5E8OB

The structure of the teipp associated altered peptide ligand trh4-p2abu in complex with h-2d(b)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8oB00
4RGMC 1LHZA 4F15B 5A2JH 4JZJC 5KVGH 2HRPL 3QIWD 4RQQA 1N8ZA 1ZANL 2LU7A 2EDKA 1S78C 2HMID 1KULA 1RUMH 3MRPB 4RAHA 5D1ZB 1MVUB 3MCKA 5EO9A 4OIIL 4JQXA 4C54A 3BZDA 4HS8L 4WFFE 3FQRA 2KBGA 2QADC 1CBVL 4H25B 3NCMA 4MJ4A 3SE9H 3MJ9H 3VXRD 5FEBA 1KN4L 1ZE3C 5FYJD 3TO2A 5K9QG 3HC3L 1U6AH 2XZCL 3VXSE 1SM3L 4ZTOL 3RVTD 3ZHDA 5FDWB 1A1OB 3FQUA 3O3UN 4C57C 4KRPC 3UP1A 3WNNA 1P7QD 2J1KA 5SX4H 1VACB 3HNTH 1LGVA 3ZTNL 5CJOH 5BO1H 1KJ2B 1M7DA 5E8EB 4LAQL 4MAUH 5CJ8A 3HPLA 3IDIA 3LMJH 2BSSA 2HVKB 1BQLL 5FYKH 5SWQB 1V5JA 4QHNB 4Z0XB 1T22A 3U7WH 1FO0H 3BIKA 1LO4H 3BGMA 2V7HB 4PIRF 2CLZA 3O45B 2OZ4L 1R24A 2HLFD 2OQJB 5E2VL 3IDXL 4XVSL 5JORA 1WTLA 4LCCA 1JGUL 4D8PB 1S7SA 2A83B 1JYWA 3VXUB 1UH4A 3OJDB 2X41A 1E6JH 1D6VL 3RL2A 3OXSA 4IEFB 1BJ8A 3STLB 3LDBC 4NQDB 2Z9TA 1UXSA 4AIOA 1I9IL 5KW9H 4TULL 5IROA 2XI9A 3CVHA 4CBPA 2VDMH 3H3PL 3U4AA 3LN9A 5EOTB 3LRSB 3ZKSD 4LSDA 4NKDB 3A6CL 1DSFH 4EJ1C 3NFSL 4JO3H 5DJXB 5EU5A 3QXVA 4R4BB 4M7JH 3QJFA 5C0AE 3SKJH 1CICB 1HDMB 2VZTA 4E41B 4Y89A 1CDBA 4LLMB 4DKFL 3VU2A 5CINL 1NEZB 3G5ZA 3SN6N 1BFOA 3CFBB 4S10A 4XMKH 1ORQB 4KI1A 5IFAH 5CP7A 4LIQE 2V2WA 5CGYD 3TN0B 4Z7NE 3B5HA 4RRPG 4PRDA 2NNAA 3NA4A 2GJ6B 2FLRT 5LQBL 4WGVB 1ZT4B 4RSVA 5L2JA 1HIML 4MMXC 5IKCB 3SE3A 3QA3B 5I1JL 2PCPA 1H3UA 3UC0H 2J4WL 3BPNC 1MEXH 5F1SA 3ZSSA 4HUMB 1EFXA 1FH5L 4Z7UB 3D39A 4ALAH 1FYHB 3WS6A 2PXYC 5ESQA 5F9DC 1LD9A 2X4QB 4NO3B 1K8IA 3QNYA 4LCWD 2VXTL 1AO7A 5D1QC 3MACL 4QRTB 2HTLC 3WE6A 5EZJA 4BA8A 5KVEL 1JFQH 4LLVB 1X5GA 1DQJB 3MCG1 3BX7C 5D2LB 4MXQD 3H7BA 3ZYIA 2WWMC 3BUYB 4FFVC 1T2JA 5IHZB 4PRIA 4WUUD 1PGRB 3IJYB 1DQDL 4K23H 2ZOKA 3BDBA 3O41A 4ENED 3O6FD 1JHKH 3GIZL 3MRKB 4L8BA 3Q0HA 1QRNA 1B6DA 1NBVH 3OKOA 3SKOA 5FK9A 4IS6B 1QVOA 2R56L 3LEVH 3WFHB 3BP7A 4JHWL 2OM5A 1OAXL 1XZ0B 3SGJC 5J1SC 3IDYB 3UYRH 1GGCL 1DQLL 3C6SB 4O58L 5IBTH 3NN8A 2ZKHH 1A1MA 3TVMD 3MV8B 5HY9A 2P48B 3L3KA 2WM0A 4BZ1L 3HR6A 4XHJD 4F80A 2AXFA 1MH5B 1P7KB 4DAGL 4AL8H 2IALA 1QSEE 5GIRB 1TPXB 1IC5H 2IG2L 1SVCP 4NT6B 4KAQH 5A40E 4LRNL 5GGVL 4N90D 4WW2F 5FO9A 4X4MA 3FT2B 3PJSB 3KYNB 4XWOC 4P9HL 3IS0X 3T1FA 4P3CL 3L3HB 3IVKA 1DN2A 3FN3A 1I8KB 2IJ0C 2EE2A 3ECBA 2HG5B 2O26U 5I9QC 5DGRA 4D3CH 4YPGA 4N1CA 2FIKA 2GQHA 1EEZA 1RV6X 4OLXL 5DJZB 3NFNA 3H9SD 3WO4C 1EJOH 3D0LB 3K2MC 4YK4B 2DMKA 1E4XH 5EU3A 1I1AB 1N64L 4PBXA 5L2KD 4LQFL 3L9RA 1ADQA 3CC5A 3QDME 4XNXH 4F7EB 1BFSA 2H45A 4R7DB 3ULVE 3ARDB 2DI9A 3B4NA 4OLYH 1A7RH 4X6DF 5E8PB 1J7VR 4YDKH 3NPSB 2C3WA 4YGVB 3P0GB 1BP3B 4WU7A 3U30C 4QHUB 4MD0A 3TT1H 3O6LH 5GGTA 1CWVA 1N6VA 1QBLH 4NKIH 2V7NA 2VIRA 1IGCH 3HE7C 4PGEB 2BVOB 2AW2A 1MELA 2P5WE 4KXZH 2DBLH 3NCBB 3LS4L 3VI4F 3UTSB 3WFBL 5HYQB 4NGHL 4X5XA 5GJSH 3C2AL 2Q7YB 4KK5C 3IXTA 2H1PL 4HIHB 3WNMA 4XP6H 1NGWB 5EORL 5F3BA 5I1HH 5C6TH 3UJJL 4OLWL 1B88A 5DVOA 5DC9B 1WSST 3VXPB 3QEQE 4ZAKA 3AXLA 1IEAB 1PZ5A 5CBEB 5JDSA 1NFIA 1NC2A 3T4AB 3X11A 2E8YA 4JFDD 2VSDA 3CIQA 3A6BL 1GAFH 1AGDA 3QEGL 1RZFH 5BZWA 3AREB 3DOSA 2Z8WC 4KJWD 4MA3A 1BQHA 5FYJH 4LSSL 3AVEA 5DEFA 3H2WA 5T1MB 3RUGA 2VDRH 5K9KA 3DSFH 2R2CA 3QZWB 5IB2A 2QL1A 1J1OL 3Q2CA 1W2KT 4HXAL 5E8NA 4Y19D 4PJAB 2IWGA 3WO3B 5FUCE 2J6EL 2JJSA 1X7QB 4GBXA 4HGMA 3U2SB 4NQVB 2X44D 5AZEH 1BBJB 2O5XL 1G7IB 2AJUH 5F1NA 1OTTD 2AXGA 4HBQA 3IJHB 2BXYA 1MHHA 4L9LC 4GRMA 3BESR 2APBA 3PHSA 1T83A 1VADA 4K7PH 2XQBH 4PG9B 5FAAA 5DXWA 2D31B 3QIWB 4HUXA 1HNFA 5KVGL 3KPPA 4MMZC 3CZJA 1RUML 3GM8A 2F74A 2VLLA 3I6LE 4FTVB 4BQBA 1XIWA 3IRZA 3VXME 3JWOL 1V3MA 1V3JA 3DV6B 4KMQA 3O8XC 2LAGB 3VXRB 3BPCA 2BSED 2H41A 4LF3A 2HWZH 3SE9L 3MJ9L 3JV6A 1A2YB 4JAMB 4AZ8A 1T1XA 5DSCA 3OV6A 1U6AL 4GAFB 1XFPA 2EKSA 3RWJB 3SDXF 2E5EA 3MGOB 5EZLA 2YD8A 1R3LA 4I2XB 4ELMA 1LWRA 1IGFL 2UWEA 4B41A 2VQTA 3HNTL 3PWUA 5IBUB 5BO1L 5CJOL 3QDJA 4MAUL 3TNMA 2FR4A 3E6HA 3LMJL 1LP9E 1FZJA 5FYKL 1UFUA 4JGMA 1D9KD 1U93B 4Y5YC 3U7WL 2E7LC 1FO0L 2XFXB 1LO4L 1HEZB 4LLYA 4MX7A 3GBLA 4APQC 3ZE0F 5BOZG 2PF6A 5GXBB 3RVXD 1FAIH 4RMSA 2A6JA 3GMOB 2IANA 2P24A 3BGAA 2VERN 3LKSA 4MQXC 4X9BA 2OSLB 4Z95H 1ED3B 1A1NB 3KLDA 4Y4FB 4KJQD 4FG6D 1CS6A 4I3SH 4XRCB 1E6JL 2X1XR 5I17A 5MEOB 4LNRA 2NY3D 3QBTB 5ACZA 3V6FB 4U1MB 1T7YA 3NTCH 2MNUA 3QO1A 4LSVL 4Q6IB 4RDQG 5KW9L 3L5WA 2MJWA 4LFHG 4NUGH 4XPGH 1XGQA 2VDML 1TZIB 4JRYD 3RY4A 5FV1L 7FABH 4JZJA 4UB0H 4OZHF 1GGTA 1EFQA 3A67H 1FRGH 4OZIB 1DSFL 2A2QT 2A74B 4JO3L 4ODHH 4F7TB 4M7JL 3JWDC 3SKJL 2A6IA 5J6GB 1KB5A 1UZ8B 3IKKA 5DS8A 4PJEE 5TGBA 3S37X 3QXUA 4L8CA 1E27A 4XMKL 5IFAL 5KVMC 1IM9A 4W70A 4P59H 1YMMD 1ZSDB 4ETQA 1YQVH 5F1IA 1B9ZA 1D6EA 4E5XA 3QUYB 1MNUH 3BH8B 3RUGF 5IJVA 4MCZB 4XVJH 2X1WL 3GSVA 1JGLH 4D9QD 1EK3A 1XGPA 2JK5B 4LLDA 1HHJA 4OZ4B 1U9KA 3T8XB 3HAEB 4Z7VB 1S3KH 3UC0L 3JTTA 4BFIA 1T1ZB 3CFDB 3C09C 2GY5A 3MLZH 2V5MA 4K8RD 1HN1A 4ALAL 1W72H 4KTEH 3BHBA 4XZUB 3RBGA 4BKLA 1OAKH 3Q6FA 3KPLA 2YPLD 4TTDC 4U6HA 4ZQKB 1T04B 4YDIH 4HBCH 1UCBH 1TZHA 