD 1H8OA 3QUZD 1J8HB 3TJHD 4FZEL 4ELME 4UB0H 3I85A 4BFBD 3D5OF 5F9WC 2E7MA 2BNQE 5DHVA 5C0NC 3TPUB 4PJ9C 4C56E 1R5VB 4BK5A 3ALXA 3W2DL 3EO1A 4DGYL 4QRPB 4YO0A 2ZCKL 1XGPB 1T04B 4DKDC 5F71A 1ZT7B 2EO9A 4I0PC 1A7RH 3QUXC 4LSPH 3JWNC 4XBGB 3QQ3B 5F9WB 3PHQB 3U4EB 4KMTL 4PJ9B 4OLUL 1I9IH 4MWFA 4X98A 5DUML 2IGFH 5I1GL 2FH6A 4NO5B 3BP6A 3WEXA 3IU3B 4XBPA 1V3LA 1KFAH 3RWJB 1FFNB 5D2NC 4J6RL 4OGZA 5FB8A 3NZHL 4P48A 4PJ7A 2ZJSH 5KSUA 3MRJB 1C12A 4GW4A 1RZJC 4M93C 1B90A 1S7WA 5JUEL 3ULUE 4JFZL 4NKMB 1U6AL 1KG0B 3CZJA 3QZWG 5EFIB 3IRZA 3EOAA 5D2NB 5DJCA 1B4JL 1OTUC 2ADGA 4G6JH 3NCYP 1I3UA 4Q0XH 4U1LB 1FYTA 1T1XA 1I1FB 1X6LA 4I3RL 1U8QA 1A1MA 1AFVH 2K9UA 3TPKA 1DANU 1HHHA 3HKFA 1P9MA 1FN4B 1E6OH 4NRXA 5EO9B 5FGBC 4DZBA 4ODXA 1VACB 3CDCA 1QKZH 3KLSA 4WI6A 2BY3A 5ACLA 4MCZA 4YIQA 2P7TA 2X05A 1HOCB 1RZKH 2DKSA 1E4WL 1AC0A 1O5DT 3KHQA 1DQLH 3RVTD 4PRAB 4IRSD 5HGBA 1JWSB 5AYUH 4OB5L 4LKXA 4NZDA 1FZJA 1FL5B 3FFCE 3IETA 1LNUA 3QIWB 2BMKA 4KJWC 4XPBH 3X17A 1HCFX 3DRTA 1MNUH 5D1QC 2XACC 4JFPB 5ADOH 3SDAB 3LV3A 3D69A 5MERA 4JB9L 3VFOA 5BZDA 4PRHA 4EN3D 2X40A 1ZLVH 2P8PB 1MELA 1MJUL 1U8MA 1RUMH 2QQNH 3SJVE 3ULVH 2MPAL 5GGVL 3FCTB 5K93A 3V8CA 4OLYH 3T0WA 1AXSB 3MRRB 5ISZD 4F57L 2ADIB 2D4FA 3MUGB 3DHJA 3R1GL 4TTGA 1NDGA 1C5DA 1MF2H 3THML 3QDJA 4RIRA 1P4BL 4AT6B 3QUMA 3DV4B 2NY6D 3T0XA 2AEWA 3WDJA 3QXAB 2AK4D 4LPXA 5IIEA 2Y7QB 2Z0BA 4FOMA 2VABB 4K7FB 3QDME 3ZE0F 1JWMA 2EDLA 1U8HB 3MFGB 3NPSC 2P5EA 5CSBA 4G6AD 3ZHDA 5CCKH 1J8HE 3MUY1 1EVUA 2MJWA 2XA3A 3WUWA 4ZODA 4QOKB 5I8EA 2Y06L 3SE8L 4Y19A 4QRPE 4N0CC 4HUVA 1NFIB 1NMCC 2EH8H 2EC9U 4YBLB 4WO4D 2NY2C 5F89A 3NPSB 3N9GL 2X9YA 2HMIC 4EI5D 5I73B 4NOFA 4P4KA 1LO5B 5I1AA 1P4IH 1R3IL 3PWPD 5EO0B 2XWTA 2ED7A 3SDCA 3UTZA 3F7PC 1ERNA 5KN5B 4MXWL 3GMLA 2E9IA 1A7PL 5CEXB 3MO1A 4X8XA 3PDDA 4H8WL 1SQ2N 4KI5E 2YUWA 5E7FA 1G7MA 5IVXB 1OSZB 3QI9D 2EZ0C 5J56B 4JFDE 3S4SG 4N0UB 1NEUA 2FGZA 4XWGH 1QBAA 5DZOA 3JBG7 3GSOB 1MY5A 3MXWH 4FFWC 1F2QA 3PQYA 5BS0D 1T5XA 4XXDA 5I66B 