5E8PB

The structure of the teipp associated altered peptide ligand trh4-p5nle in complex with h-2d(b)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title The MHC Class I Cancer-Associated Neoepitope Trh4 Linked with Impaired Peptide Processing Induces a Unique Noncanonical TCR Conformer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 15
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e8pB00
2D03H 4GW5B 1DL7L 2A6KA 5JW4R 3HS0A 3VMOA 4XBGB 2HAZA 1I4FA 1DEEA 2OZ4A 4TTDD 3DURB 1E27A 1KJVB 3FKUS 2APXA 3KJ4C 2EH8H 2GJ6E 2F53D 4RMVA 4I3RL 4ZTPH 1WAAA 2F53B 1JNNH 3GMPB 4Y8AA 4ALAL 1XF2B 1HE7A 2IF7A 2FLRT 3ULVD 2PXYC 3TPKA 1KIRA 2FH8A 1QSFD 2Q6WA 2EE9A 3HC0A 1T5WA 4WNQB 3VI4E 3ZT6A 3V8CA 4R4NC 3VJ6B 1JGLH 1IC5L 1N26A 2H32B 4TSBL 1M1SA 1BIIB 5K59E 2DLGA 4MA7L 5IB5B 3C8KA 1U0QA 2QQNH 1FAKT 3D9AL 3G5XA 3OB8A 4CW1A 3FFDA 4J23A 2GAZA 2QLVB 1OAXH 2BHZA 5F1OB 5H2BA 4K7PY 4I5BA 4ZSOB 2VLKA 1GXEA 4FZEH 2A83A 4M7LL 1RZKL 5GRUH 4U49A 5KSAC 1NCCH 2B1AH 5DWUH 2EE2A 5K9QG 1TXKA 3SGEI 5DUML 1W0VA 3KPNA 2EO9A 4HD9A 1AQDA 3EJZD 1KGCD 3O2DH 4HUWB 5K9QI 4LSQL 1FNGA 1IJ9A 3DHMA 3MGOA 1VGKB 5D1QC 1CLOL 1YPZA 4IS6A 5EU5B 3G04A 4LP4A 2J5LC 3IAPA 5EBLA 3ULUE 4RMQA 2NXYD 3TJHC 3OX8A 3QO1A 4P9ML 1GGCL 2NXYB 4FFVC 4P5MA 3LEYH 3BKJL 1IAIL 3MV9E 3WJLC 3UO1H 4UIKH 1BOYA 1FGVH 1WF5A 3O3BB 3IU4H 4HH9A 4JG0L 2Y4SA 3GMOA 2CO6B 1JPFA 1RULH 4RFEB 1NBYA 1KLUA 1BZ9B 4NUJB 3PJSA 4OCWH 5C08E 4UAOB 1KLGA 2DLFH 4GBXA 4JO1L 3CJJA 1NFDA 2EXWC 2AK1H 4Q6IB 3L3IA 2XOTA 3CUPA 3NFSH 1VENA 4RWHA 4ZUWA 1OAXL 5HI3D 2YWYA 1JZ3A 5EC1A 4PTUA 2D7NA 2P24A 2CKBH 4HX1A 3DSNA 1KJMA 2MHAA 4P4RA 3P4NA 5ITFB 3MLTB 5DWUL 1BQHA 3HNSL 4NBYB 2X6MA 1WAAF 4N8VG 4RCAA 5B38A 1LE5A 4HMDA 3PQYD 3I02A 2EE3A 3U7AA 3P11L 3U7YH 3PQYB 5EOTB 2OXHA 1PKQB 4XMKL 2Z93B 1MJ7L 1EO8H 4U1LB 3LRSB 1MHPH 2X9YA 3RVTC 1D6EB 2VUYA 5M95B 1EUTA 2XICA 3OB0K 3TO4D 1R5IB 3CH8A 4LLQB 1UADC 1C08A 5IF0B 1JFQH 3V0AC 1RI8A 2SEBA 4OZHB 3LEYL 1ZLUK 4X7FC 1NGPL 4PRPD 1XR9B 1MCWM 4UIKL 1FGVL 2WW8A 4PRPB 5FDWA 2JTDA 4CVWA 4QHMA 1I85A 2JELL 3TN0C 2IAMA 3SGKA 4DUVA 4MAUL 1RULL 3KJ6H 4V1DE 5I8OH 4PJGE 1SBSH 8FABA 4HGMA 4QWWC 1HQRB 1RZGB 2DLFL 3ZDYE 2AKRB 2D7OA 5F7DA 3UTTD 3O3EA 4JO4H 2NCMA 4PTTA 3UTTB 1OPGL 3NFSL 3Q3GA 2PETA 1I3RB 4U6VH 4WFFD 1YPZF 4WHDA 2BK8A 4HKJB 2P45B 4NIKB 3H9SD 1L7IH 4OGYH 3G5YB 2X89D 4ZO9A 5ADOH 4NNPL 3H9SB 1URLA 4E41E 3HUJB 5GGUB 4XAKD 4PJDB 3HNTH 2G2RB 5GGRY 3V79C 3U7YL 2VZ1A 5DFVD 3ULVC 3CVHB 1IARB 3PP3K 2X41A 4NKDB 5TDPA 4QCIA 1NCUA 3MMEA 5CINH 1AXIB 1JI2A 3ECBB 3ARYA 4KTDH 5DHVB 4GS7B 2YR3A 1QEWB 2VB5A 4HUVB 1JWSB 1JFQL 2FIRT 4RMTA 3QUZD 3RWJB 3QUZB 3DRQB 4WY7L 5MENA 1U8LA 3GJFB 3WUZA 1OD7A 3KJ6L 5EIIB 3U46B 1CR9H 1OP5H 3ZDXF 2R1XB 4FQPA 3RVVD 5F88B 3D85A 3MPCA 4M9OA 2EYSB 1IM3B 5FUOL 2JJSC 3WEXB 3QULB 3EJZC 1MI5E 1RFDH 3ARZA 5F7UA 2VDLH 5LCVH 1G7QB 3RHWK 4ZTOL 2E9BA 