5E8OB

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oB00
1Q0XL 3MJ8B 2CK0L 4G42A 2IH1A 4K3DL 4YEEA 3SKJH 1XGPA 4Q9RH 4LCWA 2GT9A 4APQB 2BNQD 1I1YB 4ISVA 4DEPB 2C4FU 1MEXH 1YEHH 2X1QA 3RWFA 3D1MC 4TQEH 4KXZI 3BP5A 1DBBL 1IM3B 3ZKXC 4CVZA 5HYJB 4YDIH 4QRPE 4F7EA 3IETA 4LHUG 5E5MB 5ITBL 1A02N 1P1ZA 3AFLA 2ZOKA 5D7LB 4DKAA 2R2CA 4KUZH 5FM5M 5KVMC 1A7RL 3V6OA 3UTTB 1T5XB 5FDWA 3NGBB 4JPIB 5L2KB 1PLGH 1KC5L 2HVKA 2VZTA 1RFDL 3VWJD 3QFJD 1E6JH 4G6ML 3MBXL 3BJLA 3GKWL 2NY3B 5F7FA 1F00I 4M6AA 4YHKL 1CGSL 2WAHA 2G5BA 1S7WB 3STZA 5J6GB 4AMKL 1JF5A 1GZPB 4JZJB 4LCCA 1TJIL 3PHSA 2DL9A 3RQ3A 4MCYB 5DJXB 5INDA 2GY7B 4AEHL 5EC1B 5L9DH 2DQFB 5HVHB 3MJ8A 2JB6B 2LFGA 4JRYB 4EN3D 1LWRA 2R0WH 3FQUA 3LD8C 3VA6A 2IBGA 1FH5H 5KS9F 5E9DD 1A9BB 2D7OA 3QUYA 3U7AA 3HZVA 5L6YH 1RZFH 3UX9B 2NW3B 4GRLB 1A3RH 3ARBC 4RMVA 4LBEA 1E28B 4XXCC 4OI8A 1P7QA 2BCKA 4JRXB 4RSVA 1OAUL 2C3HA 1G9NH 1IL1A 4YUEH 3BESR 3FT3A 1OOAA 5HI5C 4RAHA 2XN9E 1HKLH 1YC7A 3DRQA 3DUSA 4DVRH 3DNKA 3IJSB 1D9KD 1T89A 4ZPVA 4OUUB 3V4VL 4F8QA 3BZFA 4P2QA 1A64A 2WBJD 2UUDK 3T2PA 1TZGL 2ZOLB 3T3ME 5EU3A 2BHUA 4NFDA 1IT9L 3CX5J 4I4WA 1T7VA 1OB1A 5EA0L 4YBLC 3QI9A 3THML 3P77A 4QKXB 4P3DB 4JY4B 4XMLL 4P46B 3WMSA 4F2MB 3ALPA 5ESQB 3HTLX 1GRWA 2A0LD 1NJ9A 2JF1A 2CRYA 2A6KA 3JZ7A 1TPXC 1T7ZA 1KCRH 3P4MA 5EIQA 5D8JL 1LE9B 3P9LB 3TBTB 3P9MA 1FIGL 2R0WL 4JFPA 3L9RB 4NQED 5ID1A 1JV5B 4ZUUA 5HHPB 1BVLA 4TTDD 3HRZB 4GG6B 3PHQA 4JEGB 5KSAB 1DVFC 1QD0A 5DFWH 2F53A 2ZPKL 5T1LB 1JGVL 1RUAL 2CMRH 1AQKL 4PRIE 2A9NH 4PJEE 2BSTB 4JFHE 1KLFA 2UVFA 3VXSB 1A7PL 4EDXA 1R3JB 2I9LB 1F90H 3ROLB 4PJ8B 1XIWD 7FABL 2HT4D 4FQLL 3REWB 3GSQB 3DGCR 1Q0YH 5E24E 1FNEA 1MWAL 4DUVA 3L3OB 2FX8L 2Z93A 3S35L 3DOSA 5AWNL 3R8QA 5C0AE 1MELA 1MJJA 3O4LB 2EDFA 5AG9A 3DROA 3VH8G 3UEZA 3QO1B 4H8WC 4K7PH 4CJ0A 2VUYA 3KPSB 1FV1A 4IOIA 4QOKD 5E8OA 5CD3B 5L6YL 2FZ3B 2UWEB 2VLRA 1L7IH 2FCBA 4OZIB 1IQDA 4QTIL 5EA0H 2P5ED 1FC2D 4ZNEA 5C09D 4C57C 3BDXA 3IGAB 1XGQA 4PRHE 3NCEB 1ODAA 2VXUH 5DHXB 3BEWA 4JQXA 4N8VB 5CP3A 3KPPA 2NY4D 2OBGA 1HKLL 4JRWA 2OTWA 3BD5A 1HXMB 1JV5A 5HHPA 4Y19A 4QXTA 3QUZD 4M7ZB 4EI5A 2DS4A 3INUH 5GGTH 5GS3A 1FFNB 1RVFL 5HHOE 5T5FL 4HEPG 5DD5L 2R23A 1RY7B 2UWEA 2VLRB 1CGTA 1V3KA 5FF6B 1XF4A 1Q9LB 3V5DB 1FYTE 5D2LA 4UBDC 1XCQA 3CDGA 2JKXA 1U58B 3WNPA 3EJZC 2E7CA 3BH9A 4K8RH 3KAAA 1UH3A 2MQCA 1J12A 3D25B 1HNFA 3KPLB 5E9DE 3WFBL 4E42B 5SWQA 1P4BH 2D9CA 1QEWA 2ESVE 4EDXB 4HULB 2VRAA 1EO8H 3R06A 2NY5L 1AE6L 3MLWH 3PWJB 2BVTA 4J8RB 4LLDA 5C0DB 4JCLA 4KKCC 2X4SB 2YOCA 1RMFH 4POYA 4L9LB 2OXHA 5GGQL 2ICCA 2X4UB 5F1IA 3CH1A 4NKQB 3SCMD 3OG4B 1OF2A 3UJTL 4MNQB 3L3KA 3S96A 2VIRB 3M07A 2FO4B 1SHMA 5DMGC 1URLA 1Y18B 4M02A 2VUOA 2E7LA 3FO9B 3ZYJA 4MDIB 1BD2D 4XP9H 3C6SA 5A1AA 5IFJA 1BZ9B 3GIVA 5BRZA 4YK4C 5I15H 4IOFD 2BHYA 2GTZB 3H9SA 5EC1A 1JHLH 2AGJL 1MCRA 4PRNA 1RK1A 1F4WH 1KJMB 3BGMB 2ZNXA 1MFBH 1K8IB 3BZFB 1UXWB 3DPBA 4P2QB 2G5BB 3STZB 1DSFH 1NCAH 3ULVC 3FT2B 3NTCL 3BPLB 5F88B 4LKXA 1SYSB 1HHGB 2AV1B 3UBXG 5HGDB 2ERJB 3VFRA 1WAAF 3MRIB 5E4IA 1JYVA 4P59L 2VQ1A 1F6FB 1RIHH 2MKWA 3O6FD 2EC8A 2NTSP 3MRKB 4JHZA 3HZMB 1QSFA 1KYOJ 3AMLA 1JGDA 5ABDE 2BJML 3SGEI 3L7EB 1G84A 4F57H 2MCG1 1JWMA 2D31A 3TF7C 2QKIB 2DF3A 2Q1EA 5IV2B 1F4HA 1UJ3C 1PEZA 1JGLH 1OD9A 1RUQL 2XN9A 5KSUA 4QYOA 3T1FA 4UIMA 3SDAB 1JF6A 3WN5C 2IQ9H 5EOTA 2K1MA 2CIKB 1KCVL 3D25A 3NIDF 2QSTA 5MEND 2CDEB 4G6FB 4TNVF 2XY1A 2H41A 3M1BB 1F3JA 2BJMH 4KTYA 1QRNB 5DRNA 4OCWL 2CKBH 3C60C 1HI6B 1FHGA 1MAMH 4Z7VB 2DM7A 4QRRD 1T22B 3ARQA 1XEDA 2R1WA 2VLKB 3AY4A 1FZMB 2BSSB 5HYQA 3QNXA 5TGBA 4IS6B 1HXMA 2WP3T 4PB9L 5IGXH 4Y4FD 5TF1L 1S7TA 4HKBA 5DK2B 1N3NA 4ZQKA 3WNOA 1BFVL 2C3XA 2OX5A 4PRPE 3T1WA 4QXUH 3QIBB 1MHCA 1BZ7A 4XPBH 3SE4A 3E6FA 3EOBB 1TIUA 3B6SB 4JKWA 1F97A 1IEBB 4NPYB 3GIVB 3NVQA 4NN5B 3RVXD 4YAQB 3TWCH 3PF2A 2GJ6E 3E6HA 4F7CA 1KXQE 5IP4A 2YUWA 3QCVL 2HJKB 2A6IA 5I73C 3ARTA 3MRMB 1ZGLM 3IB4A 2OQJA 2Q86A 4MDJA 1RJZA 1KCVH 3WE6B 4E0RA 4NQCD 4OTXL 3I6LE 2VLLA 3VXSA 1XF5A 5DJYA 2GCYA 2AXFA 5EFIB 3VFOB 5EPMB 1AQDA 5L88L 4K3JH 4ZPTB 5MEQB 4I0PD 4U33A 1RU9L 3FO0L 2DQIL 1BLNB 4KC3B 4DQOH 1PKQB 5TF1H 3NFNB 2YUVA 1P5UA 2GFBB 4PGZA 5CJXC 2X9XA 4QT5A 4K9EL 4HMDA 3V5KB 3BAEH 2XPGB 1LE5A 1UVQA 2ITDA 3LKNA 4CN6A 4LLVB 5D2LB 4DOHE 1QFUH 5B21A 4I9WE 1GC1C 3CDYA 3MGOA 5F7KC 3DHJA 4QRRB 4CU8A 3ARFB 4X7TB 3TWCL 1OB1B 4JG0L 4AM0B 1LK2A 3ARVA 3BXNA 3QUKA 2OJEB 3RDTD 1AO7D 1MPAH 1U93A 4PREA 3HR6A 3F5WB 5FYKL 2LQRA 4NKMA 4S0TD 3MLVH 3KPPB 1LP9F 4RWYH 1GGBL 5HHXH 4LDEB 2PO6B 3EFFA 4XH2B 1ZV5A 1MNUH 2Q8BL 4XGZA 3D85B 2QADC 3BZ4A 1K4DB 4ZOAA 1MRCL 3JV0A 1FV1B 4IOIB 3UO1L 1KJ3L 5FV2A 4D0CB 2E8YA 3VFTA 4EN3A 2IANE 1QA9B 4P2OB 1NAKH 4PJIB 1V3MA 2E8ZA 1KTDA 5TDNA 6FABH 1RZ8B 4M00A 4K2UH 4Z0XB 2EDLA 3RWIA 2Q7YB 3QZWG 1T7WA 2PXYD 1AQKH 3VXOB 5IM7B 5E6ZA 4NUJA 4ZUWA 3SDXA 3MRQA 1IGYB 1NC2D 3MV9A 4U7MA 1BP3B 2ZSWB 4UQ3B 4GLRI 4P2QD 3QZWA 5AEAA 2WWKT 1NDMB 2DQEL 5JDSB 4PP1C 1QSEA 1V3LA 4JCMA 4XP9L 3MV8D 2ATKA 4OUOA 3ESVF 4KHXH 4LHUA 4LOUC 3UDWA 