3LOWA 3ETBF 3KAAA 3MBED 3QNXA 4XX1G 3D0LB 4OZIF 1H3PL 2CLZB 1YUHB 4G7VL 3RZCB 1AGBB 4NC1C 1JI2A 5D2NE 4EQ3A 4EUPA 1LO3H 2VTFA 1IM9D 1RVFL 4G6FB 1EIBA 4GS7B 1ZS8A 2X6MA 1B0WA 2AP2A 1D5BB 5L88H 4Y2DB 3NAAL 2YMXL 4QRUA 4YHKH 2NY7H 1LEIB 1BLNA 3ZT6A 1YJDL 5IROC 3MA9L 3BIBX 4G6KH 5C6PB 2WBWB 4R3SB 3V5KB 5DFTA 2E8ZA 4OCNC 1IGFL 3BEWA 3STZA 2OX5A 3LEYL 2W0KA 5JPMA 5GISH 3V4PL 3D39D 4K9EC 5BJTA 1RU9L 1KB9J 3ES6B 4JFEB 3WL9B 5D4QA 3X14A 1JTOA 1H5BB 2OM5A 3TCLB 4FQCH 4RMTA 1ZGLB 3T3MF 4PS4L 4NWUH 4ZO6A 4K94L 3I3BA 1GZPB 4GW5B 4JN1H 5ACZA 3QCUL 5FYJH 4Y4FB 5F9OH 1P2CB 3K1KC 4NP4H 2ZKHH 3ALWA 3FL7A 3O8XB 4RAUA 5DJAB 3LZFL 3AAZB 1C7SA 1FNGB 1AIFB 4ODWB 1ZLUH 4I3GA 5HGAA 5KVEH 2NY0B 4XH2B 4DUVA 3I02B 2R2CA 1AQDA 1S7XA 3WFHA 4LPVA 3OKNA 5GQBA 5C0CA 4NNXB 5D5MB 5TH2B 3VH8B 3IDNB 4ODUA 3H8NA 3TBYA 2YEZB 2YD8A 4HPOL 2BRRL 1L7IL 1CT8A 3TH3T 5T1KD 2JJWA 1BQHB 4KTYA 3BPLB 2CDEA 2R1WB 1F6LL 1R3KB 4L9LA 1QFOA 3QJHB 1RAMA 4JY5H 4XI5D 2WLYA 5D1ZA 4XAWH 1W72L 5DK2A 3QEHB 5E1AA 2VC2L 1BZ9B 4TUJA 3RY6C 1BOGA 4RFNC 4OCWL 3CFCL 5GGQH 2ICWA 2R0ZL 3DV6A 5D6DA 4LIQH 3U0PA 1WCBB 3CVIL 2CH8A 2XA8H 1MEXL 3IFNH 4QOKE 5DVLA 1C8PA 4QY8A 1LO4L 1ITCA 4X7TB 4IMLA 3NGBB 2QHRH 5CGTA 3OGOE 4HBCL 5KAQG 4M61B 4WV1B 2JKXA 1DBBL 5DJ0A 5EUOF 1LO0L 2VZTA 3DX8B 2ZOLB 3ARVA 2GIYA 3EZ8A 2OP4H 1OM3L 3U36B 3RBSA 4J1UB 4EOWH 1L6XA 3LKNA 1PDKA 1KB5A 4YWGH 2X4SA 2XFXA 2BNRA 2CO7B 1ORQA 1F02I 3PJSB 5IVXE 2AXJA 2EDNA 7FABL 2VXTH 2X09A 3O6FD 4NUGH 4N0UE 1AH1A 3L3DA 1X7QA 2FX8L 5IFHH 4RX4A 5H37G 4OCXL 2V5MA 1KACB 4D0BB 2HTKD 2EKSA 3BIKA 5IVZB 1YYLH 2OCFD 4JO4H 43C9A 4ONFH 5EO1B 3GBML 5FAAA 25C8H 1FCCA 4PY7A 3BDBA 4KC3B 2Z93B 1RK1A 3BKYH 4JKWA 4P5TD 4UTAH 2ZCLH 5F21B 1AD0A 1D5MB 4G42A 1SYSA 4LVHB 4IIQC 4U6VH 4HGWA 3L3HB 1WVZA 5J57B 4NC1E 2W60B 4MSWB 4NBXB 3RVWD 3SCMD 4YH6A 2NLJB 1CK0L 1NCTA 3WIFA 2J88L 4OZIA 1ZLWH 3BGMA 3JV6A 1BJ8A 3SO3C 5FV2A 1OAUL 4IIQB 4JFEE 2UZXB 1J10A 1DE4B 4I18B 4H1LH 4KJPC 5LG1A 1BM3L 3MLUL 2JJTC 3PP4H 4WTXA 4ODHL 2FATL 