1JZ6A 4QCIA 2AI0H 2WAHA 5HDBE 2W0PA 4LAJH 1QLRB 3EDDA 5C0JB 2IADA 4ELKB 3D9AH 1EEYA 5KSBE 3T0AA 5HGHA 3GK8H 4J23A 1JFQL 4OCYH 3HMXA 2FJGA 2OTUA 3BN3B 3MQIA 4WUUB 3D6GA 1U8IA 4J12A 5HI5C 4K23L 3L6FB 5C0NC 4NDMA 2W59A 2WQRA 3HUJA 2RCSH 1H3GA 4U4BA 1MUJA 4U6VH 3HG1A 1MLBB 1A4JB 4RGNE 1JHKL 1S8DB 1ZHNA 4N9GA 5HYFA 1J12A 1NBVL 3SE4C 4XP1H 2R15A 3LEVL 1C7TA 2DAVA 4UUJB 1RIVH 4G7YH 4HDIB 8FABB 5JLZA 4ZS7H 2NXYD 3HC4H 4ELMF 3UYOD 2UWEF 1UQSB 2HN7A 3G04A 5F9WC 2HTKC 3UYRL 2PTTA 5ICYA 1C8PA 2VLJD 5DVMA 4F15C 1JP5A 4FQXB 1ONQA 3TVMB 2VKWA 5IB3B 4P2RD 2ZKHL 3CUPA 1KYOJ 1CD8A 5DRNB 2I60L 1U3HD 5FA3A 3OB8A 4L4TD 5D1ZC 1JWSA 3ARWA 4JHZA 3QIBB 2P5EA 4AL8L 2HT2C 1IC5L 4ZFOB 4KAQL 5IMMA 2VMFA 4CVUA 3SQOH 2DRUA 2DLGA 1U8KB 4B53A 4DCQB 1B90A 5HI4D 3MJ7A 4QHMA 5BV7H 3EOBB 3CCHB 2Q86B 2FX9H 3QDHA 4AEIH 2VO5A 2Q87A 5HXMA 5BOPA 4C56D 2ICWA 5DEGA 1IEBB 5EBGA 3H9SB 4DEPB 4Z6AT 2PXYA 2R9HC 4PGZA 4FFZH 5IMKB 3KWWA 4WFHD 5L2KB 5T3XH 3U82B 1DUZB 2CRIA 4F37F 1OWWA 4U2ZA 1SMAA 5D1QA 3MLSH 4ONGH 1YQ2A 4XNXL 5F93C 3LY6A 5BXFA 5D2NA 4OLYL 1A7RL 1MCWW 1BZ7A 5CBAB 2VZUA 2EDWA 5CEZE 1MQKH 4ZUUA 4GKZB 3SCMB 3IKCB 9CGTA 3C08H 4PGCA 3TT1L 3CU7A 3IT8D 1P2CA 3O6LL 4O2FB 1EPFA 4PJCB 3BW9A 4NKIL 4CVXA 3QZWG 4WW1A 2G9HA 1IGCL 5J4MA 4HIIA 3WIHL 1KLFA 2UYLA 3JVGC 4KJPD 2DBLL 1CLOH 5GJSL 4N0FA 1T20A 4ODBD 4IOIB 3U0PB 5ALBH 3QQ3B 3RAJH 3VD3A 1PW3A 3SGJA 2X4UA 3D0VB 5D93B 4KRMB 5C9JA 3X14B 1X5FA 1KJMA 1NAMA 5I1HL 4Z9KB 4NBZB 5C6TL 1K4CA 4TYUA 1Z9OA 3D85B 1KTLB 3ARGD 5F7UA 1XGUB 2PNDA 4E42B 1CICC 1JE6A 2EDLA 5HYIA 1A6AB 3AM8C 2VC2H 2BNRD 5BS0A 1JZ3A 1KENH 4JFDB 2A6DA 3BXNA 1TXKA 3U6RA 3U9PH 3B5TA 5EDXA 1GAFL 1OAZH 4HCRH 1RZFL 2WW8A 1QRNE 1D5BA 4JQIH 3UBXB 1BD2B 4JZNB 4ODUB 5FYJL 5DD6B 3WDHA 2DYPA 2ZCLH 3OR6A 1RFDL 3SDDD 1T7VA 4U0RB 4QYOA 4G6JH 3HUJF 2OS7A 1TJIH 3T0EC 2N1KA 4NO5B 2VDRL 4JRXD 1IKNC 3OG4B 4XBGB 3FL7A 4YHPA 4F2MA 2ATPA 4Y19B 1KCSH 4BQCA 5IBUG 3F65A 4U1NB 4DFHA 2AJ3A 5AZEL 5BVJA 1R3JA 4YHKH 1WC7A 4P46A 4WHTA 4FABH 2GTWA 4EXKA 4ZYKA 1EBAA 2XQBL 3ZKMD 2DTMH 4PY8J 1TJGH 2I24N 3WEXA 2V2XA 4L9DA 2Y72A 1D5ZB 4HGWB 1INQA 2HT4D 3MR9B 5JOFB 4U2YA 3HE7A 4BFEA 4I0PD 3DUHA 5JHDA 3AS1A 3NBNA 3UTZB 5CP3A 2WK2A 2IPUK 5D7KE 1QZ1A 1HXMB 1J0ZA 1ZHKB 4BQ6A 1EIBA 3U4BH 4AJ0A 3LEYH 5GS0C 2HWZL 3SY0B 1F42A 4K7FB 3QG6B 2HT3D 5EU6D 4D0BB 1RZGA 4XPBH 1FHGA 2R1WB 1E28A 1PZUB 1P9MC 4PJ9D 4UV7H 4OQ1A 1FNLA 5C0RH 3GGWA 3BQUD 3OAYK 4PGBB 3VXOB 2CUHA 2NX5D 2DQUH 5CLWA 5DK0A 2F8VA 1BZ9A 4POZC 4DGVH 5F44A 4OF6A 2N56A 3QPQC 5I76B 1BECA 1F3JB 1JUFB 1JNLH 2CDGB 1TPXC 4HIJA 3T0BA 5EUOE 2R2HB 2ZUSA 4C55A 2FEDC 5EC2A 3N50A 1K3IA 1ZGLB 3BZEB 3HLAB 4F7CA 5DUBA 1X5IA 4NCC1 3DV4B 2VZ1A 3HA0A 3CZFA 1U92A 4NNYB 1FAIL 3MV9B 3EYQD 1IBGH 2X4NB 3SO3B 5CKGA 1CE6A 3WKNA 3PWPA 1XT5A 4R97B 5HBBA 3HAEG 5GGUB 3TC9A 4R90H 4Z95L 5CSZB 3WS3B 3GSRB 4X6FA 4IJ3B 4YDVB 4K8RH 1DDHB 4EN3D 3BKJH 4F7MB 4I3SL 4QT5A 4BSJA 3BKMH 1U42A 1OVZA 3ALPA 3GMPB 1I1AC 4DUVA 4Z18A 5IEHA 3QXAB 4J6RH 4L9LA 3DUSB 3NTCL 2DLIA 5F9JA 3QT2A 3WNLA 4YAQA 1H3WM 4NUGL 4XPGL 5D96C 2XN9A 4OCMC 1IT9L 2BZDA 7FABL 4UB0L 3DMMA 1S9XA 5C92A 3A67L 1FRGL 1QSFD 4G8IB 4ODHL 4WEBL 4GQPH 1CXHA 1PY4A 1XF3B 4NKOB 2F53D 4EDXB 5B3JF 3O8XA 4WI8A 4BH8A 2JJWA 4P59L 2XKNB 2AK4A 3TCXA 3LOWA 3KVQA 5IG7A 4WRLA 3P0YH 3BVNA 1YQVL 2YUZA 4OKVB 3DIFA 4S11A 5IWLC 1BBDH 1MNUL 1RPQA 4JDZA 1A9EB 3LQZB 1JZ8A 3HC0B 4XVJL 3QI9D 3BYYA 1JGLL 2O61A 4BSVA 3OAYH 4PR5B 4Y4HB 4JFED 1XR8A 1S3KL 2APFA 3EHBD 3ZMRA 4PRBB 1UA6H 3MLZL 4G5ZH 1W72L 2IGFH 4KTEL 3K8MA 1NCDH 4JN1H 3KYMB 1OAKL 5JW5A 4QEGA 4U1JB 4YDIL 3MLXH 1BIIB 1HCFX 4Y5YA 2E7LA 4QRSB 3AREC 4PTTB 2AI0L 4APQA 2ZSWA 1U58B 3D9AL 4OFKA 3GK8L 2X4OA 4OCYL 4WI5A 1QLFB 3OKKB 5F96H 1DUYA 3U1SL 4MXVE 2YBRB 1F4YH 4NO0A 5IHLB 4TUKH 5JQ6H 2RCSL 4NPYA 5JO5B 4U6VL 5JW4R 3JWDH 1W0VB 1GXEA 1RK0A 1M7XA 2JJTC 4XP1L 1IJ9A 1IGTB 1VGKB 1GPOH 2NW3A 1RIVL 3CXHK 2NXYB 4G7YL 4QXTB 4M61B 3QUZD 3HC4L 2C5DC 4IRSC 4YXLL 4KK6C 3MRBA 1ZLVK 5GSRB 1B0WA 3QFDB 1OOAA 4PV8B 1UH3A 4HK0B 5D6DC 2J3SA 4M62H 2HMIC 1U3HB 4L4TB 2MOVA 3IB4A 4N0UA 2RFXA 2IANE 1JZ7A 5E6ID 4QXUH 3ARPA 3FOLB 4HUVA 3DVIA 3PP4H 4RA0C 4U1IA 1LEGA 3ARRA 3N1GC 4RGOH 5C07B 4P5TD 2WUCH 1FDLH 3SQOL 5L9DH 4NM4H 4B7IA 4MD4B 1QLEH 4OCXH 1F45A 5BV7L 4PRAA 5SWSE 4M43H 1HH6B 3PQYD 3SO5A 4FQJH 2JCCE 5GJTH 4NZTH 2X4PA 4AEIL 2DQGL 1IAIM 1MJUH 1QTYT 1KEMH 4C56B 4KZDH 1KN2H 3ZE1E 2CLRB 4G8EA 4PJ8D 3D3VD 5D7JB 1XEDA 4KJYA 4FFZL 2IEPA 3F7PC 5GZOD 2GCYA 5T3XL 2ARJQ 4P3WA 4A6YB 3D2UA 3MLSL 4NOBA 4ONGL 3S36X 3MRDB 4UI2A 4GAGH 4G80A 3C5SB 3PG2A 3T3PF 1AR2A 3UBXG 3FHAA 5JW3L 3PL6A 4OJFL 2D7PA 2HKHH 3QFJD 4L4VA 1MQKL 1KNOA 3C08L 1UZ6F 3RGHA 3U0TA 3GEWB 3CLFH 1FYTE 1Q9KA 1M05B 4M8VA 4X6EA 4Y1AD 4Y4FC 4UQ2B 3FQTB 4DVBA 4PRPD 3S3JA 2D4DA 5BMFH 3MRFA 3OJ2C 3EO9H 5D7SH 4UT6L 3SE4A 1DLHB 2RHEA 3RWFA 4FHBD 2WSKA 5F97E 4LCYA 4RAUA 1CLOL 4J1UA 3PWVA 4FXLA 3VWKB 5ALBL 2OP4L 3RAJL 3LPFA 1TVBA 4R6UA 1ZLVH 4GRWE 5DD0H 1TQBB 3KAAA 2NLJA 1NMAH 4MNQA 4P9MH 3ZL4H 3MRPA 5D1ZA 3SJVD 4KK8C 4XBPA 1MVUA 