3K3QA 3BQUB 2PNDA 3LRHA 3WN5B 4Z7WA 5T5FH 3K74B 3S7GA 4PV9B 1HXYB 4GAGH 1F42A 4TOYL 2NTFA 5C07E 3SGJC 1I7UB 3OL2A 5ALBH 4MAUH 2CQVA 1IFHH 2DD8L 5TH2B 2UZIH 5KVFH 4DFIA 5HVFB 1H3WM 3LN4B 5GISL 2FJHB 3QWRD 1ZLSH 5AZEH 3B2UC 3CLEL 3LQAC 4OJFL 3R1GH 3NABL 1E4KC 5IHZB 5IMLA 2I60L 1EO8L 1T0MA 2F53D 5GS0L 5JPNA 5DA4A 2LTQB 5F7LB 2DQDH 2O61A 4UAOC 3GMQA 3GSNA 5B38A 3QUXA 3RIFK 3H3PL 1UEYA 2Y72A 3VFNB 2NX5A 1QACA 3G04A 4HKJA 1A4JB 3MV9E 4L5FH 4X9HA 3QUYB 2ADIB 1KEMH 2Z9TA 1P53A 2LVEA 5D2NA 3KPTA 1NPUA 1U92B 4B7LA 2X09A 4Z5RB 2FEDC 3DX9B 5I1DA 1QYGH 5ELIA 1TDQA 3JV6B 3NABH 4Y4KD 5FO9A 3NZ8A 4NCC2 3MGTB 3UYRL 2VLRD 4P5KB 3TFKC 2B5IB 3BW9B 1ZLUK 4I9WD 2FATH 3OWEA 1R24B 4APQC 5DJCA 4KK9D 3OV6A 3MA7A 1FSKB 1JYWA 3DMMC 1QFWI 2EH8H 1NCCH 3SDDC 4PLJC 4OLWL 4KJWC 1BZ9A 2EYRB 5D2NE 2ZCLL 4L1HA 1NFDB 1YMMD 4LPUA 2HG5A 3KPRA 2MQ3A 4Y19D 3IKCA 4OF5A 1W8OA 5GIRA 1DBMH 3DV4B 4OGYL 3HMWH 5IIEB 1C1EL 4Y5YC 5E5MA 4KI5D 4F7EB 1K8DB 3C6LD 4G7YL 1ZT7B 4RGOH 2JTDA 4F80A 3ES6B 5IT2H 2OJZL 3WKML 4YHIA 3BP5B 5EU6D 1U8IA 2EH8L 5ANME 3H42H 1CGSH 3ULUF 2DBLH 2W0FA 4GAFB 3C5JB 1A7PH 1N59B 1QLEL 1I8KB 3OR7A 2UZIL 4U6XB 5SWQB 2OP4L 3ARXA 3WJLC 3VXNA 2BHZA 1Q0XH 5IJVB 2GQHA 1SJHA 4PJGA 1OSPL 2QEJA 5E00A 2DTSA 2HRPH 3DI3B 2YK1L 3MPCA 3P11H 5F9OL 1EAJA 1FO0A 3P9WB 3S5LA 3HS0A 4E41E 2C3GA 1XF4B 2APWA 2J2ZA 3RVUD 4Y2DA 1BD2E 4PRPB 5EUKA 3H9ZA 5TE4H 1DVFA 4DKFL 4XMPL 4J3SA 4M1GH 5FHAL 3DETD 5ITFB 1Q0YL 4LRIA 1JNHA 3VFUB 5LXGH 4P4KB 5T1KA 3VFWB 5FGRA 4K3DH 1RJLA 2ED8A 3SKJL 4KI5F 3UJIH 4GO6B 1YQ2A 2D0GA 2E6PA 4WFGE 2WBJB 4G7YH 4LLMA 3BX7C 3GM8A 3VXRA 1D9KB 4PGDB 2UWEE 1G9NL 5T33L 3NIFF 4POZD 3IDNB 4RQQA 5D72L 1JGEB 1QLRB 1UACH 1A6VH 3OTTA 4RDQG 5GHWL 4G9FD 4HIEA 5I1KH 3T3MF 4PJ8C 2Z31A 4Q6YA 2ICEA 4ZAKC 3K81A 5DD6A 4GW4A 4NYLB 1OQOA 2Z8VC 3S34H 4GRLD 2VQUA 3T3PF 2E7MA 3OG6B 3EBAA 2EKSB 1QSVA 3O6KL 2DIBA 1QSFD 4KVCH 4OGXH 4UINL 3ULUH 4BZ1L 4NNYB 4OCXL 1BOGA 4KVNL 4YDLC 4RFEB 4L3AA 4MB5A 1F4XL 3UXFA 1G0YR 2CO6B 3MV01 3W0WB 4MCZB 2F74B 2ZG1A 5C0IA 5F6IB 2DLIA 2DDQL 3GRWH 5SX4I 1JZ5A 4MAUL 5I17B 2BNUA 3L3JB 2HLAA 2HN7B 5C7XL 2Z8SA 2C7UA 3L6FB 1Z0MA 3BWAA 4Q6IA 4D9RE 3WSQL 1WWAX 4GMSL 1HWHB 1VGKB 3HLAA 4K55A 5HDQL 1H3TA 2R4RL 4PPTA 5HHOA 3GBNL 2OCFD 4S1DC 4DGIH 4M6ML 1HQ4A 3ULUC 2VOTA 5D1XC 4QRSB 1WZKA 3TCLB 1MCWM 3MOAH 4UB0H 4UU9A 1Z9OA 3C2SA 3F62A 4P2RA 5K9KA 1KN4H 3KPQA 1JPGB 2Y5TA 5BQ7B 4K3JL 1ZLSL 1EPFA 2NPLX 4YNYB 4XAKE 4S1SH 1BQHA 5IBTH 1DE4A 4ZXBA 3ZE1F 5IB3B 2C3WA 3PQYB 4JFHD 5TQ2L 1ZWIA 3GSUA 3U46B 3TNNA 1RUKH 3MO1B 3LCYA 2OL3L 4DGYH 3FFCB 5E8DH 5ETUA 3LKOB 1HHIA 4QNPE 3N85L 2AJXL 1RPQA 4HXAH 5EBLB 1QFUL 5CGTA 3OR6B 4PJHF 3IS0X 2ORBH 2HH0L 4FQXD 5CILH 5F1NA 4BSVB 3UO1H 3ALXA 3U7WH 1W0YT 1NFKA 1VACB 1HOCB 5I18H 1A21A 2DQFA 4N90D 1CFTA 4M1CC 3MJ9A 1HHJB 2RAMA 2APXA 1WCBA 5DS8A 4JM2C 3HMXA 2WIMA 3EO1A 4JZJA 2G9HA 1GGIH 3DX7A 2MPAH 1CI5A 3PJSB 3GO1L 2KKQA 3P3YA 1VKXB 1QPPA 5JIPA 3CVHB 5IG7A 3VXTB 3FHAA 3IDUA 2NTFB 3MBEC 4HKZA 5H37H 4R3SB 1VGKA 3HLAB 1X5KA 5DD1H 1X5FA 5KS9E 5TF0A 1IC5L 4H1LG 5AG8A 4QHKI 1CFNB 4NRXB 1LD9A 1I75A 2Y36L 5D6CA 4MX7A 5D1QC 2NYYD 1ZEAL 3UAJC 1T66D 2R56L 5I17A 4JFEE 4G3YL 4YXHL 5C8JA 3QXVA 4ZUVB 4KJPD 1NCWL 1VKXA 1JMXA 4XPBL 1F4WL 1VFBA 1H3PL 5IM7A 1JWUB 1FG9C 2IWGA 4X6DF 4PJDE 4JKKA 1TVBB 5D9SA 4OV5B 3TPKA 3BPLC 1MCJA 3DUUB 3MODH 3U7WL 5L2KE 3MRCB 3TNMA 3HG1A 1JIBA 4XBGA 1H5BC 4PB9H 5IGXL 4X98B 1QNZL 5D5ME 3SKMB 5E2UL 1XR9B 3VXPB 4PV8A 1JNLH 4XNZB 5EWIL 1ZT1B 3EYQD 3QDGB 3BAEL 1DJSA 4JKLA 4X6CE 5CSBA 2V2XA 1T7XA 4PG2C 4B5EA 3GSXA 4X9GA 1OTTD 3UP1A 4X4XA 1OAXL 2Z0BA 3CFIC 3CSYB 4MS8D 1RHHB 3FRUB 1HNGA 4JREB 1KV3A 1IC1A 4KJQC 3TVMD 3LMJH 2WQRA 4OLVL 4AT6A 5DI8A 4Z8FH 3GB7B 1F2XK 2IG2L 3RX5A 1A1NA 3D0LB 4WI4A 3TC9A 2QHRL 3F65A 5J6HA 4EEEA 2VAJA 3ZTNL 2CIIB 3B9AA 5FM8A 1J1XH 4NRYA 3X13A 4MSWA 5HDQH 1U8OB 3MV8B 2H6PB 2VR9A 4NO2A 4M4PA 4Y2DB 5TDOA 5JR1H 4Z7NF 1NDGB 4WEUD 3BRDA 5FA4A 5C0EA 3L1OH 5ESVB 1ITBB 1CFQA 5EZJA 4ZSOB 1WFUA 5FKAB 1NC2B 4NO2B 1K6QH 2CKNA 3GSVA 4K94C 3RIAK 1FGVL 5GGRY 2HKHL 1M05A 2BNRD 3ARWA 3EFDL 3JWDC 4JZOB 3T0EC 3IXAA 1BLNA 1EEYB 3L3HA 2R69H 2CIIA 4ACPA 5C0IB 4DCQA 4UV7H 5D7JC 1S9XA 4UINH 4HH9B 4PY7B 5CIPA 4YFDB 3S4SB 4XVJH 1I85A 3AREB 4HV8B 4PBXA 3O6LH 3MLYL 4P2OD 3BH8A 3DX8B 1GJIA 3IU3B 1FZOB 2YD2A 3U7YL 1ZHKA 4Z95L 5CILL 5FKPA 4G6AD 5GQBA 3PGFH 5TQ0H 3GSVB 5DGQA 1NAMH 3FCTB 3GMOA 3FO2B 5IMKA 4HH8A 4LNVA 1RURL 3QR2A 4JAMA 1HHKB 4EXKA 1F45A 4MHHI 2JCCB 1AHWB 4LLUB 2M26A 3WLBB 3TNMB 2P49B 2VXQL 3UPAA 3K4DA 4MNHB 4U1MB 3LS5L 5DRWA 3LOWA 3RUGB 2N4IA 1N3NB 3GMPB 3PWVA 2E3VA 4M1GL 1BQUA 2YPKA 1MFAL 1R3IL 1T3FB 2XV6B 1JNHB 1IE5A 5FO9B 1KOAA 2RB8A 4U4BA 3KLAB 4KKLD 5ICZB 4Y5XA 1RHHA 1K5NB 4ZFOB 3JV4B 3NZHH 1OM3L 3VH8B 2J4WH 3GMLB 2DQJL 3P11L 2J1KA 2OK0H 1T22A 3CC5B 2WZPD 2Q3AA 4NO3A 1J1PH 2OSLA 5T33H 4WU7A 1U91A 1JK8B 3ZDXE 1JFQL 4ETQB 4I0PB 1SJHB 3KPRD 5HYFA 1G9MH 1F4AA 4JFEB 5JXEC 5DD1L 1HSBB 3MBEB 1J11A 3D2UB 3O4OB 4O2FB 2G5RA 3QAZC 2YSSA 3PIQB 4QO1A 4PJAB 3WFDL 4DVRL 