4Z7WB 4BSVB 1D6EB 1YN6A 2BSSB 4NNYB 3DROB 1IEBB 1DUZB 4F8QA 3MV9A 3QFDB 3TJEH 1N0XL 1T03L 2ZUTA 1JPFB 4K3JL 5C0AA 2NY1D 3HMXH 1HHKB 2W9EL 3G6AB 3PGFL 1UWGL 3JZ7A 3WNMA 4UDUB 2E9WA 5D5ME 1P7QB 1DBJL 3NCCB 4ZYKB 2Y25A 1ZHKA 1U92B 1E27A 5DURD 1IKFL 4NO0A 5L9DL 3O45B 2EC9T 4RQQB 4S1SL 1Z2KA 1RURL 1F4YL 1PZ5B 2I60L 3O11A 1URLA 3FAXA 4LBEB 3K81A 4LLVA 3VXOA 4C83B 3KNBB 1BD2D 5K9QG 2AKRB 4JRXD 1I1AB 2OR9L 1SBSL 3A0OA 1FG2B 4XPAL 4MMZC 4JQXC 3FZUC 2P1YA 3GJEA 2FYYA 3QEUB 1T5WA 4XMLL 2J4WH 2HH0H 3U0WH 4Y7MA 3QP3A 1DQJA 4U0RC 3BPOB 1JHLL 4MJIB 5FDWA 3D25A 5CBEA 1EFXA 1R5IB 3MA7A 3UPAA 1TCRA 4MS8D 4YHPA 2MHAA 1GHFH 1DN0B 1E28B 4UV4L 4UT9H 4U1MB 3ULUH 3V6OC 4YE4L 3S6CA 5E56A 4L8SB 4Y5YB 1A5FL 4JJHA 3NCEB 3BO8A 4NQEB 3W0WD 2ORBL 3TA3B 2FECL 5ERWB 5FYKH 1ETZB 3O9WA 5DQ9A 4CRPA 5IEKB 3PWVA 1AR1D 5AZEH 1I4FB 3GMNB 2VLKD 1HHGA 2BP3A 1KEMH 3NABL 2WINB 5EUOA 3BRDA 4XC3L 5I19H 3ZL4L 2W1NA 2L0DA 3SQOL 4I8DA 4NZTH 3QFJA 3BE1L 5TFSH 2HG5B 3CD4A 3MFFA 3MGOA 3ARSA 4PB9L 3ARBC 3I75A 1SJHA 1YNTB 5MEQA 1BPVA 1NAMB 4PREB 3ZT5A 3QCTH 2GITA 5JOPE 2B5IC 4KKLD 1CFTB 1R24A 1XCTA 2MQCA 1S7QA 3MJ9H 2E7LC 1Z9MA 2X4TB 1PZUB 3LKSA 1A6WH 3UPRA 1CFVH 4LAQH 3SDYH 3LB6C 1KCRL 4HCRL 4YBQD 3VFRB 1CDHA 1W8NA 2ICWJ 1T0MB 5CJQL 3RWEA 1LEGA 3VXMD 1IT9L 2B5IB 4GSDL 1EXUB 1NUGA 5IB3B 2IANB 2V7HB 4I48A 5KSAA 1HH9A 5TDPB 1F4XH 3O2WH 3QIBA 3NN8B 4HH9B 1CF8L 3OHXA 3Q48A 1HSAB 4HIEB 2X4UA 4HWEL 1SEQH 5IB5B 1VADA 5IBTH 2DRUA 4UIMA 3ZO0A 1PEZA 1RJZA 3S35X 2GJZB 4NQSB 1L7TL 2Z8VC 1HQRB 1A9BA 4K23H 2H41A 4JJ5B 4WJ5B 3TBTB 4Z7WE 3BT2L 2FD6L 1KTLA 1PJ9A 4HFUL 2NW2B 3IXTA 3OTTA 4YZFF 4ENED 4TSCH 4YNYA 2YA1A 4HD9A 5FV1L 5J6GA 4OGXL 3D85A 3V95A 1F00I 1LDSA 5E8PB 3QCVL 2BC4B 5LGHL 1N59A 3M17A 4Y16A 4CAGA 4E42A 3QDGB 5FF6B 4PGJA 1XT5A 1GC1L 1LD9A 4NSKB 5EC2A 5EZIL 1BHGA 4EXKA 3L3KB 4XC1H 1M7XA 3JV4A 5LXGL 1HI6B 3QXTA 5EUKB 4FXKA 3QIUC 1X5YA 3HE6C 3LQAL 1PY9A 4KY1L 5K9OB 3NA4A 4M7JL 4QHNA 1JV5A 1BWMA 1XAUA 1B88A 1OTSC 1FVCA 2W9DL 3ZYZA 4AEEA 4GRWB 