2EYTA 2PR4L 2NXYC 4OCLC 2DQGH 5CBAB 2RBLA 4X4ME 5IMLA 43CAB 4I3SL 3BZ4A 1AR2A 5DJYA 1QFWL 1LEKB 1MHEB 3DUSB 3MLYL 5KW9H 4WEBL 3ZHDA 1N2RB 3D3VE 5DC4B 3TYGH 5CGMA 3BEVB 3K80A 4LHUG 5TE6H 4JY4B 5CINL 3V8OA 2ZSVB 5ETUA 4XNXH 3L1OH 3L5WA 1DBKL 4UAOC 2GJ6A 5C6PB 2IPTH 3GHBL 1LNUA 1LD9A 1A3QA 2X4TB 4Q6IC 1W0WA 1G9EA 3ULVL 5F9JB 1P69B 3LSOA 1TCRA 1MQ8A 2AI0H 1S5HB 5HI3C 3MRBB 1S7VA 1GAFH 3LPWA 3LS5H 5F8RC 2PW2A 2UZIH 3MRLB 2G75A 4NQXA 3I50H 4CU7A 1ERNA 3OKMA 4G8IA 2Q8AH 5I8CA 1CF8L 4U7SA 3F7QA 4P2OD 2J3SA 2VLJE 1AIFA 1PD6A 3C87A 4P2OB 1RFDL 2O61A 4NO2B 3ILQD 5LCVL 3PWUB 5DHYA 3VA6A 3ARTA 4PJAB 2VRAA 4NP4L 1WBZA 5C0ND 2YUWA 4JPKH 5FHAL 2IG2H 2PYEB 1NLBL 3CFDB 4YC2B 3TO4C 3VD3A 4K3GA 1VFOA 3OL2A 3HPJA 5D72H 4WI4A 4JRYE 1Z9LA 3U79A 3SKNA 3TYGL 3BXNB 3NCYP 4F33A 3FONA 3H2WA 4QXWA 1V7ML 3RY4A 1JUFB 5E2TL 1BFOB 5IR1B 3V5HB 3L1OL 2E6PA 3H7BA 4QXGL 4JDZB 4FQHB 4K3HA 2NW3A 3UPRB 5J6HB 4GMSH 1H15B 2IGFH 1BAFL 1CLYH 3QO0A 3E0GA 2DQCH 2BSSA 4KQ3H 4GW4B 3BYYA 4Z7UB 4NZJA 3VRIA 2F19H 5IHLB 1F90H 1BHGA 1MCFA 3MJ8A 2AI0L 5KVGL 2J6EL 3TPUA 5E70A 5T5NG 4JM2A 4PB0H 3L5XL 2DIJA 4FQQA 4JQIH 3BPNB 2LU3A 1G84A 1PEZA 5JXEA 5LBSH 1BOGB 3GI9L 3QZWA 3MNVA 3MZTA 4OLUL 4YO0A 5F7NC 3PDOA 2A2QT 3LY6A 1NL0L 2UUDH 3MFFA 1IAOA 5DFVC 3KYMB 5DQJA 1XIWA 2B20A 3QHTC 1KTLB 4MNHA 4JQVA 4GS7C 5D7LD 5DMKA 1L9NA 3LPGA 4PD4K 3VMPA 5D7LB 1NEUA 3FT2B 4A6YB 4N0YH 4R2GD 4PBVC 2IG2L 3I6KB 4C56E 5HY9B 4R2GB 5HYSG 1KN4H 1NKRA 3QUZC 4OLWH 3WFCL 3MRHA 1H3WM 4U6HA 2WMPA 1CG9B 3VXOB 3VI4F 4HWUA 3M17B 1FORH 3X11B 3B9KA 5KVFL 3UZEA 5E1AB 3NA4A 3VGAB 1YN6B 4MA8L 4WU7B 3RVVC 1ITCA 1TVHA 3V5DA 5K59F 4OCYL 1S9VB 3C8HA 2CLRA 3O2WL 2C4FT 1JHKL 1CLYL 4PJEB 5IT2H 1INQA 3RZCD 5SV4A 4KQ3L 3RFZC 1A3LL 3N0PB 3ZDZE 4HZLB 4ODUA 1ZANH 4GO6B 2F19L 3RZCB 1EAPA 4H20L 3QDGE 3VXTA 3QI9D 1ZTXH 3NFPB 3VFVA 4LDOB 1JWUA 2EC8A 3S97C 3EDFA 4V1DA 3QI9B 4PB0L 1HH6A 1MLBA 5IFHH 4PGEB 4CDHA 2NY1D 5IEHB 4H1LA 4MXVE 3CDCA 1ZWIA 4XXCC 4MWFA 1PBYA 3ESUF 4HUUA 1NBVH 4AMKL 3CFEA 3MXVH 5C6WH 1KCSH 1A47A 2IBGA 1NUGA 1OCWH 2AEIT 4PV8B 3X14A 3WL9A 2ZUUA 5C3TA 1NKOA 2HRLA 1Q72L 3P9LB 3RWCB 1XR8A 3LN5B 2HWZL 4I0PD 3RUGB 1NEZA 5KZCD 3D0LB 2XY1A 1D6VH 1MJJA 3CVHL 4I0PB 1FVCA 5F9WB 5KZCB 1VGEH 2CGRL 1G0XA 4GRMB 1OAKL 5BVJA 3A6BH 5DD5H 4LNRA 4OTXH 1CD1A 2CKNA 1IT9H 1NGYB 4JM2F 4X6BA 3T0XA 3OKOB 5L88H 2AK4E 4ZUVA 2VQUA 1A1MA 1EH9A 3ZE2E 3IYLW 4P2OC 3X3GH 4X7TB 4UB0H 3VXNA 3M8OH 3SHSA 1LO2L 2NNAA 1CU4L 4NNYA 2HJFB 3TVMA 3RWDB 4L3CB 1ZTXL 3ILQC 4LEXH 1W72A 5C0BD 4GAGL 5C0NC 2X4OB 4HAGA 4YC2C 1B90A 5C0BB 2FJGA 2V9RA 4N1EA 3KPRA 4IRZL 5BOPA 1MVFA 3MV8E 1ND0B 4HLZG 2AV7A 4WVRA 1MI5A 2PTTB 3I3DA 4MNGA 1U3HD 1KTDB 5F6IB 2P8MB 1DLFH 2BVEA 1U3HB 5DSCA 1NBVL 3C09B 1OCWL 3QA3A 1BJMA 1SMOA 1T5XB 3OKEB 4QOKD 3MROB 5HYQA 4QOKB 4X4MA 2EDXA 5CJBA 1WIOA 4DW2L 5ICYB 3WFDL 4YHLL 2ATPB 2W1NA 1A21A 4I3GA 5JW4Q 2OBGA 3KPLB 