4XX1G 2NY5H 3EO1B 5BV7H 1H9VA 3D6GA 1XCTA 3C9NA 3SE4C 4PY8I 8FABB 4NWUH 3BPOB 3L7EA 3TO2A 2DLFH 4FP8H 4UDTB 1J0YA 1QFOA 1OLLA 3MLZL 2EZ0C 4PJ7E 4OLZL 5EBMB 1A6VL 3HZMA 1JN6B 3G5XA 4LU5H 4MNGB 3T0BA 4IMKA 3QJHB 4R8WH 1NCDH 1MCBA 1IAMA 5GGRB 4NC1E 4UAOB 3DXAE 5HHMB 5D1ZC 4MNQE 4XC1H 3D18A 4Q7DA 1HEZA 4XTRD 3W5MA 4KQ4L 5SV4A 3GGWA 3MNWA 2DWEB 2R39A 4G6MH 4LHQB 1KJMA 3BGMA 2E27H 2W92A 5DS8B 4TNWF 3S36H 4QRUA 1H8NA 5EU7E 2XWTB 2ICWJ 5FOBB 4Z5RA 2PUQT 3T77A 3FO9A 5GGRA 4U3CA 3MX0A 3WEXA 1CF8H 4URTB 3FQWA 4OCRH 4LF3B 4JO4L 4GW5B 3TBWB 3DWTA 5IVOA 4GMSH 5E6IA 5DD5H 1TTFA 5IQ7L 2HLAB 4LCWD 1OT2A 4L8SC 3RZCB 1N6VA 4GBXC 1FFQA 4G8FA 4H0IA 2YN3A 1XF1A 4C58B 5JPNB 1WFOA 2F8XC 3BPNC 4LSVH 4J8RA 4R7NB 5GISH 1N0LA 1A6ZA 1X5AA 5C3TA 4XBEL 3NN8B 4G6KL 4P2RB 1ZKAA 3W9DB 5DR5H 3OAZH 2X70A 3EOTH 3RY5A 1A5FL 4U0QB 2X4RB 5DURD 4KKAC 2P24A 3O6FB 1HXYA 3WUWA 3BEVA 4YBQD 3GHBH 4QHMB 1IGTB 2ATKB 2O5ZH 1AIFB 3O0RH 5I1EH 2HN7A 4JQVA 3O4LE 1XGYL 4NDMB 5CP3H 5GRWA 5JDSA 2QR0A 4U49A 2W0LA 2RFXB 4O2EA 4UNTA 3QIUD 2VISA 4U3XA 5HI4D 4RA0C 3WLWD 4H5SA 2BVPB 5TPWL 3KWWA 1BGXL 3HE7D 4DVBB 5CEXB 2VTFA 3VFUA 1H5BB 4JJ5B 1IGIL 2OR8A 3T8XB 4KRMB 5EBGA 2QQKH 3DJ9A 4XWOD 5IBUG 1YEIH 3HZKB 4I18C 1LILA 4D9RD 2CUIA 3FB7A 4NJ9L 1KJ2H 1NUDA 1TQCC 1CZ8L 4DKFH 1BVZA 1QA9A 2IMMA 3DMMB 2V5YA 2YD7A 2AJZB 4K94L 4S2SB 2EE9A 1FL3A 1L0QA 1MHHB 4X6EB 5HHXL 3NCMA 2ZWLT 4RFOL 5D1QA 4CMMB 5K93A 1AD9B 3VG0L 1YNLL 4XH2A 2CXKA 1MHCB 3B8YA 3UTPD 4HS3A 4W4OA 4EOWL 4LDOB 1RZKH 5GGVL 4JY5L 4AEHH 3DO7A 1V7MH 1IFHL 2DD8H 3H9SD 4ORZC 4QHNB 5KVFL 4FABH 3BO8B 1KPRA 2B0SH 3D39E 5AUMB 5KG9B 3ES6A 4J3WA 2XA8H 4Z78A 1FZJB 4G9DB 4G6JL 3P9MB 1ZHNB 3W9EB 5E2VL 5EOQH 4RGOL 5JQ6H 1NBZB 4JM2A 3F6LA 3IFNH 4K7FA 5I71C 4NQEE 4M6NL 2QQNL 4X80H 3PL6B 5IQ9B 3LKNB 1KBGL 1WAAE 4L3CB 1J1PL 3AS2A 3L5WA 4FFYH 2A74A 3WFHB 3FOLA 5HYIA 5FDYA 1IAKB 1JRHH 4JZNA 1P7HL 3MA7B 1JZ6A 3TA3A 1FNGB 1NBVH 3TP4A 2NXYD 1A1NB 3W39A 5HGHB 3L3DB 1IC7L 2QTEA 5EFIA 4KQ4H 3RHWK 4K2UL 1RFDH 5E5UB 2J8UA 4FQQA 1I9IH 2NX5E 4I3GA 3C2AL 1DP0A 3RZCA 4ZXBC 1UB5B 5DK3A 3S37H 5GZOD 1TJGH 2ADIA 3GM0A 1MCCA 3I02A 4KROC 4N0YL 1CICA 1CGXA 1KCUL 1V05A 1XIWB 4OIIH 1NMCB 3HE6B 2AJ3B 4ONGH 4EIGB 5IB5A 1ACZA 2E7BA 1DUYB 4V1DA 1RU9H 3FO0H 5FGCB 3ARBB 5I16B 3MQIA 4KH2A 1ZK9A 3CPLA 1CFVL 3GHEL 2XT1B 3QULA 1JPTH 3RI5K 2VR5A 4QF1A 1NGPL 2DM3A 2KPNA 3ARDA 4PS4H 2CJUL 4C55A 1RZIB 4P0DA 4ERSH 1PY4A 3UTSA 1W0VB 3ZHLA 1WEJH 3OGCB 4U1SA 1CDIA 4WV1C 1X5XA 3QDMB 4JB9H 4G8GB 2OMNA 1CN4A 3RY6C 4D2NA 2FB4L 5DSCA 2VNCA 4OB5H 4WO4D 3KYKL 4Z7VA 1A4JA 3SO3C 3ILPB 4OGAD 3QJFA 4H20H 4M61B 1FO0L 3Q6FA 2YKLH 1KJ2B 2O61B 1I1FA 4HWZB 4XPAL 1CLYL 2PR4L 1NLBH 3UJJL 2H2PC 3O6ML 3SGKC 4RBPK 4GSDH 5TDPB 3QYCA 3D39A 2K3TA 5J9PA 4FTVD 3H2WA 5LCVH 4JO1H 3VWKC 1O7SA 2KH2B 1LDPL 4BK5A 4RZCA 4G3YH 1HOCA 1KYOK 2AI0L 1I1FB 4Q2ZA 4PV9A 1KJ2A 4P2OA 3PGDA 3MLXH 4JRYD 3RAJH 2XG5A 2IH3A 5I76A 4QLRA 4OZFH 3QRFM 1OPGL 2XQBL 2CRMA 1SYVA 4MAYC 4X6DE 4WW2B 4I18B 2A73B 5CEZE 3V6OC 3SDCC 2ZKHL 1PSKL 5I1CL 4HUXB 4H26A 3GK8L 3EHBC 4CL7A 4JLRB 1IGYA 1PFCA 2YA1A 4NKMB 5C07D 5T3ZD 2P43B 2EIZB 3OKDB 1ZSDA 5BZDA 35C8L 1OAXH 1M7IA 3ZSSA 2P45B 3F7QA 3CK0H 4IIQB 5IB1A 1IKFL 5BXFB 1A6PA 1L4IA 1YEEL 4AEIL 1IGJB 4FFVC 3DYPA 1DBAH 1GAFH 3FFDB 2OL3B 4ZTOH 4MMZC 4HFWA 1WIOA 2A83A 2SEBA 2FJGA 4JVWA 4P5MA 1MQ8A 2FX9H 4ONOA 3FONA 3GZKA 4QXWA 5KVEH 1JHKH 2VSCA 1ZHKB 2VN4A 4HBQA 3U30B 1E6OH 2BNQB 3MA9H 4OBSA 5ALCH 3RKPA 3GIZL 2OTPA 1QFWH 1P2CA 4JVPA 4LSRH 4AIOA 1X5HA 5CUSH 1RHFA 5FV1L 3ESUF 4QXUL 5IEKA 5HGHA 1CT8A 2GCYB 4KK8D 1T83A 3BKJL 2PTUA 1A2YA 4MWFB 5CGYD 4LCIL 5JPMB 1BVKA 4EJ1C 4P46C 3VFSB 3KPLA 3I2CH 3LY6A 4TN9A 1LE9A 4YXLH 3K4AA 4RCAA 3HRPA 4P5MB 2NZIA 4LSQH 4XXDA 2AJYL 5JQ6L 4U1IA 4G43A 2Z31B 4HIEB 2VXSH 1D5XA 4CAGA 4Y4FA 1Q9LA 1QO3A 4PGDA 2PCPB 2Z8RA 2FNBA 4M8VA 2BNRE 1FFNA 3IF1B 1N26A 3QEHB 5DJDA 5FEBA 5EU3B 1CVSC 2Y06H 3SN6N 5I0ZA 1EHXA 2ESVB 3HUJF 1F3RB 3K80A 4PGEA 1NBVL 1EUUA 1AJ7H 3BP4B 3IS1X 3CGTA 2K7PA 1B3JA 3RNQB 3I50L 1RUPL 2XTJC 3OB8A 4ONFH 1D5ZA 2LTQC 1T21B 3WUZA 1L7IL 3ZDZE 4TUOB 1YMHA 2KUTA 4CMMA 1AKJB 4F57L 5L2JB 5KVDL 1LVEA 1PVHA 1SBBA 3SDCA 1MUJB 1S7QA 3PABB 3QO1A 1TNNA 4X6FB 3RRQA 4MA3A 4E41B 5IMMA 3BPCB 2V7HB 3O9WB 3WD5L 5DO2D 3MLRL 4RRPG 3VE0B 3W81A 5ACZA 4PJCA 4KY1L 4RISL 3N1QC 4L8BA 2I9LA 2BOCB 1T4KA 1W8NA 4YK4B 4MD0B 4YXKL 2MCPL 1I8KA 3KWWB 3K1DA 2IFFH 3DURA 1C5DA 4L4VB 1YY9C 1NGPH 4PS4L 3HHRB 3VWKA 3NA9L 3U1SH 4J3UA 4KQ3H 4O02H 1JWMB 2BC4A 2PYFA 4UOW1 4XMPH 3B43A 1F4YL 1H0DA 4MJIB 3QO0B 3P4MB 3GUTA 5F7UA 3WIHL 1MI5B 1QSEE 2G60L 2L7JA 4YDKH 4CVXB 3SPVB 4P9HC 1NCTA 5BVJB 5I8CA 3OPZL 3B5TA 2Z31C 1ZTXH 2PW2B 3VXSE 5GGTL 1XGTB 1IT9H 2W0PA 4TVPH 3J7HA 3CVHA 2ED9A 4Y8AA 1BQLL 4JN1H 1CCZA 1A8JH 4LEOB 1S9YA 4YDVA 3SDAA 3O8XC 4YHNA 1PGRB 2YPLE 3DX7B 5CMAB 4BQCA 1DQTA 1DEEB 3IJSA 3QULB 2CGRL 1JCKA 3LSOA 2VZSA 4L8SA 4G42B 1D9KC 5D8JH 3Q5TA 1FRGL 1T7YA 3GBML 4OCNC 3C6SB 2HJLB 4PYGA 1YPZA 4K7PL 4JO4H 2YEZB 5DHVA 3CMOL 3MV7D 4JPVL 4E5XB 1CK0H 1X5LA 