1BECA 1WZKA 2PKDA 1KN2H 3JXAA 2JJSA 5C3TA 1CXKA 1JRHH 3MBXL 1I7ZA 4WTZA 1NCCL 1UJ3A 3D3VD 5D70H 5ACMA 1G6RA 3FN9A 4MDIA 1X5HA 1G7JA 1RUQH 1TZIB 5FYLD 4QRQA 1UKTA 4KVNH 1UACH 2BY0A 4M1DL 3PV7A 1Q9OA 2XNAB 1QSFB 5E9DA 3OF6A 2VDQH 5GGVY 3E2HB 1QFWH 5J12B 1Q1JL 1RIVL 4MJIE 4C54A 4DTGL 1QRNB 3GM8A 5JZ7D 1ACYH 1JTPA 5C07D 4DFHA 4U1KA 2NXYB 3IKCA 3V52L 2R4SL 1I9JH 1MQ8A 4WRLA 2CKBA 3JUZA 1U3JA 3D48R 2DM3A 1DCLA 2VLLA 4OUUB 1A4JB 5DZNA 5IFJB 3HPLA 1NMAH 2EH7L 1KYOK 1KF9B 5C6TH 4HDIA 1VPOL 1NANH 3JWOL 4YFLF 3UTQA 3ARQA 4NQEE 5KZCB 4X6FB 4OIIL 1WWAX 3QJFA 5HGHB 5AD0B 1RHHA 4P57A 4RBPK 3KPNA 4TPRL 5F1IA 4ZNEE 5E8OA 2A77H 1JGDB 3RDTB 1C1EH 4OT1H 4HV8B 5DJ8B 4K8RH 4RSVA 4LHUD 1U42A 1H3XA 1EEZA 2UVFA 3T65B 5HY9B 1TIUA 4QXGL 1AO7D 3T0EB 4CDGC 5A2IH 4R8WH 3TYFA 2Q7NA 5CP7A 4WW2F 2VZVA 3C87A 3UEZA 1GL4B 5FOJA 3VWKB 1IE5A 5BZWB 2W0PA 3HPJA 4M6OL 5I1JH 5EZOL 1ES0A 4XNUL 3X13A 4PJFF 1HINH 4GAYA 1UZ8A 3QWRA 1U3ZA 1MLBB 3TO4A 3JVGA 3P4LA 1K8IB 5FYLL 4G9FA 3GHEL 5DHVB 5E2TH 2E3VA 4F7EB 3EO1B 4YO0B 3GSUA 3UYRL 1FQ9C 3MCG1 2DJSA 3S88L 2IANE 3BW9A 4HQQL 5SWSA 4OFVA 4ZFZA 3F65A 3WXVL 5DYOB 1NFDF 4E41D 5C08A 1BBJA 1REIA 3RL2A 1X44A 3JWDC 3IDMB 5C0DA 2B1AL 2VN7A 1YZZA 1E6JH 2BOCB 4U1IA 4MWFB 3G5XA 4HT1H 4ISVB 5GS0D 1U8NB 5TE7H 3BP6B 3QZWA 4OF3A 3O6ML 2VLMD 3WEXB 2YZ8A 1P5UA 3OKOB 4Y5XB 4JM2F 4M7LL 3WIHA 4FNLH 3WN5A 3I3DA 3HMWL 4PJ7B 5I1IH 5KSUB 1C12B 4YEEA 3DO7A 5CFHA 5ID1A 3C5JB 2ZPKL 1A7NL 3SY0A 5ICYA 4Y4KB 3QSKB 1KC5H 3QDGE 4DN4L 4Z7NF 4PG2A 3MRHA 3O2VL 5FKPB 4R2GC 1JHKL 3AVEA 3EOAB 3GKWH 5DDHA 5DJCB 3ZDZF 1CVSC 2VDPL 3RPIA 1IC5H 5C0BB 1FYTB 4GRWE 2VAAB 3BSZH 3G9AB 5EA0H 2F19H 4LLDA 1RIUL 1HYSD 1I8LA 1U8QB 2DQJH 1A1MB 3PXJA 2WBJD 2ESVA 3S98A 1HHHB 4R2GB 1B4RA 1NEZB 3S96A 4CU7A 2VDML 4KAQH 3U7YL 3O6KH 4PJEF 1DBKL 1TDQA 2CRMA 1ZV5A 1OAQH 1EDQA 3CX2A 5AEAA 4PIRF 4XNQA 2P7TB 1NCNA 4I9WD 5HGBB 1RPQA 2HRPL 4J4PA 4NM8H 1QRNE 3EHBC 1FZJB 5IGXH 4KUCF 5C7XL 4X80H 3PWNA 3BWAA 1A6PA 5JORA 2PTUA 4KI1A 5SX4H 4OTXH 