4RGMB 2GSIA 4MD0A 4AM0A 3JVGA 4L4TD 5K9JL 3EYVA 2FJHA 4YLQT 4Z0XA 3D3VA 4MQTB 4L4TB 4HZAA 3T0AA 1JL8A 4JKWA 1UH3A 1CI5A 5DD5L 4JZOA 3QJFB 3MUJA 2AJ3B 4X9IA 3CMGA 1MUJA 2Q20A 3BPNC 4PJGF 5BV7B 5IQ9B 3QNYA 4UDTA 5T1KD 1D9KD 2HA1A 2NPLX 3ZDYF 4QGYA 5DEFA 4AIXA 1D9KB 4XX1E 1CDGA 4M5ZL 3ZTJG 1JGDB 3GSQA 1BZ7A 5D2NE 4UB0L 3M8OL 2WUCH 1FZKB 3IDYB 3DBXA 5GGVY 1EHXA 4YJZL 3KLSA 1YEHH 1JRHH 4P5TB 1RJCA 3HR5B 1UACH 4LLMA 1V7NH 4R2GC 1YEIH 3LKSB 5B4MD 4PG2C 5D1XD 3FN9A 2VLJA 4OZIE 5DMJB 3O41B 5DYOA 2HFFB 2DMKA 3MJGX 2YWZA 5D1XB 3ULSB 1DLFL 2EDLA 3H42L 2CRYA 3BKCH 1E4XI 1T7XA 1JZ6A 5DT1H 3VGAC 4HIIB 4K2UH 5C9JA 1KEGH 1AGFB 1P7QA 3MRDA 2DKSA 4HIJB 5D1ZD 4EUPH 4JRYA 5D1ZB 3RZCC 1OY3B 1FG9C 1AKJB 2ZNXA 3LKRA 1JHLH 3WE6B 4YXKH 3QI9C 4FQCL 4EOWL 3RWIB 2XA3A 4ZUUB 5I8KH 1PQZB 4HQQH 3MNZB 1PAMA 3KPMA 4O5LL 3PHOA 4Q9RH 3NIFE 2ENYA 2Y7QB 1I8MA 1MHCA 2EIZA 3GK8H 1BEYL 1UJ3A 5DA0B 3NOIA 5DK0B 2X70B 1C5CH 1CL7L 3QPXH 5E4EB 1DQQA 3TFKD 5HGHB 4JFHD 4GW1A 1RUMH 1CN4A 4NRZA 4HIHA 4AZ8A 4MJIE 1MCKA 1YEHL 4N8VB 3SGJA 3VFMB 1YEIL 4NO3A 3MRKA 4JG1H 3MRQA 1WK0A 1JNLL 4I0PC 5F9WC 1A9BB 1ETZB 3DO7B 4CUCA 3TIEB 2X1XR 3QUYD 4PJBE 3BGFB 4CBPA 4HWBA 1JPSL 4TVPH 4OSUL 5CJOH 3O2VL 1CIUA 1F97A 4HJJH 5LGJB 2OTUA 4C56A 4KFZC 4OF6A 1LE9B 4NN6B 1SJEB 1II4E 3RTQA 1BJ1H 4PJ5A 3S4SA 1YMME 2R2BB 5BXFA 3LQMA 3MLSL 1Q9LA 1JHLL 1J05B 1A0QL 4YXKL 5L2JB 5T33L 5I8KL 4HQQL 2BVUA 4NN5B 3W0WE 1GVIA 3S37X 5BW7A 3DIFB 2HN7A 2F5AL 3MRCA 3I9GL 4PJCE 3WIFB 2DI7A 5C0DA 2G60L 4UUJA 4CRPA 1F6AB 3OXRA 4HJ0D 5F6IC 3IETA 3OZ9H 4A2LA 4YBLB 4RWYL 4WU5B 1U3HC 1M7XA 4Y4FA 2ARJA 3C09C 3QFDB 4J6RL 3QPXL 4ZFGH 4PGZA 1FGNH 4ORGA 1LILA 1ED3B 1Q0XL 1JNHB 5F72S 3V4UL 1EGJA 2EZ0C 5C0RH 4HH8A 4JG1L 3IXTA 2R8SH 4RGMC 4FMKA 4YUEL 3VFUB 3I3EA 1C7SA 5IQ7H 3UJJH 1NMBH 4M02A 2ZKHH 4L4VE 2BMKB 4E5XB 3ARPA 3KYAA 1XH3B 3QYCA 4WV1A 4JREB 4OBSA 4HJJL 2EDJA 5BV7C 2YK1H 1MCEA 1JZ2A 4Y2OA 4D8PA 4QRPD 4OLXH 2NTFA 3DARA 1T1ZB 1TNNA 4NFCA 1D9KC 4QRPB 1QFOA 1EVTC 4JZJA 3MRRB 3K0WA 3FZUD 3QG7L 2J8UB 2B7DT 4PRHE 4Z7VE 1RUKL 4OD2A 3ARXA 3O3AA 1ONQB 4G6MH 3LB6D 2BVQB 3MRPA 1U8NB 1HIML 2P1YA 3IDYC 5FUZL 5CEZH 4P57B 2DM4A 3SDXB 5IW1A 2HTLD 4P46A 4RGOH 4YX2H 1OAYH 3PL6D 4P5TC 2R0KH 3K4AA 2AK4A 4GAJL 3EO9L 3PL6B 2UV3A 3SKOB 2WIMA 4GXUM 1NCAL 5JHLL 1K4CA 4RNRB 5B4MC 5D1XC 1J86A 5IVOA 4OUOA 3OZ9L 1RHHB 2B8OT 2IAND 1D3CA 4OZFG 4ZFGL 5D9SA 1YMHA 3GMNA 4AG4L 4EQ3A 2IANB 3O9WA 1XCTA 2HMID 5GGTL 5J9PB 5E2JA 5GS3A 2YPLD 3IU3B 4AL8H 1F4XL 2BDNL 2IH3B 4LPXA 4YDJB 5C2BH 2YPLB 5D1ZC 2NX5D 5I15H 1WFUA 4LHUD 5J89A 4HK3J 1NJ9B 2ZKHL 4ZO6A 2NX5B 3RJDA 3I6GB 4KY1L 4LHUB 3S7GA 3TBTA 5MERB 2D31B 3BZEB 3OGCB 1GZPA 1I9IH 2EKSA 2VDNL 4HKBB 2WM0A 3C5SB 3RQ3A 1A7QL 1KCKA 2YK1L 3SBWA 5FYKD 4QXUL 5FKPB 3RNKB 4OLXL 2R4SH 1T1WA 3D1MC 2XKNB 4U1NA 4IRJA 1BX2A 1I9JH 2FO4B 3ZDZF 3F58L 3HE7D 4G6ML 5E4EC 3QEHA 4R96A 3HE7B 2K1MA 3AXLA 