3KNBB 1IAIM 1XGUA 1HHIB 1TFHA 1KXVC 3CD4A 3VFNA 2AK4E 1F8TL 2I5YL 4PLJD 5ADOL 5H8DA 3S6CA 7FABH 2I07A 1S7UA 5C09E 2XWTA 3KR3H 3TH4T 2E5EA 2AQ1A 4XBEH 2X4SA 1JPSL 3RL1B 1DE4B 4L29A 3G5YA 3FT2A 1QQDA 3VD5A 4I8DA 4LCCB 1GGCH 4PGJA 3CNKA 2FJHA 1U41A 2FATL 1NSNH 4M3KB 3TIEB 4GT7A 3T4YA 1MWAB 1QSED 1FVEA 5F9JA 1BM3L 3RTQD 4O9HH 3VD4A 5J9PB 3SE9H 1E27A 2ICWA 4Y4HA 4M1DL 1EGJL 5FF6A 4Y1AD 2C7UB 3L6FA 4TPRH 2R0LL 5F1IB 3U0TB 3GEWB 3UTPE 4HG4J 1S7RA 5HYJA 5EZOL 4G9FA 2DJUA 3SKUD 2BC4B 5FYLH 1VFAA 4UQ3A 3CX2A 4LPCA 4EUPB 5GGSA 2VC2L 1XCTB 5CBAA 4MQXD 2XKSA 3MRFA 4JG1L 4OZIE 3MUJA 5DXWA 2DBLL 1C5DB 5E56A 2A77H 3K4ZA 3KGRA 5I75B 3MBXH 3ZTJG 4OCSH 4HS3B 3BEWB 4PJIF 3R06B 3ZDYE 4APQA 5CEZL 3I9GL 3FL7A 1QHPA 5BO1H 4YUEL 4WHTB 4BH7B 2NY4C 1CU4L 1RZ7H 4I5BB 2X10A 3IT8D 2WMPA 2DAVA 5DDHA 5HGBA 4H8WH 5E8NB 4X5LA 5DUML 3RUGE 2DMKA 2DQJH 4E41A 5IMMB 5FYJH 3PQYD 3V2AR 4N5UA 1MY7A 1PG7H 4R6UA 1DL7L 4TSCL 4PRIA 4E9LA 1K4DA 1BM3H 4IRJC 1NFIA 4GKSA 2EH7H 4POZC 4XP6L 3UTZA 1UZ6F 1IAIL 3D3VA 1UQSA 5T5NG 1UZ8A 2NY6D 2H32H 1G7LB 4ZO8A 3VFWA 5BS0B 1IQWH 1L9NA 1TITA 3PHOA 2DQGL 5I2IB 2XXCB 2Y07L 4RISH 5DJ0A 4HUUB 4PJDB 5CJQL 4AM0A 3P30L 3G5ZB 1WWCA 3TN0C 1PKOA 4LMQE 4OLYH 2C3VA 5AZ2H 4OZIA 5KAQG 3SGEH 2HWZL 1QO3B 1UJ3A 4ZOCA 2H1PH 5EZLA 1FYTA 5D2LE 4DOHB 4XI5C 3SCMC 3O0RL 4X6CB 3U9UB 4XXDB 3UPRB 1FCCA 1ADQL 2DL2A 3MROB 5DMGD 3U4AA 2J5LB 2GK0B 3F7VB 4NZTH 2J88L 4O4YH 1I1AD 3WL9A 2E9IA 3DX8A 4MZ2A 5IVZB 3TBSA 2D9QB 1T2XA 4JQXC 2X2YA 5K9QG 4XAWH 5AD0B 2WK2A 3O8XA 4I77L 2JJTA 3DUSB 3JSSA 1VHPA 1N5AB 1JWSA 4WENB 2LU3A 5EUOF 2Y6SC 4G8FB 1TCRA 1YECL 4Y4HC 4YHKH 4FTVA 3QEGL 2YA2A 4G9FB 5HYSG 1ZVSB 2FGWL 5J11B 1OL0A 1RJZB 1PJ9A 4M62L 4N9OB 1MCNA 2E6JA 3WD5H 3O3EA 3MRRB 3VMOA 1HH6B 3WIHH 5JNYB 5HYSA 3X3FH 4LQFL 2EDXA 3TCXA 2NCMA 2HTKD 4K23L 2CLVB 3NIFE 1FL5A 3LN9A 3IAPA 4JN2B 2QQLL 4U1HA 1CE1H 2LU7A 5J6HB 5CJOH 3B3IB 2AS5M 3O3BA 2NY0D 3EYVB 4NC2B 3E2HB 2A1WH 2VLJD 3VXUD 2DYPA 5BZWB 3UTSE 1KPUB 3HAEA 5D7LE 5JZ7C 3QBTB 2HKHH 4H25B 3PWPB 2DQHH 3QQ3B 3OF6D 4GXUN 4EBQL 4CU6A 3CSYA 4M43H 1KB5H 1HHHA 3TYFB 3ZE2E 5HI3C 3HNSL 2VLJE 1QRNE 1FNAA 1NGXB 5MEOA 1GL4B 3KPOA 2GAZB 3AGVA 3FB5B 2NY2C 1JYXA 3KPMB 5EU4B 3CXHJ 3FQUB 3TA3D 3HE6D 4OLZH 4XHJD 1IM3A 5F7MC 4QOKE 1KT2B 4TSBH 5CJXA 4RZCB 1NGZA 4HPYL 4Z7UF 3KJ6L 3MACL 3U4EB 2GSIA 4OIBA 3MJ7B 5SWSE 4QYOB 3JTTA 4A2LA 3RA7L 3WFEH 2V6HA 3OJVC 1EEQA 1B4JH 1MEXL 1YEHL 2AK4D 2NW2B 3B5HA 4WUUA 1LEGA 1ADQA 4TULH 1OW0C 1B4RA 4NKIL 1HYSD 5ANMB 1T5XA 5IJKA 5HHOD 3RX7A 4HD9A 3DLQR 2VH5H 4OKVA 4IBLT 5LGHH 4NJAH 4UIKL 4F7MB 4I3SH 5GJSL 4LRNL 1IKNA 4QHLA 1C08B 4DUWA 1ZT4A 3PL6D 4IOSD 5C0RL 2ZSWA 3GO1H 3OGCA 4U1SB 4XCEA 5EB9A 3MV9B 3X11A 2IPTL 1SBSH 5MERB 1G7PB 1J86A 1HH9A 3PWVB 3QXAA 1ZS8A 4LSRL 4NO5B 1MH5A 3BP7B 2GJ6D 1WCBB 3KYNA 1VEMA 4MXVF 2P5WD 4X0KA 3ZHDA 5C0FB 3DXAB 4WI3A 1U8NB 5J3HC 5E94B 5F7EL 4GBXA 3WXWH 5DZLA 3RGHA 3QCVH 3KPMA 2I24N 2EEAA 5EU4A 1UM4H 1T80A 4XRCA 5JNYA 5DC0A 3OAZK 4MA3B 4PB0H 3VDCA 3EO0A 1YN7A 4N0FB 1BX2A 2VQTA 4X83A 5INCB 1M7DB 1D6VL 4XNQA 5LVEA 5EO0A 5JR1L 5FM4A 1RSFA 3OAUL 3O81A 3S98A 1AO7E 4UUJA 3QP3A 4HFUL 2QHLA 4HUWA 4RGMB 4RX4A 5DRXB 1KCSL 4WEBL 1S9XB 4FHBD 4JO1L 2UV3A 1KTKE 1KCKA 4U7SA 1OAKH 1OP9A 3L3HB 5DHYA 3V6ZA 1JHKL 3G5VA 3WS3A 1BZQK 3QEHA 5LBSL 4LASL 3MROA 3OKMB 2CO7B 4MB4A 4LSUH 3PP3H 1AC6A 3RWJB 1G7IB 2FDBP 1CFQB 2APBA 3UTQB 4UI2A 3SKOB 4P2RE 3RVWD 2H6PA 3JV5A 5DZNA 1HZHH 1U8OA 5JW3L 1NLDL 3S8WA 3WXWL 2R8SL 2J8UF 4HHAB 1VPOL 5KOVC 1XF2B 2RJMA 1SY6H 1JNNH 1EXUB 4NKOB 3EO9L 4X4MA 5J06A 3LV3A 2R0KH 3IU4L 2JE8A 3QHFL 4YHLH 2V9TA 5DD0H 3W82A 4JFXA 2X4TB 1P2CB 5IOPA 3PDOB 3CUPB 4ZNCD 4YBHA 4I0KA 1YYLH 3IGAA 5GSVB 5EO0B 5ICXA 1IZJA 4HFUH 3H6JA 3FONB 1MHHA 5GRVL 4L9DA 4TSBL 3TH2T 5GHWH 5INCA 1WZ1L 2FZ3A 2YBRB 5LQBL 3EO0B 3EYSL 3CH8A 1EVUA 5GS2D 1A4KB 1UGNA 3E6HB 2R9HC 4LCYB 4X5XB 2YWYA 3A6BL 3I6LD 3MV7A 3SKMA 4LVHB 4PB0L 3E3QE 3AMKA 4PTTA 3N06B 1IEBA 4OF7A 1Q9WA 4YR6B 4I5BA 4LLMB 5DWUH 5EZIH 4N0UB 4RRPA 3PDOA 5D7KE 1H5BA 4JJ5A 4FQCL 3TZVC 2HMIC 4AL8L 2AV7A 1T2QL 1R0AH 1UWGH 4XVUD 1V7ML 3ARZA 4H5SB 3E3QC 4JFDB 5CJOL 1PAMA 5FYKD 3MC0A 4TUKL 2BY1A 3L9RA 2XOTA 1KULA 2FBOJ 1MLBB 5C0RH 1CICC 5DUPH 1MREH 3MCLL 1K2DA 2ADGA 2GYSA 4NWTL 3S5LB 3BVNA 4GRMA 5DZOA 4C4KO 1QRNA 3WUWB 4CVUA 3MUY1 4RA3A 1MCEA 4LFHG 5ILTL 3QEQA 1QFHA 3G5VB 3WS3B 5E6ID 5EOTB 2XWBB 5A3IC 5DJZB 3VA2C 4FXKA 4P48A 2XN9B 2X1XR 1UH2A 2MFNA 2F58H 4KDVA 1S7UB 3AXLA 3BKCL 4HMCA 4HXBL 2HT3C 4HWZA 3DV6A 5T3ZE 3DV4A 4XP5L 3KJ4B 1QPXA 2ORBL 4FQIH 5DUBB 3HZVB 4GQ9H 3KPRB 3MRPB 2D2OA 2DMCA 2HG5B 2XZCL 2OZ4A 2OP4H 4K07A 3MRIA 2X6MA 3QDME 4X9IA 1KUMA 3LKSB 3PQYA 4NT6B 1HHGA 2QSCL 3MLTB 5CJQH 2VDPH 2WANA 4LSDA 2HJFB 5F9DC 2R2EA 4XNYH 3RPIA 2AERT 1F11B 4PTUA 1HN1A 4LSTH 1HEZB 1GYAA 2FHCA 1FIEA 4JREC 3QXWA 4M9PA 1G7JB 2IFGA 3V9FA 3DARA 3RZCC 4AEFA 2HFFB 4U1NB 4AQ1B 2XXMB 2BRRL 5F3HB 5D71L 4YZFE 3DGGA 4P5TC 4HX1A 4QEGA 1VEPA 5KSAC 1OLZA 1ZGLB 3SDAD 3HR5B 4DUXA 3LPWA 4FQJL 5D6DC 3CAFA 4I1NB 4U1GC 5I1HH 2JJVA 