5E8OB

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oB00
1CL7L 2AQ3A 2COQA 2AJZA 2XIDA 4WHTB 2CDGA 1HHIB 4HK0A 1ED3A 3S96A 4U4BA 5C0BA 2ENYA 1HYRC 3LKSA 4HKXA 5BZWB 2BP3A 5F89A 1EBPA 5J6GA 5HSFA 1H3PL 3VGGA 3C60D 4JKLA 3NACH 4HCRA 2VE6B 3OKKA 1G9MH 3M07A 3OB0K 3QXVA 4TTGA 5CWSB 3LIZH 3VWJD 2BSSA 4HPYL 1GH7A 4K7PY 2HYMA 5JOPD 4PJFE 1F11B 5DEZA 3UYRL 5HHQA 2QSTA 4F7EA 4MSWA 5D2LA 3T0VA 3MLYH 1NAMA 1G7PA 35C8L 3L3KA 4OZFB 1XCQA 5IHLB 3X3GL 4W4OA 5H35A 4NN6B 2IADA 3IDUA 1NL0L 1PG7H 3A6CL 3CZFA 1FP5A 5KAQG 4PRPD 3WFDH 4OSUH 4P49A 3BKML 2JJSC 4NZRL 4NZJA 3MRKA 1FORH 2Z9TA 1U8NB 3VFVB 5FM8A 2J6EH 3WUWG 4K7PX 4LDEB 3VW3H 2MFNA 2CJUH 3UJJL 2WP3T 1I9JH 3PWJA 1YMMA 1DBML 2MQCA 1VSCA 3RL2A 5HBBA 5J8OA 3TBWB 3VXNB 3FCTA 2IGFL 3T2NL 3WBDA 3WJJC 2ICWA 3FMGL 4IOFC 1AO7E 3O2DL 3C60B 3VI3F 1XGUB 3ARVA 1QPXA 4XXDB 3VWJB 2VLLA 4YPJA 2FSEA 1AGFB 3OR7A 1YY8B 5HHNA 1BBDL 4D8PB 1GGYA 1OGAE 3OAUL 5DC0A 5KVEL 5CD3B 3C6LC 2PYEB 1PQZB 2A6IB 4HIEB 4QGYA 5GS1B 5DJDA 4N5EC 3LV3A 5E00A 1MFDL 4FTVA 4PJEB 5FUZL 1YY9D 4KPHL 5DGQA 2IFFL 4JFEE 1XF5A 1EGJL 2A83B 2NY2D 3VXUA 3QG7L 4TPRL 1O5DT 2P5ED 2E27L 4HKBA 4OCWH 1DDHB 1T20A 2A9ML 2D7TH 3FOLB 2YA1A 4PRPB 3BPNB 5DJAA 4A2MA 3P3YA 3S34L 4OM0L 3BX7C 4DWHA 4FS0A 3G5YB 3LRGA 1QFOA 1KC5L 3KAAA 5EOCJ 4M5YL 1EBAA 3LRSA 2DM2A 2Z8VC 3KXFE 3S35H 3DX8B 3OKEB 3O3DB 1KJMA 1OAZL 2XZAL 1WBXB 4OCSL 3KR3H 4MD4B 5D93B 1CWVA 4N8VB 1A6WH 4PTUB 5A16B 3EOTL 1FLRH 2C1OA 1R5IB 1KTLB 3S3SA 1MRDH 3KDMA 5ITFA 4J3OC 4F7CA 2F54D 3G04A 5C0AA 1OPGH 3CPLB 2RHEA 3SE8L 5DD0L 3PDGA 1IAII 4KK5D 4P46A 3DI3B 5DDHA 1MVUA 3MJGX 5C0FB 4LBEA 1P69B 4PRBA 5F72S 1AFVL 2MQ0A 1X5HA 5SV4A 1FNGB 4ZUVB 2JK5A 1QLRB 3OKNA 1JPST 3QUKA 4K3HA 2IANE 1J1XL 4JN2B 3I9GH 3M8OL 2NY2B 3HFML 3MCLL 4Y16C 4ZO7A 5D8JL 4JFDA 2VQTA 5E8PB 2P5EB 3SBWC 1I8LA 1Q38A 3EJYC 3BZFB 1IGML 2R1XB 1CFBA 3M17B 1QSFE 3NZHH 4MNHA 4MHHI 1A3RL 4H0IA 3TBVB 2ICWJ 4O5LH 4GBXA 2IBBA 1QRNA 4YE4H 1TVBB 5FYKL 4MXVF 2KZWA 5FECB 2J8UF 1RPQA 4BA8A 5E94B 3BZ4A 1D5IL 5I8OL 1HHGA 4HXAL 1N2RB 4KVCL 1NSNL 5IF0B 1NC2A 3WFBH 2R4RH 3EYQD 1IGCL 3GEWB 3SGDH 5D6CA 4E41A 4KHXL 4NN5C 3VFSA 1QFWL 4JY4A 1CCZA 2F54B 1MNUL 4N0YH 5SWZE 1MHHA 5FKPA 2GQHA 4H8WC 5AYQA 1BVKB 1QA9B 4LCCC 2FO4A 4JFQA 2NX5E 4WU7A 1ORSB 4GT7A 3QUML 4IMKC 5DRWA 1MSPA 4NQVA 4U1GC 1JZ6A 3WIIH 5C0DA 4JZNB 3PHQB 4M5ZH 1WTGT 5B3JF 4LSRL 4HBQA 5I71C 4P57A 1KACB 4ZNCD 2DLIA 4UBDC 4GG6A 1A7RL 3HR5B 5DXWA 3ISWA 3BGMA 1HSBA 2V2TB 4TTDD 4I4WB 3T0EC 1J12A 3U2SB 3PWLA 4YDKL 1A5FL 1CR9L 3H9ZA 1VHPA 4HS3B 1EK3A 4RA0C 1AO7D 2P8MA 4WI5A 4P2RA 1AXTL 3SKUD 4Y4HA 4XB8A 5BVJA 5JMRA 2C1PB 3MRPA 2HWZL 2R23B 3S97C 3VI3E 3VJ6A 4PJFB 2R15A 4JKMA 4AZ8A 2QADD 1AH1A 2UYLA 1P9MA 1DBAH 4HJJL 1CDUA 3L7EA 5F8QC 3UTTA 4ZFFA 1HIML 1IC4H 4HW6A 5F3HA 1VFOA 2VNCA 2VWEE 1XGRB 1UVQA 4NT6B 2OK0L 4HUXA 3VMPA 2DN7A 4JM2D 3OMZA 3U9UA 4JFED 1T04A 3JWOL 1MJ8H 2WUBL 3VRJA 3GSUB 2JELH 3I6LE 3L3HB 3P0VL 4HJGB 3P4MA 3LKRA 5LWYH 1J10A 4LKXB 1F8TH 1LO4L 2CUIA 1PSKH 2YA2A 1QBLH 1QKZH 3QWQB 5DMGD 1YEFL 1UM6H 4Z18A 2X89D 5E8DL 1HSAA 4X5LA 4XP9H 5IBTL 3G08B 1IE5A 3CFCH 2BVOA 1QRKA 2EKJA 4BM7A 5HPMB 1B0RA 5LGJA 3L1OL 4KUZL 4TULH 2D7MA 1RJCA 5F9WB 4X7SL 4AL8L 1U8OB 2ADFL 3RDTA 3BJLA 4XPAH 1YEDA 4K8RC 1AO7B 4Z7VF 2AK1L 3V79C 3QFJE 2Q8BL 2ADGB 1LO5B 4MXQC 1WZMA 4R0LB 3J8F7 4R7NA 4O58L 4Y8DC 1GZQA 5DJ2B 3SDAD 4FRWA 3ARDC 3QI9C 2XXCB 4AMKL 4S2SA 3O6MH 1N64L 1F3JA 2WUCL 4P3CH 5I1HL 1OGAB 4N0UA 4BQ6A 4JKPH 4UOJA 3QULB 3JWOC 3TT1H 4JN1L 4LQ1A 4C4KT 5TGBB 3LQZB 5L88H 1GYAA 5CINH 4JFEB 2A77H 3H9SE 3CVHH 1RMFL 2PTVA 4ELKB 1JPGB 5DQJA 2P24A 4WI3A 5AUMA 5T5FL 4R4FL 4X80L 25C8H 4JPVH 3BPLB 4JO4L 5I1LB 3JBG7 4LHJB 2J5LC 1F4YL 1FBIL 4PR5B 2OJZH 1H3TA 1I1AD 1MPAL 2Z35A 1MOEA 4CVWA 4U6VH 3DYMA 3VFGH 3KXFB 4NSKA 5DFTA 3O0RL 5EZOL 4FFVC 4ZOAA 1BZ7A 3IDNB 3VFRB 3NABL 5HI4C 3FO2B 5I16A 2LAAA 4MXVE 1JGUL 2O5ZH 3SDDC 2J8UE 1AP2A 1BZ9A 5DVMA 1UWXH 2JJUA 3RGHA 4QRTB 3I2CH 4XP6H 4HKZB 4APQD 5SWZD 4LPWA 2H1PH 2CUMA 1XZ0B 2O5YL 5KTEH 1CXLA 2ITCB 3TESA 3L5XH 1T2QL 3WHE1 5F3BA 1GZPA 1IGFH 1UZ6F 2D0HA 2AK4E 2NX5D 3LN4B 4G7VH 4MJIA 3EOAB 4BK5A 1TNNA 2KQMA 3VH8B 1UKTA 3MRIA 3GHEH 4RAVB 3FFDA 2IANB 1RSFA 1KJVA 1WC7B 3ROOB 4JRWA 1CDIA 1A9BA 3VD3A 3T4AB 5DD1H 2OI9C 5DJCB 3VXTA 3AROA 5CBAA 4MD0B 1EVUA 4KJWC 3FONA 2VDOH 5GPRA 3SGDI 4J12A 4JRXA 1QSFB 5GS0L 2ZP0T 4KJQD 3LKQB 1NEZB 1TCMA 1HQRB 4ZS7L 4C83A 4ACPA 2YD9A 3MV01 2B1AL 2GJ6E 5JHDA 4Y5XB 3KJ6L 2GFBA 3MNVA 1TZIB 3DIFB 2MHAA 4YGVA 2AW2A 5EOQH 4GKSB 4U1SB 3PQYA 1GGCH 1IGTB 3C5SB 4OCXL 5HDOA 5EU6A 1F4WH 3WJLC 4BFGA 5SWZB 3HZYB 3N1PC 1J88A 5HGDA 1MHPH 3RWEA 4K3DL 5L2JB 1NCWL 3O81A 1CXIA 5IFAL 1K8DB 2IPKB 4MDJB 2NX5B 1HKLL 4GXUN 1PKQE 1RZGB 1U58B 3I6LD 2WZPD 4Y4FA 4KK9C 4HG4K 1N8ZA 4TUOA 1KIQB 4HT1L 2ZUQC 1TXKA 1JZ5A 3P9MA 4M8VA 4EVNA 3SE9L 4L4TE 1JF1B 4LRNH 3LPWA 3UBXB 3UTQB 3WDHA 1N5YH 2K1MA 5I30H 4HUNB 5EZLB 1F58L 1CLOH 2FYYB 3MLPA 4M93B 4XPFH 3BD4A 1FVDA 1LO2L 3CFKA 3REWB 3MTRA 4LRIC 3TP4A 1JK8A 4YDLC 3WKML 1TJGH 3P0GB 