1TCRB 2VOTA 2GSGB 2VC2L 2GY7B 4LLQA 5BW7C 5F71A 1KENL 2NY0D 1QA9B 2LTQB 5J1TC 5C0BB 3ARZA 1DCLA 3U9PL 1M7IB 1NCWL 1OAZL 4HCRL 5C0EA 4X9HA 1ZXQA 1PQZB 4H1LH 4JQIL 4ZXBD 5LXGH 3F6IA 3QUYC 4PJFF 1ACZA 1AGEB 2YUXA 3OBAA 1XF2B 3FO2A 1HCVA 3H9HB 5HHME 2ZCLL 3AC0A 3SDDB 5FDWA 1A1OA 1R3HA 4G6JL 2ZCKH 3O4LD 3KPRB 5SX4I 3I02A 1AQDA 1KPVB 1VACA 4FQHA 1KJ2A 5E8EA 1KCSL 4LMQI 3LZFH 1HNGA 3P4MA 5SWQA 1NC4D 3C5JB 4J3OC 4I5BB 4QHNA 1IE5A 4YHKL 4LCIH 5C1MB 1WV7T 4FABL 3NCYP 2V7HA 3O45A 1PY9A 1T66D 3OZ9H 3V5DA 5I0ZA 3IYLW 3HZMA 1TJGL 3EOYG 3LAFA 2A83A 3KPOB 2B39A 2YOCA 4TVPE 5HHOB 3FAWA 3VXUA 1C1EH 1BZQK 3RWDB 8CGTA 3OJDA 3HE6B 4JM2D 2H9GB 3JVGA 4K9EC 1I4FB 3STLA 4NQDA 1T2QH 5C8JA 3L3JA 2EC8A 3HB3D 3QHFH 1NCNA 3H9ZA 3LEYL 5EU6B 2P8PA 3CFEB 5BRZE 2XTJE 4XPBL 3MV01 1O5DT 2KQNA 4HHAB 3LRSA 4N0YH 4NKDA 4UV7L 5C0RL 4PJHA 5D2NE 3UPAA 3O3AB 5DJXA 4R4BA 4MJID 2NX5B 3LSOB 1CICA 4OGXH 1HDMA 2DQUL 2MTPA 4E41A 3UAJD 4FQXC 4CU6A 3S5LB 3AM8A 1DJSA 4DGVL 1EHLH 3CFBA 4BK4A 1ORQA 3NCCB 4J3VA 4EXPX 5A2IH 4KRNA 4NQEB 3QIBC 1JNLL 1KIPB 1GGIH 3W2DH 2FYYB 3EZJB 3S36H 5CZXD 5FO8A 5EC1A 4P4RB 3QA3A 4QOKB 5C9KA 4NQCE 4GG8B 3JTSB 3OG6B 4WUKH 4Z7WB 2HYMA 5B38B 5CIPH 3T0EA 3TH2T 5LGJB 3NIFF 4XX1G 1IKNA 1IBGL 2QKIB 2JIXD 2ZUUA 3TPUB 4R90L 1KGCE 4Z7UA 4PP2B 5GGRB 3HI1B 4EN3B 3LKQA 4K8RL 4DEPC 1S7TB 2XTLA 3BKML 1RUQH 2X4QA 4NO3A 1FL6A 1I9RH 2W9DH 4J6RL 3RVWC 3S4SB 4P2OD 1JRHH 1YEJH 1CDHA 1B6UA 3MRNB 4QRTA 3FFCE 1RUPH 4OQTH 3CX5J 4LLVA 4NRYB 4CN6A 1DQJA 1KCLA 2EDEA 5DQ9A 3BUYA 3V7AE 1QSFB 3SCMC 5HJ3B 5IHZA 4QRQB 5SWZD 2ICWJ 3FQNB 4ZUSB 3ILQD 1MOEA 3MRKA 4OQTA 4GXUN 4U05A 4IS6A 4F9LC 1U8PB 2FD6H 3B9AA 1A47A 3P0YL 3WFHA 5C2UB 2UUDK 4XAWH 1BBDL 1XZ0A 1P9MA 1JI1A 1E6OH 3QI9B 3IDGB 5IMOB 1FL3A 2H2SD 4U33A 5D93C 4JDTL 3C6SA 2R29H 3VFVB 2EXYC 4JFEB 4MHHG 1VESA 5TF0A 5EIVA 4JFQB 1G0DA 1BM3H 3R8BB 2BRRH 3MV8A 2XPGB 1C12B 4FA8A 4HKJB 3U0WH 2C26A 3MA9H 5JA8B 1P1ZB 1UA6L 4G5ZL 3PDOB 5GIRA 4LSQH 3DXAE 2DB8A 2IGFL 4NT6A 5EN2B 1NCDL 4JN1L 5JHDE 1U36A 5L6YH 5EOCH 2BVTA 1A6TB 3MLXL 5HGBA 3OSKA 5CEXA 1NCCH 1T1YA 3PJSA 3GM0A 3HNVH 2FL5B 2WQ8A 1I8KA 2ADJB 5E4EB 5FV2A 4OB5H 3BP4B 4Z5RB 3UTTA 5DJZA 3RDTC 3GSUA 3ZE2F 1E4XI 1F4YL 3D0LA 1QEWB 4TUKL 5JQ6L 1I1AA 4NSKA 4G9FE 1KC5H 4YH6A 1CGYA 4PGDA 1WZ1H 4R7DA 3RX8A 3RNQA 4PJHF 1GPOL 4OD1H 3EJZC 5E8PA 3QUZB 3DSNA 4U7KA 1IEHA 4YGVA 1NEUA 3O11B 3TPKA 2E9JA 1ZLUK 2NY1D 5AAWA 5IJKC 1T3FB 4QHUA 2YD9A 3VD7A 3FT3B 3VXQA 1MHEB 1NCAH 4M62L 5E6IB 2D7TH 3TGXA 4I8DA 4QXUL 5KJRL 2BVOA 1ZMYA 3PP4L 3IAQA 3KLAB 3SKNB 4KXZI 1G7QB 2OR8A 5D7IA 5HYQA 3UTSA 4YHZH 4P5TB 5IWLA 2Q7YA 5HI3D 4XNMB 2WUCL 1JHTB 2UUDH 1FDLL 4YFEA 2MWCA 1DLFH 5L9DL 4NM4L 1JPTH 1NGWA 3BRFA 1C5BH 1QLEL 4OCXL 4JY6B 4M43L 1J8HD 2ICEB 4FQJL 4Z7UF 5GJTL 4NZTL 5H2BB 4JFHE 3VXPA 1MJUL 5I1LA 1KEML 1IEAA 4WVRA 2VN4A 4KZDL 1KN2L 5CBEA 4RDQF 1NKOA 1UJ3B 4UILH 2R4RH 3T4AA 2DQFA 1FC2D 1DANT 5FKPB 4JPVH 2PYED 5L8JB 5EWIH 3GIVB 3AREA 1S7QA 3QP3A 4M3JA 4U49A 1I7UB 5L7XH 2B4CH 5CGMA 5CUSH 2AK4E 3R0NA 5TE4H 4H0GA 4GAGL 5K93A 3TNNB 2XXMB 1U8LA 3WJJC 5T1MA 3GHEL 1U8HB 5CCKH 5C0DA 4KROD 3QZWA 5FXCH 3CLFL 4R97C 4Y1AB 3N1QC 4PJAA 5CD5D 4IJ3C 1X7QA 1T5WA 3PGDA 5E6YA 5BMFL 3U2SA 4NQVA 3EO9L 2CDFB 5D7SL 4W6YB 1JNNH 1BBJA 2JJTA 1G7IA 3VRLF 4HWUA 3SDAD 5IVOA 1BJ1J 1WVZA 5DI8A 2MKWA 1EERB 2UZYB 3IJHA 3S3PA 4OV6F 1CXLA 4NHUA 4IRSA 3IFLH 1EAPB 2APWA 1I9JH 1BGXH 1MREH 3TO4C 4PG9A 1MFEH 1RJCA 4KKCD 4WV1B 4MZ2A 1ZLUH 1SMOA 2D31A 5E2WH 5DD0L 2F58H 3L1OL 5D6DA 1UWXK 1MCFA 1NMAL 3W0WE 2I9TB 1LEKB 4XCNA 1OGAE 4P9ML 4MGXA 3SJVB 3ZL4L 4XC1H 1JPGB 3ZKQD 5HYJE 1YN7B 2KPNA 6CGTA 3FQWA 4FTVA 2NY0B 5E1HB 15C8H 1KB9K 2A1WH 5D8JH 3RRQA 4OFYA 3DV6A 4X0KA 4UV4H 3P9MB 4OUUB 3VXRA 1P6FA 3GO1H 3BZFB 1A2YA 4ZXBB 5LXGL 1N0LA 3RWJA 3KJ6H 2Q3AA 2AJVH 2ZCKL 3ARYA 4Y4HC 3EYUH 3QO0B 3S5LG 1OTSD 1G9MC 1YEHH 3SGDH 1G6RB 2KKQA 4K3DH 1OP9A 3LZFL 1YUHB 4BK5A 3MXWH 1R6VA 3LKRB 3QDMB 3F62A 4KKLC 4RMUA 1U93A 4LCIL 4M6OH 1HKFA 1HEZA 1GL4B 3AROA 4LLUB 5H37H 2VZ3A 3OZ9L 4PV9A 4UU9A 1RZJH 3RQ3A 3GMOA 4OD2A 1HWHB 4BFBD 5B38G 1KJVA 4NN5C 2YPKB 1LDPH 2A9MH 4UTBH 2EDRA 4Y4FA 5D7IF 1V05A 5FIEA 1C1EL 4XRCA 4JM2B 4DUWA 1G1CA 3F12A 4S1DC 1VB9A 5E5RB 3VCLB 4QTIH 3V6FA 2AKRA 3QHFL 4UIMB 2VDOH 2FHCA 3EZ8A 1AKJB 3S4SG 3FCTA 1TZIA 1WEJH 2NXYC 1HINH 2ZG1A 1NANI 4N0YL 4NUJB 4HWBH 4CW1B 3D25B 4MJIB 1VEPA 5JTWA 1UWXH 3RA7H 3VG0H 4OGXL 1Q9WB 5J6GA 3I50L 4H8WH 1UZ8A 5DUPH 3TZVD 5BW7A 1EHLL 1A22B 3HR5A 2YWYA 4ZSOB 1JBJA 1RHHB 3W11C 1ZSDA 3V2AR 1GGIL 4HWBA 4XPAH 3W2DL 1QPPA 3QUYA 4PJXB 4M8QB 3ORJA 4RX4D 3S36L 2VDNH 1ORSA 2AJZA 5HHPB 4XCFH 2OL3B 5I18H 4TSCL 3RZCB 2D7QA 2BJMH 1BVLB 4WUKL 5GHWH 3S6CA 1KIRB 4Z7QF 4KI5D 3EYSH 3T8XA 1ODAA 3HAEA 4Z7VA 4JCLA 2EKJA 4BUGA 3QUMH 2JIXB 1T1ZA 3ZDXF 1MAMH 4G6AD 4WTZG 2JELH 2HLAB 2EDNA 3GMRB 4PJ7F 4HZAA 4XZUA 4NRXA 4EVNB 5D7JC 4ZQKA 1RUQL 1T04A 4MJ5B 5H8DA 1DEEB 4M93C 2MCPH 1I9RL 1ZK9A 2W9DL 1JRHL 1YEJL 1QLRA 3WXVH 5C0JA 4DZBB 2GJZB 4ELKA 1KTDB 1RUPL 4OQTL 4IBLT 4XH2B 3X17A 5F1OB 3MUHL 1IAIH 5ESAA 3SDCD 