4F80A 5ESVB 3TFKC 3U6RA 3QHZH 1OAYL 3P9MB 4NCC2 4NPYA 3VGHA 4HS8H 2H6PB 1H3TA 1IGMH 1ULVA 1U92A 3S34L 1K3ZA 4MXVF 4YAQA 4P9HH 3GBNH 1A7NH 4UIMA 1U9KA 3B3IA 3CX5K 5D2NA 3BGFC 1HDMB 4ISVB 3IKCB 3QUYC 3O2DA 1DBJH 1HWHB 2OQJB 3WCYA 6FABH 5JPMB 4JO3H 5I71B 2PCPA 5KBNC 1KTRL 4JKMA 4NN6C 4AL8L 4KTYA 1HXMB 4BH7B 3TM6A 4OZIA 3AMLA 4OZHE 4YDVA 5I15L 1RURL 3KYKH 2C1PB 2VLLA 2UUDK 1S7WA 3KDMB 3OKLB 4GQPH 2ARWA 2HT4D 2FX7H 3D69A 2A6DA 2D4FA 1CBVH 4NN5C 5F44A 1ZLSH 4X83A 4NCDA 4XPGL 2R23A 4JFED 1SYSA 1ZVHA 5EUOA 5FO7B 3ZE2F 1WEJL 4LKXB 4N0UB 5E99H 1I9JL 4JFEB 1VEMA 1M6OA 4YBLC 1LP9A 4XMPH 3X12A 4HJ0C 4XC3L 1PYWB 3GIVB 2ERJB 2FX9H 1KCUH 4MXWL 3QHZL 4WHTA 2D9QB 2CKBA 4KJWD 1IGML 1HYSD 3H9SE 3MCLH 2FGWL 5IG7B 5C86A 4P9HL 3U7WL 1A7NL 4XCNA 3H3KA 2FR4A 4OBRA 5BRZD 3FB6A 3G5VA 1ZT4A 4W68A 5BRZB 2A77H 4JO3L 4JREC 2ZPKL 1X6LA 5GGRB 4MJIA 4P5KB 1QTYT 3MOBL 5HYSB 2YD5A 3BDYL 3WUWG 2RCSL 3MODH 1M71B 2Q3AA 2FBOJ 2IQAB 4P0DA 5T1DH 3WDJA 3MLRH 1MCPH 2GUOA 3KYKL 4PJBA 3IDIB 3FZUC 3F12B 1U8PA 4R4FL 1ZSDA 2F54E 3LB6C 3O4OB 4WW2B 2EDRA 3P73A 3QXTA 1XAUA 1FL6B 2HTLC 3PL6C 2CDFA 1YECL 2H9GA 1VPOH 3AY4A 1ZLSL 2DIAA 2RQ8A 2WUBH 3QIWD 2IH1B 4PJ9D 3L3OB 3QIWB 3HC3H 1N59A 3ZZ1A 2R56H 4PLKD 2NY5H 4PJ9B 5K9OB 4Y16A 1NGZB 4XMPL 4XVTH 4FHBD 3T0VA 4JN2B 2FX9L 5ELIA 5HYJE 1WTLA 3GSUB 5ESQB 1KPVA 2OXGA 1NH6A 2HMIC 2JCCE 1BM3H 2I26N 4KKAD 3CU1A 2AJYH 3PG2A 3UPCA 1CE6B 1F13A 3BZFA 1Z0NA 2O93L 4J3VA 4Z7NF 4YDIL 4OZIF 4JFFB 2XFXB 5F9OL 1Y18B 3P77A 4WFGD 4OLVH 3PP4L 1ZV5A 5DTFA 1HKLH 2P42B 4W6WB 5EO9B 2QHRL 3QIBD 4RA0C 2GK0A 4LVOB 3QIBB 4OT1H 3BH9A 2NLJA 3RKDD 4OCSL 1X6NA 3MODL 5EU6D 1UWGL 1D5BA 5E1HB 5EOQH 5F1IB 1FFNB 3BPCB 5EU6B 3LKQA 1U36A 2BCKB 4L4VA 1CQYA 2DDQH 4U6YB 1WCBA 4WFED 4DGIH 3TIDB 3HE7C 1JVKA 3UTSD 3MQIA 4NYLB 3RPKA 2PYFB 3UTSB 4HPYL 5CUSL 4ONHA 4U1IB 2ZUXA 2VNCA 3MV7A 4LCUB 3VFOB 2ED8A 3BDBA 4XVSH 3NIFF 2WUBL 5B3JF 5HJ3B 4N9GA 3HC3L 3BPOB 4BSVA 4Z7VA 4PRHA 2R56L 2VL5A 3FQRB 2ZOLB 4M7LT 4XVTL 3AROA 4DKEL 1OSPH 1U95A 5I71C 1F2XK 1G0DA 5JA9A 4EKXA 1JF1B 5D7KE 3L5IA 5IFAH 1H9VA 3RDTA 1BM3L 3RU8H 4GRWB 2AJYL 1BVKA 2PYEE 1WC7B 1KV3A 1LDPL 3TYFA 1HHHB 5DK2A 4HT1H 1FFOA 1RUPL 4PJBF 3VE0B 4J1UA 4OIIL 3DXAD 3O0RH 3IJHB 2WP3T 5IVZB 2A6IB 3DXAB 1C16A 1FZOA 4JJ5A 1OB1B 3UP1A 4NJAH 2HT4C 5I17B 2P8LA 1MCIA 1U6AH 3HZVB 2F8VA 3GNMH 5LKNA 1BBJB 4OGXH 5EOQL 3ARFA 4LSSL 2XG5A 3FRPA 4L8BA 3ZHLA 3AGVA 2P5EA 5DRZB 2ERJC 4TPRL 4DKDC 1ZA3B 1FFPB 4I2XA 3L3KB 4J3WA 1TCMA 1I1AD 4JB9H 2X05A 2ICCA 3GSRB 4UTBL 2ITDB 1I1AB 1P84J 3MREA 4M5YH 1DBAH 1CGXA 5C09D 4KJWC 3M1BA 4PJCF 2A73A 5IB1A 1HYSC 2EKJA 2EDOA 5C09B 4EI5D 4I9WD 1J8KA 1I7RA 4ZFOA 3E6HB 4EI5B 4JRXD 2WQ8A 2EIBA 1KEML 4JRXB 2MQCA 1BECA 4GAYB 4ZDHB 2J88H 2R69H 4Y1AD 1A6ZA 2QKIB 3RU8L 3CVIH 5DEGB 4FQ1L 4PV9A 4Y1AB 5KVEL 4UOW1 1HZHH 1BREA 2F74A 2ESVE 4KUZH 1UM6L 5AZEL 5CJQL 1RIUL 1R5VB 5DD6A 3O4OC 4WW2C 2IPKA 