5BRZD 1RZ8B 4KI5C 1NBZA 3RKDD 1TCRA 4ODWB 4DGVL 1E28A 3D25A 5GRWA 1AJ7L 2D31A 1CIDA 4L3CA 3CC5B 2GTWB 2Z8WC 1M71B 3QXDB 4OZHF 4Z7VE 2BX5A 4ZXBA 1Q9WA 5C0GA 4ZSOA 1BPVA 2BNUA 4PGBB 4LNRB 4F8QA 1XR8B 3EW3B 1E4WL 5JR1H 4Z76A 4EZMA 3MO1B 1J8KA 3K7UA 5DJ6B 5JIHA 5JPNB 1LEIA 4FABL 3MBEC 5FFLA 3F6IA 3OJ2C 4YHIB 3CVHB 5DJ8A 1ITBB 4QOKD 5J1TC 3H9SD 2AXFB 3OAYH 4WTZA 3WS3A 3KGRA 3M1BA 4MNQA 3QEUB 3DO7A 3ORJA 3BVNA 3DLQR 2AJ3A 1Q94A 4HFUL 3BUYB 5IJKA 2IQAB 3C08L 3KNBA 3IXTA 3MACH 1AHWA 1BQSA 4X7TB 2VUOA 5JPMB 2AJVL 3KYOB 2NY4C 1E4XL 4HXBH 4M6OL 5B8CA 2ICEA 2B5IB 1HQ4A 4R26L 1K2DA 5HHVH 3GI9H 1HH6B 2F5AH 2V2WB 3EYFA 3EYSL 3QDGE 2BERA 2VXTH 5BRZB 2XWJA 5L9DL 1H5BA 1E4KC 2EC9T 2Z4QA 2J12B 2GSIB 3OGCA 1WT5C 3CH8A 4WGWB 5DA4A 2QQKH 5HI5C 5I75C 2CO6B 1RZJC 2V5RA 3AMLA 1K4CA 5DD6A 2IC2A 5ANME 1UZ6E 4X5WB 1JNHA 4X9BA 3MGAA 1DTUA 2Q86A 2WWMC 4DK6A 1J0ZA 4LL9A 1U8KA 4ZO6A 4BFEA 2ZUSA 3B6SA 3W9EA 4QHMA 1OP5K 1S7RB 3H9SB 4YR6A 3SKMB 1Z9SA 1UJ3C 3DUSA 3LHPH 3I6GA 1JYNA 1RJYA 2HFEA 2R9HD 4Q2ZB 3RWDA 3VGAC 4OQ1A 1YECH 4YFDB 4EBQH 3DETC 2VH5H 1BZQK 1CQYA 3QDHA 1S9XB 3NPSB 4KKCC 2OZ4A 3QQNA 4ODSL 3FQWB 5E6ZA 5HYSG 2CKBH 4GW4B 5E5MB 5HY9A 3S4SG 4K2UH 5B39B 1V3JA 4JKKA 5CSZA 3MRGB 5I8EA 3UYPA 4DZBA 1NDMA 1B88A 4FZEH 4UUJA 4OLUH 4LLMA 5J1SC 5IGXL 1CFNA 1NGZA 3AAZB 1PGRB 4NGHL 4YEFA 4CDGC 2CKNA 5A40E 5KSVB 3ME0A 4WU5A 2J8UB 3QRGL 5D7IF 4GMSL 3RWCB 5EG6C 3IDYC 3F58L 1N3NB 1KEMH 5F44A 3W5MA 4OLVH 4IIQC 3OKMB 1DBJH 5LWYL 2VDRH 4GRLC 4WW2A 2A6KB 4UV7L 1YQ2A 3MOAH 4LCWE 3WSQL 5DJYB 2ICES 3N50A 5D1QC 3VXUD 2AK4B 3C8KA 4LPUA 1YNTB 5IMKB 4PRHE 1J8HA 1IZJA 5JW5B 1DQDL 3GMNB 4WNQB 4PRIE 3QHTC 4NCC2 4GJTB 5ESVB 1WITA 4ZMAT 4YHLL 4L4TD 2JB5H 3HNTH 4G6FD 4N68A 1I85C 2PW2A 5HDQH 3IB4A 4G43B 3NH7L 5L6YL 4DKAA 4MDIA 4ZTPH 1DQJA 5KAQF 1ETZA 3O4OB 1U9KA 4MA1C 3PGFH 4AEIL 5JQ6L 3AREA 4G8GE 5E8OA 1DFBH 4NJAL 5T3ZD 2C3WA 2X4OB 1F3DJ 2GJ6B 1VACA 1R3LA 3C2AL 1OAXH 4UU9B 3WN5A 3RPIA 5CJ5A 4OZHE 3VWKA 5J9PB 1I7ZA 3DTXB 3JWDH 1L0YA 1KCUL 4OQTH 1NAKL 4RNRB 5HJ3A 2VDPL 5BMFL 5ISZA 1ORQB 2R8SH 4GFTB 4I18C 1KLUB 2OJZL 1PKQB 2ERJC 5IW1B 3V4UL 1DSFH 1UWXK 3N1MC 5HHXH 4Y4KC 1I1RA 4K23L 1MJUL 5T3XL 3QZWG 5K9OB 4X9IA 4MAYA 4L4JA 1CDHA 3MLUH 3ARRA 2FZ3A 3WNOA 1JYWA 5LQBL 1VGKB 4ZQKA 4L4TB 2X70A 1QRND 4OD1L 2ZCLL 4UNTA 1HXYB 3MFFB 4HUVB 2MOVA 1M05B 1UEMA 4JAMB 1VCAA 1D9KD 1J1OH 2R2HA 5F1IB 3QDGD 5CSGA 3L5XL 1U92B 4K3JL 1CYGA 5KG9A 3SJVA 5GS2H 2V9TA 4FZ8H 3Q6GH 1KT2B 1P7KB 3EFFA 2X42A 3HI1A 3NZ8B 4Z7VB 3G5ZA 4Q9RH 4BQCA 2VISA 2VLRA 5DK0B 1EPFA 4NHUA 1KN2L 4YLQT 5FKAB 3IDMA 4JRYE 1V5JA 4YGAB 1JZ7A 1T2JA 4F33A 3C9NB 6FABH 3V7MA 4G6JH 4G42B 5E2VH 5IB3B 3DXAA 1AGCA 1DBBH 3F5WB 1CXFA 3MCKB 2DLFL 2AQ1A 3GSQB 1JRHL 1W72A 3P11H 4NQCE 3JSSA 4G9FD 3VFNB 4DGIH 1UZ8A 1GL4B 1SY6A 3UTSE 3O8XC 4QTHA 4YHPB 3ZL4H 2JJSA 1B0GB 4YBLB 5ENWB 2J8HA 3LKOB 1DN0A 5ICYA 4U1JB 2F19L 2R0ZL 3PF2A 5HHME 1A7QH 2CGRH 5DHVH 5KVDH 4JLRB 4N0CC 3JV6B 2XWBA 3LH2L 3ZTNH 1OLLA 3BHBA 1D9KB 1S9YB 2UY7A 2XNAA 3RWJB 3QDGB 1EHNA 4LASH 3VG0H 5AD0B 1MEXH 5I1EL 3K4ZA 1TZGL 5D7IE 4M8QB 4MX7A 4XVUD 1NBYB 2AXGB 3FQTB 1CBVH 4MMZC 3HE6B 4LCWD 1Q0XH 3NMEA 2VAAA 2GK2A 4L9LC 2FX8H 1A14H 5D7LA 3PNWA 1ZVHA 3RQ3A 2CLZA 4Z78A 5ANMB 4OLZH 4PRHD 4X9HA 5CGMA 1WCQA 3FAWA 1XF2A 3N85L 2FX7H 3GSVA 4OF6A 4W4NA 4PRID 1JFQL 1MAMH 3O41B 4KKBD 3C6LA 1UCTA 4MWFB 4LLWB 4XC1H 1IM3B 2DQFB 1YMHB 4MLSA 5FUOL 4MQXD 2XPGB 4BZ1L 1M7DB 3DX9A 3J7HA 4PJ8D 3L3OB 5FB8B 1WK0A 5IV2B 4ONHA 1W0VB 3QQ3B 2QKIA 2HFFA 5KANI 2P44B 1C5CL 2DLGA 4LNVA 4TN9A 2ESVA 4P4RB 1AR2A 5IFHH 1U93B 4Y5VC 5ILTL 1FJ1A 2AI0L 4RMTA 1DUZB 1OGTA 2HVJB 3OAYK 4PP1D 3MA9H 4R8WL 4NWTL 4MCZA 5IWLA 1T1YA 5J0BA 2YWZA 2HT4C 3O2DA 3U46A 2UWEA 3UPAA 4Q0XH 4V2BA 5F7NC 4JFOB 3RVWC 2EIDA 3OQ3B 5CCKL 4WTWA 5GGUA 4LCWB 3BEWB 1IBGL 1GGIH 2R4SH 4WFHE 3QAZB 3EJJX 4RAUA 5D71H 1T1XB 4N8CL 4ALAH 5TH2A 2BDNH 4PRHB 4X4YB 3BIKA 1T5XA 3T0DA 2C4FT 4PRIB 1UXWA 2R29L 3O2VL 1VFAB 1QSEA 1JGDA 1A1NA 3BUTA 3TCXA 1KCSH 3QJHB 3IVKA 2FBJL 4XHJC 1IC7H 3O11A 4DKFL 2VXTL 1S9WB 4PJ8B 4PTTA 3MV7E 4Y16A 1B2WH 2BCKA 2ORBH 3F7YA 4PBXA 4O00A 5JNYB 4RMRA 3RY6A 1HYSD 1YEEH 4PJBA 4DOHE 1RIHL 3KLAB 1KJ2A 4L1HA 4DFHA 4U1HB 1OAYL 2AV1B 4G8GB 4BZ2H 1I75A 2EIZA 3CDYA 4NYLB 1JZ3A 1T21A 2ZG2A 1CT8A 1D5XA 5D6DC 2AJUL 1UQSA 2A73B 5EFIB 3QXAA 4KHTH 5HGAB 1X7QB 3IU4L 4NUGH 2NY3B 1CFSA 5C0JB 1FFPB 2HLFD 4NQEA 5D1XD 3P73A 4TOYH 4KXZH 3MR9B 1KENH 4OZHB 5BVPL 2NZ9C 5EZIL 2VDNL 4JRYD 1WZLA 5TE4L 1WGOA 1JGEB 5IIEB 5TQ2L 1MCKA 2I27N 5DJZA 4EOWL 1V7NL 2GUOB 5C09A 3U6RA 2WWKT 1G6RL 2P7TB 1A7PH 2YD2A 4LCCA 1S8DB 3RVXD 1MF2L 2Y5TB 1DE4A 4IMKA 1NLBL 2Y7QA 4S10A 4J4PD 3VD9A 1U8JB 1FZOB 2FHFA 4JQXC 5TDPA 1T7VA 2CLRA 4N90E 5I0ZA 1P2CB 2N7BA 2WP3O 5HHMD 2WW8A 2EXWC 1TPXC 1HWGB 4ZDHA 3CSYB 2VSCA 4HGWA 4P59L 5F21B 4U7SA 1MWAL 3MLWH 4MXWL 3T0EA 1FH5H 1NFDE 1DCLA 5GXBB 5EU6D 1NDGB 3U83A 2BOCA 2DAVA 3H42H 4IRJD 4P9HH 2DQEH 2OP4H 4YHOH 5FF6B 3MV9A 3FQXB 4PJCF 3NFSH 3BXNA 1A9EA 2GTZA 5D1XB 1HOCA 5FOJA 2Q7YB 3EYUH 4YWGH 4XCNA 