4X7TB 4JCMA 5SWZB 4X7FC 3L6FA 5E00B 1AD9A 3RVUC 4LK4A 1MLBA 4CN1A 3VD5A 1S8DA 4QRRE 1EMTH 3VXMB 4PRNB 2DQCH 2ESVD 2FD6L 2H2PD 4UUJA 3OGOE 1CDJA 8FABA 2LVCA 4XAWL 2MHAB 1IGMH 3B9DA 3VWKC 2CXKA 2DN7A 2VLRD 5TQ0H 4AYFA 3MLUH 1E6OL 1UQSA 5HDLA 3L3IA 5F88A 1A7BA 2CSPA 4ORGB 2F5BH 5DRZB 5JXEC 2R29L 3L3DA 2YWZA 4FQXA 4FQLH 3ARFD 4R96B 1TQBC 1BM3L 1EX0A 2BRRL 5DRNA 2GK0B 1HQ4B 3FO9B 1JK8B 3EDFA 3U0WL 3QIBA 4Y16B 4XCEA 3VXUE 1A7OH 4LSQL 2BNUB 5IQ9B 4ZFOA 2ICWI 2OBGA 5DT1H 3BP5B 4Z8FH 2LTQC 1LP9B 5L6YL 5EU7E 5EOCL 4DCQA 4GSDH 3X12B 2DL2A 2FX7H 4XWGH 4IMKC 2CQVA 3K1KC 4EDWH 1FORH 4W81A 1QFPA 3EOBA 1U0QA 3HNVL 2Q86A 3C5ZD 1YJDC 4G8GA 2F19H 5TF1H 3ZLQC 4JPWL 5C0FA 4OB5L 5BJTB 1DBBH 1CLCA 2GKIA 1IEBA 1A64A 4D2NA 1L9NA 3H9SA 3BO8A 1G7MB 2FIRT 3K4DA 4E41E 3V0VB 4ZO9A 2R0KL 2A77H 5GISH 3MFFA 1DUZA 1WWCA 2F54D 3ULUH 5F21B 1KC5L 1G0XA 2GJ6E 1WBYB 1WZ1L 3WLBB 4OD1L 4RMTA 5CBAA 5DMGD 2ADFH 4GKZA 1IARB 4E0RA 3SCMA 2Z35B 3IKCA 4G6FD 5JIHA 2YZ8A 4PJBF 4O2FA 5HHNB 4PJCA 3UDWC 1NCAL 4PJEB 2D7TL 4C58B 1BLNB 1MCQA 2GITB 5IMLB 3HE6C 1FCCA 4UNTA 4JVWA 4F9LA 5AWNH 1FG9C 2FWOB 4YHZL 3RWIB 3BDYH 2XZAH 4HULB 3G5XB 3OTTA 4IOIA 2NY5H 1M6OB 4NCC2 5A3ID 3U0PA 1DLFL 3DBXB 2HT3C 3D0VA 5CJQH 1JHLH 3TBYB 3X14A 1C5BL 3C6LD 1J8HB 3QXTA 1C5CL 3RU8H 1J1XH 3QHZH 2XWJA 3D85A 4FZEL 5IB4A 1KTLA 1XGUA 4YZFF 5D2LE 3CFJB 3OKLA 5D7LD 4E42A 5I66B 4OV5B 4HFUL 1AD0B 1BFTA 3CSYB 4UILL 2R4RL 3VI4E 2PYEB 4HH8A 1WAAA 4JPVL 4HKBB 5EWIL 3ZTJH 3DROA 3BISA 4X99A 2VDPH 5L7XL 4KC3B 1BD2A 2B4CL 4JZNA 4ODUA 5CUSL 5TE4L 5DD6A 1J0HA 4H0IA 1CTNA 2HAZA 4YIQA 2CIKA 2X09A 5KSBB 3ROLB 3MOBL 4UDTB 1KLGA 3ZZ1A 4Y8AA 4NO5A 5CCKL 3PGFL 2V17H 4WY7L 3RDTA 3UZVB 1AH1A 4XBGA 3MUY1 2C3GA 4XNQB 2HH0H 5ESVB 1VFBB 3B9KD 4WFGE 2DJ4A 1AI1H 4U1NA 3S9DB 3L7EB 2XIDA 3WYRA 1KLUB 4PPTA 4HX1B 4KDWA 5D5ME 5DFVD 2EDOA 4RWYH 2UY7A 1KG0B 3IFLL 1QFWL 1I9JL 1ITCA 5CGTA 1BGXL 2IH1A 1MFEL 4UQ3B 4GOSA 3VFRA 4M6MH 5E2WL 2F58L 6FABL 4HGWA 3KYOB 4EUPH 4XC1L 4OI7A 2BNQE 3LV3A 3AUVA 4CN4A 5IW1B 1DBAH 4MAYB 3UTZA 2AQ2A 2A1WL 1VHPA 5E2JA 5D8JL 3DUUA 1EEUA 1HXMA 3DI3B 1NGZB 4UV4L 3DX9A 2EYTB 3SY0A 4K7FA 3GO1L 3QG6A 1QACA 4D0BA 3S34H 1PX4A 3QQ4B 1T6VN 3RY5A 4QKXB 3QI9C 5DJ2A 4PGBA 3VXOA 1MCSA 1FNAA 1BEYL 4F9PC 4KRLB 3G6AB 4LVHC 3CDGB 3EYUL 1QR1B 3FN0H 4KK9C 1J88A 5MHSE 3MREA 3T09A 4WJ5B 5I76A 1F3JA 2CIIB 1YEHL 4YBQC 1KT2B 1QHPA 2X42A 4K3DL 32C2B 4DGYH 5CSGA 3WLWC 2OR7A 2R2HA 3MXWL 1ZGLA 3HLAA 4M6OL 4OIAA 3WJJA 3ULUF 3DV4A 4NC1E 3MV9A 4PD4J 1RZJL 1NGYA 5DHVH 5E4EC 4LPTA 3CH1B 4B5EA 2ZUYA 4XAKE 5CSZA 1LDPL 1YY9D 2A9ML 1INEH 4UTBL 3WS3A 4TNWK 3IDNB 3P9WB 3WBDA 1SYVB 2JB5H 1HZHH 4F7MA 1Z6JT 2YK1H 4J3UA 2IAMC 3QPXH 2Y5EA 4P5MB 4HEPG 1JGEB 4J8RB 4QTIL 4RCAA 2JB6B 4CUCA 3DUSA 4JFFE 3WHXB 1QQDB 5J7CC 5DHVA 5T5FL 2VDOL 1MCBA 1XR9A 3C60D 5EB9A 2AAVA 4B7LA 2OR9H 1A6ZB 5DLMH 3WIFB 4TNVK 4PP1C 1WEJL 1HINL 1UWEH 2VSCA 4DJMA 3WSQH 5C09D 4HWBL 4PGJA 1FFOA 3LKOB 4HWZB 3HN3A 4Q9RH 3N9GH 4G8IA 1CD1A 1MIEH 3RA7L 3VG0L 1WAAF 4H8WL 1TETH 5DUPL 3MRJB 1XF3A 4NKOA 1OTUD 3TBTB 2C7UB 2XKNA 4PJAE 4WU5A 4MVBD 4P49A 4XPAL 4OKVA 3V4UH 5EBWB 2VDNL 4XCFL 3LQZA 3QHTC 5I18L 3HC0A 1FGNH 5I8CA 3ZDZE 2BJML 4P23D 4HWEH 2FGWH 4NQTA 5GHWL 4PR5A 2JJVA 4Y4HA 3EYSL 4MWFB 2IBGA 4X8JA 3QUML 1MVFA 3NIGE 4PRBA 1MAML 1WIPA 5MP6H 4PLKD 3VDCA 2JELL 2X1QA 2YRZA 4GRLD 4FP8H 4OM1H 5JZ7C 5EZOH 4HUUB 1NBZB 1BIIA 2G2RB 4QRSA 2MCPL 4PTTA 2DD8H 2ZOLB 4RAVB 1G7JA 3VJ6B 3WXVL 3GI9H 3VXRE 4PJIB 1U58A 4HJ0C 4I3GA 5FYJE 4V1DB 4LGSB 4S2SB 4M6AA 3SDCB 1IAIL 1QLFA 3OKKA 3KNBA 5ISZD 2OJZL 1FG2B 2YBRA 4BH7B 5KSVB 4MLSA 4U1HB 4I2XE 4XXDB 2EE6A 4XMPH 1EMTL 2H32H 1EHAA 4GMTH 1GHFH 1OHQA 2EZ0D 4U31A 2VWEE 4Y2DD 2DQCL 3VWJD 1IGTA 1VGKA 1MFNA 5HYEA 2GUOB 2Y5TB 2EIEA 4R3SB 1ZT7B 1I1YB 4QXTA 2VLRB 3MROB 5TQ0L 5J12B 2P7TB 3MLUL 1MCRA 4LLWB 3TCLA 2F5BL 4OBSA 1NGXA 4FNLL 1FP5A 2V9RA 3ARFB 3PUCA 4PV8A 2VQUA 3HZYB 4OLZH 4QO1A 5HHVH 1SJEB 3PGCB 2F8XC 5IB1A 3FOLA 4MD5B 4D0CA 2GYSA 2X89A 4YPJA 5MEND 1A7OL 2NY0C 3F58H 5DT1L 4Z8FL 5ANMB 5EUOB 5C07A 1JMXA 1HI6B 3SDYH 3T04D 5C0CD 4GSDL 3DHJA 1G7LA 2FX7L 4XWGL 3EIFA 1LILA 4EDWL 1FORL 4P5KB 1HOCB 1HH6A 5DMKA 5E99H 2BK8A 3T77B 2NW2B 4WO4D 5FYLH 5BVPH 4U3HA 5D72L 2W0FB 4P2QD 2F19L 5IV2B 1RZKC 4C56A 4OZIE 1YECH 1DBBL 4ZO8A 2CKBH 1RJLB 4JKPH 2CLRA 5D7JA 4OM0H 2A77L 4G43A 3T4YB 3KXFD 5GISL 4EQ3A 4M1DH 5IHBA 1U8OA 4A6YA 4AM0B 4NC0B 3ULUL 3RY6C 3EOAB 1FNSH 2CKBA 3C5SA 2VE6A 3ULVC 2ADFL 4QY8B 1JI2A 2MQ3A 1FL5B 1SY6L 1XMWA 1R5IB 2NTFA 4GKSB 1DVFC 4O2CB 3VE0A 5TDPA 3SHSA 4H26B 3BYTA 4Q7DA 1LNUB 5CHNA 3TFKC 4YDLB 1SVZA 1F4AA 4Z7VE 3FT4B 4U3CA 4UQ2A 3FQTA 3G5VA 4GUPA 3KPSD 4EIZC 1XH3B 1CYGA 5AWNL 4KDVA 3R8QA 1J18A 3LEXB 4Y4KB 3UO1L 3BDYL 5CILH 3VWKA 2XZAL 2NY5L 1KXQE 5TJWK 3UPRB 4LCWE 5J3HD 5DEZA 5CJQL 2OCFD 1JHLL 3C6LB 3HRZB 2I9LB 5JXEA 4P4KD 1EGJA 3RU8L 3U9UB 1J1XL 3BD4A 3QHZL 2X10A 1LO0H 3BMVA 5D7LB 5TH2B 1UENA 1AFVH 4O5LH 2VZSA 2IQ9H 1MJJB 3L3OB 4WUUE 5CJXC 2GSGA 3R4DA 4K3HA 1CT8A 1QA9A 2RR3A 2AERT 5C0BA 1M7IA 2GTZA 1RSFA 4CRPA 4E9LA 