3RVUD 1IC1A 3DRTB 3ZMRA 4RFOL 3TZVD 3C5ZC 1EMTL 3LV3B 5CGYC 3GSWB 2ITDA 5GS0L 5MERB 5BZDB 3VFOB 1FSKC 3NTCH 5JHLL 4FQLH 4G3YL 1U8MB 1WFOA 5KAQF 3EO0A 4YXLL 2VLRE 1M4KA 2OJZL 3HLAA 4RMVA 5EIVA 1ZA6B 5JMRA 5HVHB 1WAAE 1MJ8H 4YHNA 2D31A 2DQCL 1MRFL 4Z7OF 1MRDH 4P23B 3ZKXB 1M05B 3ILPB 2WIMA 1FPTL 3FOMA 3LN9A 3RUGF 1S7VA 1C5DB 3BH9A 4YHOH 5F7FA 2I9LB 2RCSL 3T0EE 2MKWA 3LN4A 3QUMB 1WIPA 3MSPA 4MA7L 4J2XA 3K2UL 5DO2D 3B9DA 1A7OH 1UT9A 3ARDD 1P53A 4LCCA 5CJOL 3UAJC 1U8LB 3C8KA 1G7LB 5EBLB 3AS1A 3LKQA 3EFDL 2EDQA 4FFZH 3UTTD 2YN5A 1TQBB 4IRZL 2HFGL 2BVQA 1CFNB 4P4KC 2YPLA 3WFEL 3SDCC 1UG9A 1MUJA 1DVFB 2VISA 3G5VA 2VUOA 4HUVB 3OJ2C 4RGNC 5EDXA 5F89B 3FONA 5IQ7L 3QEQA 4UOW0 4WW2A 4LHUG 3VWJA 1LHZA 3S4SA 1GSMA 3QUZA 2EO1A 2X1OA 1N2RA 4ODTL 5E6ZA 2XWTB 2I9TB 1XF5A 4PJFA 5EU5A 5JW4Q 2DDQH 3CH1B 3RVVD 3ZE1E 2HAZA 4U6TA 1P4LA 1EJOH 2ED8A 5BW7A 3K46A 1CU4H 1FORH 3MO1B 2XQBH 3OB0H 3WFDL 2X5PA 3O4LD 1BZ7A 2GSGB 5ICZA 4PJ7E 1KCUH 2BVEA 1I3GH 5EBGA 4PTTB 2LVCA 5AUMA 3QB7C 3S37X 5LCVH 1NFDA 3C9NA 4KKBC 3PHOA 4EUPB 2RR3A 3GIZH 4MQXD 1OARL 2HJFA 5C0BE 3BKJL 1ZS8B 1FYTE 2N56A 3EOBA 3U79A 1WISA 2EDRA 4QXWA 4KJQD 1R3JA 3MLWH 5DJZA 1IKNA 1BLNB 2AERT 1EBPA 1UM4L 5L7XH 1T6VN 2Q86A 2Y36L 4GMTH 4OZFG 4G7YH 1BVLA 3MR9B 5DD0L 3STZB 1IGJB 3T77A 4NM4H 2KZ1B 2Q76A 3QEGL 1WWCA 5JPMB 1MFAH 3FQTA 4XCYA 1VFAB 2Z35A 4JM4L 5DVMA 5GGUA 1XF2B 2VXSH 2VSCA 3WXWL 3K7UA 1H3GA 4RAVA 5LKNA 2EXWC 4XMKL 3JTSA 4N68A 5CZVL 1HZHL 4LK4A 2C1OA 5DRWA 4PRIB 3C2AH 5DS8A 1YC8A 5K33A 1Q9KB 1OP3K 5I1LB 1UWEL 2FJGA 4J3WA 4UDTA 5LJYH 5J6HA 3T2QA 1CLYH 3NH7H 5F7NC 4ZFGL 4IRSA 1K85A 4OD1H 4FQ1H 4OFIA 3VFGH 5M95B 3UPCA 4FQ2H 4JDVB 1AQDB 1S7XB 4XP6H 4L9LC 4JLRA 1YMHA 4NKOA 4PRNB 2J5LB 4UT6L 1D5IL 3ULSA 5D1ZC 4Q9RL 1T66D 4NCDA 1OVZA 4KGLA 1WFUA 1U8JA 2GW5A 3TBYB 2MFNA 3H3PL 4ZD3L 2NY5C 3LD8B 2C3VA 4EN3A 1CT8B 3EYFA 3SGJA 2VERN 2CDEB 3QDJE 1JFQH 1YEFH 3N06B 2A83B 4NJ9L 1UCBH 5DK2B 1GCFA 2AV7B 3MCLL 3LH2H 3MLTA 3VFTA 5CSZA 3LMJH 3UZVB 2H2SC 3I9GL 2ZNWA 