1D6VL 4JRYB 4QRQA 1I8IB 4ELMA 2V7NB 1I9RL 4F7MB 2F74A 3S5LB 1MLCB 2W59A 4XPHH 5JZ7C 3GKWH 4RFNC 3RVVC 2HN7B 5AZEH 5LGHL 3DROA 4FA8A 4XCFH 2PO6D 2R1YB 5CILL 2DQIH 2I60H 1XIWC 4IEFB 1DLFH 4NQCB 4P5KB 3LDBC 4HH9B 3QEHB 1H0DA 1YN6A 2DL9A 1JN6B 1U2HA 1VPOH 4GS7C 1DBKH 3VE0B 3VFTB 4EQ3A 5JUEH 3OKDA 3EO9H 8FABB 3Q5TA 3FB7B 4XBGA 1A0QL 4Q6IB 3V2AR 1T03L 4P9MH 3UPRB 3HC3L 1HN1A 4NNXA 4F58L 4D3CL 1DLHB 3PE9A 5HHMB 2FJHA 2GI7A 2E5EA 4DZ8B 4Z7NF 3OG6B 5K9JH 1HE7A 1I1CA 3IU3B 4I0PC 1VEPA 2IBZY 3F12A 5K59F 3L3DB 5B38A 2YD8A 2AV7B 3L9RA 1EUTA 2X4PA 4PLNC 4LSQL 2NYYC 3P77B 3REVB 4ODXB 4OD3L 1GGBL 3PV7A 4DW2H 5ACZA 3FTGB 5D7IB 1CDJA 4IRJB 1T7ZA 1YEIH 2H45A 4MCYB 3RWIA 3CAFA 2O26U 2DYPA 3B2VH 4WFHD 4LHUA 3QHFH 3D5OF 2GAZB 3BI9X 2AXHA 5A3IC 3ARDA 3QI9A 5LCVL 1WJ3A 1WCBA 2E6JA 5C8JA 4XNYL 3SKJL 4WV1A 5DYOB 3UXFA 4KRLB 5JOEA 2X7LB 3T2PA 4EXPX 2BFVL 3MREB 3VFOA 3ULUL 1IM9B 5INCA 3S6CA 1EO7A 4WJ5B 5DSCB 4DTGH 1ZT7A 2PO6B 5H2BA 4BSWA 3MV7D 1EVTC 1NGYB 4ZTOH 1UB6A 1VFBB 1CXKA 4QGTA 3VXPA 5IW6A 4BFIB 1U91A 4MVBC 2VQ1B 3TBYB 3C87A 1RVFH 3QXUA 3BW9B 2ZPKL 4HUWB 2EXYC 3PWVB 1IFHH 4F7PB 2X09A 5DFVD 1TFHA 3QIUB 2YPLA 2XI9A 2KL6A 3IGAA 6FABL 2NXYC 3EYVB 3WUWB 4TQEH 3GMOB 4HK3J 3CFBB 1UM4L 1QQDB 5HVFB 4OJFL 4U31A 5IQ7H 3BGFB 5M7QA 3SDDA 2W60B 4XP4H 1PD6A 1ZHLB 1SJEB 2F58L 5HD8C 5F6IC 4KI1A 4POZD 1K8IA 4NCDA 1P7QA 3WLBA 3O3BA 2AABH 5I73C 4LGRB 4LLYA 3ULUC 3MZTA 1MCEA 1RIVL 1T6WA 3SCMD 3MUGA 3X3FL 2VXUL 1KLGB 1SEQL 1CDYA 2NNAA 3I75B 3K80A 3JUYA 3WFZA 5IM7A 2NLJB 4N90D 5CUSH 1WFOA 3LKNA 4RDQG 4F15C 4LASL 3QXWA 1NMBH 3T1FA 3RU8L 3WL9A 3MV7B 3K8KA 4CBPA 4OB5L 1RUAH 2J3SA 5E56A 4X0KB 2PYFA 3HI5H 3A67H 4KXZI 1UKSA 5E7BA 2ED9A 4DOHB 3W2DL 3DVGA 4GKZB 3BQUB 3MXVL 4M6NL 4CADA 5DRNB 4UMGA 1QO3A 1OAUL 4O02L 1IMHC 1U8MB 1IKNA 1YC8A 2FX7L 3C5JB 1QR1B 3TZVA 1UB5A 4I48B 4AM0B 3VGDA 4FQCH 3BN3B 4UTBL 2B0SH 2X44D 3U0PB 4PJCE 4NM4H 2DOCA 5JO5B 5CP3A 1R0AH 3KPQB 2QSQA 5FK9A 1U3YA 2IG2L 3BSZL 2DQHH 2PETA 4FMKA 3U4BL 3AC0A 3IRZA 1LDPL 4S1SH 2HH0L 4PY7A 3QDJA 1B4RA 3N0PB 3QCTH 4Q6YA 3SCMB 5FO8A 5I6XC 4PS4H 3V5KA 4YXLH 1JWSB 5HGGS 2EDEA 3V0WL 1NGPL 3S3PA 3BZEB 3ARED 1U3HC 1IL1A 2B4CH 3PV6A 4LCUB 2JCCF 3L3IA 5IJVA 3P4NA 4LKCB 2VLME 1JHTA 3HCVA 3NCYP 1FO0L 1CD1A 4HKJB 4ODUB 1KB5A 4Z7NE 1I8KA 4WY7L 1FSKB 1GGIL 5F6HJ 4XI5C 3S36H 1NFDB 2CXGA 3VFWB 4C56E 4FXGA 3PL6D 5K59E 2B1HL 2PR4L 4XBEH 1AE6L 4LRIA 2VUYA 1FQ9C 1ZS8B 1II4E 2PF6A 1U2CA 2AEQL 4P48A 3UROR 1WBZB 1XGPB 3GMQA 3QB7C 3Q1SH 4PV8A 5I2IB 4QT5B 2VYRE 4QHLA 4YK4B 2VERN 3O4LE 1PY9A 1BFVH 2IALA 3NFNB 4HH8A 4V2CB 1ND0B 2XZCL 1XCTA 4C4KO 1GCFA 1FLTX 2VC2H 5E4IA 1MFEH 2KH2B 1E6JL 4QTIL 4QWWC 3QEGL 1KCRL 4YIQA 2D7NA 4DEPB 3MBEA 2A74A 3IFOA 1JGLL 1OD9A 1ZTXH 1D3CA 3KPRD 5TF0A 5FV1L 2H9GA 3WEXA 2GSGA 4PJDA 3T4YB 4JM4L 3MRQB 5I1DA 2R56H 1PZ5A 5GZND 4KUCF 3SJVD 2J88L 3TIDB 3EFDH 4NOFA 5LGKA 1I7UA 4KQ4H 1FVEB 4OBRA 3KVQA 2HKFH 1MREL 1LE5B 4WI2A 4IHOB 2VLRD 4O9HL 3HNVH 3CFJB 1ZLSL 3V6OE 4R4NC 3TO4C 1C5BH 4HIJB 5BJTB 3ZHDA 2J7LA 3VI4F 3PL6B 2XTJC 3STZB 1JTPA 1RHHB 4ERSL 1QD0A 1Q1JL 4NO2B 2DMBA 1B3JA 4Z0XA 3H8NA 5BQ7A 3TVMD 1E4KA 5BW7C 1WT5A 2Y1VA 3LAFA 4EN3D 4EEEA 1EEZB 3WFCH 3C60C 4Z95L 2XKNA 2KZ1B 1YDPA 2ZOKB 2HG5B 3FO1A 1AD9A 1V7ML 3VWJC 1TTUA 2H3NA 1FVCA 1JZ2A 2PTTA 1LE9A 4YHML 1MFBL 5TDNB 4JB9H 1ZT4B 1RZIB 1FL6B 4X6CB 2I9LA 1FNSH 5I1JH 3WXVL 4QY8B 4R7DA 4LVOC 5BXFA 5EO1A 2CMRL 1DQML 2WANA 2XA3A 1OQXA 3KLHC 5I76B 5GGRB 1WTLA 3MJ6A 5DMKA 2Z8RA 3VFUB 2X4RA 4KDVA 1BGXH 3EOBB 3D0VA 2WIMA 3BPNC 3EYUL 3L7FA 5DRZA 3IAPA 1DVFA 3W0WE 5BS0A 3R1GL 3TA3D 4H1LA 4Z9KB 5JMOC 4AY0A 1EFQA 3I85A 2X9XA 2Y07H 2WQ8A 4XGZB 3PXJA 5EN2A 1NJ9A 2LU7A 5E2TL 5I1AA 1YJDL 1F3RB 3D2UA 5D72H 3U0TB 4CVUA 3PUCA 5JIKA 1RU9L 3QNXA 5D93C 5D4QA 1H3VA 2BVYA 4ZS6D 3TVMB 4GRLA 2WAHA 1YPZF 4FQJH 4JY6B 5HYEA 4I5BB 5D1QA 4EN3B 1S7TA 3BEVB 4GG8B 3BAEL 1HHHA 2VIRA 1ZLVH 4AYFA 2HJFA 3WD5H 4XNMB 2PCPA 5K9JL 4P2OD 1WEJL 4HMCA 1FRGH 3BH8A 2EDLA 2AJXH 5GGSA 4I3RH 5CZVH 4KJYA 5EH1A 4B5EA 3OXRB 4D94A 1XF1A 3ARUA 2YUVA 4S1QH 3QO0B 1I85A 3RTQD 4D0DB 1BD2A 2VLMD 3JTTB 3DX6B 1YY9C 5IESH 2V5TA 3MJ9L 5EU5A 2JCCE 3WO4B 3WNMA 2NY2C 4A6YB 4QRPA 3LN5B 4C56D 1JI2A 3GGWB 3BP6A 3V95A 5ID1B 1BQLL 2VITB 4ZNEE 3SOBL 1YJDC 2WBKA 3MMEA 2DQCL 2QEJA 3TA3B 1L4IA 2EICA 1E27A 4C54A 5JW4Q 5D70H 2K3TA 4GG6F 3OJDB 1WBYA 3O4LD 2ZUYA 1TNMA 5EIIB 3KWWB 4PJCB 3SGEH 1G7HA 1A1OA 1MCNA 3PJSA 3QUZD 1QSED 4JFPA 4KK8D 5EA0L 1UH4A 3G6AB 4GRWF 1A21A 1BFSA 2EC8A 4I18A 5DMIL 4QHUB 1A1MA 4OZIA 2EZ0D 5E8EB 5EOCH 1ZSDB 2BXYA 4YDVA 5EBMB 1C8PA 5ESQA 4LSUH 5B3NA 2A6JB 3SE4C 1FAIL 5GGVH 4KK5C 4JY5H 4HCRH 4PJ7A 3FOMA 1AC0A 4Y4KA 3UAJD 2DQGH 4TQEL 4H88L 3O3AB 1AQDB 1OM3L 4O2EA 1UCBL 4LCIH 2BSTB 4ZFZA 1HWHB 3QPXL 5IMOB 2YUZA 3RTQB 5GIRA 4OUOA 3B9KD 4X5XA 3S37L 4NQED 1NAMH 1AD0B 5EU4A 4C56B 1X5IA 3BKCH 4UT6H 1JNLH 3JV4B 3UC0L 1OF2B 2XWTB 2QSCL 4OCMC 3VI4E 1ZHBB 3VFMB 2NY1D 1FGVL 3IFLH 4R97C 4L8BB 2WIIA 2WV3A 4GAFB 4LSVL 1A3LH 1M6OB 1CG9B 5FGBC 3O4LB 3ESVF 3WLWC 4HGKC 2VR9A 1INEH 