4IMKA 2HFEB 2VDPL 5DFWH 1PQZA 3VGDA 3WNKA 1NGQH 1XF2A 3H9HA 4N8PA 3I3BA 3RZCC 3ZKND 1KPRB 3KPRA 3TIDB 2V17L 4OAWB 3FMGL 3ULSB 1AXIB 4JFOB 2HVJA 5IK3B 5E9DA 2HH0L 3QNZB 2VZVA 4ZUWB 5DO2D 5FUCC 1AI1L 4RBPK 4TNWF 4I5BA 2J8OA 3GZKA 1A5FH 3CPLB 3TJHD 4HWNA 5I6XC 5J0BA 5FA4B 3MNWB 3STBA 2DQDH 3ARTA 4RWYL 2CH8A 4N90E 2UV3A 5E0QA 5F7WC 5LGHH 4PS4H 1IGYB 3WJLC 2WBJD 1RMFH 2X7LB 4ZFZB 4M6ML 3NCYS 4LKCB 3UDWA 1MRDH 5HHOA 4NQSB 3RWDA 3DX7A 4YEFA 1OT1A 3HE6A 4OD3H 2ADIB 2H9GA 1KSRA 1DBAL 3H9SE 1I4FA 4P57A 1JV5B 3M07A 1A4KA 2WMPA 5L2KE 4L3EA 2JE8A 3CFEA 3H3BC 1J9CT 2GSIB 1PSKH 3S34L 3VA6A 3P11L 5SWSB 1NGPH 2J12B 2JCCB 3ZSTA 2NX5A 2B5IC 3LSOA 5E03A 3L5IA 4RWHA 3VGHA 3RTQD 3S5LA 4K94C 2AGJH 3I84A 2J88H 3P30H 3QIUB 4N5ED 4GKNB 2EIZB 3MJGX 4PJCE 4NQEA 4Y16C 1KIPA 4DGYL 4K2UH 2FYYA 3GSWB 3X13B 2DWDB 4U6YB 4O51A 4QOKA 1MJ8L 3KPMB 1WZKA 1FNGB 4GG8A 1FNHA 3JTSA 4KKBD 2SEBB 4HLZH 1RQ5A 5LGJA 2P8LB 2WIIB 3ARBD 1I7TB 1T7WA 3D48R 3BH9B 1FYTB 3MA7B 5CS7A 3VFOB 4WEUD 3EOTH 1INEL 3GSQA 1MF2H 3KS0J 4PRHD 5F6HI 5GGRA 4GW1B 4AIXA 3V4VH 1S7TA 1HZHL 1F13A 2YK1L 3WDIA 4OF3A 4RBPH 3BP6A 3V9FA 3QPXL 1CXFA 2DS4A 3HHRB 4JFDE 4MDJB 3S4SA 3MRNA 4OGAD 3C60B 3WD5H 1G7PB 2OR9L 4D9LL 1KXVC 5DLML 1E4JA 1GOHA 4NRYA 3GMLB 3WSQL 4GRWB 1QSFA 5HJ3A 3JXAA 4Q9RL 3MLRH 3N9GL 2L4OA 3FQNA 4YGAB 1NDGB 1U8QA 4R0LB 5GPRA 3BRDA 5KTEH 5ADPH 5FM8A 2E7MA 4HKZB 2BCKB 4JO1L 1ZHBB 1AXSB 2Q3ZA 3JV4A 3IFOB 4WDIA 4Y19E 2A0LD 5GRYA 1LEIB 3G6JB 2A73B 1U8PA 1A7NH 3DYOA 3MOQA 4PTUB 1G7HB 4PYHA 4X98B 3V4UL 3W9EA 5MEQA 1GZQB 3QI9A 3IDGA 1I1RA 5IMOA 1FGNL 4LSPH 3VXSA 1VCAA 5CLTA 5HPOA 5HHMB 3F5WB 3RKDD 3VFVA 4F9PA 4HWEL 4DOHB 1HYRC 3FRPG 4JFQA 1R5WB 3JUYA 1CLYH 4WTZA 4LPYA 2XPGA 1C12A 4OKDA 3C2SA 5KSAD 5DJCA 4BZ2H 4UIKH 5MP6L 1P1ZA 4GRLB 3PDOA 1N2RB 3P2TA 4V2CB 1AC6A 4FP8L 4OM1L 4YQXL 5EZOL 1MWAH 2BVQB 1IM3A 5ID1B 1A6TA 4X9FA 4FQQA 4YNYB 3RI5K 3VXNB 1ZKAA 2DD8L 2ZG2A 4KHTH 3GI9L 2FL5A 1CVRA 1RUKH 1H8NA 2ADJA 1ZGLP 1EO7A 2YD6A 4GAJH 3B3IB 2G5BB 4Z5RA 5ISZB 2EE9A 2D3VA 1S5IH 5AEAA 4X6CE 3IF1B 3OX8B 1UB6B 4JGUA 1C16B 1QEWA 1A14H 4M9PA 3H0TB 4XMPL 4Z77B 3M1BB 4GMTL 1GHFL 4Y2DB 1BFVH 4ZO7A 2R0LH 2DF3A 2YHGA 1AR1D 2HJKB 2DMBA 3QUZA 3BAEH 1Q9OB 3QJHB 3O11A 4OGYL 1T3FA 5IBLD 4OF8A 4NRZB 4QRPD 5C0AA 1G9NC 2P4AB 4RMQA 4JRWA 4I4WB 4JG1L 2O5ZH 4V2BA 2NY7H 3KLAA 1P84J 5MENB 1G7QA 2AV1B 4MAYC 3VFUB 3F58L 3CDYA 1TTGA 1PLGH 1JHTA 1R3KB 5C0CB 4OCSH 1QFHA 1IAKB 3RGVD 3SDYL 3VFNB 1U8MB 4NQCB 4GQ9H 3BMWA 4NFCA 5E99L 3WFCH 5FYLL 1ULVA 2ICEA 5ENWB 1BJMA 4P2QB 4JRYE 1AP2B 5H2BA 1EEQA 1W8OA 4U6TA 4JREB 2X1PA 1YECL 1CZ8L 5IFJB 2E27H 4JKPL 1S9YB 1DP0A 5C0IB 5FKPA 4OM0L 3KXFB 5EO1A 4MNHB 3GIVA 2DJUA 3O3EB 5LAXB 4KUCF 1O0VA 4NWTH 1I7UA 4Z76B 1YMME 2DM7A 3FFCB 1K2DB 1FNSL 3TNNA 4M7KL 4U1LA 3JV0A 5LKNA 4D9QE 4HUNB 2VLKD 1DE4B 1U8HA 5FOJA 2E9IA 3OKEA 3TF7C 3MV7D 2ERJB 1M71A 3VW3H 4Y1AA 3X3FH 5CFHA 3KPSB 4TPRH 3QCVH 3NMEA 5HHQB 3KDMA 1RAMA 5B4MC 3FO1B 2DICA 2YPLE 5CILL 4OZFB 1D5MB 3WN5C 5HVGB 5HGDA 1FNFA 1EXUA 4UZGA 1P5VA 4UNUA 1LO0L 1FIGH 1AFVL 2QQKH 2EDYA 4O5LL 5I2IB 2IQ9L 2WWKT 3AMLA 3AS3A 4KUZH 1QSEA 3UMTA 3SGEI 4PLNC 1FZMB 3DXAB 1RVFH 3UJTH 3MPCA 4XC3H 4BZYA 5ICZA 4Q2ZB 4NQUA 1ZAGA 4KKAC 3BZFA 1W0YT 1FNEB 4YXHH 3LPGA 2FSEB 1A02N 3RJDA 3GMQA 1Z0NA 3NGBB 1NGQL 1S9VB 2J8UB 3PXHA 4LPWA 3DETC 4R4ND 4M1CC 5JIKA 3EJYD 2VLJE 4DKAA 4PUBH 4JJ5B 5JW4M 4P2RE 4XNZB 1MFDL 1GOFA 1G6RA 5KS9E 4L4TE 2AQ3A 4HXBH 5T33H 4G9FB 4HG4J 3QDMA 3IDMA 5KAQG 3RY6A 4BQ8A 4JKMA 5JMOC 1JGDB 5FYKD 1F6LL 3L95B 4GAYA 2DQDL 1ZWIB 3MLVH 4JKKA 1DVFA 5LGHL 3MLWL 4PS4L 2DJSA 1RMFL 2YPKA 4QHKI 4Z7NF 1MRDL 3PABB 1N7MH 3QQ9D 4L5FH 2D7MA 4KV5E 2IFFH 4C56E 4OD3L 1S7WB 3ESVF 2Y6SC 2P5WA 4UBDC 3VCLA 1T80A 4GXVH 4WFHE 3BPOC 4YDJB 4U6XB 2H2PC 1AKJA 2KDGA 2BVPB 3O2DA 1GH7A 4HC1L 1FV1B 1PSKL 1WWBX 1QYGH 4CW1A 5J12C 3D25A 2NXZD 1NGPL 4MJIA 1I3GH 3RTQB 3IU3B 4TSBH 3QEQA 3U4EB 3OGCA 5CJXA 1BOYA 4I48B 3DARA 4MQ7B 2AGJL 1A6VH 3QXDB 3P30L 2R69H 5ETUB 1YNTB 5C0GB 2P49B 1RHHA 3ZHLA 2BHUA 5D70H 4K2UL 1G84A 2Z4QB 4PJXA 4M8QA 1TDQA 2DDQH 5HHPA 4M03A 4QF1A 1G1YA 5K9OB 3RZCA 2EH7H 2BOCA 4HF5H 1BVLA 1EFXD 1YC8A 3D39D 4IRZL 3RI5F 3F7VB 4JO4L 3OB0K 3ARBB 1YEIH 2JIXA 4ERSH 5F7DB 4XXCC 1ZEAH 2L7JA 4PRHB 1AO7D 2HLAA 3EOTL 3QUXC 1H5BB 3GI8H 3V4VL 2H26B 4EVNA 4MJ5A 3FZUD 2BNRE 5D6CB 1ES0A 3NFPB 2VR5A 1QD0A 1A9BA 1WF5A 4PRID 3WD5L 4DZBA 2GJZA 3WJLA 1KYOK 2P8MB 3ILPB 4X7TA 4LARH 2G75B 1ETZB 4EQ2A 4ZS6C 3REWA 5JNYA 3RFZC 4JVUA 4YDLC 5HYJB 5KZCD 5KTEL 4JRXE 5ADPL 2WINB 2CRZA 3BIAX 3AS2A 3VXMA 2NR6C 4PRNA 3BSZH 3C8KB 1MI5D 3SEPA 1ZV5A 1WISA 4L3CB 1QSZA 4Y4KC 1I7ZA 5A3IC 1DFBH 3ZYZA 3ZKXB 3PP3K 1NBYB 4LSPL 4OGZA 1RK1B 5DRZA 2ZSVB 3MRGB 3TBSB 3CVIH 3MRCB 4R96A 2QR0A 1CLYL 3HZKB 1GSMA 1J0YA 4Y5VB 1HQ4A 3FO9A 4BZ2L 3EYOB 4UIKL 2VN7A 4Y16A 1YEKH 1Z2KA 1BVKB 3ULVF 1KOAA 2BNUA 3BP5A 1LP9A 3CSGA 1MWAL 3GSXB 1AC0A 5I1KH 4ODSH 1NFDE 1MRFH 1HILB 3K4AA 1RUKL 5EU6E 5E8DH 3QWRA 3JWNC 4GAJL 2UY6A 1JPFB 3OB0H 1VFUA 4DK6A 5BJTA 1EZVX 5DUMH 3GJEA 1S5IL 1XCTB 2NX5E 1S7XA 