3O0RL 1KENL 2DKMA 5HGBB 3ULVF 2EDBA 1DANT 1BD2D 4NJAL 3IGAB 1KIUA 1BD2B 4I0KA 5FGCB 1P5VA 3P4MB 3U9PH 3QIWC 4DWHA 3WXVH 3BEWA 1T1YA 3WIIH 4PJ9C 3FB5A 4Z7VF 3ARVA 4KROD 4F9LC 1CFQB 2O5ZL 4PLKC 1WITA 2DLIA 3C6LB 4KROB 4CMMA 5D93B 5DRWB 4KRMB 1A5FH 1TITA 4JZNB 4DKFH 4PJHB 4ZFZA 3L3GA 4M5YL 5LGHH 1AE6H 5TF0A 4KKAC 2JJVA 3U9UA 4Q97A 4PY7B 4UINH 1QKZH 4NSKA 3T77B 2AEPH 2E7LC 1XGYH 4M43H 3N85H 1SJXA 5ILTL 5IJKC 4XPTH 5KSBB 2H1PH 1UCBL 4LVOC 1A2YA 3DOSA 3QIBC 4HS3A 5J8OA 2DJ4A 4MS8D 3LH2L 4TVPE 4F7MB 1A7PL 3FO1B 1KCVH 1D5XA 1I7TB 1NDMA 3RKDC 4R26H 1KPRB 1HZHL 5D2LB 5FYKU 2X4QB 3BMVA 4KUZL 3SY0A 4HK0B 5IGXH 5TQ0H 1K3IA 3E6FA 2DLEA 4OZ4B 1V05A 4O2CA 5EFIB 5IVXB 3FQNB 3UBXI 3V6FA 1J0KA 4YPJA 4X8XA 1MWAB 3WMSA 4X5WB 1N5AA 1EEZA 2BNQE 3U9PL 4QRUB 3BPOC 3C5JB 5E8PB 3WIIL 1MRDH 3O45B 1KJ2B 3LIZH 2DWDB 4NM4H 5IMKA 2F54A 4N0FB 4PGCA 5F3HB 1JPTH 4UBDD 4X6EB 2LU4A 1J0YA 3V0WH 3WNOA 4K71B 3MLXH 3S5LA 1MQKL 5INCA 4X6FA 1NCDH 4DVRL 3SE4C 2V7HB 2YC1B 2HLAA 3VI3E 3PUCA 1KYOK 5LGHL 4ZPVA 5I1KH 3QNXA 1AE6L 3T2PA 1VSCA 2J2ZA 4QRTB 3CXHK 5IMMB 1QKZL 2UY7A 1EIBA 1XGYL 1CLZL 3N85L 1IGJB 1UM5L 4RGNE 4IMLA 4JFPA 2E7CA 2IQ9H 4J4PA 4XPTL 3LDBB 3AU1B 4R0LA 4KV5E 5HYJA 4BUGA 4Y5YA 2D4DA 3TO2A 3TCLB 1Q9WB 4JANB 5T3XD 1ZVSB 4FXKA 2JCCA 4TYUA 1T89A 4XCEB 3G6DH 3MUGB 3QQNA 1KNOB 3G08B 4NJ9H 4OZHF 5E6ZA 1S3KL 3DSFL 3QDME 3DGGA 2VISA 3GJEA 5TQ0L 1PZUB 1T66D 1FN4B 4JPWH 1P4LA 3KLAB 5HHOE 3RNQB 3U36B 5CS7A 2YKLL 3CFCL 1FL5B 3T04D 2XNAB 1I1AC 4FZ8H 4PPTA 3CK0L 2ADIB 4JE4B 4PD4J 3OKDA 2IJ0C 4LLVA 3T0WA 5FB8A 5DJXA 2W0FB 3VD4A 4Z8FH 1MRDL 4UT6H 4EI5C 3KNBB 4D9QE 1SJVA 1T2QL 4XWOD 2WBKA 2J8OA 3HZYA 2OMBA 1JPTL 3HTLX 4JKKA 1MFEH 3T65B 1J5OH 1HSBA 4G8FA 4N68A 5FECB 1NCDL 3ARGD 4JKPL 3FCTA 4BQBA 5D6CB 3ARGB 3F7VA 3QXWA 1OW0C 4FG6D 2FB4H 3VXQB 2CLVB 3CDGA 2Q8BH 3PV6B 1NSNH 3MV11 2YEZB 4OZFB 1M7DA 5ID0A 3OKNB 3MCKA 2X4SB 3MRNB 3PGFL 3HB3D 4LHJB 3VFTA 2LABA 3KHQA 1T7ZA 5H94A 3GGWA 1WGOA 2C3WA 3U0PB 1IAKB 5BQ7B 2P5WD 3GMRA 5F8QC 2B0SL 1T0MB 3HRZA 1I1FA 2P5WB 1LWRA 1MCCA 5SX5H 4D2NA 3EKCA 3T4YB 3C6LC 4KROC 5D93C 2CD0A 1MFCH 3UTOA 1DTUA 4BSWA 1IGCH 4XBEH 3GM0A 4NDMA 2A1WH 2DLTA 2XG4A 3LMJL 1A6WH 5CD3B 1C12A 4HEPG 5IB3B 1MCLA 1FO0B 3Q1SL 4WUUD 3CMOL 2OP4L 3O6FA 5JW3H 3VG0L 4Z8FL 4WUUB 3T0DA 1ZLWK 5JOFB 3CFKA 4OF7A 2L7JA 1GC1H 2UZXB 1KG0B 3QWRD 1MFEL 4OLZL 1J5OL 1CFTB 4G8GE 5EBMA 1P9MC 1U41A 3UTPE 3L9RB 4YGVA 1MRCH 2JCCF 4CN1A 5IKCB 3DX8A 1EO7A 2HG5A 1UXSA 1HH9B 4UQ3B 4O51B 2FB4L 4MS8C 2V5TA 4L3ED 1MFAH 4XWGH 5IBTH 4D9LH 1NSNL 2UWEA 3BO8B 4L3EB 4OB5H 2VXVH 5ICZB 3MR9A 3QISA 3MV01 1P1ZB 3IJYB 4JR9H 3UEZA 1U58B 4GXUN 3KPSB 5TE4H 3NZHL 5E56A 4ODWA 4WWKD 5GGSY 2ZCLH 1N5YL 4NQCA 4D0CA 1AD0A 4S1QH 5JA8B 4XHQA 4WWKB 1WISA 3WKMH 5I66B 4D0DB 1CS6A 5TPWH 3GI8L 4LEOA 4NQVA 2CRZA 4XP9H 1A3RL 1KCRH 2ESVA 4G9FA 3RIAK 2QR0A 3VCLA 1LO0H 3DVNA 3FT4B 1OWWA 4EUPA 2QQKH 