4OKVB 1FL3A 4JVUA 3VGEA 4TSBH 3MRJA 2DTSA 3ZTJH 3IDGA 3EYQC 5EO0B 4PGEB 1FHGA 5DHYB 1T80A 5C07E 1QZ1A 1T1WA 3IJYA 1U8HA 1S78D 3WHE0 4HEPG 5DO2D 3FT2B 1I7TA 1G9NH 1QVOA 5KSBA 3OJMB 3IFPA 5A2IH 2CRYA 3HC4L 3DGGA 2B0SL 1WIUA 4KWUA 3W0WD 2I9TA 1LNUA 3EZ8A 3HG1A 3ILQD 1TJHL 2VDMH 4PG9B 4UV4L 3WIHH 1D5MB 3TNMA 3I50H 2WLYA 2IH3A 1Q9KA 3B9KB 2Q8AL 4Q9QL 1KLFA 2FB4H 4WO4D 4TTDC 5HGBB 2HJLB 4GMTH 4LSSL 1JWMA 4J8RB 4OF0A 1VADA 2KQNA 4LQFH 3TPUB 2XQBH 1FNEA 4YXLL 4RRPA 2NY1B 2Z91B 4O4YL 5F9WC 1EXUA 1F4AA 1BM3H 4OUUA 4L9LA 3RX5A 2O61B 4KZDL 5F88A 2R2BA 2CDFB 3A0OA 1YPZE 3DMMC 4RWYL 1S7SB 2H2SD 1M4KA 4ODTL 4RFEA 5F1NB 5IHUL 1QEWA 4NNPH 4ONFH 2QADC 1KIRB 4KMTH 1J0YA 1C08A 4RGNE 5JXAL 2X4QA 3ALPA 2NXZD 3QWOB 3GZKA 4XRCA 2XXMB 1WUNT 4NRYB 15C8L 1ACYH 1AC6A 4JM2C 4EDWL 4EJ1C 5E99H 1C16A 4XH2A 2QJDA 2FIRT 1UYWH 5MI0B 4XVJL 1N6QH 4DVBB 1ZWIB 5T1KA 2VXSH 3MOBL 3V0VB 5GGTA 1IGJB 1OD7A 5BV7L 4Y5VA 3BPLC 3W0WB 2ZUTA 3D69A 5DMGC 4KTDL 2KDGA 4KVNL 1ZTXL 4GG6E 4LLUA 5CJBA 2QQNH 1AR1D 2EIBA 4UIMA 4CW1A 3KYNA 1ED3B 3PWNA 4OF7A 4RGOH 4QXGH 5L2KA 3MC0A 5ICZB 3BGAA 3DV4B 1GIGL 4HKXB 5F89B 1JV5A 4GRWE 5D2NC 5J6GB 1RFDL 3P0YH 4LF3A 4YNYA 4YHZL 4ETQB 3SDAC 3BP7B 4D0BB 3CH1B 4P2RE 1MIEL 2CD0A 3EOYG 3NGBC 4D9QE 2OR9H 4KUCD 3OJVC 4PB9L 4ODBD 2BY0A 4J3WA 2NXZB 3X13B 4BZYA 3UTTE 5DJ0A 3Q3GA 3TBTB 1MQKH 5BV7C 5JOFA 4N1EA 5F71A 2JCCB 3MRDA 2VLKA 3L3KB 3SGEI 4JZJB 1ERNA 2DD8H 5MENA 1YA5A 4Z0BL 3QO1A 3K46A 4MHHG 4PJAA 4P4KD 3GSRA 4Z5RB 1IGYB 3CZFB 1AKJD 2JF1A 1XR9B 1B9ZA 1PYWB 4NO0D 3GBMH 5GRUH 1I1AC 5CJOL 2C26A 2PW1A 5ERWA 4RWHA 4X8JB 5HYSB 4OZGA 4JQIH 3S4SB 5J12B 3I6KB 5I1JL 1M7IB 4RSVA 3HC0A 2XFXB 5CD5D 1XF4A 3MRCA 4JPKL 3FFCA 2R69L 3U82B 4UDTA 2HFTA 4F3FB 5C08A 1MCJA 5CBEB 2BHZA 3C09C 4P23A 3GSWB 2WK2A 5C07D 1IQDB 1IEAB 5IB5B 3LQAL 4LLVB 1U8PB 4Y5YB 4APQC 3N06B 4DUVA 4V1DA 4YZFF 5K9QG 1PLGH 3TCLA 4GRWH 1SMAA 5E8NB 1Y0LA 4Q7DA 5DD3L 1T83A 3H0TA 4QYOA 4XZUA 2FSEB 3GSNL 1NC4B 1FZKB 4NOBA 3HMWL 4PJGF 5JIPA 2JIXB 4LGPB 4LEXH 4QHNA 3TIEB 4YXKL 1T6VN 4PGCA 3FO9B 4NQTA 5FYJE 2XN9D 1JHKH 1LK3L 1F90H 1D5BA 1ZLVK 5ID0B 5I8KL 2GK0A 3L95B 4FQJL 3VXME 3CD4A 2MTPA 3D9AL 3MNWA 4ODVL 3QEQD 3UX9B 4P4KB 1T20B 3DHJA 4NUJB 2OL3L 3GM8A 4WI6A 3D0LA 2X1QA 4E42B 4NM8H 5GISL 5BZDB 5J13C 1UA6H 4NO0B 4JPIB 4N0RA 4MA8H 2CRIA 1WWWX 2GIYA 4HWBA 1JE6A 2ICWI 4JFFA 3VXRA 1NCAL 3RHWF 3LRSB 4JHAH 4S1QL 5J1AA 3LQAC 5BO1H 4OV6F 2IAMD 1CGYA 5DFWH 4QLRA 5IVNA 2KKQA 3BRFA 2H6PB 2IMNA 5D1ZC 3TBSA 2XA8H 3TFKD 1X5JA 4FQXA 4LPXA 5CMAA 2EDJA 5C07B 4BH8B 4YX2L 4XMLH 1YNLH 5MP6H 3ALXA 2EDDA 1XIWA 1L6ZA 4CN6A 1V3MA 3G04B 5DF0A 4BH7A 4B53A 1QOKA 4M48L 2NMSA 1RUKL 1P5UA 5I8CA 1KNOB 4JFXB 1F2QA 4XBPA 4HS6B 3HMXL 1MWAA 3AGVA 1ZGLB 2Y06H 5ALBL 4AG4H 3KLSA 4PRBB 1S3KL 3B3IA 4C58B 4HC1A 3NAAH 1W8NA 3QZWB 2ZUWA 1I1YA 4HPOH 5DVLA 5ICXB 4I0PA 1NANH 1QSVA 3WV0A 2EH8L 1H8OA 1GVIA 3E8UH 1FNFA 5F9AC 2BHYA 1CFTA 5CEZE 3RZCB 3H9HB 3OZ9H 5HHOE 1RJLA 4JY5L 4TVPE 5GRJH 1G84A 1CD8A 4R2GD 2BMKB 1YNKL 3RKDC 1W2KT 1NUNB 1YPZB 3OHXA 4LU5H 3F7RA 2VDLL 2RQ8A 2IAMB 5FA4A 4N1CA 4GAJL 4JDZB 4D9QD 3GJFB 5FUCC 4CL7A 1HHGB 3R0MA 3WNLA 3ARGD 4RGNB 5JLZB 2VDKL 2F8OA 3KPOA 3IS1X 5JXED 4JDVA 3E6HB 5KS9A 5E0QA 1S5IH 5D6CB 5D96B 4JJHA 1QFUH 2FGWL 2XZQH 3ET9F 4GO6B 5DURD 1I4FA 1JPSH 1CU4L 2W9EH 1RZ7H 3K1DA 2D7OA 1KFAL 1PG7X 1ZVSB 2WINA 5AZ2H 3DVNA 2P43B 2DL2A 5FO9A 1N26A 3HAEG 4NQVB 5FYLH 3RGVD 3NPSC 4OGXL 4TSBL 1MJ7H 3CXHJ 3QHZL 1NUDA 3HS0B 4OCYH 3QIBD 4U6HA 1XFPA 4JDTH 1TETH 3ZZ1A 3THML 5CEYB 4KFZC 4GG6B 5DD5L 4JPWL 3KPLA 3WE6B 2WWKO 5DTFB 3A6BH 1E6OL 3RA7L 4GW5A 5CEZH 5IMLB 3K3QA 2QHRL 4TVPH 4R2GB 3VGFA 4GRWB 1U0QA 3GB7B 3QYCA 5DK2A 4P2RB 5INDA 4YZFE 3O3EA 4MJ2A 4HX1A 3ETBF 5FGSA 5FCSH 1S9VB 1K5NA 2HRPH 2Q6WB 3O6FD 1DVFD 5E6ID 3R4DA 4HIHA 5DWUL 3DV6A 4XVSL 4JHZA 4M61A 1NUGA 5FYJD 3TH4T 2G9HA 2GT9A 4PJGE 2AKRA 3B9VA 5DURB 3U9UB 3VXMD 4WDIA 3OKOA 12E8H 3E6FA 1VGEL 4L9DA 2R9HC 3DURB 2DBLH 5JW4R 5I0DA 4ORGB 3IF1B 3OXSA 3LKRB 3VD7A 3RGVB 2HVKB 4P5MB 4WFEE 4XWGL 1A7OL 5C9JA 1A6VH 1J5OL 1WISA 5ADPL 1A47A 3QIBB 4IMLB 4Y19E 2I5YH 3S35X 4LPTA 4NKIL 4AIZA 1OP9A 1HSAB 3TWCL 3VH8G 3GSOB 1KBGH 2FL5A 4OFKA 1SQ2N 5EUOA 1LO0L 3U7WH 1RAMA 3MLXH 3T65B 5SWSE 5AWNL 3DGCR 1HH9A 2QR0A 5T3ZL 3VRIB 3SO3C 3MLZL 2BVPB 1RD6A 3LSOB 2EDKA 3HZVB 4NP4H 4L3EE 5F1KC 3ZDXF 1MCPH 4HQQH 1ULVA 2DM4A 2OJEB 5DVNA 2VZVA 5DQDH 1MQ8A 4EUPG 5IBLD 4LK4A 2XQYG 3BDYH 5E2UL 2X6MA 1MFAL 3DUUB 4N5UA 3O6FB 1U3HA 1TZHA 5E6IB 4JO1L 3X17A 2DQTL 2GYSA 4P2QE 1BFOB 1Y18A 4G6AD 4LDOB 4HFWA 1QTYT 4NQSB 3QA3A 1OAKH 3VXMB 3ZKMD 3HKFA 4XP5H 3CDFA 3ECBB 4OT1H 3LS5H 1PG7W 1QBML 5DUBA 5TE7L 3MRLB 1A6AA 1XMWA 5TE6H 3OTTA 5HXMA 3GJFK 4WHTA 3RIAF 5HPOA 1HHIA 4WUUD 4HS8H 5DQJB 4JREB 4GQ9H 2BY1A 2F8XC 4TVPD 1JGVH 1H3XA 1FCCA 1MY5A 5I66B 3NCJH 1NQBA 4CNIB 3DECA 5BZWA 4P2CG 3MLSH 5CGYD 3QUXD 5EDXA 2X4SB 1NFKA 2VE6A 3W81A 2FDBP 4P46C 5CWSA 3TN0D 1P1ZB 1J0HA 1S5HB 3MRRB 2DTML 1YUHB 1YEHL 1F11A 1B6DA 5AYUL 4OGZA 4QF1B 1FFOB 1GC1L 5DQ9A 3RUGB 3BPCB 5KW9H 4MB5A 