2NY4D 1OF2B 5IVZB 1X4XA 3V0VA 2FJHB 1A14L 3GSNH 1B2WH 1J0JA 3WHE0 1N6QH 1QUNA 4R2GB 1BFVL 5L88H 2R0LL 1X4ZA 3HZVB 4FQCH 1WBYA 2BDNH 3WLBA 5DFVC 4FQ1H 3V79C 5HDOA 1HHKB 3BAEL 3K8KA 4GS7C 1JWMB 2Z35A 3GSNA 1UM5H 3HPJB 5T5NF 5I1IH 2G60H 4Z7WE 3GDBA 2DOCA 4S1RH 5KG9B 1SYSB 3LPWA 4OCLC 5HHNA 3T3ME 3G08B 3RWEB 4O2EB 4PJEA 1KTKE 5FYKU 2O5ZL 5B8CB 3FOMB 4WEMB 2B7DT 2GITA 2LV4A 2NY7L 5IMLA 1NL0H 2FWOA 1DN0B 2XZZA 5J56B 3RWIA 1PLGL 1FLRH 3N85H 1QKZH 3G5XA 1MAJA 2FH8A 3K3QA 3F7YB 4EI5C 3RGVB 5KN5A 1OCWH 4OCSL 2B2XH 3DBXA 5C08D 4YHOH 4ZAKD 2X4RB 3TBYA 1FBIH 4OZFG 4GQ9L 4QHLA 4ZFFB 3WFCL 4WENB 4HQQH 1FIEA 1T0MB 5I66A 4OV5A 3CFJA 2VJXA 1QSFE 2VISB 1AD0A 3CSYA 3OPZH 2BY0A 2E27L 5DJ6B 1GGUA 1Q72H 2YC1A 1CVSC 3QIUC 3ROOB 2PYEA 3CK0L 5E4IA 2AJYH 2UZIH 2EDFA 3LH2H 4FFWC 2A9NH 4YHMH 2F53E 2R4SH 2YD4A 2J5LB 5EZIH 1JNJA 4NWTL 4ZOBA 4ZPTB 2GI7A 1XGRB 1ZA6A 5KSBA 3CJJA 3ROLA 4UDTA 1WZLA 4M48H 1CFSA 4QXGH 4GBXD 3MRHB 3EAKA 2E3VA 3MV7B 4JFEE 3VW3L 4PLJD 4XNQA 2XQYG 2P45B 5ESVA 1PFCA 3FB8B 4TPRL 1FCGA 1G9NH 4QRRB 3QCVL 2ZCHH 4G7VH 5DTFB 1KLUA 3LB6C 4WHYG 3U36B 4HX1A 4CKVX 2DIBA 1KG0A 1E4KC 4HT1H 2L0DA 5IVXE 4UQ3A 1VKXA 5DWUH 4KDTC 1XIWD 3FQRB 3KYOA 1FIGL 2QQKL 4R0LC 2W07A 5FHBH 1LP9F 1V8HA 3UEZA 1F3DH 3CVHH 4MAYA 4KUZL 2NZ9D 1AIFB 2QSCH 1VSCA 1R5VA 1RVFL 3UJTL 3MYJB 4XC3L 3CLEH 3B2UC 5CJBA 2KUTA 3MLTB 2LFGA 3OKNB 4EIGB 1A7QH 3QQ4A 4YXHL 3S98A 3ZO0A 2VAAB 2QQLL 1YPZE 2APTA 3M45A 1FZOB 5J57B 3QDJD 3TA3C 3G6AA 5FM5O 4PJ5D 2YD2A 1A0QL 3AY4C 1QR1A 4PUBL 4WJ5A 3PHQB 3TH4T 1LO5B 4I1NB 5GGSB 2CIIA 3MO1A 1KT2A 2CLZB 4HXBL 32C2A 3LIZH 5H35B 5T33L 3FFDB 3WUWB 1GGBH 4WW2B 4QWWD 5JORB 3VD4A 2IAND 5FGCB 3GHBH 1S7SB 2ZJSH 3MGTB 3GRWL 1A6WH 3MLVL 2OXGA 5GS1B 1FO0B 3PDGA 1OT2A 4PJEF 3MTRA 4HS6B 1CGVA 5DJ0A 4J4PD 4XI5D 3PQYE 3CH1A 5J1AB 1OAYH 1HSAB 2JJUA 3IDNA 1N7ML 3BN9D 1SYVA 4IIQB 4L5FL 2IFFL 3VXTB 2DQIH 4LHJB 3WIIH 4P48A 5FOBA 4P5MA 2DQHH 5IW6B 3D3VE 5EIQA 2JB6A 2EO1A 4CVWA 3OF6A 1U2HA 4GXVL 5EU5B 4X6DB 2Y36L 4UDUB 3WN5A 5L8KB 3S8WA 4PBWD 3MRLB 2XWTA 3OL2A 2E6QA 4M5ZL 1QYGL 2XTJC 1IFHH 1ZVYA 4JHAH 3LKOA 1IM9D 2XNAB 3V5KB 2QADD 5D2NC 2FHFA 3QFJE 5JPNB 4AEHH 1I3GL 3O9WC 4TSBL 2X40A 3K4ZA 4OF5A 5E7FA 1DQMH 4HMEA 3MRJA 1A6VL 3B83A 3TBTA 2C7UA 4JE4B 3F8UB 2R69L 3IU4H 3M8OH 4Y1AE 5HDBF 1L6ZA 4ACPA 1A6UH 3EBAA 5KSBF 5D70L 1FN4A 1K6QH 4KRPD 3RL1B 2FNBA 5EBWA 3EDKA 2DDQL 4BFGA 1OAQH 1CDYA 2QSQA 2EH7L 1WICA 3MMEB 4YO0B 3WL9B 4HF5L 3WKMH 2YN5A 2BY1A 4K7PX 4MWFA 2XRAH 1YEIL 4LSUH 1YYLH 4Y5XB 4ERSL 1K8IB 1ZEAL 3VGGA 4UOJA 1AO7B 2DI8A 5LVEA 3SJVE 5E7BA 1CG9B 4LHUB 5EZJB 4MXWH 5IQ7H 3FN9A 2W9LA 4J7RA 4HUUA 1NBZA 1OGTB 2G2RA 5ITBH 2ZOLA 4RAVA 5D5MB 2V9TA 2DLHA 3HI5H 3O0RH 4PJIA 1N26A 4V1DA 2B1AL 3LN5B 4S2SA 3P77B 3HG1D 4WWKB 4YHNA 4L8BB 3SKUD 4KQ4H 1ZT1B 4LARL 1FG2A 3W5NA 1ADQH 4XP4L 2FH6A 3ZYOA 4BH7A 5KSVA 3O4LE 5KZCB 3QAZB 4U1HA 2ERJC 4W6WB 4XXDA 1S7VB 3REVB 2BNQB 4NN7B 4IMLA 1F58H 4KFZC 2A6KB 5DURB 5FYJU 4JFYB 1MI5B 3BSZL 4HK3N 3GMNB 5IM7B 1J1PH 2YEZB 4R3SA 1ZT7A 1I1YA 1KCRH 2VLRA 5GGTH 3MROA 1DFBL 2P7TA 3FRPA 4JO2H 4S1SH 2AXFB 5C86A 2IALB 4P46C 2P5ED 3ARFA 4I18B 3CVIL 2EC9U 3HZYA 3INUH 4C4KT 2BOBA 4MA8H 3RWCB 1SJEA 3PGCA 2EDDA 2WLZA 2BFVH 4MD5A 1YEKL 4N8CH 4LHQB 5HD8C 2Q6WA 4LDLB 3QDGD 1NQBA 5ANMA 1C5DA 3ECBB 5EUOA 1HI6A 3BOVA 2Z8SA 1WFNA 5FKAB 5I1KL 4ODSL 4P5KA 1HOCA 1MRFL 2NY2D 3SDXB 2YZ1A 1T1WB 2PXYD 3FB5A 5E8DL 5EU3B 2I26N 1F8TH 2W0FA 3AB0C 4OZGE 4XXCA 5IV2A 3CC5B 5D1QD 1RJLA 4MJIE 5DUML 3QUXA 3MJ6A 4JVPA 2HTLD 2Y25A 4XNZC 1B2WL 1N6QL 3G5YA 3T4YA 4M00A 2WWMD 4FFVD 4ZSOE 4AM0A 4Z78A 4JFFB 1FPTH 5L88L 4MD0B 5T3XD 2NY6B 4FQCL 4FQ1L 2I25N 1UVQB 4PJXE 3TEUA 2VLMD 1J11A 1FL5A 4GKSA 4O2CA 5CKAA 1UM5L 1F6AB 4H26A 5I1IL 1LNUA 4ISVB 2G60L 3T2QA 4S1RL 4X5XB 3FT4A 3IXTB 1CFTB 4AH2B 4F37K 1NL0L 1XH3A 2VXQH 4ZMAT 1T7XA 2ARJA 4OSUH 3LEXA 4Y4KA 1YMHB 2XZQH 1FLRL 3N85L 1QKZL 3TJEH 5C08B 3UTPD 4YBLB 1OCWL 4HV8B 3AXLB 4OZHB 2B2XL 4ZAKB 5GS2H 3HRZA 3DO3A 2I9LA 3TT3H 3X11B 5BS0D 3U9UA 4HQQL 5D7LA 3DURB 4MSWB 2N7BA 1AGDB 1L7TH 1MJJA 1RZ8B 2YUVA 5SWZE 3DMMC 4ZPVA 5DMJB 4XWOD 1ND0A 4AG4H 1JJUA 3OPZL 1Q72L 5DJ8A 4G9DB 4G42A 1UYWH 2DYPD 5FUZH 2AJYL 2UZIL 3LH2L 2A9NL 4JZOA 3RUGB 2HFEA 4JLRA 4MNGB 2IMMA 5J89A 2YD1A 2BERA 2MPAH 5MI0B 3BFOA 1KPRA 2E8ZA 1I8IB 4I3RH 5DVKA 2HFFB 5J13C 4QXGL 2YS4A 3TIDA 2XA3A 4OAWA 1UJTA 1WCBB 2AXGB 3KLHC 4JFOA 1MHHB 3AAZB 4X83A 5GGQH 3C8HA 1O7VA 3QNZA 1P7QB 5JMRA 1Y6KR 3G9AB 1H5BC 4ZUWA 1G9NL 3EYVB 3MUZ1 1J0KA 2ZCHL 4G7VL 4OF0A 2BVUA 5FF6B 5IT2H 35C8H 3BE1H 3CPLA 5FA4A 1NEZG 1FSKB 2QTEA 3WUWG 4LEXH 2GAZB 2CPCA 4MZ3A 3HE7D 4HT1L 3QEHA 1FVEB 2RIKA 5DJYB 1IGYA 5I75C 1UEMA 1AHWB 2X7LA 3DO7A 3EW3B 5EOQH 4ZFZA 1Z9MA 3N06B 4LKCA 2ITCB 3B6SB 2CKNA 4KK5D 5ELIA 4NQSA 4QRUA 3GUTA 4NOFA 1PAMA 2UVFA 5EUOF 5FHBL 4LDEB 1DBKH 3L7FA 3CVHL 1UACH 1TMCB 3VH8B 4TSAH 2QQNH 5IOPA 4JKWA 1L7IH 2A38A 1JV5A 2QSCL 2ZUQC 3PV7A 3MBED 4EI5A 5JPMB 1R3LB 2UWEB 1A7QL 1KB5H 3B2VH 2DM3A 4H20H 5SWSA 2LU4A 3MRQB 4FFYH 3PWUB 5F7LB 3ZKXC 3QDJB 4F3FB 2JCCA 1VGEH 4PJ5B 