3DV6B 5SV3A 5ISZA 4TSAL 3V5HA 1U93A 2Q3AA 3WHE0 3S37L 3V6BR 3FAWA 2IMMA 2HLAA 1IAIH 4OGAC 4X9HA 3IS1X 4LF3B 5D7JD 3U6RA 1YNLL 5HI4C 5I8CB 4QY8B 3RUGA 2YPKA 2FB4H 5DMKA 3T2NL 2AK4A 3M1BA 1PQZA 3QR2A 4HKXA 3BOVA 5C0ND 3CC5A 2AABH 3CXDH 3CVHA 4GG6F 4ZS6C 3LKNB 2CLVB 4I0PD 3QUXD 1KB5B 4JPVL 1QSZA 4RGNE 2X4SB 2EDJA 3PDGA 2XKNA 3BYTA 1WF5A 4WO4A 2YK1L 4R9HA 2VZ1A 4M1CC 1YDPA 2GSIA 3HE7B 5FEBA 4G5ZL 3W11C 4EI5A 4YX2H 3BQUD 3GSQA 1ORSA 3L3DB 1JRHI 3PWPA 3NIGF 4PV9A 4WWKD 1T2QH 3PQYE 3MXVL 1TENA 1HIML 4LPCA 2A9NH 2FCBA 4CUCA 3QHFH 2IAMD 1SY6L 5DMIH 3I2CH 43C9B 4N8VG 3EDDA 2NXZC 4D9QE 3QI9A 4YGVA 4OGYH 4L4VD 5CEYA 4LCWD 5E8EB 2XPGA 1QFWI 2I5YH 5BS0A 1BF2A 5EORH 5HD8D 3MBEA 5HHOD 4YXKL 3SGKC 4JCLA 4RMWA 2NXZB 1J8KA 3FT2A 4TRPL 1JPST 4URTB 1F4WL 1IM9A 3ZTNL 3BAEL 4XP4L 3G08A 4OZIB 1MVUB 1W72A 3GJFK 4HMEA 1NANI 4OLXL 5TDNB 1FNLA 4XHJC 1A02N 3D9AL 2ICCA 3HZKA 2LABA 1IGML 2O5ZH 1FDLH 3DTXB 1UWXH 2WWMD 4XVUC 2VE6B 1FV1B 1YN6B 2H26A 1XGTB 4M62H 4O4YL 3TF7C 3D39A 1M6OA 2QADC 1MFCH 1MFBH 4I1NB 5CZKA 4TOYH 1I3RA 2NY4C 4KJWD 1G0YR 3S34H 1NAMH 1U91B 5C0AB 1UENA 5D1QD 3CCHA 1MQKH 4NPYA 5C0CE 1KNOA 4PLOB 2VH5H 1FNAA 5CD3B 4GBXC 2HKFH 4KKNA 4NO0B 1PSKH 1IC4H 1RJLB 2FL5A 1KYOJ 4U4BA 3TYGH 2JJVA 3O11B 4AZ8A 1CGUA 3ARFD 3STLA 3F5WA 3Q5OA 4NKQB 5I8KL 5JDSA 3VXOB 4Z78B 2JB6B 3ROLA 5KANI 2BSTA 3L7EB 3SKNB 2FBJH 4JG1L 4KTEL 4MJ2A 4G80A 3OGCA 5DWUH 4DKAA 3AREC 4LFHD 2KBGA 4MD5B 4F3FB 5BXFB 1KTKE 2B1HH 4PRPD 3ZE2F 4YHLH 2FYYB 1T5WB 4WVRA 2VDKL 3WFBH 5T1KA 3AB0B 4TVSa 2R69L 3RL1B 3MJ8A 4D0CA 5TF1L 3L3IB 1DQJB 4HUMB 5GZNC 5J13B 3KPMA 1UM6H 3PABA 4EDXA 3D25B 5CBEB 5D8JH 1HXMB 4Z0XB 1UQSA 3O9WC 1T0NA 4YHPB 1BOYA 5C92A 1A64A 4HF5L 4N0CD 2DTML 1ZXQA 3R8BB 4LQFH 3DYOA 4EDWL 1INDL 2NY2D 5CILH 5MP6H 1T1WB 5DD3L 1EGJL 3P9LA 4XVTH 5IK3B 4NDMA 5DQ9B 4GRWH 4TQEH 2OYPA 4U3CA 4GAJH 4FFYL 3PWVB 4X99A 2FRGP 3P0GB 4LSRH 4LLWB 3DSNA 1XIWB 3OV6A 2R23B 2AJVL 4PUBL 4AEHH 2HWZL 5EUOB 3UJTH 4WEBL 4OV5A 2WUCL 2EZ0D 1NAKL 1PBYA 5LAXA 4GG6A 