3BT2H 3NCYS 1Z6JT 4JHWL 3IDXH 1T2XA 1NANI 3HLAB 4OZFA 3V4VL 1F3DH 3HZKB 4M7ZB 3RPKA 4LSPL 5F3BB 1V3KA 3V4PH 3U48A 4X6EA 1I8LC 4JO3H 1R3IH 1IGIH 3E2HC 1FO0A 4JZOB 1XGYH 2YBRB 5DT1H 3VFVA 1DEEB 1U8NA 4ISVB 4U1NB 1CGSH 2FX9L 1K85A 1E0OB 4HLZH 2H26B 2W9DH 5B4MD 1PLGL 1D9KC 4HWNA 4NZTH 1F4XH 5HHOB 3FQUB 3TBWA 4RQQB 3ZT7A 3T08A 3VXNA 5BW7A 3FONB 3UJIL 3BKYH 1ZT1B 2OZ4H 4KK6D 1SMOA 1T5WA 1HKFA 1GC1C 3QUXB 1NCCL 3C60A 3BP5B 3U1SH 1KN4H 2FR4A 1XGUA 1C5DA 4WWKD 5FYKU 4XXDA 3VWJA 3TN0B 3QCUH 1AGFA 2GFBB 2Y25A 2F53E 1YY8A 3ARBD 4D8PA 5HVHB 2XZZA 5IVZB 1RZKL 3HG1D 4GSDL 2A6IA 2P48B 4HIEA 1KJ3H 3GBNL 5GS1A 4JCMA 2V5MA 4K9EH 4NC1E 4PJEA 2UZYB 1OSZB 2A83A 4NBYB 1N0XL 1FDLH 3CLFL 4IRZL 1RIUL 2GJZB 2XRAH 1DDHA 1LDSA 4NN7B 4PRPA 2Y72A 3FB6B 1IKFH 4WFED 3G5YA 2VTFA 3ZMRA 1OAQL 3P9MB 5SX4H 1IAOB 4Y19D 1FFNA 2HTKD 1XH3B 4HWEL 3DX8A 3OKEA 3O3DA 4Y4HC 3WNKA 2ZSVB 3P40A 3U0WH 3R06B 4Y0GA 1KG0B 5SWSD 3DO3A 2DLTA 4RISL 3QDAA 3W11D 5C7XL 4MD4A 1P9MC 4N8VA 5D7JD 5E2JA 4PTUA 4QKXB 4LLDB 4WUKH 5A16A 1R5IA 1YEGH 4L3ED 4XVUC 1CVRA 3Q48A 1MY7A 3CFEA 4YDJB 4ZPTB 2G60L 3CPLA 3QAZC 4FNLH 2W0PA 2VZOA 4LAQL 4WWKB 3GK8L 3ZDXE 2W07A 5T1KD 2X05A 4P0DA 4KJPD 1LO3L 4RAHA 1G7LB 2BNUB 4L3AA 4K3EL 5B39G 1FNGA 2AJSH 4ZUVA 1HILB 4OLXL 2A9NH 3MPCA 4KKBC 3O45B 1QLRA 4P2QD 4PJGB 2X4NB 1NGXB 1NGQH 4MQXC 5EC1B 2GEEA 2NY5H 3DXAE 4PJ8C 4X4XB 4UQ2B 5E8PA 2P5EA 3M1BB 1H3UA 32C2B 1TVHB 4W6WB 3L5IA 3BZFA 4UILH 3L3GB 2AJ3B 2R1XA 1F45A 5ECJE 4EQ2A 3M17A 5F7FA 1CGTA 1F6AB 4PP1C 4Y19B 5D5MF 3TBVA 4TRPH 1TVBA 1IC5L 4DQOL 4BSVB 5IOPB 5FDWB 3FB8B 3SDCD 1UENA 5FECA 2ICEB 5E94A 5SWSB 1BOYA 4HD9A 1Z3GL 4I77H 3LB6D 2W9EL 1FPTL 1T1ZB 5C0RH 5IF0A 5D7JB 1JZ8A 1I9EA 1NFIB 2YA0A 1EHLL 5JHLL 5FHAH 3FJTA 4CU7A 4L3EB 3Q6FB 1NKOA 1UADC 2F54A 3MJ8B 1BVKA 1QA9A 1D7FA 2MPAH 5JDJA 4U1LB 3PGCB 5GSRB 4LMQE 2CK0L 1RULH 5F93C 1Q9OB 1RUPL 1UACL 3LQMA 1UWGH 5DD6B 1ORSA 1S7UA 5EBWB 2BRQA 2FECL 4K7PL 3MJ9A 1RV6X 4FQ1H 1NLDH 1MCLA 3PIQB 4JZNA 2SEBB 4XMKH 4P2QB 2J6EA 1SHMA 3FT4B 2FH6A 1KEGL 1G6VK 2H32A 4PJ9D 3HR5A 1YYMH 5JORB 1EJ6A 1EAPB 2V2TA 4PRNB 2EH7L 1RJYB 1W72H 3U2SA 2FIKA 1F2XK 4P23D 1OVZA 2BVTA 5ACLA 1CE6B 3IDJB 1J18A 2EKSB 43C9B 1P7HL 4HS3A 1A64A 3UO1H 1S7QB 3PABB 2HRPL 3BDXA 1CL7H 5FGBA 5KVGL 4DZBB 2EEBA 3IAGC 3SDCB 2IPTL 3FKUS 2C1PA 2R23A 1CQKA 3CK0L 2F53D 2HLFC 5D1XC 3MCG1 4PJFA 1H3PH 4Y88A 3GMMB 3I3BA 5SX5H 3MGOB 4YDIL 1XGRA 3UJTH 4NT6A 1I9IH 3R0NA 4HPYH 1JF6A 5DLML 4IOIB 5AG8A 3BPOB 3RJQB 3UYRH 3C8KB 4ZFOL 3RVXC 1FYTD 2I5YL 3GSUA 3L3HA 4HJGA 3DYPA 3QP3A 3U30B 4JG1L 4J4PC 4LKXA 35C8H 4F57L 1LQSR 1GOGA 3X3GH 1R5VB 4Q6IC 3STLA 1NL0H 5E70A 1UT9A 4JFFD 3A6CH 4W70A 4PJ9B 3G08A 5LJYH 2VQUA 3BKMH 1MCPL 3TF7C 2CRZA 4NZRH 5HPMA 5IB4B 4KDWA 1L0XA 2APWA 5JW4N 4PLJD 2CXKA 3LKPB 1U8IB 2NY0D 3UJJH 1U8OA 2DWEB 4GAYB 4NPYB 4R6UA 1AO7A 5A2LH 1OQOA 1DBMH 2ADGA 1LO5A 2DJSA 4R0LA 5DJ2A 4GRMB 1TTGA 3PWUB 2F53B 2C3VB 2IGFH 4Y4FC 3WN5B 1UM5L 1OGAA 3FMGH 3ZDYF 3QULA 3O2DH 3AU1B 3ES6B 3ULVF 4XAKE 5TGBA 2K9UA 1LD9B 5SX4I 3LQZA 5E5UB 4JM2A 1JGVL 2PO6C 3CXDH 4JFEA 1OHQA 1BBDH 3OAUH 4OFYD 4GOSA 5KVEH 1BBJB 3RHWK 4LVHC 3SDYL 2O5XL 4ELKA 1JPGA 2JTDA 2ZNXA 5K9KB 1AGEB 5FOBB 2P46B 1MFDH 5FUZH 5DI8B 4KPHH 4XAWL 2IFFH 5I1LA 1EGJH 4K7FB 3QG7H 4TPRH 4HWZB 5CHNB 2VZ1A 1U6AL 2E27H 2X89A 5IB1B 3KXFA 2EECA 2A9MH 2WBJD 3K74B 3VFRA 3S34H 4NZUL 1R6VA 4OM0H 5D5ME 4CVZB 3FO2A 5F9DC 4PJXF 3BGFC 4M5YH 5FYKE 1G0YR 3V4PL 2BVQB 4M62L 3AM8C 4LP5A 5FXCH 1KJ2H 4HKZA 1OAZH 2XZAH 3MXWL 4ZOCA 4OCSH 5D2NA 1XZ0A 4XVTL 2ITCA 3RFZC 1XGYL 1OTUD 3SDAA 3MV9E 2CLVB 3EOTH 4OCNC 4H20L 3EOAA 4TSCL 2Y5EA 2OMNA 2EYRB 4DUXA 3SE8H 5I19L 2ZSWB 5DD0H 3RX7A 4RAVA 3PWPE 3P30L 2IANA 4FHBD 3QH3B 3DXAB 1WC7A 3ROOA 1JTOA 1AFVH 4GW1B 2VRAA 4YAQB 5C86A 3SEPA 4H8WH 3ARTA 4PV9B 3T4AA 5CEXB 5DJCA 5C6TL 3V8OA 5EU3B 4LVNC 4MD0A 4HG4J 1J1XH 1WVZA 1QSFA 3M8OH 3HFMH 2N7AA 3LKQA 3MCLH 1NEZA 5DFVC 5D8JH 2QHLA 1I1AA 2ED8A 4U3HA 2X10A 1J86A 4MQTB 4Y5XA 4K94L 4M6MH 1MRCL 5GJSL 1TZIA 3DIFA 2FEEI 5JQHC 4NFDA 3H2WA 1IGTA 5FYKH 3C5SA 4POZC 2XRAL 4APQA 5F96H 2APBA 1D5IH 5SWZA 5I8OH 3HZYA 4HXAH 1VFMA 5KZCD 1WAAA 3ZKND 4KVCH 1NSNH 1K8DA 2IPKA 4MDJA 1IGCH 2NX5A 1HXMB 4LCYB 3O6LL 1U58A 4KHXH 4MQ7B 1QFWH 4CMMB 1RZFL 2EDBA 1MNUH 4MAUH 1KIQA 3K0WA 2DQDL 3EDDA 1EZVY 2L4OA 1CFVL 1CL7I 3D3VE 3IKCA 3ZSSA 4OIIL 1JF1A 3QUMH 3UBXA 1R3JB 5C3TA 4YXHH 2W0KA 3DX9B 2DQUL 5EZLA 2ZJSL 1YEJL 1FSKC 1CZ8L 4LSRH 1AXSB 1X3DA 5FM4A 2FYYA 3FQRB 1T7WA 1RUML 3PP3H 3REWA 4K94C 1A7RH 3HRZB 3D39D 5E4EC 1IEBB 1RZ8A 2UZIL 5DRXB 2MCPL 4ODWA 3P2TA 1GAFH 2A9NL 1L9NA 4YDKH 1A5FH 3CC5A 5CJ8A 2GTWA 1M71A 3QXDA 1CR9H 5E5RB 4MCZB 4YK4C 2H2PD 2K7PA 1EZVX 3GNMH 5F7UA 4PGBA 4LNRA 1FL5B 3U46B 1XR8A 5L8KB 5DZOA 4KKAD 3MO1A 4G80B 2LVCA 2AEWA 1AXTH 5KOMC 3ZDYE 5JPNA 2HWZH 3QG6B 4J3SA 5GGUB 3CVHA 5KZCB 4K8RH 3ZE0F 4UOW0 3ULVE 3ULSA 4HJJH 4HUMB 3UMTA 4DGYL 2E9JA 3QEUA 4TRPL 4LOUD 3MYJA 4RBPK 3BIKB 2PUQT 3K8LA 2OK0H 3BUYA 2IQAA 3VRLF 3AREC 4TNWK 3GMRA 2FBOJ 3JWOH 1A1NB 1G7JB 3OV6A 5IK3B 1T3FB 