5A2KH 5E5UB 1IGCL 4K71C 1W2KT 1RAMA 4UBDC 2ADFH 2XZAH 3GM8A 3MZGB 2VWEE 2GY7B 3IXAB 4EDWH 4JHZA 2XTJD 1FYTE 4GQ9H 5FHBL 5FKAA 1DUZB 2XTJB 3ARED 5C0FA 5JPNA 5B3NA 5I1HL 4N0RA 5KS9E 4O2FA 3SEPA 2VDOH 3HNVL 1YNLH 3F6IA 3AREB 4ODSH 4PR5B 1GGBL 3OR6B 3FFCE 3SPVA 1NCTA 1T1XB 3PWVB 3VWKD 1GC1L 3LDBC 4NT6B 4PJIB 3VWKB 5K93A 3QHFL 4HF5L 3T2NH 1JYXA 4MLIA 5CMAB 4PRAB 5CJ5A 1MRCL 4XWGL 4K3DH 2CDEA 1N8ZA 2CLZA 4OFYD 1ZHBB 4BK4A 4AH2B 1EFXB 4OB5L 3R0MA 1A9EB 1RJYB 1T66C 1N6VA 5EORH 2OX5A 2ZCLL 5F1NA 3WUWB 2ZOKA 2WWKT 1U8JA 5I8EB 6CGTA 3BRFA 5C0IB 3LD8B 4XP9L 2OM5A 4I8DA 1S7QB 3WBDA 4EVNB 2IALA 4FTVD 1CWVA 3X3FH 1FH5H 5A2LH 3SDCA 2AQ1A 2QQKL 4FTVB 3C6SB 4XWOC 5E08L 2GY5A 5I2IB 3TNMA 2VC2L 1F8TH 4O02H 1MWAL 4FNLL 5IV2B 1TZGH 3ARGC 4EDWL 3L6FB 5ID1A 4GQ9L 3QPQD 1G7MB 2BNQA 2H26A 1KJ2L 4FG6C 4YHMH 3EDDA 2OSLB 5KTEH 2VDOL 3CD4A 4MB4A 1IGYB 3RAJL 1E4KC 4ODSL 1JHTB 3MJ7B 4OCNC 4XC1L 5KOMC 4IMKC 5HHQA 1L0QA 4NHUB 1F4HA 3HB3C 4RQQA 5EU4B 5T1MA 2YD8A 5FO9B 3NTCH 1PY9A 1UQSA 3QUXA 1CXKA 2P43B 4E0RA 4YHZL 2Y5EA 4OFDA 2OMNA 2O5XH 3BT2H 2EE6A 3PWLB 3QFJE 4YHPB 4GMTH 5IWLC 4JHBA 5EORL 1DDHA 1UKSA 2XXCB 2IWGA 2ZCHH 3RX7A 1I3VA 3SDAA 1QQDA 2DBLL 2JIXA 5F9DC 4H26B 5I1EH 3R1GH 2YS4A 2XWTB 1WWBX 4UV4H 3QDMA 1Y6MR 3TA3A 5CBEA 2IBZY 4WEMB 4C54A 5J1AB 4YXHL 4FQIH 2AAVA 4K94C 4GH7B 5HHOA 4U1HB 2BY0A 1F8TL 2KBGA 4JY6A 1GGIL 3KWWA 4OV5B 2DD8L 1F3JA 1TZGL 2BOBA 3S3SA 5IUSA 3NIDE 4F7TA 3DLQR 1IRAY 3RY6A 4CGTA 4HKXA 4X80H 4OD3L 4NWUH 5INDA 2I25N 4WWKC 5E0QA 2KH2B 5F3BA 3OJDA 5CZVH 3ZL4H 4IHOA 5ESAA 1J9CT 1I7UA 1SY6L 3TWCH 5DMGD 5JDSB 4HWZB 1V8HA 4LCWA 4PRDA 4AIZA 5BJTB 3BP4B 5JOPD 3FAWA 4GKZB 5BZDB 1OSZB 1MCNA 1NC4A 3GSXB 3E3QE 4JJHA 2JK5B 2VZTA 4GMTL 3PWJB 1YC7A 5GGQH 5HHPA 2NY7L 2G5BA 2NXZD 4I13B 4UQ2A 4KRPD 2Q76A 3S96B 3SOBL 4QTIH 2XTJC 5HHNB 4KRPB 5MEOB 1UXWB 4EDXA 3IDXL 3FO9A 3AREC 4TUJB 3GSNB 4MDIA 3KG5A 8CGTA 4N0UE 3L95B 1A1OA 3GHEH 2GEEA 3VWKC 1OLZA 1NFIA 2W9EL 3LPFA 1NEZG 2VOTA 2MJWA 2B4CC 4XCYA 3VI3F 2AGJH 1FO0L 2AJXH 5EA0H 3CSBA 2GHWB 1K85A 1D5IL 3C9NB 5GRZA 3B2UD 4S2SB 2I07B 1H5BA 3MLUL 3CC5B 1MCOL 3RL2A 4K94L 4GFTB 5C0CD 4HEME 2PTVA 4KV5F 4NWUL 4G8GA 5C0CB 3VXSE 4LAQH 2FRGP 2ICWB 3CFBB 3GUTA 2BVOB 4QKXB 2XQBL 1MFNA 3I3BA 1NMCB 5TFSH 3HI1A 3MUHL 2AJVH 3LD8C 3PABA 4N8PA 4L9LB 1FC1A 1S5IH 1JPST 2W0LA 4XB7A 3E2HB 2W9DH 3U83A 2FZ3A 1UKQA 5F7EL 3WIHA 1ZHKB 3UYOD 3O4LD 4U6TA 1YYLH 3TBYA 3O4LB 2LE9A 5K9KA 1HN1A 4DTGL 1JF5A 5F1SA 4ZNCD 4LMQE 3SJVE 2A6KB 3HS0B 3MLZL 1S7UA 5GRYA 1DEEB 3DRTA 3TT3H 1SYVA 3GMQA 3QPQC 2R0LH 5CSGA 1E27B 3D39E 1AGBA 4LVNB 1HKFA 2DLHA 3V5KA 1A6VL 4X6DE 3GHEL 1CE1H 1CXIA 2XRAL 1KIRB 3EZJB 1KPUA 2Q6WB 2DQFA 3ALWA 4XP1H 2MCG1 3VFNA 5GS0H 3HC0B 1FYTA 1T5WB 2DQTL 5EA0L 5IB2A 1YEJH 5J56B 3GMLB 4KQ4H 3S6CA 3SE8H 1U8IB 1QSEA 4YHOL 3ZSTA 3RGVD 1N64H 4N1CA 3CSPA 1HEZA 3FFCA 3O6LL 3RGVB 2PW1A 4JFFE 4CN6A 2R9HD 3C8KB 