15C8H 3GRWL 3WS6C 1PKQE 5GGVH 5BO1L 3O8XB 4IRZH 2DB8A 4MVBC 3FHQA 3S3JA 4JM4L 5I1AB 4PJAA 4POUB 1YEDB 5D7SH 2IH1B 3ARED 3B9KA 1U3HD 5BV7B 5F89A 4MA1C 3ULUL 4W70A 3QEQB 4XNZC 1IEHA 3ECBB 5IROA 5C0JA 4FG6C 2CPCA 5IBLD 3WLWC 2ICEB 4AJ0A 1CK0L 3MRNB 3GHBL 2GAZA 4MQXC 3QXDB 5EOCL 1EZVX 4C83B 2EDJA 4RQQB 5I1KL 3TYFA 2Y5EA 2WM0A 4QHUB 4FQLH 3G5ZA 1R3LA 1NGWA 3LKRA 4OZFB 4GRLC 5D2NC 4CKVX 2D7TL 2VDPL 3B3IA 3S36X 3BIKA 4UILH 1FAKT 5FECB 3O3AB 1Q1JL 4GMTH 4D8PA 2PETA 1AD9A 3H42L 1IGCH 1E6JL 3PDGA 1S7SA 4RWHA 1EX0A 4HBCL 2VL4A 3W11C 5HSFA 3VXUA 12E8H 2ZNWA 5FIEA 2WW8A 5AYUH 1J05A 1OAZL 1NCDL 4K7PY 4OLXH 5GS1C 1A4KA 1OAQH 1VENA 1IGML 5KANI 2Z4QB 1JHTA 4O51A 2J4WL 3P4NB 3FN0L 1GGBH 3GSQA 4XNMB 1ZVSA 2W60A 4G7VL 1IARB 3RU8L 3NGBC 1YMHB 4L8CA 4LP4A 4A2MA 2C1PB 2PO6A 2XIDA 4NWUL 5IOPB 3FZUC 4JFXB 4RMSA 4BZ2L 3C5JA 3GNML 3ZYZA 2CRZA 3UDWC 1R0AL 3QDGE 4U1KA 3ZL4H 4KAQH 3SDXE 1ZHBA 3TYGH 1VFAB 2P7TB 5EUOB 5MEPB 2FD6L 1JPFA 3JWOH 4KDTC 4M6OH 1UWEL 4IMKC 2EEDA 1P84K 4L4TB 4PRID 5JUEH 1OY3B 3HPJA 2AJYH 4QRTB 1F13A 1IZKA 1MLCA 2A6KB 4OCRL 1FFPB 1IGJA 1FH5L 1HSAA 1UZ6E 1Q9KB 1Q9OB 4BFIB 1MFDH 1BWWA 5EOCH 4HXBH 4L4JA 2NR6D 3AB0C 4RGNC 1MQKH 1PKQA 4FFWD 4HT1H 1HE7A 3BE1H 1DANT 5C70A 1BHGA 2YC1A 3FKUS 4J6RL 5J4MA 5IKCA 1MFAH 1QBAA 2H26B 1M6OB 2P5EB 4ZPVB 3CSPA 2VE6A 4HG4K 4AEEA 2YN5A 5DJYB 4YX2H 1OP5H 5KSBB 4MLIA 1YZZA 4YXKH 3RWDA 5KVEL 1JRHI 1PLGL 5BVPH 4E0RB 3TH3T 3WE6A 3HAEG 5D2NB 3I6GB 2DTML 3V4UL 4KKNA 3MRHB 2SEBB 5FM5O 5C0GA 1G7MB 4GJTB 1MCFA 3HPLA 4OF8A 3CK0L 1A9BA 4PV8B 3D0VB 4Y0GA 3VGFA 4AYFA 2DWDA 5BXFA 3GMRA 1SM3H 1INQA 3NACH 3AVEA 4NRZB 4WI2A 5HGBB 3PNWA 2UWEF 3AS0A 4RMUA 3WV0A 2WBKA 3O6FC 1FPTH 1KGCE 3RIFF 3MRJB 3MRBB 4EN3C 2GSGB 1I7TA 3G08A 2YA0A 4WO4C 4MJ4A 4X5WA 1YA5A 1LO3H 3EO9H 1CD8A 2YZ8A 1RULL 4MYWB 4FQCH 4JY6A 1ULVA 4OTXH 3TJHD 3VD9A 3UZQA 3V5HA 2EC9T 4RX4D 4ZTPH 1AR1D 1BBJB 4YHOH 1BF2A 1PG7W 4V1DE 5DEFA 2WWMC 2F5BH 1ZVHA 5J8OA 4ORGB 4Y16A 3IDXH 3QJHA 2OMBA 3RGVA 3NFSL 1LO2H 1TETL 3IJHA 1AGFA 2WBJC 5KSVA 3IETB 4CGTA 4HQQH 4WEMB 1KNOA 4LSPH 3DSFL 2I9TB 3NIGE 4DN4L 2FWOA 3B2VL 5IG7B 1DN0B 4DN3L 3U0WL 4HIIB 4F8TA 1JJUA 2HTLD 3QEQE 1CDYA 3BKJH 2G9HB 4OD2B 1DLFL 1TJHL 2RQ8A 2VXVH 2Q7YA 1KCSH 4Z8FL 5EH1A 3BUYB 1PSKH 2GSIB 2GI7A 3KG5A 1NEZG 4WUKL 4OZ4B 1RZ8A 2NYYC 5E03A 1QR1A 3FN3A 4XNXH 3BPCA 3HE6A 1I1AB 1QSFB 2XZAL 2YD4A 3Q5YA 1TCMA 3MUGB 3V4PL 4ZNEE 3UTOA 3QH3B 4PJGF 1CYGA 4EKXA 1V3JA 1NC4D 1KJ3H 2AXGB 2OZ4L 3U7YH 3ZKNC 4XB7A 1S9VA 4J3VA 4RGNB 2NY3D 3QPQD 1T3FA 5GRVK 3VDBA 4L8SB 3S35X 3VCLA 3RNQA 1MFEL 3VWJB 4KTEH 1FLRL 1L7TH 1UXWA 1GGIL 1JNNL 2X1PA 1JPGA 2Y5TB 4YHNB 4LPWA 5CS7A 4DK6A 3Q5OA 2NQCA 5I15L 2LU4A 1IMHC 3C5ZC 2DLHA 5CINH 4XPAH 2ARWA 5BMFH 5D7LD 1R5VA 5C0CB 4PRHB 1TZHB 4P4KD 3WFHA 5FB8B 2YD3A 3MMEB 4HIJB 3RUGF 4X7DC 2V7NB 3OJDB 1FE8H 3LRSB 1NAMB 3GMOB 1GAFL 4WNQB 1YEJH 1P4IL 1ZHNA 1KB5L 4YX2L 4R26H 4HUMB 3JVGC 2P7TA 3HB3D 1OWRM 2J8UB 4ZO9A 3TESA 4KRPB 1ZHBB 3VRLE 2DI7A 4ZPTA 1KPRB 1JWSB 1EEZA 4FOMA 5CINL 2HRLA 2GUOB 3H7LA 5B39G 1IC4L 2APTA 1U8PB 4UBDD 4KGLA 4R4ND 3W5NA 4M9OA 3U0WH 2BOCA 2ARJB 1FP5A 1A0QH 3P0YL 4ZOBA 1EMTL 3DRTA 1LQSR 5I8OH 1R5IA 1SM3L 2GK0A 2J6EL 5TE6L 4UIKH 4NYLA 1ORQA 3DIFB 4F37K 3MSPA 3MLPA 5ENWA 3O2WH 1S7VB 2FRGP 1INDL 3TN0B 4HS8H 5DVLA 2DTMH 3V4UH 5JHDB 3F58H 4DW2H 4TULL 3OMZA 1S7SB 4L1DA 4WU5B 1GHFL 4Y19B 4LVEA 4NRYB 3O2DA 3EW3B 5HHVH 5CEXA 1LMKA 2OR9H 3I3EA 3O41B 3WHE1 5DI8B 4BQBA 5F93C 2IF7A 3QFJA 4NZJA 5FYKU 2ICES 2V5SA 2P5WE 2IALB 4R4BB 5GSRA 5IWLC 4K71C 5I1JL 1MFEH 3PWUB 4KRPC 4QRPD 1N0XL 3X3FL 1OAYL 2PW1B 4K23H 4PRIB 4XCNA 1ZANL 3LH2L 2Q3ZA 4ZMAT 4C83A 5IFAH 2JIXA 4C54A 2DI8A 1IGTA 4LPYA 3OKYA 3ULVD 2WUCL 5C0JB 1KIQA 4OD3L 3QFJE 4XBGB 4HJGA 2ILLA 5BOPA 5BS0E 5I1IH 2LE9A 2MPAL 1DQDH 2IAND 1B6UA 4GAYA 4JHBA 4OBRA 3UCRA 5C0AD 2IBZY 4W6WB 3MRFB 5DMYA 1MFBL 4RFOH 1XZ0B 4AENA 2RFXA 4ZFGL 3CDFA 2W65A 1ZMYA 4S1QL 2A6DA 4Z77A 1J88A 3ULUE 3QJFB 1YDPA 3MUHL 3S35H 4U1NA 3PDDA 4HZLA 2ATPA 5DR5L 5CJ8A 32C2A 3QDMA 2ZUUA 4PJ7F 4W6YB 3FT4A 1Q1JH 1UCBL 1FVCA 2VKXA 3BOVA 1BECA 2CMRL 4MJID 3HUJB 1A7QH 1CS6A 5GZNC 1PX3A 3G6AA 4F7PA 1DFBH 1EIBA 3IYLW 3VW3L 1XGYH 3T08A 2PYEE 2Z8WC 4HUXA 4OT1H 2JJSA 2PXYB 43CAB 5I16A 4HZAA 1DUYA 4V1DB 1NCBH 2AXGA 4OLEA 4HZLB 5F1NB 4BSVA 3FN0H 3K0WA 2NY7L 3VMPA 3F7YB 1XIWA 5IB5B 2ZCKH 3LS4H 3QEQD 1MFDL 5HXMA 3HA0A 5FYJL 2E7LC 1M4KA 4PJXF 2LAAA 4K8RD 4YIQB 1RI8A 1A6TB 1I9JH 2D7NA 5E9DA 1YPZB 3QQ9C 4NJ9H 5F6HI 1JVKA 3G9VA 2DDQH 1OQXA 4IRSD 5KVGH 4BUGA 4WCYL 1AKJD 3SDDB 2XA8L 3FMGH 2P5EA 3AM8C 4S10A 5ISZB 4XVTL 3PWNA 5J6GA 1MIEL 2AK1H 2AAVA 3CLFH 2VLKE 4NQUA 1KC5H 2X7LA 1IAKA 3QFDB 3D2UA 3WKMH 3GI9L 5SWZE 4LFHD 5SV3A 1A3RL 2A74B 4UZGA 1A6WH 1WC7A 3ULSB 2ESVD 3PUCA 1XIWC 2MMXA 5CJBA 3BQUA 3ILPA 3KHQA 4EI5D 4LHUB 1MLCB 4X99A 3ARFD 1EGJH 4MNGA 5GGUA 1NL0H 3CC5A 3C60A 4P23D 3OBAA 4YGVA 3R0MA 3KYOB 4PG9A 4GRWE 4NO0A 4QXTB 4Y5XB 2XQYG 5E2VH 5EOQL 5D96C 2H9GB 1ROWA 3CLFL 2EXWD 5EU7C 1W0VA 4BA8A 3BO8A 4UT9L 1FBIH 1NSNL 1N6QL 4XWGH 3CMGA 5E0QA 