3MGOB 4UINL 1EFQA 1KIQB 3C8DA 3DSFL 4FFWD 4F7MA 2APTA 4K3DH 3I75B 1HKFA 1SJHB 1ZTXH 4G8IA 5MEQB 5E99L 1BJ1H 1QLRA 2GITB 3EYSL 3O6FA 1R24B 1Q9LB 5KSAC 3H2WA 5HI5C 2GTZA 3OXRA 2F58L 3UPRB 3RWGA 3MLYL 4PPTA 3QIBC 4Z0BL 4M9PA 2FEDC 4JHAL 4AIZB 3MOBL 4FZ8L 1CDBA 4JHWH 5E7BA 2QEJA 3DECA 2WMPA 1OGTA 2DQFA 1FAIH 1JPSL 4N90E 1K6QH 5SX4I 1CDJA 4OZIE 1HH9B 1I75A 1VGEL 2FSEB 5F6IC 4LMQE 4P5TA 3QQ4A 3QIBB 5I9QB 3LEVH 5CEZD 1MLCA 2W59A 1VADB 3VG9C 3TNMA 3CFJB 4UIMB 1RJZB 2E27H 4N5UA 4Y16C 4QHMA 3SCMA 3F7YA 2W91A 5IQ9A 5EC1A 1QSVA 1R5WA 4N5ED 5F96H 1KTLB 4W68A 4DGVL 4WUKH 1KCVL 5J6GB 4O2EA 3D85B 1MCJA 5C2UB 3ZKMC 3IFPA 5C0AE 4Y16B 2JJSC 4R97B 3L3GA 1MHHA 3QISA 4V1DD 1IQWH 3C6SA 4BZ2L 4GRLC 3FO1A 1KULA 1KIPA 3CXHK 2DQIL 3MRPA 4PR5A 3U1SH 5C6WH 4GFTB 4M48H 5F97E 5T3ZE 4PGBA 1JV5B 2DD8H 5MEPA 5DHVH 2G5BA 4RNRA 5BV7C 5E94A 4ODVL 5CAYB 4UUJA 3MNZA 3OZ9L 1AKJB 4KHXL 4WGWB 3QXWA 5F3BB 3VJ6B 2OMNA 3GKZA 2O26U 1I7ZB 1OWWA 2PO6D 1UJ3B 2BHZA 2IC2A 3DURA 1G6RB 4MDIB 2WV3A 1WZ1L 1MCSA 5I8OH 4QRQB 4PJHF 4GMSL 2RGSA 3FOLB 4L8DA 5I74C 4OLEA 6FABL 2EXYC 3U7WH 4HKZB 3VDCA 1JMZA 2QHLA 1FNEA 1UXSA 1PX3A 1J0JA 4X9IA 5AAWA 1BD2A 1XCQB 4JRXA 4M8QA 5SWSD 1LP9F 5HYSG 4U1KB 3IKCB 5EU7E 1FGVL 2CKBB 2YD4A 2Q6WA 5CEZL 5IKCA 4HCRA 5D72H 4Y1AD 4J3XA 1XF3A 3HPLB 4JFQA 1NSNH 5DRNB 4HDIB 1KT2A 4K9EL 3UTQB 5FK9A 1TZHB 5MHSE 3VD5A 4WEMB 3QJFB 3BN3B 4NKDA 3FT3B 4H25B 1RHHB 4YK4C 5F1IB 1MCRA 3MNVB 1SM3H 5E8OB 4NFCA 4XPFH 4NZRL 2EIBA 4LFHG 3UJJL 1MCFA 5GS1C 4JVPA 4TNVK 4O58L 4F37K 4J12A 4ZUUA 1YC7A 3ILQC 1ZLSL 1JGLH 2BSRB 5EUOE 1KSRA 3W0WA 5J11C 5D7SL 3JVGC 3K8LA 1BGXH 2FWOB 4TUKL 5FCUH 4LSSH 3QFJE 2G9HA 5CP7B 2UUDH 3L95A 4L4JA 5EOQL 2OTWA 3UYPA 1TETH 2VLKA 1ES0B 1GGBL 4TUOA 4GAYB 2CKNA 4UOW1 2AV1B 5JQHC 2OR8A 1JPTL 3TO4B 1ZT1B 2NYYC 4M7KL 4HEME 4HAGA 4HS6A 4JY4A 1A1NA 3MRIA 4FQJH 4JRWA 4FQQA 4MNGB 3GSUB 4S0TD 3OMZA 1FYHB 1NUDA 3GI9H 3GO1L 4QRTB 4ZFZB 2AEQH 1WC7A 5C08B 1BBJB 3H9SD 3B9KD 5C0DB 3GIVB 4P5MA 1KPRA 4HS3A 4LCUA 4RRPG 