4X7TA 5JPMA 5KSAD 2WUBH 4EI5D 3KYOA 1ES0A 3P0VH 2FD6L 5FHAL 2EDFA 4UBDD 2OBGA 1LO4H 1DQQB 1MHEB 2OR8A 3O6KL 1P6AB 2BCKB 1HH6A 2V2WA 3F7YB 1YEFH 3PL6C 5FYKD 5E8DH 4PJXE 3TGXA 1P4LB 4L29B 1WV7T 5IBTH 5BRZA 2ADJB 2X9WA 3QQ9D 3L1OH 3OF6D 4HHAB 3B43A 4HZLA 1KPUB 2N56A 1NGWB 1U3JA 4X7SH 1PY4A 2ADFH 4H5SB 4X5WA 2R0KH 2AK1H 5AEAA 1YYML 4YUEL 3X14B 1CE1L 2Q8BH 4YPGB 1KELL 4O58H 4AMKH 3PWPD 5TFSL 1HCFX 1N64H 2WUCH 5I1HH 2R2EB 1ZA6B 3DSFL 1S7RA 4QOKA 3H9SA 1SY6L 3U6RB 3TC9A 4E9LA 3SKMA 4YC2B 4ONOA 3QDJE 4JN1H 2BSRB 1M7XA 2NZIA 2YN3A 2YXMA 1S9XA 4U1GB 5F7LB 2R0WL 1RMFH 3FQWA 2HMIC 4AK1A 4TUJA 5E5MA 5KSAB 4EI5B 4A6YL 4WWID 2E7CA 3MRGA 5GJTL 5T5FH 3VG9B 4R4FH 4X80H 4QRRE 4BFBD 5D5MB 3AAZA 4JO4H 3UJTL 1I9IL 1BMGA 1F4YH 1FBIH 5HYJE 5KSVA 1MPAH 2J8UA 3KPSE 3RWCA 1N3NA 2PYED 3O0RH 5EZOH 1EO8L 3OKMA 3NABH 3TVMC 3SQOL 1N59B 1JGUH 4EN3C 4MXQD 3MV9B 2HLAB 4KGLA 1EJOL 1YNTA 3AS2A 3TYGL 3BXNB 4G5ZL 5IMKA 5FO7B 1A9EB 4O51B 4MZ2A 1HOCB 5JW5A 1MJJB 3GMNA 2O5YH 3MV8E 4WNQA 1AQKL 1T2QH 3ZHLA 2RBLA 3NVQA 5ESVA 4NNYB 3PWPB 3H3PL 4RZCA 5CP3H 3QUMB 3D3VD 3SQBA 3EO0B 2VSDA 5EU7E 5TQ0L 1CFQB 1MI5E 2IFGA 1O0VA 4IJ3C 1DZBA 1JYXA 5LBSL 4F37F 5C0EB 4D9LL 4G43A 2YKLH 3BD5A 3TJEL 4UT7L 5F7MC 3GSXB 1J05B 2G75B 5CJQL 3T77B 4NRZB 2IMMA 3TA3C 2X4OA 2HT3C 3C8HA 2GJ6A 4YFEA 4UU9A 5GS0H 3VCLB 5DC9B 4Q9BA 5B38B 1QFWI 3CXDL 4X4ME 3UP1A 5J9PA 4ZS7H 3DTXA 2B1AH 4NO3B 1JNNL 4D9RD 1QYGL 4ZS6C 4RNRA 3KJ6H 3T2OA 3RWIB 1A8JH 1ORQA 3DBXB 3ULVD 3TO2B 4UB0L 3RX8A 3VGHA 1KLUA 3NFPB 4UIKL 4P3DB 3QI9B 4OCXH 3ZE0E 1X5KA 1WCBB 4OAWA 1I8MB 4P2OC 4LPCA 1MCFA 3RY5A 4YQXL 3RNKB 4K3DH 5K9OA 1NCWH 4RMQA 5IFAH 3S3JA 1HKLH 2YD7A 3D3VB 2J4WL 3UDWA 4L4TA 1MHCA 3MLVL 3VRLE 5IEKB 3RL1B 3RTQC 5IWLC 5IMMB 1FC1A 2EDOA 4KV5F 1KJ2L 1YN7B 1CLYL 2DICA 3MFFA 2P5WE 3NIFF 4DAGL 1M05A 4HT1H 4JAMA 3GMLB 5F1IA 1U92A 4ODHL 4QXTA 3G5XB 3DRTB 3SE9H 1J0KA 1RJZB 1KT2A 1P7KA 4ZAKD 4ONGL 2VOTA 4YO0B 4F80A 1F58H 2C3HA 5BS0E 3NZ8A 3HAEH 2K7QA 4PUBL 1LO2H 4KQ3L 3WKMH 3B5GA 5FKAA 3S88L 3SDDB 3QUZC 4DGVH 1RK0B 4H8WL 1AJ7H 2BNRE 5E95B 4KK8C 3S98A 4I8DA 1SBBA 5IB3A 5E2WL 1C12B 4M6AA 3MCKA 1E4WH 3GSQA 1OSPL 2EZ0C 2QV2A 3VFNA 1VA9A 3ILPB 3RY6C 4FABH 1IQWL 4KK9D 4MB3A 3UAJC 1BVLB 5EUKB 4YHPA 4M6ML 2FWOB 1B0GA 4LPYA 2CO7B 5ENWA 2JE8A 1INDL 3LKOA 5I15L 3IJHB 4U1JA 5HGHB 5L8LB 4U3XA 4QRRD 5GS0D 3B2UD 4HFUH 2HTLD 5F96L 3V6OC 3JV6A 3B9KC 3C08H 5FA3B 1D9KA 1S9YA 5HYQB 1BEYL 2D2OA 1F6FB 1KPRB 3QDGA 4QXUH 1ZXQA 3RWJA 5HYJD 5EORL 1NH6A 4J7RA 2CRMA 1DQTA 4KAQL 1CTOA 2AJVH 5AD0A 1E4XH 4PJXB 5MERB 4M6OH 4ZAKB 1Z5LA 4R26H 1FFQA 2NY1C 4M8QA 1NBYA 2AXGA 3FQTA 1B4JH 3HE6A 2AGJL 4MAUL 3EYSH 4OIAA 4L5FL 3L5JA 4H1LH 1LMKA 3L5WB 5ANMA 5K9QI 1TQCB 1FIGH 5L9DH 3RBSA 2YD6A 4YXHL 2BVUA 3PP3K 4G6KL 3CDGA 2I24N 4OTXL 4PP2A 3O41A 2OSLB 4MWFA 5CIPA 4LLWA 2XT1B 3W9DB 1UC6A 1IM3A 1MUJA 2DQFA 3U9PH 4IDLA 1YMHA 4I9WE 1S78C 5DZNA 2W0FB 1M7DA 5FB8A 3L3OA 1N6UA 3QDJB 3B4NA 5DO2C 1MLBB 2NY6D 5IV2A 3AMKA 5IR1B 4FQQB 3QQ3A 4G9FA 5SWQB 1GAFL 2NR6C 4KKNA 5MI0C 4HIXL 4KY1L 3FZUD 4EUPH 3GNML 1U93A 3WHXB 4PRDA 3VMNA 4IRSD 1DUZA 3ILQC 2FO1A 2VO5A 2HVJA 1BAFL 1PX3A 4QRRB 4H25A 3QCVL 2ATKA 3L3IB 3P4NB 4I13B 4U1MB 4FQPA 4IM8A 5E24E 1ROWA 5HYJB 4K8RL 4ODSH 1OGAD 4WO4C 3KPSB 4JGUA 3BE1L 4PJAF 4OQTA 2YMXL 4FFWD 2APXA 4JFOA 4PJHF 5IGXH 3CCHA 4NGHH 4LCWA 3BEWA 2E7HA 3IFNL 3QRGH 4GMSH 1U95B 1T1XA 3F58H 4QHLB 3TH2T 4PRHA 3MRFB 2H2SC 3LCYA 3MV8B 4UV7H 3WSQH 3NPZB 4PRIA 5C0IB 2EYTB 3SKOA 3U36B 1VFAA 5EBLB 4TUKL 3CX5K 3QJHA 1P4BL 2NXZC 1MI5B 3KXFD 6CGTA 4X6FB 1DQDH 1S9WA 1FV1B 4L8SB 2YSSB 4PJ8A 2GSGB 2P5WD 2NY6B 1S7XB 4RA3A 5JNYA 5MEQB 2GHWB 4KV5E 4YHLH 4ENED 3NIFE 1UWEL 2G5BB 4U1HA 2HKHL 1BQHG 4X4ZA 3GIVB 2R0KL 4IRSB 5E9DE 4Y89A 3HAEB 1KCVL 2R0LH 3HPJB 4LHQB 2A73A 3NH7H 5EFIA 5L6YH 3KJ4B 2EDTA 5HYIA 1X7QA 3WS6C 4NDMB 5J12C 3VXQB 4AEIH 3CVIL 1C7TA 5C0JA 5JQ6H 1FFPA 4WV1C 4OZHA 2PNDA 1QNZL 3MR9A 2AXJA 4CKVX 4YHKL 4NJAH 1CGXA 2BNRD 1AR1C 1EEYB 5IIEA 3C2AH 2OYPA 5GGRY 2IAND 1WLHA 2GUOA 3V52L 4HMEA 4OI7A 4TSAL 4Y5YC 4XNXL 4RMVA 4X99B 5I75B 5GHWL 4F7TB 2P7TA 4ORZC 3IXAB 1KCUH 1S8DA 3GMPB 1NAKH 1GOHA 2Y5TA 2VDPH 5BMFH 3FO1B 1XF3B 3KYMB 1FVCB 1U8JA 1FZOA 1QSFD 1TVDA 1TQBB 1P2CA 5J7CC 5E08L 1DP0A 2I9LB 3QQ4B 2CIIB 3V4UH 4ZUUB 1LWRA 2P5WB 4K23H 1MJUH 4WEMB 3QFDB 3CSYA 5T3XH 1UJ3B 1CLCA 2X5PA 1IJ9A 3LPGA 4FP8L 3VGAB 5LQBH 5CJXC 4LDLB 4OD1H 3QNYB 1S9KC 3OGOE 2ZCLH 4J23A 4KTEL 4P4KC 1NDGA 3B9AA 3KG5A 1I7RB 5BS0B 4NFCA 1KTKE 2GCYB 4K3JH 2AJYH 4PD4J 5FF6A 4UNUA 1F02I 4XCYB 3KPPB 1R24A 1FYHB 2Q7YA 5D1XA 3V5HA 5CD5C 3NOIA 1NCTA 1DJSA 3BKJL 4JRYA 4WTXA 1I8IA 2V7NA 2BNRB 4F7MA 5D7SL 1MLCA 3S5LA 5IB2A 3QNXB 2YKLL 4IIQB 2EEAA 2HN7A 4I9WD 4GRLB 1KN2H 3F6LA 5EC2A 5B3JE 1T0MB 2R1YA 5DK3A 1MCQA 5F1SA 5L2KE 4P5KA 4HH9A 3QEHA 3CZJA 1JN6A 2VIRB 4B41A 3IRPX 1MAKA 1MRFL 3VE0A 3VFTA 1CLZL 4EUPB 2XTLA 4J4PA 1E4XI 8FABA 3FB7A 2W9LA 4NJ9L 1EH9A 2DLFH 4WW1B 3NTCL 5GGSB 1JRHH 4Q6IA 1IKNC 3UPRA 1KB5L 3CFDB 2ZOLB 1DLHA 1CK0L 1YYLL 3TZVC 4DZ8A 1R3KB 3L3DA 4PREB 5HHPB 