5IFHL 1ED3B 5JORA 1RIVL 1Q72H 3CFCH 4XC3L 1I8LC 4U1MA 3GNMH 1YJDC 4L8BB 2H32B 1N2RB 1I9JL 1GXEA 5ALBL 4N8VG 3HN3A 1Q9WB 3MBEA 2XZCH 4PJXB 1IQDB 5E4EC 2EDBA 4I3RH 4YLQT 4LLUA 4GQ9L 1NL0L 4Q9CA 5KSBE 3LEXB 4H88H 3BN3B 4D9LL 1G6RL 2FL5B 3C6LA 4QY8B 3DROB 5DJAB 3NZHL 1OM3H 1A14H 4PRBB 2EEBA 1P4LA 3VXRB 4XMLH 3D85A 2J8UE 2DMBA 3KLAA 3I9GH 5H2BB 5E99H 2YWZA 3QUYC 1U3HA 3QHTC 5KVGL 5AZEL 3SKNB 3NAAH 3LQZB 4KY1H 2QSCH 4XAKD 3IDJA 2JCCA 5FKAA 3AS1A 4MJ6A 4NUGH 1SQ2N 4Y4FB 1QUNA 5HHQA 1J87A 1PEWA 4NQEA 3VXQB 5C6PB 2O5ZL 5ICYA 3IDIA 4BKLB 4QT5B 3ECBA 1MHEB 4NQCE 4JFDD 4FQXC 5D70H 3K2UL 5FKPB 1R5IB 1JPFB 3VFSA 1BVKB 3ELAT 4L9LC 3QI9C 3SKNA 1VGEL 3QIWB 4M1CD 2YUZA 4QHNA 2VMFA 3VFOA 5KZCB 3UROR 3VJ6B 4KMTH 4HIXL 5T1MA 1YEFH 1UCBH 1CWVA 4I2XB 1ZLVH 1RK0A 4GAGL 3GI8H 4M7LT 5FCUL 4R9HA 4ODUB 4OZHA 4QOKA 1FL3B 1G9ML 2AK4A 3LDBB 4WUUD 1YN7B 3WIIH 4Y7MA 4OAWA 5CSGA 2CLRA 3DYOA 1NAMA 3MUGA 2OL3A 3DMMA 5CHNA 4KUZL 3FB8A 1II4E 2AQ3A 4ZG1A 1D6EB 5FB8A 1WBXA 2IPUK 5IHUH 5E94A 1RZJH 5SX4H 5T3XH 4HW6A 1ZSDB 2Q8BH 3BKCH 1PW3A 4WI7A 3QIBA 1U0QA 2IFFL 2X4OA 1MHPH 5TFSL 3P0VH 2FECI 5B4MC 3VI3E 4HIIA 1DUZB 4IDJL 2C4XA 3FMGL 2Y06L 4NGHL 2R29H 3DX9A 4OM1L 2YHGA 5LAXB 3QNXB 2AABH 5JIKA 3FO1A 4JRYE 3SQOH 3PXJA 1NBYB 1YPZE 5C08D 5K9JL 1ITCA 3H9HB 5DUBA 3QG6A 3BZEA 4YGAB 4Y5VB 1ZT1A 3U9PH 3U4BL 1I1AA 4RMQA 5H94B 5FGBC 3BEVB 3GMQB 5B38B 5C0BA 4BFEA 5ANMA 2VKWA 4HMEA 4OFYD 1J0JA 1FDLH 1OTTC 1MRDL 1OT1A 3MJ9L 2Z91B 5ITBH 3REVA 4KQ3L 4O02L 3OKKA 2CIKA 3HZYB 3C9NB 4MNQD 3DUUA 1S5HA 4HK0A 4U1LB 1U95B 4Y2DC 4CUCA 1R3IH 4MNGE 2YMXL 1XGPB 1DN0A 2GSGA 1T66C 3G08B 1F3DJ 5EOCJ 3SDYL 1UYWH 3C8KB 2M2DA 2NXYB 3HR5A 1U8LA 1NEZA 5JXAH 4MX7B 5EBLA 1DQQB 2DJSA 1E0OB 4WFGD 1F58L 2EIEA 3DXAD 3QHZH 1KLGB 4HC1L 2F9BT 3I6GA 1G1YA 3VD3A 2VDLL 4OZGE 1P6FA 3QQ3A 2YMXH 3MRLB 2FH8A 4PLKD 4PGCB 2KDGA 4HLZH 4PJHA 5L7XH 4YHPA 4ELMB 4QF1B 3C5SA 3OAYH 3S97C 1YN6A 3X12B 4U1HB 3RDTA 4MS8C 3SGDI 1FDLL 4YDJA 3MRBA 3TIDB 2EYTA 3TVMC 1AHWA 1N4XL 2BX5A 5LGHL 1HHKA 3NPSC 1BJ8A 4PJIA 1FGVH 5EUOE 4NQDB 1J0KA 5C09B 4ZAKA 1UB6B 2BDNH 3HI5L 1JNLL 1G7QB 2AK4B 1OF2B 3ETBF 3P4OA 4JGJA 3MCG1 4TUJA 5F21B 1TCRB 3O4LD 2X44D 1FL6A 1AXIB 5A2FA 3M17A 4XWOC 1KN4L 5CLWA 3ZE2F 3WIHA 4M5ZL 4NZRL 5I30H 4P9HL 3KPSE 2EECA 4PJ8D 2YD8A 3TA3B 4YHML 2M8XA 3VXSD 5D1XB 3WL9B 4F15C 4PP1D 4BSWA 5C0AA 5SX5K 3RWHB 4QRRA 5JLZB 1MHEA 3GJFK 3IDIB 4BKLA 4DW2L 2FR4A 3JBG7 3PL6A 2C5DC 3EDKA 1U91B 4KKCD 4NQEB 3V5DA 2JIXB 1JZ3A 4Q6IB 4PJEB 1RV6X 4J2XA 3CFJA 3P73A 3QEGH 3TVMA 3VXUB 1MLBA 1WT5C 4U6TA 3J8F7 4ZTPL 2ENYA 2JJUA 5CGYC 1U8JB 4CMHC 2A1WL 2GJ6A 5EUOA 3IDGB 3SGJA 5C2BH 5AUMA 5I75C 5KG9A 5IW3A 2FBJH 3L3IB 5A2IH 4OGXL 2IPKB 3ZO0A 4HUWB 3HNVH 2BMKB 2BVUA 1KJVB 1L0XA 4I2XE 1AO7A 3TT3L 4GXUM 3H0TA 1MJUL 1YC8A 1QVOB 1AP2A 2H2SC 4LARH 2OQJB 2VERN 4FQ1L 3KPSA 2H3NB 4P3CL 1E4WL 3CFKB 4N0YH 4Q9QL 4I3SL 5GJSH 4OZGA 3A6OA 1E4JA 3MTRA 1X5ZA 1RIHL 3FCTA 3LEXA 2AJUL 5DT1L 4M7KH 1ORQB 5I71B 5K9JH 2Y07H 2NXYC 4LLQB 5KZCD 3EOBA 3HZKA 4GLRH 2OR7A 2V9RA 4EUPG 4M8QB 4ZD3H 5CKGA 4WHTA 4MA1B 1UYWL 4D8PB 3G6JB 3IJYA 3MGAA 5DVKA 4HV8A 1VA9A 5J1AA 3S4SA 1JWUA 4MXQC 4DN3H 4IRSA 3BE1L 4NKOA 1UM5H 1EXUA 4HT1L 1FN4B 5D5MB 5LG1A 5JW5A 1KPVA 1JI1A 4WFFE 1C08A 4QHLB 2DI9A 2VL5A 2FYYA 4WNQA 2E9WA 4RBPH 3DGGB 4OB5L 3BI9X 1OSPH 1HI6A 4M93C 4GXVL 2ICWB 5F7WC 5IMOA 2EYSB 3GDBA 3N85H 3T04D 5I73B 3C8HA 4NKIH 3B83A 4PRHA 3RAJL 3LIZL 5IJVA 1KG0B 2VDQH 4HBCH 1H8OA 3C60D 2HFGL 3QISA 4P23A 4XCYB 4LLYA 4NO0D 4RFNC 4QRPA 4OUUA 4A6YL 1HIML 1U6AL 3G5YB 3CDCA 1EERB 5EZOH 4M5YL 2ZUTA 1ND0B 1I4FA 2B1AL 5IHBA 1U92A 2FIRT 4HJ0C 3DSFH 2PR4H 4X80L 1DQML 3B9KD 2YD5A 3W2DL 5ACMA 4NZUH 4HKJB 3I6KB 4JFED 5F3HA 1YUHA 4DTGL 2YEZA 5DHVB 4D3CH 4GRWF 2YUXA 4GBXB 3IDYB 5FOBA 5F7HA 4D94A 5CZVH 2EE2A 2V5TA 2AK1L 5E6YA 3QSKB 2G2RA 3BWUC 5J0BA 2W0KA 3EYVA 3BDYH 1DVFD 1EFXA 4P2QE 3NFPB 4OD2A 1R24A 1YYML 2VC2H 4YHPB 1MHPL 4GKZA 4KMTL 4FXKB 1RK1B 3QB7C 3MNWB 4Y4KA 2JLLA 5DJ2A 1RZJC 4UU9B 2EDDA 3VFMA 3MGTA 3WIFA 4MXWL 3ABZA 4LHUD 5CSZB 4XP6H 1S3KH 5L2KA 3C87A 2X42A 4RMRA 3ARYA 2I26N 1G1CA 2RCSL 3RVTC 2NY2B 3I84A 3S34L 1OAZH 1JF1B 3MZTA 1TTGA 3G04B 1XR8B 3OX8A 1CF8L 1UWEH 1X5JA 2IQAB 3EOTL 4BZYA 4Z77B 1RVFH 1W72L 1DQJA 3LD8B 1MY5A 2HWZH 1J0HA 3S37X 1IGIH 1A5FH 4LAQH 3DVFA 4NKDA 1Y6KR 4YBQC 2EXYC 3MRQB 15C8L 4XC3H 4EQ2A 5I1HL 4GAYB 1I1YA 4ISVB 1DLHB 3A67L 3VGAC 4E42A 1ACYL 3TO4C 4PJ9C 4NZTL 2CXGA 1EFQA 5CZVL 1KTDB 3T2OA 2Z91A 4YHYC 3OPZH 2V2WB 4KVCL 3ARGC 5ERWB 2ZSVB 4OI9A 3V6OE 4BUHA 2OYPA 4JFZL 3WN5A 3WHXA 3MNVB 4ZS7H 5D7JD 3CMOH 2OSLB 2ZG3A 1RZFL 4NO3B 4G80B 3FN9A 3CSGA 4R2GD 1EHLH 3ARUA 3MRHA 3IFPA 2QADD 1AKJA 2VLRE 5L2JA 1CGYA 1DQMH 3ZKMD 3F7PC 2ZCLH 4RGMC 3U46A 3S36L 3SQBA 5JDJA 5SWSA 4JM4H 2WP3O 3HAEB 3V7AG 1REIA 2VDOL 4ZXBB 5J1TC 1C5BL 2D7TH 4PJXE 3F5WA 5BRZE 1MIEH 3RUGA 1MAKA 4QCIB 3CCHA 1YMMA 2JK5A 1VCAA 2YC1B 1QTYT 3QUKB 2B1HL 4JG1H 1UG9A 3BZDA 2F53E 3STBA 5IT2L 2V2TB 4HS6A 3FB6A 3LIZH 4ZXBD 3SJVB 4FQIL 4PJEA 5ADOH 1HSAB 5IK3A 1S8DB 3MLZH 