4FQPA 3QR2A 4Q9QH 3E6HB 4XNUH 1FZJB 4CMHB 1NANH 5F7EH 1SHMA 1T0PB 3QIUA 2FO1A 4K71B 1FQ9C 3RX7A 3LIZL 5DZNA 5T1KD 3NZ8A 3CX5K 4M7LH 1GGBL 3GSWA 3X13A 3EFFB 4LL9A 4LOUC 4TRPH 43CAA 2P24B 4U6YA 5DQJB 3LKSB 3PWPD 3GHBL 2ZJSL 3PXJA 1FNGA 4N0CC 1A6WL 3IDJB 5DC0A 2YD7A 2SEBA 5HVWA 2WV3A 5I17B 2P8LA 1VA9A 2WIIA 1RJYA 1I7TA 1J8HE 2FATH 5ACZB 4NWUH 5TFSH 1JZ5A 3O3DA 1FYTA 3MA7A 1OAYL 2WLYA 3VFOA 3QO1B 4KMTH 1WIOA 2FO4B 4YHYC 1MEXL 2DQIL 3WIIL 2XN9D 1UG9A 1H8SA 4JZJB 2DQHL 1B0RB 3MFGB 2V2TB 4LHUG 4MDJA 4R2GC 2PYEE 3HMXH 4HFWA 5I19H 1G7PA 1E4KA 1AR1C 1D5IH 5DS8B 4HPYH 4LCWB 3E6FA 1PEWA 4LQ1A 3GMLA 4KDTA 1IFHL 5AYUH 2YRLA 3P73B 3SBWC 3F6LA 2QADB 3I6KB 1NDGA 4R0LA 4AEHL 2XWBB 2VH5H 3PL6C 1LO2H 5F1IB 2ZUTA 4XMLH 4E5XB 4HKZA 2BCKA 3J8F7 4UT9H 5EPMB 1MFCH 1ZHBA 1NUNB 2MKLC 3GSVB 2EDXA 3IU4L 1LEIA 3M8OL 1XGPB 3VI3E 3O6FB 3G6JA 2A73A 4PTUA 1A6UL 4O4YH 4KRPB 1G7HA 2Y23A 1K6QL 4XPHH 4X98A 5LJYH 3ALXA 2ATKB 1OAQL 1UC6A 3ELAT 3VFMB 4ODWA 4ZUVB 4I0CC 3F5WA 4MXVF 3S3SA 3TA3A 4F58H 3WKML 5D1XD 3EUUA 3AY4A 4BKLB 1R5WA 1D5XA 3KPLB 2XRAL 4LSUL 1BF2A 1UADC 2K7PA 5IBTL 5EBLB 1RZ7H 2R23B 2X6MA 4GRLA 1N2RA 4APQD 1EEYB 3CDCA 4LBEB 4TUOA 5HGHB 4MXWL 4HUWB 5IQ7L 1Y18A 1W72B 2BVQA 5ID1A 4TVPH 4KPHH 1AY1H 2Z8RA 4MQXD 2J5LC 3VXNA 3R0MA 3KG5A 2CMRH 3HI5L 3O0RL 3MSPA 4NO0D 1JPSH 4FXKB 4DFIA 4N9GB 4FOMA 3PWLB 2E7BA 2G5BA 1AJ7H 4KQ4L 4GH7B 3NACH 2ITDB 4K3JH 1MHCB 3IF1A 1ZA3B 4NZUH 1ADQL 3OX8A 2EDQA 1C16A 2VL5A 4D3CL 3H42H 4DGIH 3H0TA 1IVLA 1IQWH 4MQTB 1BIHA 1F58L 3UTQB 4Z77A 5JXAH 3M1BA 5MEPA 4FXGA 1EJOL 2PTTB 1E4XL 1ERNA 4X9IA 3H9YA 1N59A 2HJKA 5F3HA 5BRZA 1KCRL 5GGTL 5FA3B 5GSVB 4KH2A 1AGBB 5KSUB 1Q9OA 3QJHA 1U3ZA 1JWSB 4JO2L 4S1SL 3KPNA 2P5EB 1QPXA 3ZE1F 3O9WA 3P4OB 2PO6D 4JFXA 3QWOB 4YDKL 5IMMB 1CFVH 3INUL 5KAQF 5F72S 1MLCB 4MA8L 5GS3A 2BFVL 4CADA 2F5AH 5MENA 4WI6A 1DQTA 1QBLL 2AV1A 3QH3B 4N8CL 3GBMH 3VFUA 1KBGH 3I75B 3QDGB 1NAMH 2CR3A 3JWOC 1IAKA 2XV6B 5EU7C 3VFNA 5J9PA 4NQCA 2NY2B 3K0WA 4NP4H 5B39A 5ENWA 1YEEH 5BV7B 4P2QA 1AP2A 3KWWB 4XP6L 4AQ1B 1F8TL 5I8OH 1X5KA 3EJYC 4PJGE 1KIUA 3D2UD 3ZDYF 3OR7B 4KVCH 5IFJA 4OCRH 1S9YA 3MRMA 1TVHB 5ICXB 5C0IA 2Q8AH 3KXFA 4MNHA 3VD9A 1HHHB 3O3EA 4L4VD 5LAXA 5EA0H 4Z76A 4WW2C 1FPTL 1NSNH 4GRWF 3TN0C 2VXSH 5HI5D 3O81A 1P2CB 1RD6A 3FFCA 1LK2B 5C0ND 1K2DA 5F89A 4Q58C 3AS0A 3MX0A 1F3DJ 1KTRL 2FBJH 5GS1C 4WW1B 2G9HB 4AT6B 5EBMB 5L8LB 4XVUD 5FECA 3TIEA 5AG9A 3T2PA 4KI5E 4DUXA 5K9JH 3KPSA 1CGTA 4IIQC 1CFQB 5HHQA 3DSFL 2BC4B 2M8XA 1Z5LB 2HTKD 4WWID 4G8FB 3KLSA 4QNPE 5E8OB 2COQA 2XZQL 4OZFA 4MNQD 1D5MA 4R26H 3N1FC 3TJEL 3V6OA 4F33A 1RU9H 4J3SA 2AJUL 5D1ZD 2E6JA 3E1F1 4WHCA 2EYRB 3TBVA 3TT3L 5BS0B 4PJIE 2A6DB 4K7PL 5J6HB 3VGBA 2OJEB 1SEBB 3ME0A 4V1DE 3KGRA 5CP3H 3RIAK 2GFBB 3U6RB 1CBVH 5I2IA 1L7TL 3V52H 1PKQB 5DMYA 3STZB 3QXWA 2P1YA 1G9EA 1MCWM 5BQ7B 1FFRA 5DJAB 4AG4L 1FZMA 2YA0A 3DXAA 4JN2A 4ZTOH 1UYWL 3VH8G 4Q2ZA 3IJSB 4NNPH 2ESVE 2VL4A 2FSEA 3WO4B 1J10A 3P0VH 1EHNA 1NBQA 2R9HD 4WFED 1NDMB 1S9VA 2MPAL 2VR9A 5KVDH 5F7MC 2VLRE 5FHAH 4I3RL 4P2CG 1TNMA 3IDYC 4X6CB 4Y5XC 1R3JB 1CD9B 1BJ1H 1ZHLB 5LWYH 4FQ2H 5GGQL 3GSOB 1KV3A 4YWGH 1BWMA 1ZTXH 1I7RB 3U7YH 3VDAA 4L29B 4G9FA 3U30B 5E2VH 1RZIB 5IT2L 1KF9B 1QO3B 5DRWB 35C8L 3BE1L 4PYGA 3TP4A 4MB4A 4JB9H 1JGDA 1X44A 3L95A 4LEXL 2IFGA 5ANME 1INQB 5HPMB 1Q38A 1ZWIA 4X7SH 1D9KB 1K3ZA 4TTGA 3MRRB 2X70A 1YY8A 4M5YH 2Z91A 1J05A 2OZ4A 5TQ2H 4NQXB 4WWKC 1J5OH 5EOQL 5I15H 4NQDD 2VXUH 3PABA 3QAZC 1BAFH 2CLVB 1S7WA 1DBKL 2F8OA 1UACL 3IXAA 4HGKC 2QQNL 1L7IL 3MBEB 4YDJA 4ZDHB 4CL7A 4YK4C 2E9WA 3S96B 1CICD 2F54E 1AGFB 2NY3B 1EA9C 2BVPA 5DK0B 4LCUB 4LVNB 1FV1A 1KB5L 3B2VL 4H20L 1B4JH 3CXDH 4OTXH 1S9WB 3VFSB 3ARDC 4JRYB 4XGZB 1VGEL 3IU3A 3NCJH 4HIJB 4JFPB 4Q9QL 4XNUL 3U4EA 2PTUA 4I18C 5E56A 3NPSC 2IQAB 4I48A 1HHIA 5F7EL 1EVUA 4MQ7A 1U8NB 3QXDA 1EDQA 3WFDH 5ETUA 4F7CB 5DUBB 3VRJB 1J0IA 3U48A 3H7LA 5T1KB 1CDGA 4RRPA 1QG3A 3IAPA 4HS3A 5KOVC 3T0ED 4M7LL 1YMMB 4TRPL 5AG8A 3PWPB 4MS8C 4WGWB 4L3AA 5DHYB 1FZKB 4NC2B 4X6FB 4XCYB 4DKEH 3MRIA 4XP9H 4JY4B 4NC1C 4PFEA 5F7DA 2FATL 4NWUL 5TFSL 2R0WH 4LFHD 3MUGB 5D7LE 1JF1B 4YAQB 1I3RA 1H5BA 3ZT6A 4DVRH 5IVNA 5KVEH 4MYWB 3GJFK 1Z9SA 3V6ZB 3UROR 1F11B 1QSVA 3NFPA 4OCNC 4PREB 3L5XH 1CDIA 1IRAY 1OB1A 2YPLB 3HMXL 1DQDH 5I19L 2ZUVA 2NY6C 1Z3GH 2X2YA 4HBCL 1UCBL 4HPYL 1VEOA 2P8MA 4BYHA 2DLFH 2G75A 5LCVH 1T5XA 4DZ8B 3W0WA 5IG7B 1OGAA 2VTFA 5GS0D 2VH5L 1LO2L 5HYJA 3DIFB 4XMLL 4UT9L 2VQ1B 2ZP0T 4JDZB 1MFCL 5T1LA 4CAGA 4GMSH 3C8KA 3LQAC 1XR8B 2PYFB 2IPKB 4L3CA 4XPHL 2BSRA 3MV8D 4YBLC 3QPQD 2Z8VC 1SJVA 5D1XB 1RK1A 4F58L 2PUQT 2ZSVA 3MRGA 3TBSA 4ZS7L 3MRCA 3P4NB 4Y5VA 1N5YH 1P6AB 2VLJB 2FEDD 4FRWA 5I1CH 1OD7A 3TWCH 3QIWC 1RZ7L 1V3LA 4P2RB 1DBMH 2OLDA 3RNKB 5KS9B 1BVKA 3GNMH 1JN6A 4LPXA 1MFAH 2DIAA 2X4TB 4RIRB 1NCTA 4ESKA 4KPHL 1AY1L 4PJFB 5EH1A 5J11B 3WNPA 3UTTD 1A21A 1HILA 4NO0B 4WTWA 1JYNA 2ILLA 4LU5H 4NZJA 2LVEA 1JPSL 4U1SB 4KY1H 4NPYB 1N64H 5MI0C 1I1AD 1BMGA 1EV2E 1I8MA 1AJ7L 1NCUA 4P3DA 2FX9L 3NACL 4K3JL 7CGTA 1XCTA 4NZUL 2X4SB 3RVTC 