4AQOA 2AV7A 4G8IB 3ARZA 2F19H 4XNQB 5B22A 2R0ZH 3P77A 5ALCL 3REVA 4ODXA 2DIBA 5FDYA 4C59B 4XXCC 3FTGA 5D7IA 4IRJA 7FABL 4PJAE 3LH2H 4MCYA 3N9GL 5MHSE 4PJHE 3H7BB 4NFBA 3LMJL 3T0AA 3VDCA 3FN0L 2GAZA 3HUJF 1LEKB 5ETUB 5I1EH 4OGAD 1TZGH 1J87A 1PJ9A 2IAMC 2JB6B 2YC1B 5DYOA 3I02B 2X7LA 4LPVA 4PJ5E 5K93A 4ZFOA 3STBA 3TFKC 3MREA 4MA7L 4FXLA 2RR3A 1SBSL 1ZGLP 2X1XR 4M1CD 1OB1B 5DSCA 2PO6A 1MCBA 4HV8B 3EAKA 1AGBB 5D96C 1Q72L 3N85H 5C0NC 1JFQH 1NGYA 4V1DE 1NEUA 1KYOK 1VFBA 4RMSA 1EHXA 4YHYC 1IT9L 1HINL 4BFIA 2R39A 2VQ1A 3TBYA 1R3HA 5FUOH 4PB0L 3BW9A 4DN3L 5DS8B 3O8XD 3QDME 4HUWA 3PWVA 4TVSa 4BZ1H 3C2SA 4F7PA 5E9DD 1MCSA 1ONQB 3QFJD 1HI6A 1C5CH 4RGMB 3NCBB 3WUWA 3BFOA 4N0CD 3CFBA 4N0FB 1QQDA 2P8LB 5ILTH 1Q0YL 1EUUA 2AI0H 3LD8B 1FN4B 2W60A 4UQ3A 4NIKB 4R8WH 1ZHLA 2A0LD 4NWTH 3MUZ1 3AM8A 2IH1B 1RZJL 2QQQA 2BC4B 1KGCE 1LP9F 3MRBB 4U3CA 1BX2B 4R2GC 1NMAL 2FLBT 5HVGB 3V6BR 4WCYL 1PFCA 2PKDA 4LGSB 4OF8A 2E7LA 5CCKH 1J7VR 1KLGA 4XTRD 3SGJC 4KGJA 3I75A 5CS7A 2M1KA 1IBGH 4CUCA 5FEBA 1UXSB 3ARGC 2EYSB 3BISA 4QXUL 2NLJA 4N8CH 4ZUSB 4JFYB 5JXEC 1AY1L 4OZ4B 4TYUA 3MV7A 4X0KA 2R29H 3O2VH 1B4JL 1X4YA 2FBJH 3MRNB 4G6ML 3DRQB 4GKZA 3FQNB 4DKFH 5FYJL 2Q76A 3O8XB 1KULA 1FIGL 5DRNA 2HJKB 4F2MB 2YRZA 5E9DB 1U8MA 2GW5A 3RGVC 3QFJB 1JIBA 1ZLUH 3C5JA 1QR1A 2AK4D 4I48A 4AM0A 1RIHH 4EKXA 5IFJB 1OAYH 2QSVA 3U9PL 1CTNA 1NUFA 3U0PA 2HT4D 3S9DB 1X9QA 1JMXA 4YBHA 3AXLB 3QJFB 2AJUH 5JO5A 1C1EL 3KPQA 2XQYK 1VADB 4MJ6A 3RVWD 3IU4H 3U4EB 3SKNB 3T1WA 3JV0A 1BIIB 5BVPH 5EZIH 4FG6D 2VDNH 5TE4H 2RJMA 3SCMA 3W82A 5TQ2H 1SJXA 2Q3ZA 2BJML 1JWSA 4EOWH 3OB8A 1V7NH 1F97A 2E9BA 1N5AB 1LEGB 1K3IA 3DX7B 1G6RH 2V2XB 2XY1A 2NY7L 3BZEA 3CSGA 5A2JH 2DS4A 3F65A 1INQB 3O6FC 1DVFC 5E6IC 1C08B 2BXZA 4XHJD 3JXAA 1MF2H 2GJ6D 3GHBL 3D18B 4JG0H 1NLBH 5FAAA 4HDIB 4LKCA 4HUUB 1H3GA 4U1IB 3ZTJG 3K81A 4ODUA 4HKJA 4HUKB 1NFDA 3VFWA 1P6FA 3QISA 4EDXB 2MMXA 1U42A 5F7KC 4Z77B 1M1SA 5GGVY 1U8QB 1ZS8A 3VFPB 2A2QT 4P59H 5T5NG 1MWAH 4MXWH 3SE3C 1WBZA 1XGPA 5I2IA 4QT5A 4X83A 2ADIB 5GRVL 2VABB 1A4KB 2Q87A 3RRQA 3NFNA 2A1WL 3QUYD 4QHKI 4EIZC 5JDSB 1ND0A 3HUJE 3WKNA 3GIZL 2L0DA 4F37K 4PJ5D 2EDXA 1JRHI 1JF5A 4F9LA 3KYNB 1SYVB 4GKNB 2NTFB 2ZZUT 1D6VH 1XGTB 4QCIB 4YHNA 1I9RH 3MBXL 3SO5A 1JV5B 3MRQA 4LIQH 3OL2A 3SPVB 5J6HB 1PEWA 2R0LL 1JPTL 1NCUA 5IBLC 2YS4A 3VXSE 5LGHH 3TIDA 1DANT 3QDMD 5CILH 4Z7UF 2Q3AA 2ZG1A 1FVEA 3KPMB 4XCEB 4AJ0A 3ZLQC 4PJEF 4OLEA 1L7TH 1LE5A 1SVCP 3NIGF 5DJ0B 2DRUA 4ZOBA 5MEPA 3CFJA 1A22B 3ZKMC 4J1UB 4PJIF 1A0QH 2ZWLT 4HIJA 2B2XL 5BJTA 1T03H 3MROB 4HZAA 3HC3H 1HEZA 4F58H 2RCSL 4D3CH 3PL6A 4CMHB 3STZA 1RHHA 3OB0H 1FZJA 4NO2A 4Y1AE 5I1CL 1KGCD 4PJHB 4OV5B 2BSED 2YK1L 2E8YA 4G8FA 2DKSA 3ALWA 4LSQH 1EEZA 5CGYC 3QUXC 5TDOB 1LP9E 4OD3H 1GGBH 2ZOKA 2HG5A 3QUYB 3T8XB 3TN0C 5EWIL 4PJ5B 4UDUB 5TDNA 2VZ3A 3RZWA 5CZKA 2ZCHL 3CFIC 5HVHC 1ZT4A 2IJ0C 5LCVH 4DN4L 1RZIA 1FL6A 1MCCA 1FZMB 1MH5B 4X6CA 1Z2KA 5I9QB 2B39A 4QY8A 4XNYH 3SKJH 1RURL 3KPRA 3V6FA 5F97E 4I2XE 4V1DB 2EIEA 2BFVH 3ULUH 1KCKA 2AJYL 3ZT5A 5I76A 4L8CB 5GGRA 3WFHB 1Z9OA 3AB0B 3QDMB 5E1AB 3VFUA 4ZD3L 3EOBA 4NN7C 1KB9K 4M1GL 3HE6D 2UZXB 5I1IL 4PGCB 1I3UA 4G7YL 3RWGB 5FCUH 1CI5A 1QFWM 4XGZA 2ZPKH 2YPVL 4CN4A 2E6PA 4LLQB 4M7LH 1JUFB 5B4MC 3U0TA 1A4JB 2I26N 3TVMA 1CICD 4S0SD 1UM4H 2R1WB 2OXGA 4R9HA 3B83A 4OJFH 4JY6A 1OW0A 1EX0A 1WWCA 4I5BA 4EN3A 4KK6C 4GG8A 1WFTA 2F58H 1G1YA 4JANB 4MS8C 5C70A 4WWKC 4XNMA 43CAB 1G6RB 4FFYH 1QSZA 2LV4A 3ARBC 2CKBB 4JO2L 1BOGB 4NO5B 3TBSB 1RIVH 2GJJA 3OXRA 3SY0B 1JVKA 3X3FH 3QO0A 1D6EB 2VXUH 1SEQH 5EZJB 4D0DA 3RVUD 1MAJA 2X4TB 3JTTA 4J3XA 3DX6A 5GGTL 1JYVA 3KPNB 1EFXD 2CR3A 4A6YA 3MLTB 3LN5A 4GS7B 5I17B 1WWBX 5ID1A 2VITA 9CGTA 4MVBD 4C55A 3RU8H 2X1OA 3U7AA 1K4DB 4OB5H 4XBPB 4L4VE 2VDQL 3TA3A 4N9OB 4YFLF 3BWAB 1I1YB 3W2DH 5TF1L 3MXVH 4G9DB 4GH7B 2HTKC 3OJDA 4I0PB 4M6NH 5EIIA 1JJUA 1OAUH 1TMCB 1ZHKB 4O02H 4PJCA 3R8BB 2YD5A 3Q0HA 2RGSA 3W11C 2XTJE 1FCGA 5D7JC 4ZFGL 4UTBH 4XP1L 1CICB 3B8YA 3PHOA 5GRYA 4E0RB 5E8EA 3MZGB 3NA9L 1ZV5A 3LS4L 4LARL 2IG2H 1T89A 3BSZH 4DUWA 5GS2D 2DI8A 3RAJL 3B9EA 4P2OA 3MRMB 3U4BH 3E0GA 4XC3L 1LDPH 2HH0H 1P5VA 4MLIA 4NQXB 5DEGB 5L7XL 4KJPC 3O3AA 4G8GD 2BSTA 3RP1A 4PGJA 5I18L 5IMOA 1JNJA 3RTQA 4Z7UE 4J3UA 4N9GB 3UZQA 1CGUA 3V0WH 1NGPH 5IT2L 2NY3D 3SDXF 1EFXB 4PJEE 2EE2A 1AD0A 3NIGE 4C56A 5KVFL 4OZFH 4Q74A 1YEKL 1OF2A 4PJIE 2XWTA 1KUMA 4Y1AD 1EMTL 4LEOB 3PDDA 1WIPA 2X4UB 1ZHBA 1LK2B 2H8PB 4HIIB 4IDJL 1FO0H 4WY7H 4L8BA 1M6OA 2B1HH 1QLEL 2PR4H 1TJIL 1AE6H 3O4LA 4U6HB 3SDCC 1PVHA 3HUJB 3CX2A 4OKVA 1L7IL 2AEQH 4F8TA 3QUZA 5DMJB 2VLJE 3LB6C 1OARL 1NMCC 5EO0A 4PGEA 5C92A 5DHYA 3HNSL 2XZCH 3D85B 1NPUA 2VKXA 1E6JH 4PYGA 4QTIH 3FT2A 3QEGH 3QNZB 3CMOL 1KCRH 1FE8L 1HHJB 4X6DF 2IQ9L 3VXSB 1JGLH 4FQHB 1MCOL 1KTDB 3U30C 5F7WC 4JM4H 3G9AB 1G7QB 2OTWB 4PG9A 2C7UB 1D5MA 4JM2F 4M61B 2J88H 5IQ9B 1QP1A 4P99A 4JR9L 4CJ0A 3V6OA 4WVRA 3B9KA 2AAVA 1FGNL 1BJ1J 4EI6B 4WDIB 3OKOB 2NW2B 1MREH 5HGBA 2HJLA 4Y1AB 7CGTA 4J8RA 3LZFL 4P23C 3TPUA 4HWBL 4S1RL 4O9HH 2DWDB 