2F5AL 4D0CA 1F4YH 2CLRB 3O3EB 1IGMH 3BKMH 3KVQA 2JELL 4H8WL 4JM2F 3SBWA 3ULVE 4WHCA 4BSWB 2IJ0C 5D7JB 2IANB 1CG9A 4MGXA 4JKPL 1OTUD 3OKEA 4LVOC 4M7ZC 2G75B 4OKDA 1WZLA 4GW1B 4OCMC 1N6QH 1I8IA 4U7KA 1EDQA 2W9EL 2AXFB 25C8L 2VDRL 4PREB 2HVJA 2IBZX 1CTOA 1KB5B 3BD4A 2UZYB 2QLVB 4XVSL 1DBJH 4ODWA 4JQIH 1M7DA 3FQNB 2R1YA 4GW4B 4M7KL 3SKOA 2R0LH 3EYOA 5D1QD 3HMWL 3QXUA 1Q94A 2XY2A 5EU5A 1DBKL 1LE5B 3IKKA 3SO5A 1Y6NR 2J12B 3P77B 2Z92B 1QBLL 1M7IB 5HPOA 1G6VK 1TVHB 2NY2D 1I3UA 5BW7C 5GS1A 5I2IA 3G6JE 1DEDA 2JK5B 4QCIA 4IIQC 2XKNB 4KK6D 4U1GB 2CGRH 5EIIA 4XT1C 4G8IB 1X7QA 3QXAB 3R1GL 2OTUB 1JPSH 1NCNA 2GKIA 3V6FB 4GG8A 1XF5B 2VLLB 5JHDD 4JM2D 3FRUA 2Z31D 3VMNA 2PYED 1CE6B 4P9MH 3GKZA 5A2LH 4TVPL 2VXSL 4PRBA 1FQ9C 2EE3A 4LBEB 3MR9B 4GRLA 2NW3A 1SMAA 2VDNH 2A38A 5I76B 4YWGL 2EO1A 4TVPD 2I5YH 1JUFA 4LARL 1B9ZA 5A16B 4WW2C 2ZSVA 3VGHA 4H1LH 3MCKB 4GRWB 3D69A 2CDEA 4Q9BA 1QP1A 4RIRA 1GIGL 3IDMB 4ODVL 1AGBA 3FFCD 3B9KB 4X0KB 1INEH 1J1XL 4UIMB 4FQXA 4ZDHA 4RWYL 1GC1H 1N59A 1T04A 1U3JA 4IHOA 4OD1L 4K71B 1B6DA 3LN4A 3IAQA 3QUML 4U1LA 4ZQKB 3VXME 1IEAB 4HK0B 4Z7QF 5MERA 1YYMH 3Q0HA 5CBAB 3IFLH 3TBYB 4JRXE 4RDQF 4JDTL 3OAUH 1DZBA 3BPNB 3CVHH 3MYJA 2PW2A 5K9OB 2F19L 4M61A 5MHSE 4Z7WB 4LIQE 1ZGLA 2AEPL 3C60B 1EV2E 3KPOB 4U1JA 3X14B 1F5WA 5D7LA 3KPRE 3R0NA 4R0LB 4KHXL 1E27B 5CP7B 4LSQL 1JTOA 3BGFC 3JWDL 1AGEB 2ZJSH 2Y4SA 4G8EB 5C07B 4PD4K 5HGDA 5CEYA 3QFDA 1WBZB 3JXAA 1SJXA 1I7RA 4UT7L 3T1FB 2E6QA 1NFDF 2DOCA 5JOPE 3NA9H 3U1SL 1T20A 2PTTB 1IC4H 1U42A 3QCTH 3NPZB 5C08A 2A6JB 3W0WD 1NLDH 4Q6IC 3WO4B 3EHBD 2ZUYA 3LHPH 1TETH 4LPXA 1W2KT 3GBLA 5IVXF 1J8KA 4KI5C 4K3EL 4FN0A 5IJKC 5HI4C 4ELKB 4FFZL 4U6YB 4Q58C 1CD0A 1BWMA 4PUBH 2CH8A 1TQBB 3LKQB 3S88L 2X4UA 1CDCA 2VAAA 3PWLB 5FOJA 5FYLD 4ELME 4BELD 3B5GA 1T21A 3RWDB 4KI5E 3CJJA 3LB6C 3R4DA 4P9HH 4F7PB 2L0DA 3RDTC 4G8IA 2OR9L 5KTEH 1IAII 1SY6L 3GHEH 3MLVL 4MQ7A 3GSOB 5K9KB 2MTPA 1CR9H 3CSBA 4WFFD 4AH2A 1H3XA 1ZEAH 2XWBA 5DVMA 1FL5B 2Y9RT 5ID0A 2YKLL 3RGVD 3VWJC 1HQ4B 3GIZH 3M8OL 5EZIL 3RVUC 1MRDH 5C92A 3TT1H 1IM9A 4MDIA 1G6RA 3CDGB 4X4YB 1XGRB 1CDJA 4U6HB 1I3RB 1KXTB 2XPGA 1NBZA 2FLBT 3OXSA 3ROOB 5JXED 1YJDL 3OAYK 2VL5B 3SQOL 1KIRB 3I2CL 1L0YA 3MFFA 3LHPL 2WLYA 4ZO6A 1IAOB 4BM7A 3MLWL 1D3CA 4LLDB 1AQDB 5F8RC 3BN9D 1WF5A 1MOEA 3ARBD 5J1AB 1BFVH 2X4NB 1NKRA 1T1YA 5D1XD 2CDFB 4YO0B 1P84J 5DTFB 3B9DA 4Z0XA 4K8RL 2HH0H 3IXTB 4MDJB 2Q86B 4ZAKD 43C9B 4NJAL 4PLNC 1XH3A 2BFVH 4LCYA 2X9YA 5FGBA 3C5ZB 5HVWA 2FL5A 3C6LB 1I1AC 4FZ8L 2AXJA 2VWEC 2WBWB 4QY8A 3WSQH 1RUKL 2HKFL 5DQDH 1CBVH 5IB1B 4FMKA 1DQLH 2JB5L 4O2CB 4XCNB 4K3EH 3L3OA 2VN7A 3STLB 4HDIB 4F33B 3N1GC 4KXZH 2CDFA 4JY5H 4EIZC 1BPVA 4F7TB 4EOWH 5D93C 5CBEA 5IVXE 5BCAA 2D7MA 2H2SD 2BVPA 5HVGB 1I8LA 5HTSA 4J3OC 3KJ6H 3MACH 5H35B 4YPGB 4JDVB 3S4SG 4FNLH 4ZUUB 4HGWB 4HF5H 1UJTA 3MRGB 4O2CA 2HA1A 2X4QA 2W38A 1JZ8A 1ES0B 1I1CA 3G9AB 2IH3B 5I8KH 2RIKA 4HLZG 3MLXL 4M48L 5ESQA 1OPGH 3TN0A 4YWGH 1S7VA 3WFZA 4MZ3A 4L3EE 4ALAL 2GFBA 3KLHC 3V52L 5HI5D 2F19H 5ID0B 1YNTB 3LZFH 3U2SA 1F6LL 4UTAH 1U8PA 4FXGB 1A9EB 1CT8B 3IRZA 4XTRC 3QUMH 1M1SA 4KVNH 2P8PA 5F8QC 1QKZL 4NKDB 4QRQB 5DQJA 4DN4H 3V79C 1H3PH 1CLYH 3ILQC 5DF0A 4XPHH 1G7HB 4HEME 2BCKB 4JRXA 5JIHA 5F72S 5J89A 4Q74A 3OKLA 2A9ML 4XNUH 5JMRA 3C09B 4HX1B 4JPWH 1J7VR 4ZFZA 3BKML 4OSUH 1I3RA 4U6YA 1CZ8H 3DETC 4LRNH 1FG2B 1JF1A 3AB0B 2AEPH 5LGJB 2FX8H 4KJYA 3K2MC 4G8GA 1MJ7L 1IM9B 3QWOA 5L8JB 3H9YA 3GMNA 2AJVL 2AV1A 1U8NA 4I4WB 3UBXA 5C08B 2EIDA 5TPWH 2YR3A 3OKDA 2FECL 3X12A 3QCUH 1Q72L 5JW4M 1MH5B 4XX1E 3SBWC 3HMXH 3RBGA 1CE1L 1FFRA 3BW9A 3LQAL 2G2RB 2N7AA 4RAVA 1S7TB 1D7FA 4EI6B 3UBXB 4MAYD 1CVRA 3FT3B 4YE4L 4HWNA 1S9VB 1ADQH 3QT2A 5TGBB 3WFBH 4O58L 4R0LA 1BREA 2I27N 1UADC 2NLJA 3A0OA 5C9JB 1G6RH 1CLZL 1CICB 1JN6A 1MRFH 1P1ZB 1Z3GH 4FG6D 3PGDB 5JOEA 3SE9L 3EJYC 1QR1B 3SE3A 1I4FB 5CEZH 3GSWA 1AI1H 4WUUB 2NW2A 1QLEH 1DEEA 1MIMH 3O45B 5E2WL 1R5WB 3CVIL 1S78C 4LCWB 1S9YB 4LNRB 1N8ZB 1MVUA 3NCCB 2WUBL 4JFEA 4TSCH 3FOMA 1Z3GL 4NNXA 4H1LA 5C0BB 4MD4A 1OVZA 5H94A 1XCQB 5KW9L 3TPUB 5EDXA 1AGFB 5I8CB 4IEFB 5FUCC 3U79A 5LGKA 3MRKA 3H9HA 2J6EA 2R23B 3ZKXB 1NMBH 3ULVF 3QO0A 4XZUA 1HILB 3QDJD 1DR9A 5FCSH 1BOYA 1HIMH 1D5ZB 2AVGA 2C9AA 3UTSB 5F88A 5E1AB 3MZGB 5EIIB 5FO7A 3RTQA 4R97B 2VZ3A 4BZ2H 4PGEB 1BIIA 2OJZH 2HLFC 1F4XH 4MNHA 5GS1B 3H3BC 1TVHA 4Y4HD 3IF1A 3HI6L 3T2NL 3CPLB 1K9TA 1XT5A 3GFUA 4G8GE 5JHDA 3UYOD 5LGJA 3EDDA 4QWWD 4S0SD 4YC2B 1S7QB 4ZSOE 3RWCB 1HDMB 2VIRA 3BISA 4M93B 1Z5LB 3SHSA 3CFBA 1QKZH 4ODWB 4TQEL 4XGZB 3F12B 5I19H 3U6RB 3MV8E 4GUPA 2HAZA 5DQ9B 4LSTL 1M7XA 2QQKL 3RNKB 3D2UD 2R4SH 1CDHA 5EC2B 2MOVA 4ELMF 2ESVA 1AXSB 3MXVL 4WW1A 4HHAA 5I1IL 3IFOB 1PBYA 2X89A 4JFPB 1U8QB 1C1EH 1E4XL 3UTSD 3V7MA 3ROOA 5IVNA 1WTGT 1UFUA 3TLRA 1Q9KA 1QSZA 3LS4L 3LRSA 5IQ7H 5CIPH 3MLUL 2FR4B 4HK3N 4U2YA 3T0EB 1BMGA 1AC0A 5FA4B 5C0EB 4PRDA 2D4FA 3RJQB 1YPZF 4WO4A 2GITB 3NCFB 4HWBH 3KXFE 2ARJQ 3ARGA 3KXFA 1S3KL 2EIZA 5C0BD 1AXSA 3CLEH 3NN8A 5J57B 5BS0A 2DICA 5B8CC 2PO6C 5T5NF 3VFPB 