5KJRH 3VXMA 2P8LA 3QZWB 4PG2C 4P2OC 1NGYA 3DMMD 1F4AA 1JGEA 1KXTB 3QUMH 3U0TA 3E6HA 1MHPL 3WN5B 4TNVF 1TQCC 4F2MB 3A6OA 3QG7H 4F37F 4OF6A 5HDQH 3VXNA 1DN2A 1BVKA 4XBEL 3DO7B 1CN4A 5JW3H 4CU6A 4K2UL 3SY0B 5HBBA 5ICYB 4TULL 1NL0H 2VDRH 1JUFB 1OCWH 2FLRT 1I8LC 2AJYH 1T20A 2DAVA 3OAZH 5JPNA 4FHBD 1A7QH 3IF1A 2UZIL 3FQWB 3VGAC 1P6FA 2A9MH 3EFFA 4ONGL 4K3GA 3CFBA 5D2LF 35C8H 2IBGA 2CPCA 4HWZA 2Y1VA 5JIHA 1IAII 2R4RH 2VLJB 4LHJB 3B2VL 2ESVB 4ZOEA 1FJ1A 4H0IA 3GMOA 1T83A 4J4PC 2ZSWB 5JHDD 4LLAA 4MZ3A 4BSWB 2HTLC 1TCMA 2A6KA 2HT2D 2PXYB 3BJ91 4XNQB 4ZTPH 1U3YA 5TJWK 5F7MC 4JVUA 4JREB 1JNLL 3LKPA 2XKSA 3D3VA 1NJ9A 5D7KD 3GNML 5LQBL 3PWNB 3BWAB 4OLZL 5JORB 2EDDA 1F11B 5IMLB 5FGSA 2EE6A 2XWBA 1R3HA 4XPHL 2ITDB 2VAJA 4N0FA 2ADFH 2W65A 4PJHA 4EUPH 4JFFD 4B7LA 1I1CA 1TVHA 3HLAB 1GOGA 5C07A 2NMSA 1IBGH 4U3XA 1A7RL 4LSPL 2D31B 4WWID 1A6VL 1S7RB 4LCCC 2D0FA 4HK0A 2HVKA 3GI8H 2BRQA 2KPNA 2DL9A 1I9IL 3A6BH 3QNYB 4DKFL 3HFML 1S7VB 3F6LA 1U0QA 3BH9B 5GIRB 4M5ZH 1MIML 2IGFL 1IGYA 3SKJH 1DBAL 3LN4B 1G9ML 4X6CF 2AJUL 2X4RA 1FC1A 1KFAL 2UWEF 1XF1A 1FL3B 2EDEA 3QAZC 1C5CH 3EYOB 3OB8A 2WP3T 3CNKA 2DLIA 2IQ9H 4LHUA 5DJ6B 1N5YH 4WW2C 3VWJC 1OT1A 2BVQB 2KKQA 3KPQA 3VGEA 1QSEB 2YPLB 1II4E 3QUZC 1AO7A 2CIIA 3TJHC 3VD3A 4HXAH 3C6LB 3OSKA 3QAZB 5EG6C 2VISB 3G5VB 4G6JL 1MHEA 4LVEA 2VMFA 1CDYA 4NJAL 5BW7C 2YHGA 5I30H 3LB6D 3FONB 3KXFD 1QEWA 3JTTA 3O3UN 5HYJB 2AXGA 3P30L 3CDFA 3KPRB 1AFVL 1NBYA 5C08E 2J8UF 3QUZB 1N2RB 3R8QA 1E6OL 4FQHA 1YPZF 2H32A 3WFCH 1NGXA 4J8RA 5DRXA 5F7DA 1P4LB 3DUHA 3NIDE 4R4BA 2R0KL 1QR1A 3VCLB 1QKZL 1G7PA 1F90H 3RWIA 4LDLB 3FHAA 1CZ8H 5TE6H 5B22A 1LEKA 8FABA 5I1DB 1NGPH 1BZ7B 1RZKL 4Z8FL 2ENYA 5CWSA 4Q9CA 2QL1A 4R26L 2JB5H 4E41A 4NHCH 5KW9L 4YXHH 3CFIC 4NFDA 3SBWA 3BD5A 3KPSD 2NNAB 3IFOB 5I17B 1NFDB 3E3QC 2YRZA 1KENL 3C9NB 4JM2C 2R8SH 1IKNC 4OZFA 1OSPH 4AH2A 5BVJB 4XPBL 3QUKB 3OKDA 1MNUL 1INEH 4N1HB 5ADOL 4XZUA 4LSQH 3ZT7A 2HJFB 3EOBB 4YPJA 1FO0L 5T1LB 1RUML 4Z95H 3VFUB 3VFMA 3ZZ1A 5DJZB 4C57C