3G5XB 1DQLL 1MREH 5A2FA 4CW1B 2GAZB 2VLKD 2DRUA 3PHSA 5H2BB 3EOYG 4C55A 4HXBH 3ALPA 3LV3A 3VRLE 4I5BB 1I9EA 2VLKB 3RWEA 2XQYG 1VFBA 1U3JA 2VZUA 2A83B 4MJ2A 2BY3A 1S5IL 3RZWA 3MACL 2A9ML 1I8LA 2W9DL 3WD5H 3B2VH 1W0VB 3KPNB 3WDIA 4PYGA 1JE6A 1YYLL 1FNGB 2VLRE 4N1HB 3MGOB 2YPKA 1YPZB 4IS6B 3EYQD 3AMKA 5JQ6H 5EBLB 3TT3L 3O3DA 5SWQA 2E8ZA 3OX8B 2XT1B 3QO1B 5MHSE 4X9GA 3WNLA 4P5MB 1DE4A 1HHIA 3C8DA 4O9HL 1CGSH 5CHNA 5EPMA 5FK9A 4MJ5A 4Q6YA 4XVJH 4XP1L 1ITBB 4HH9B 4RMRA 4X9BA 3GZKA 4KQ4L 1JPFB 1YJDC 3SE8L 1NBYB 4N8CH 5DMGC 1KLUB 3PJSB 1X9QA 3SKJL 1KLGB 3JWOH 1WT5C 1HNFA 2OR7A 2C7UA 5E6IA 1JCKA 5FV2A 4XGZB 1YNKL 5ICXA 1NFDB 3ZO0A 1MREL 5D6DA 3L3IB 1AR1D 4ZUWB 1X7QA 1PLGH 3PWPE 5EC1B 4PTUB 2P24B 3CSYA 4KRPC 1INDH 4HX1B 1HSAA 1KJMB 2YA2A 4P4RB 3BRDA 3P4NB 5T3ZD 1A6UH 5DRXA 1BQHB 2R39A 4JY5H 3QFJA 4OIBA 4XT1C 3WS6C 5B38B 4OIAA 1LE5B 3I02B 2XPGA 5CIPA 3SQBA 1NBZA 2BFVL 3TBWA 2K7QA 3DPBA 3U82B 1LK2A 5KS9F 3A0OA 3B2UC 4K9EH 1DP0A 1C08B 1XGTA 1WICA 1PSKH 1OP9A 3OAYK 4I9WE 5SX5K 3EYUL 3DX9A 3S4SG 3UTZA 2IAMD 2APVA 5FDWB 4ACPA 4OKVB 3FQXA 1DR9A 1NMCC 4QHMB 4GG6E 2IAMB 2Y06H 4Y2DA 4L9LC 1KFAL 1QA9A 4N8CL 1HQ4A 2NZIA 3QB7C 3D5OF 3E2HC 3FOLA 1KELH 1G0YR 8FABB 2HKFH 4HXAL 1B4JH 1SQ2N 3O3EB 4PTTB 2BXZA 1XCQB 3DMMD 4WIQA 1H3PH 3H3PH 3Q3GB 3DMMB 4YE4H 1PLGL 4JHWH 4WJ5A 4X4XB 1YJDL 1INDL 1KLFA 3IDUA 3QXVA 4LVNC 3TT1H 1OHQA 4G42A 4JY5L 3JBG7 4U2YA 4NM8L 2R4RL 3MLPA 1N4XL 2FATH 4F57H 5TDPB 3MBXH 3KPQA 3MMEB 4DFHA 3DI3B 4LF3B 4QRRE 3GSNL 1MFBL 2A0LD 2DS4A 3PHQA 4U1KA 1P53A 3GB7A 5E03A 3RGVC 5J12B 3B5TA 2VXSH 3DTXA 4JFYA 2R9HC 1PSKL 5MEND 3T2QA 1XGUA 5KSBE 5MENB 4BH8B 1U8LB 5HI5D 1OGAD 3DYMA 4G9DB 2NTSP 2FJFB 1X4YA 2DWEA 2E5EA 3D85D 1I9RH 4XZUA 1KELL 1XGPA 4FQXA 3D85B 5BS0E 2BVPB 3FB8A 5KSAA 5DF0A 4KZEL 3OF6A 5JXAL 1G6RH 1OVZA 2DL2A 3H3PL 3VXSA 3DV6A 3QG6A 3DUUA 4ZOEA 4YE4L 2D7QA 5B39A 1J0ZA 4XCFH 3X13A 3EYQC 5LXGH 3K8LA 2EYTB 3GBML 1Z3GL 4XPBL 4TNWK 1TMCB 1VADA 3TT1L 4U1GB 1KIQA 1HNGA 3MA7A 5F97E 4IEFB 3BZ4B 3AAZA 5DJYB 2HFGH 5DUPH 1R3IH 2BNUA 1RV6X 3IFLH 4AT6A 3C08L 2FATL 3SJVA 2OZ4L 4MQ7A 1GGYA 2PKDA 4NKIH 3MBXL 2BNRE 5ETUB 2GJ6D 3D39A 3BESR 3NIDF 3L5WB 4M6OL 3RI5F 5DMIH 2GJ6B 3THML 4R90H 1L6ZA 1IAII 2BY1A 4X6DA 1LNUB 3LCYA 1LD9B 2Y07H 4XHJD 4IDJL 1W0WB 4TQEH 5JHDE 4JM4H 3LSOB 1CIDA 2NY3D 1AR1C 1TCRB 1FBIH 1I1YA 2NY3B 3P3YA 4MD4A 4R7DA 3BSZH 1S7VB 4JN1H 4JRWA 3GJFK 4P2QE 3CPLA 4D3CL 2G75B 3O6KL 4NQXB 1AP2A 4ZG1A 5IHBA 3OKMB 4G8IB 1ZGLP 5I8CB 1SEQH 5CLTA 5A16A 5FGBA 4KVCH 4XX1G 1AIFB 3BP7A 5DFTA 2HRPL 2MOVA 2BJML 5DHYB 3N1QC 5LXGL 2FWOA 2APWA 1WBZB 1UB5A 2QBWA 4OZGE 4PP1D 4X99A 2GKIA 4XXDA 2GITA 3MYZA 1XEDA 3OAZK 2LVCA 5CFHA 5J4MA 4XP5H 3HPJB 3VH8G 1EMTL 2HFGL 3MX0A 2VLRA 3PIQA 5CEXA 5E4IA 5EBWA 4HC1H 3SKNB 1YUHB 3ULUD 2BSED 4F33B 1I85C 3FONB 2IAMC 4NKIL 3SGKC 3UJTH 3QQ9D 2VZVA 4G5ZH 4U0RB 2FO1A 2X4UA 1S7RB 3H7BB 1ZHLA 2NW3B 