5SWZA 1U2HA 2MHAA 2R69L 1GPOL 3OKEB 3D39D 2GW5A 5ISZD 2F54D 2IAMC 3RIAF 4LSSL 3EIFA 5KN5B 3SDDD 1WITA 3KPNB 1BBDH 2GK2A 3TBWA 4LF3A 3Q3GB 4QGTA 4XNUL 3MNVA 4P4RA 3RKDD 5E8NA 2YD9A 3SJVA 4X98A 4HS6B 4GS7C 4OV6F 3VU2A 2DQCH 2J3SA 2I60H 5DJ6A 3DXAA 3OXRB 4ODSH 1X4YA 2HT2D 4YC2C 2NY5C 1BIIB 1T1YB 4NO5A 2CKBA 2JJTC 4NFBA 5DFTA 4ZUSA 5CUSL 4LAJH 5JHDE 4U6VL 2VWEE 1MIML 1N7MH 3L95A 1R3LB 4G8EA 5C07A 2X1OA 3SOBH 2L4OA 2CK0H 1NAKL 4YGVB 2BSRB 2AEQL 3MJ6A 1QYGL 1LD9B 2FX9L 2CSPA 1A6AA 4R97C 3VRJA 1AIFA 3EYUH 1RQ5A 4PJ5A 4F9PC 3T0AA 1BD2B 4NWTH 4NIKB 1KIPB 3UMTA 2P4AB 5MI0B 2BXYA 1MNUL 5EO9B 1T6VN 2Q76A 4XCFL 3WIFB 1MVUB 4YDIL 3DECA 4LNRA 3SCMB 2ZP0T 5D5MF 3NFPA 1DFBL 5B38G 3WFDH 4OLUL 3PIQA 2YSSB 4KTEL 1A7OL 4ZOEA 4L29B 4JVUA 5BV7L 2F8VA 1AGBB 4YEFA 4AZ8A 2CUMA 2D31B 1AFVL 3REVB 6FABL 4MXVE 2DQUH 3BIAX 5F44A 1VACA 4PUBL 1DQJB 3OB0K 1INQB 4NRZA 3S88H 3FB5A 1E28A 4U2ZA 1KTLA 5JXAL 1DANU 5C0GB 3SEPA 3FQWB 1A22B 2CKBL 1UCTA 4N0CD 1KFAL 2P5WB 5GRJH 4PJCE 4P3CH 3DTXA 4J4PD 4FFVD 1X44A 1EMTH 1G7JA 1NCUA 3ARDD 3VFRB 1GOHA 4F3FB 4UT6L 1D5IL 1NBQA 5D7IE 2APVA 4YJZL 3V6FA 3EOAB 1FLRH 1L7TL 1LDPH 4HWEH 4WTZA 3CFEB 3ZTNH 3T0WA 3ZDYF 5FO8A 4QRPB 4XVJL 2WLZA 2X4OB 4GAJH 4OZHE 5EIVA 1EO5A 1A1OB 3EKCA 3O9WC 4I48A 5IROC 4KK8C 5IFJB 1AGEA 4WTZG 2GTWA 3VG9B 4RNRA 3U36A 5IMOB 2AJ3A 3MLRH 3QUMB 4K7FB 2AEQH 5DEZA 1FNHA 1OWWA 1LO2L 3V8CA 4M43L 2R9HD 4DZBA 4EBQH 2DKMA 3OKLB 3L7FA 3KPSD 4QOKB 1RZGA 4ODUA 2A6DB 3PGCA 4XP1H 3C5ZD 1D5BB 3LH2H 3TN0D 4I2XA 4L9LA 8FABA 1T1XB 2PXYC 2NZ9C 3ZE0F 4N1CA 3ULUD 2HVJB 2F74A 4AIXA 3W0WA 2QQLH 4RAUB 1A9EA 4XI5D 4NNYA 3BP6B 4WTXA 5D2LF 4NZRH 4WEBH 3PWPE 4O2FA 3EUUA 1MPAL 1MCKA 1M05B 5BJTB 1LEIB 1UKTA 1A47A 2R56H 4ZSOA 1R3HB 1KIUA 1WT5A 3B4NA 3QXTA 1S8DA 1QBMH 2IADB 3BVNB 5I66B 4PD4J 3PWPD 1ES0A 3FB6B 5C2UB 3FQTB 1YECH 3W9EA 3VH8A 2NY0B 2BVQB 4HUUA 4PJDA 4Z7UB 3X13B 1G0XA 4TUOA 3M45A 2VXVL 3B2UD 4PJGE 3MFGB 2OTWB 4PRHD 4R7DA 2OTUA 1ONQB 4HWEL 2VISB 3VGGA 2ID5A 5CBEB 5JTWA 3N0PB 2DJ4A 1I9RL 4DK3A 4QHKJ 3ZTJH 4D9QE 4ESKA 4RMWA 4DGIL 3C6LC 1U8JA 4ZUTA 4XP1L 1P4LB 5TJWK 3WLBA 2Z92A 3GSXB 3LAFA 1GGTA 3IFPB 3IRPX 2VABB 2NR6C 2AJZA 5HDOA 4DKDC 4RGND 1JTTA 5D4QA 1Q94B 4CDHA 2PTVA 4F58L 5E00B 1CFSA 1X4ZA 1DBJL 1OW0A 5F7EH 2R1YB 2VXTH 5DMKA 5JZ7D 2VZVA 3T2QA 3TFKD 5E2UH 2X70B 3INUL 4EZMA 5DTFA 3IU3A 2O26U 1UT9A 1N2RA 3UJIL 4PJ8A 3W9DA 1KACB 5FHBL 5DRZA 2DQUL 2EIBA 4KFZC 3BP6A 4WUUE 1RMFL 2AKRB 4F37F 1P7KB 5K9QI 4HLJA 4JFQA 1I8IB 5MP6H 1U8IB 2H2PD 5DA0B 1OP5K 2H9GA 1IAOA 2BY3A 2HFEA 4KU1A 4UQ2B 3NACL 2QR0B 3WJJA 4F9LA 2YXMA 3G6DH 3VWKD 1CFNA 2A83B 3OX8B 1XR8A 3C08H 5DUMH 4C56A 1G7IA 2D4DA 5F9WC 5IK3B 5L2KD 4QGYA 4J7RA 5JA8B 3MMEA 1CXIA 4KKBD 3EYQC 2B1HH 2XZAH 1I9IL 3QI9B 2Q7NA 5DEGB 4KDTA 3VGAB 3OHXB 4CN4A 5F7NC 1IGCL 3GI8L 4PTUB 4JDTH 5E4EB 2BVOA 5B3JF 1DSFL 2Q8AL 3PJSA 3AAZA 2V9QA 1A7NL 1EFXB 1A6ZB 2DWEA 3Q48A 1C5BH 3DRQB 4KPHH 2OI9B 5ISZE 5DLML 1EBPA 3NZ8B 1CFVH 2GJJA 3LKSA 4NT6A 4MA7L 2I07B 3PWLA 1J0ZA 1FZKB 2VAAB 2DLGA 1B2WH 2CLZA 3NH7L 4QTIH 4KJPC 2GEEA 5D1ZB 2ADFH 2X05A 3MRPA 1BQHG 1KLGA 4M6NH 3I3DA 2V2XB 3KNBA 3LN5A 1KTRL 2FGZA 4CRPA 1TPXB 1HYRC 1W0WA 4DAGH 3NCJL 1BFSA 1CTNA 4NGHH 5E2WH 2NY6C 3F6IA 5F1KC 1ZA3A 2QBWA 5D7SL 1YQVH 4ZFFA 2PYEB 1LO0H 2C4FT 3QIUC 5D9SB 4P57B 4OV5A 1IQWL 1DLHA 3HUJA 4G9FE 1OD7A 5CMAA 1T83C 4NM8L 5BQ7A 1XF3B 4LLYB 1K4CA 1G7PA 4CU7A 1P6AB 3HC4H 5T3XL 1CDUA 4QRSA 3QAZB 1TENA 5EO9A 2EH7L 3MOAL 4EDWH 4J1UB 2EO9A 1NMBL 4ENED 2R2HB 2RCSH 2ADGB 5AWNH 4PJIE 4U1JB 3X14A 2W1NA 4CVXA 3PP4H 3I3BA 5IEHB 4ZFOA 1QOKA 4HJJL 1H3VA 4OLYL 4PJHE 1F3DH 4LCUB 5IB4B 5KOMC 1GOGA 3ARPA 4JFQB 1RZKL 1M71B 1TJIH 4OCSL 2VDRH 3P40A 1IGFL 3KYMB 1AD0A 4X5WB 4KWUA 3ARFC 1R6VA 3U4EA 3QUYD 4YR6A 3Q2CA 5E2JA 3D3VE 1KCRL 3SE8L 3ET9F 1P4BL 1D6EA 1CXFA 3MV7B 3K1KC 4YPJA 1L6XA 4OM0H 4ONHA 5CCKH 5CKAA 3Q3GA 1NMAL 4WWKD 5A2KH 3HB3C 4P5TA 4NUGL 2DQDL 2HFTA 5A43C 4BSJA 1QHOA 5KN5A 1I9EA 1AR2A 1UB5A 4P2OC 3UZVB 1U8KA 3OKNA 5D72H 2X4PA 1WZMA 4O9HL 3ZT5A 1IGFH 3A67H 4YE4H 1KPUA 2FD6H 3SJVD 5EG6C 3OJMB 1A1MB 2YPKB 4CADA 3LZFL 1BFOA 2JCCF 3BHBA 4JFOA 4NBXB 1I3GH 2ICWI 3L3IA 3ZE0E 4B0MM 4QWWC 1YMME 2BVOB 4HJJH 1MF2H 3TBVA 4N8PA 2FEEI 2MKLC 2CLVA 3SGKA 5FK9B 4KZEH 4H0GA 4Y1AA 4NQXA 1NANI 4JDZB 4JPKH 2BVEA 1ZA6B 4NZUL 5TE4L 3EAKA 1JFQH 3OJ2C 4L5FL 4IJ3C 4S1RH 3ARSA 4OCYL 5CWSA 3V5KA 4OAWB 1ZVYA 2F5AH 1OAQL 3FQNA 4I3RL 3UZEA 1U8HB 2FIKA 3NOIA 4LQ1A 4BQ6A 2EICA 3EDJA 2CR6A 1WCQA 5FYKH 3VJ6A 2BERA 5CIPB 3UPCA 3T65A 3IVKB 1T2QH 3QIWA 4GUPB 3ZDZF 3TBSB 1WAAA 3ZSTA 3SY0B 1OCWL 2X4PB 1OAUH 1MCOH 4E41D 3O8XD 3NCJH 1BEYH 1K8DA 5AYQA 5B22A 4X6EA 4F58H 4R8WL 1G9NC 4R4FH 1PQZB 2FLRT 3DBXA 5FUZL 3BKYH 2HJKA 2YD1A 5C09A 2F54B 5EZLB 2PO6D 1B2WL 3NH7H 4Y2OA 5EN2A 1FVDB 1NMAH 4HSQA 3FB7B 5B3NA 4TRPH 1D9KA 4MQTB 2B20A 1SJEB 4GKOA 3H0TB 4XPHL 5C0CE 1AO7B 2HT3D 3RDTB 3TT3H 1BZ7B 3T8XA 3U83A 1AGCA 4MXWH 5DMJB 1TVBA 5DMIL 4XPTL 1KCLA 3BIKB 5J11C 4PRAB 4HKBB 4LCUA 4IRJA 2FBJL 1LO0L 3TZVA 3T0ED 1TQBC 3V4VH 4NHUA 5JOPD