5K59E 1OF2A 4YXKH 5IVZA 2NW3B 4PLJC 3H42L 3GJFH 4DGIL 5CSBA 1IQWL 4F7PB 5JXAL 4K3GA 1S7UB 3OKMB 3V0AC 5C71A 3HZVA 2VWEC 4A2MA 4TUJB 1FSKC 1AGCB 4M1GH 1HHKA 2LE9A 4N0UB 1RJZB 4XP5H 4LGRB 5E70A 1JWMA 3SBWA 3HPJA 3GJFA 1PYWA 2PO6B 4MJ2A 5KG9A 1AHWC 1SYSA 2HLFC 1TITA 2H3NB 3UTSD 4O2EA 1CFVL 2XXCB 4OIBA 1F6FB 4NKMA 4U1GB 5CZVH 4M7ZB 3RIAF 5CWSB 2F5AL 3GBML 1KBGL 3OMZA 4GLRI 1IAMA 1DN0A 3RP1A 1XCQA 2IBZX 1NAML 2W0LA 5FM4A 2HJLA 1MCOH 3F7YA 2DWEB 5TDNB 2PW2B 3HCVB 5KANG 4GG6E 3UPCA 4Q6IC 1YEEL 4KJYB 1T0MA 5DZOA 2GCYB 5C09E 5I8OL 5DYOB 3ARED 4CMHC 5JA9A 4ONOA 3ARGB 4KVCL 5GRJH 2ZUXA 3FKUS 3ROOA 2Q8AL 5GQBA 4K71C 2BNRB 5EA0L 1CE1H 1TTUA 4H0HB 5CGYC 1X5LA 4XVTH 1NSNL 3I3EA 2NPLX 3G6JE 2VXSL 4ZPTA 1XGRA 3NOIA 4H25A 4WNQB 1INDH 4GW4B 1KJ2H 3DRTB 4W4NA 2FBJL 3AU1B 3V0WH 3MRFB 5TE6H 3MRHA 4M9OA 4J4PC 4XI5C 5C2BH 3MV7A 1NUDA 4DOHE 5K9JL 4RAUB 1K8DB 4CVZB 3PWVB 1TJIL 1G0YR 4JRXB 3LKPB 4IRSD 4KK6D 3JBG7 4QRRA 2J6EA 4J3TA 5A1AA 5A16B 3U36A 1N3NB 2HVKA 2NLJB 4MNQB 1IC4H 4PY7B 5E5UB 4UOW0 4R26L 4XBPB 1RU9L 3MLYH 4Z0XA 4U1KB 5ACMA 1YEGH 4LLQB 3JWOH 4WTXA 4YHLH 4FTVD 1KPUB 2OQJA 4OFYD 4R4FH 5DA4A 2DTML 4MXQC 5C0EB 3BEWB 5ISZE 3V52L 3X3GH 4D8PA 3QUKB 1HWGB 5F7YC 1UEYA 2R1XB 4N8VB 3I6GB 1LQSR 3FO2B 4I0PB 1AIFA 3MYJA 3RPIB 4ENEC 3O6FC 1R3HB 3NIDE 4NNPL 3N1PC 3MLTA 5F7NC 1IGFH 3OKNA 4JFZH 2JTDA 3I02B 1AQDB 4PD4K 4HPOH 3MJ9A 4YR6B 1NFDB 2VAAA 3ABZA 4FQHB 3P0VL 3U4BL 4H1LB 5IR1B 1FZOA 4XCCH 5KVDL 5FHAL 5EOTA 5LG1A 3P4MB 4PJ9B 3CX2A 5ILTH 3BQUB 3DPBA 2I07B 5HGAB 3PHQA 3KPQB 1LO5A 4DN3H 5GGSA 5LWYL 4FQ2L 2CJUH 4YWGL 3TVMC 5DFTA 1CDUA 1ZTXL 4LLMA 5H35A 3U7YL 1NEZA 3T0VA 3V5DB 2ICES 3FFDA 4XHJC 3WUWA 4WW2A 3B9EA 5MENE 4PY8I 3TN0A 1FGVH 3HZMB 5GRXG 4JB9L 2GJ6A 1QFUH 4IRJD 3UZEA 3MGTA 4X4XB 1LVEA 3DVNB 1ZT4A 5GS1A 4Y4FD 4X7SL 5C0CE 4EI6B 3FONB 1FO0A 5IKCA 4YC2B 1HH9B 4M5YL 4HS6A 5TQ2L 2IPTH 3IDUA 5J1AA 2QSTA 1J5OL 5C8JB 3L3JB 5I15L 1HSAA 4P2QE 4LSVH 2VXUL 3MJ8B 4IIQA 5EU4B 2FX8H 1JNHB 2P8PB 1CU4H 3VXTA 1BAFL 5C6PB 2R2EB 3V5HB 5IW6A 2H8PB 4PJHB 3BKJL 4U3XA 4X6DA 4BSWB 3KXFE 4N0RA 4UDUA 4KK8D 3MRLA 1DQQB 5I1AB 1B4JL 3CXDL 4OTXL 5A2LH 2XNAA 3V5KA 5JPNA 4YEEA 3NCJL 1CL7I 5D2LA 1UH2A 3VGFA 5GS0H 4NYLB 3QUYD 3SKMB 5FO8B 3IJYA 5EC1B 1ZGLM 3WFDL 1NJ9B 3UX9B 3KPSE 2AEPH 2DKMA 3T0EB 1T89C 2F53B 3C8DA 4WI9A 3RL1A 3D1MC 3GFUA 2IPUG 2WIMA 3I9GH 1E0OB 1JTPA 3MMEA 4YO0A 3WL9A 2NY2C 2YXMA 3LKQB 4DKEL 3V6OE 5BV7C 4XP9L 4XTRD 4Y5XA 3BKCH 1HYSD 5CIPB 3WFEH 4AQOA 1FL6B 2R0WL 1A7PH 4ODVH 3QEUB 3HKFA 1CG9A 4DVRL 4LHUA 4OLUH 1MH5A 1P7KA 1OW0C 5DQ9B 1OGTA 2DBJA 3L5XL 5D5MA 1G6VK 1LO3H 1CF8H 3KYAA 4LPVA 4ODXB 1Z3GL 4X7EC 4KJWC 3LN5A 1Z9LA 3WXWH 5IVXB 3P77A 4WWKA 3FT2A 3LRGA 3KYNA 5DMIH 3L3HA 1ZT1A 3GMMB 2DLFL 2ZG3A 2J8UE 5LCVL 2HG5A 1IC1A 1JTOA 1MCEA 3Q3GB 4U0RC 4PB9H 1S7VA 3EDEA 3FB7B 4WIQA 3REVA 2BNQA 1RHFA 5F96L 3CH8A 5IW3A 2A6KA 1FL3B 4JFYA 1MI5A 4GMSL 3GMNA 4O00A 2ED7A 5IM7A 3JWDL 4FQXD 2YEZA 2ZPKH 2QV2A 1F90H 1MCCA 2I60H 4F7EA 1OTTC 3B9VA 1YPZB 4X9GA 3ARDA 3QIBD 3D87B 4L8SB 4I18A 5E08H 3IETB 1FE8H 3RWCA 3BT2H 1N5YL 5HGBB 5CEXB 5I1CL 2XOTA 3TWCL 1T1YB 1DBML 1RURH 3K74B 1MCLA 3GNML 3P3YA 5IGXH 5FDYA 3RWGB 1MFAL 4PGEA 4G8GD 4NJAH 5FKAA 3UTTB 3GSUB 4RGOL 3SDXA 1T1WA 4LU5L 3BPLB 4HIHA 4KY1L 4NSKB 3PQYB 3RVWD 2XKUA 1MQ8A 4PGDB 3RNQB 5D96B 4YXKL 3W39B 4ZNEE 4R8WH 1P5UA 3GB7B 3MXVH 4PJ8B 3D3VB 5GGVY 1TLKA 3SCMD 4JFFA 4Y88A 2YSSB 1FFNB 1K85A 3VXQB 3ULUD 4M1GL 1UVQA 4BQ9A 5D2LF 4XP5L 1D9KC 3WIHH 3LQAH 1F6AA 3MYZA 1OSZB 4OUOA 4ISVA 5D7IB 3QFJB 2HKHL 3RVXC 1KIQB 4IOSD 4NCDA 1CFTA 2CUMA 3SO3C 4IDLA 4AH2A 5CZVL 2FDBP 1JMZA 4PRHE 2K9UA 3MLPA 2WP3T 2EXYD 2QLVB 4KJQC 5F7FA 2W38A 4PRPB 4FG6C 3WIHA 1YMHA 3MBEC 3D85D 1MCOL 5C08A 5I1LB 1EVTC 2VKXA 4HV8A 4OZHA 4YLQT 2OMNA 2NY3C 3BD5A 1Q0XH 1NUGA 4LVNC 4MB5A 2DKSA 4HIXH 2DQFB 4PJDE 1BX2B 3VA2C 4MJ6B 5A43C 3DURA 4MSWA 1XGYH 1S7QB 3QIWA 1RZ8A 1W0WB 1BD2D 5GRJL 5D5MF 4G9DA 4LDOB 5JW4N 1RFDH 4N5UA 3EFDH 4U7MA 3WUZA 1U8LB 4N8VG 5H94B 5ERWB 1O7SA 1CE1L 5C0DB 4MNGA 3QULB 2AEQH 4XVTL 3G6DH 3RDTD 3SGEH 1INDL 1CGXA 4JAMA 5DR5H 1KJ2L 4YHIB 1I8IA 5CEYB 1JIBA 1T5WB 2HFFA 3PGDB 4H1LG 3V0WL 5I30H 5TE6L 1I8LC 1K5NB 1WCBA 5C2BL 4PJ7B 5IEKB 5DI8B 3MGOA 3AAZA 3O4LB 4I2XA 3EJZD 4NHUB 1P7QA 4IRSB 3EYVA 5FF6A 1ZLWK 3DWTA 4K8RC 2B20A 3L3GB 1NC4B 2GAZA 5J8OA 3DECA 4KTDH 1IC4L 1VEMA 2VABB 4XCNB 5L0QB 1FVEA 3MLYL 1KFAH 4EKXA 1I1CA 5DJYA 3FQWB 4GW5B 2XFXA 1YEGL 1Y0LB 1AHWA 1DBJH 1JF6A 4YHLL 5KVFH 5I74B 2ITCA 2YD3A 2C3HA 4X0KB 5C3TA 5DD1H 3B6SA 5HTSA 4R4FL 1OP3K 2VDLH 3X3GL 2OSLA 1ED3A 1A1NA 3VH8A 4J3XA 5JPMA 5MEOA 2H6PB 1KXTB 1CFNB 4JFZL 4U1MA 1T2QL 4HPOL 3MRQA 4Q6IA 4F3FA 4XCCL 5D1XC 1KJ3H 4PJ5A 4OZGB 2GJJA 5DA0B 2ED8A 2Y7QB 4KVNH 5IHUH 3KHQA 5ILTL 4M4PA 4OZIA 1M4KA 4QRPE 2A74A 4F7TA 2W9EH 4Y8DC 4DN3L 1CR9H 2CJUL 1JYXA 3R06B 1U3HC 4I9WD 5DDHB 4PV9B 4UU9B 3MZGB 3EFFA 3HAEH 3MV9D 4OD2B 4KZEH 1FGVL 5DQJA 1KJVB 4IRJB 1QFUL 5T3ZD 5J11C 3IDJA 1TTFA 3BH8A 4NN6B 4PB0H 4MCZA 5HI4C 4J4PA 3F12B 4L4JA 5FGRA 4FMFA 4RNRB 2JK5A 2FEEI 5GGS