4Y2DD 1ZLSH 2EE3A 1IZKA 3GJEA 2O61A 4NQCD 3SN6N 3UTZB 1LP9B 4ERSH 5AG9A 1Q1JH 2CDFA 3GRWL 3TT3H 1S7SA 4JG0L 1AXIB 3UTSD 1T83C 4BSJA 5F1NA 2X1PA 4AEEA 5H37H 5EOTB 5KSUB 1KIRA 4QWWD 4Z95H 2E8ZA 3LEXB 4M7JL 3QWOA 5DHVB 4YBQD 4ZUWB 1V7MH 5LAXB 2AS5M 4NRYA 4I2XB 3HE7D 2GITB 1QG3A 1G7MB 2IF7A 1MFBH 3IDIB 4YHMH 5T1DL 4OF5A 2WBWB 1HZHL 4HC1L 3K4AA 4NQDE 5C0CE 3WXVH 1ZWIA 3V0VA 1IGJA 4UTAL 1NCBH 4XCCH 2CMRH 4L4VD 3W0WA 1DQMH 2W91A 3P4OA 1MCWW 3VA6A 1WZ1L 1UG9A 3QPQD 5EULV 4OLYL 1VB9A 3HI6L 1AIFA 5J89A 1JHLH 2D9QB 4WO4A 1J1PL 4KROC 3R1GH 3HPLB 3HZMB 5EPMB 4LIQL 2XTJD 5IHZB 2DQJL 4UZGA 3BMWA 2BNQE 4AT6B 4AEHL 4I3SL 2W65B 4PLJC 4FQXC 4PLKD 1IM9D 2QTEA 4Y2DB 5E2TH 3HR6A 2NY0C 1YJDH 4NWUL 1OL0A 1Z9MA 5ICZA 3DV4A 3OR6B 2Q7NA 1J0IA 1OTSD 1RU9H 1BF2A 1VDGA 2Z92B 5F7HA 2DLHA 4XPGL 4ETQA 1L7TL 3BP7A 3UTSB 4DKEL 4D0BA 3CH1A 3CLEL 3KYKL 4LSTL 3G6DL 3MGTB 2LTQB 2V17L 1BP3B 5IW3A 3I3EA 1OCWH 2ARJQ 2RFXA 3BAEH 5GSVB 5C2BL 4NKOB 3QIUD 4PD4K 5DQ9B 4BK4A 3X13A 3TM6A 3H6JA 1K6QL 1WAAF 3HE7B 1WEJH 1O7SA 2Y6SD 4ZOEA 2ARWA 3TBTA 2HAZA 3BH9B 1MCDA 2JCCA 2FJGA 3G6JF 1A6UL 3EO1B 5TPWL 3KLHD 4JZJA 4QRUA 4X6EB 4ZNEA 4NKQB 3SDXE 1GOFA 2JJTC 1FO0B 4Z5RA 1IGYA 4L4VB 1N7ML 3DNKA 4OFDA 3MJ9H 3JTSB 1XR9A 2VMFA 2OQJB 1G7IB 1PYWA 5T1MB 3ZT6A 1BQLH 4X8JA 5HYSA 2VZUA 5FV2A 3WS6A 2WBJC 3S4SA 3SOBH 4RFOL 3I6KA 1M7IA 2XFXA 4YJZL 3OBAA 3TO4B 2DQCH 2H32H 5CLWA 2VLJD 2XTJB 4F3FA 4IS6B 4XPTL 5CBEA 2IBZX 2VXQL 3ARFD 3U7YL 3GSWA 2EDRA 1IEAA 1IQDA 1WICA 5IB5A 4WEUD 4LLVA 1U8PA 4Y5YA 1U8LA 4WTZG 4PGDB 1T5WB 5E8NA 4G8EA 1OTUC 5EA0H 4R96A 2FR4B 4O2CB 1C5DB 1GPOL 3BQUD 4CU8A 5FCUL 3WXWL 1BECA 1SM3H 5DMIH 1NC4A 1FZKA 4M7LL 4X6DE 5GS3A 2AEPL 3IT8D 2NW3B 4IBLT 2JIXA 3WIHA 3TIEA 5CLTA 1JPFB 1FAIH 3FO9A 4Z7UB 5ID0A 4H88H 4LVOB 2X2YA 1OM3H 3ZHKA 3EDKA 1UCBH 2OMBA 3L95A 5CJXA 1S7WB 4KKLC 3QPXH 1IRAY 4PJIB 5KJRL 3PDOA 5T1LD 3C8DA 3LVEA 4H26B 4P3WA 4Z7WF 3ZO0A 4MJ5B 4P4KA 2BRRL 4O2FB 4NUJA 4U1KB 1AKJA 4FFYL 3TEUA 3S37H 4E42A 5BZDA 1A2YB 4NO0A 1RUQL 4JPIA 3UC0H 2QSCH 1FFNB 4XB7A 3T09A 1FGVH 1FNHA 2Z31D 4NKMB 2VLJB 4DFIA 2H6PA 4LSVH 4WI9A 3ARFB 4OD2B 4HLZG 2PN5A 5C07A 4BH8A 1A02N 5E1HB 3CFEB 3ZKNC 5D2NE 1W0WB 1SYSB 3LEVL 4NQDD 3P9LB 5C0CD 3WNNA 1KNOA 4JFXA 4PYHA 5F6HI 5DUML 4HS6A 3MUHL 3KHOA 1ZGLA 3V5DB 2VZTA 2BOBB 2Y36L 3OPZL 3QZWA 1L6XA 3MNZB 1U41A 2XN9A 4W6XB 4W68A 3HC4H 4NRXB 5ICXA 4X7FC 3V7AG 5DMYA 3C5ZD 1SEBB 2P8PB 4UT9L 3GO1L 4UV4H 1TJHH 3IJSB 2DIJA 5T1LB 5ELIA 2BNQD 3QEQA 4M43L 4XXCA 3RZCA 3H9HA 2Q8AH 4BUHA 4Q9QH 3TH3T 2BY2A 1PDKA 1F42A 1AGDB 1CXEA 2EO9A 2EDWA 2BMKA 3EJZC 1ADQL 1YPZA 2CSPA 4LSSH 2Y4SA 3X12B 3BD3A 5GZOD 4GXVL 4FQIL 1CD9B 3WLWD 4O4YH 2H2PC 4ZPVB 2IAMA 3O2WL 2Z31B 4JDZA 5DUPH 3GJFA 4PRAB 3WFEL 1ZHNB 4KZDH 2ZCKL 2OX5A 2CH8A 4KKAC 5JLZA 4RWYH 5D2LF 2F8VA 1ZA3B 1A7NL 3E6HA 4WI7A 2F5BL 4Q58C 1MFNA 4HF5L 4ODTH 3OAZH 2DKUA 2Z93B 5FHBL 4MNGE 5IHUH 3FT3B 4KMQA 3C6SB 4Z7OF 1WAAE 4YC2C 5JXAH 3HB3C 4NQDB 4R3SA 5C0CB 1IVLA 5DR5L 1ZVSA 4LOUC 3G6JE 4MD5B 15C8H 1S7UB 4MMXC 4NHCL 2XG5A 2YPKB 4EDWH 1CF8L 1MIML 1GHFL 1UEYA 3HS0A 4XVJH 5IEHB 4UINL 5KSAC 4EI5C 5JTWA 3MOBH 1H15B 3VG9C 2DMKA 3FRUA 5BV7H 3C5ZB 5CEYA 2KUTA 2H32B 2PXYD 3CU1A 4I0CC 3WE6A 2AERT 2BNQB 2YEZA 4KTDH 4M9PA 1FG9C 2FIKB 5DTFA 1X44A 5IMLA 4KVNH 4X98B 5T5NF 3G5VB 4GUPB 4R97B 1CIUA 3L6FA 3S8WA 3GB7A 2D03H 3TJHD 3QQ9C 3DMMD 4HBCL 3EZJB 4OGYL 1OP5H 4NN6C 3PP4L 1BWWA 1DEDA 2W38A 3SGJA 3MJ7B 3RWFB 3FO0L 5J11B 1GIGH 3ARGA 1S9VA 2C5DC 5ITBL 2Q6WA 4E5XA 1TITA 5H94B 1RFDH 5BOZG 5JXEA 4YHZH 1IAIL 3PGDB 1MIEH 1KV3A 3H3BC 1SJHB 3GI8L 2VXVL 4YFLI 2CQVA 2MKWA 4PB9H 1CGWA 2LFGA 3SDXB 1UKQA 1KIPB 3DURA 3ZSTA 3TT3L 3KLDA 4ORGA 2ZKHL 3IF1A 1P84K 4L8DA 4OCRL 4BKLB 5GGQL 3ARYA 4XNUL 3E1F1 3RGVA 2HVKA 3RNQA 4Z7WE 3WDIA 2NCMA 4P5MA 3MODH 3LEYL 3QIBA 3O9WD 4IMLA 4Z0BH 3STLB 2VL4A 3QWRD 2QQLL 3O3UN 2PXYB 3GSOA 4PLOB 3T65A 3LPFA 4WHDA 4QRSB 1FFRA 1RK1B 4RMWA 5CJOH 4MA3B 3VRIA 3ROLA 2BVPA 3LSOA 1G0XA 5GS1C 3HZVA 1I3RB 4JPKH 1T7YA 1N4XL 4D0CA 2R69H 1NCBL 5BRZE 4XCCL 4HGMA 2V7HB 3N1QC 5EO9B 2OJEA 3DMMB 4Z7QF 2YD1A 3GM0A 1T22B 1ZEAL 1X5YA 3LQAH 2I07B 4X6DB 5FUCE 3DUUA 3NCEB 1JHLL 2QADB 3O6FA 3QIWD 4N1HB 3ULVL 5E6IA 4JFZL 1MFCL 4GAGL 1ACZA 3B8SA 1BFOA 5DD3H 2ARJB 3MRHB 3BP4B 3GSNH 4NQSA 3KS0J 3VXMA 4JM2B 3HMWH 2Y23A 3ECBA 4QOKE 3JVGC 3MRLA 1KPVB 4YXKH 4JGJA 2FHBA 1LK3H 2JKXA 3NACL 3MQIA 5KN5A 1G9ML 5I8KH 5K33A 3LIZL 3SE3A 5C0BE 5I66A 4CNIA 3D9AH 1OCWL 1BQHB 1UH3A 3O9WB 4ODVH 2YOCA 3EYOB 2X4SA 3NBNA 3EUUA 2ATPB 2N4IA 2OL3H 2WMPA 1P1ZA 5GISH 4AENB 1S5HA 3MLYL 3MRRA 1YUHA 2VN4A 4QF1A 1FFOA 3QR2A 4QNPF 3RUGA 4PPTA 3BPCA 1HHKB 1NCAH 1PG7L 3UPCA 4XPBH 1IAKB 5D2LE 3ZE1F 2CDEB 3HLAA 3ULVC 4U6YB 3WFDL 5D2NB 3HZKA 4OSUL 1T0NB 2DDQH 4M03A 3TV3H 3SDAB 1FORL 4YX2H 2Q20A 2J6EL 1S7VB 4XT1C 4Z7OE 1ZMYA 3VW3L 3NGBB 4JZOA 2CJUL 3QIWB 3MA7B 3LRHA 1A6TB 1L0QA 1I9JL 2YBRA 4M48H 3M45A 1RUKH 1DEEA 4ISVA 1JWUB 4U1NA 5BV7B 1G9MC 2FJFB 3HMXH 2H26A 5ALBH 3DOSA 1S3KH 4OCLC 3KHQA 1YMME 4WUUA 5HHOA 3FQUA 5D9SB 4RQQA 1BLN