4K7PH 4P3CL 2V17H 2FHCA 2AXGA 1FVDA 2DTML 5IFJA 3MV9D 3GIZL 4GKNA 2Y07L 3C2AH 4TQEL 3N50A 4QHUA 5D7JA 2JLLA 3DMMC 4JM4L 2ZCKL 4DCQA 3S98A 3MJ8B 5BMFH 2AEQH 5C08D 4JM2D 3VFPB 1L0XA 3BSZL 1R0AH 3U0TA 2D2OA 2J4WH 3HFML 3QEUB 5C08B 4JM2B 1EO5A 4FQQB 3V6ZA 1G9ML 3QZWB 3MNVB 4FFYL 4YO0B 4MX7A 3PDOB 5CKAA 3MFFB 4HWEH 1IAOB 2RR3A 5DQDH 5JW5A 2Z91A 5JQHC 1XIWD 3PWPA 1Z6JT 5DQJB 5J0BA 4LLWA 4MA1B 1XIWB 4XNYH 5DMKB 4RAVA 3ZKXB 4HPOL 1QSFA 1OTUD 5GRJH 5T3ZL 1P7HL 5J12C 3TF7C 2A0LC 4YWGH 1QZ1A 5JIPA 3QWQB 2AVGA 4ODHH 4X6DF 4OLYL 1ADQH 4LDEB 1U3ZA 2VXTL 3LN9A 4F8QA 3TBVA 1KXTB 3MRHB 5IB5A 4U6HB 1T0NA 2NW2B 3GMMA 3OGOE 5HI5C 2DQDH 4H0HB 2V7NA 3B9KB 2D7TH 4ZSOA 3EYSH 3QNZA 4L8SA 3A6CH 1B2WL 3RA7H 2V17L 4HUXA 2FIKA 3HHRB 1TVHB 1VB9A 1IKFH 3LOWA 2CLRB 4JFZH 1AGCA 1INQB 5D7SH 3R4DA 3KPSE 1VACA 4ODUB 4DZ8B 1EAPB 3VRLF 2JJSA 2K9UA 4V1DD 3VXTB 1P5UA 4IJ3B 1JWUB 1R0AL 4V1DB 2CJUH 1CXHA 2J4WL 1QYGH 4KWUA 5HXMA 1HH6B 1MLBB 3HAEH 4U1GC 5DO2D 3W9DB 5I1JL 2HLFD 4K8RH 5CCKH 5I73B 3CXHJ 3B6SA 3MLWH 1YY8A 1ZWIB 1SM3L 5H37H 4MWFB 4HWEL 1RZJH 5E2WH 2YD2A 4XPFH 3AB0B 5HHXL 4BUHA 4XNQA 3CFEB 4QT5A 3O3BA 3ARQA 3X14B 3WL9B 1JYNA 3NH7L 3BUYA 2XI9A 1QFWI 4RFEA 1IEAA 1XR8B 4Y5XA 2LU7A 4BM7A 4OF5A 1ADQL 1NEZB 2BSRB 1JGUH 4XHJC 1FHGA 1MJJB 1FVCB 3FB7A 2ZJSH 4LSUL 4DJMA 2Z9TA 2NY3C 5BVJB 4LNRB 1CD1B 1YC8A 4M48H 2W38A 4L1DA 4DGYL 4GRWF 1KUMA 1LO3L 3WO4B 3LQAH 5EG6C 4X6BB 4BJLA 1BLNA 3A6CL 2DMCA 5GSVA 4ZUVB 3RX5A 4KGLA 3VRJA 2AS5M 2CIKB 1A1MB 3TLRA 4LPTA 5I1GH 5E8DL 1AXSA 3VXNB 1JI1A 3DX6A 3TVMD 5AWNH 2NNAB 1WCQA 1ZT7A 3KPTA 4NNYB 3TVMB 2Z93A 3LHPH 4PJFE 2Y36L 3RIFK 1NUFA 1W72B 3FO2A 4PJ7E 4U1LA 5FM8A 2EH7H 5I30L 1E0OB 3KPRD 4PP1C 5HGDA 4HGKC 4YFLF 5BS0A 4WTXA 2FJGB 2VDPH 2EDYA 3CX2A 3KPRB 1MI5D 3HMWH 1DFBL 2AV7B 4LL9A 1MI5B 3TO4A 3UJIL 3Q2CA 1FG2A 2IADA 5E2WL 2X09A 1EJ6A 4XPFL 4Q2ZA 3IDMB 5DSCB 1M05A 4U0RC 3WS3A 3ULUC 5DC0A 3QQ9C 3QA3B 1I8KA 2P8PA 3LKPA 4NRXA 2C4FU 2XZQL 3K74B 3ALXA 2F58L 2VUOA 3N1PC 2GSIB 2GTWA 1JGUL 4MD0B 1ZHNA 3D3VD 3RWFA 2QV2A 4AM0B 3VXPA 3CZFA 3EYVB 2FJHB 4Z0XB 3D3VB 4OFPA 5E7FA 1HHJA 4XH2B 3FRPG 1RIVH 4GG6F 1JYVA 5HHMB 4JZOB 2BNRA 1AGEA 4P23D 5EU3B 4JM2C 1MUJB 5GS1A 2R15A 5FGRA 4P23B 4HKJA 3QNYB 4Q7DA 4UDTB 4X7EC 4TULL 5FGSA 1MPAH 4MDJB 3H0TA 4YHNB 2B5IB 5JHDA 4QRQA 5C6TH 1NGXA 3GSQB 4PJDA 1BZ7B 4TOYL 5DA4A 4MA1C 1RZ7L 1XIWC 4PGDA 5T5FH 3Q0HA 4JQVC 3LHPL 1S78D 3ZKXC 1BGXH 2GQHA 1UA6L 1N0XL 1S9KC 2EH7L 4LLAA 4P2QA 3VD5A 1OTUC 3JTTB 4LLMB 2APTA 2VLJD 4Z0BH 3MNWA 1YEFH 1P4IH 2VLJB 4RAHA 4L4JA 5DYOB 5TQ2L 2YBRA 3RWJA 3WLWD 4QXTA 1HOCB 3T0EE 5HPOA 2QADD 3B9KC 4OZGA 1KBGH 1P7QD 2DQIL 4OF3A 1CFNA 3HN3A 5EIIA 5C9JB 1F4YH 1P7QB 3MRDB 2R1XA 5D96B 4JRYD 2QTEA 1CT8A 3VGEA 1C7TA 4LSVH 4JRYB 1DQJA 3S88H 2EYSA 5KSBF 1T22A 4MMZC 5DJDA 5HYEA 3V4PL 3ULUL 2VH5L 4JQXA 3O8XD 1RIVL 4IJ3C 3HCVB 3BGMA 3O8XB 4NKQB 4NWTL 2CRMA 2P44B 3T4AA 3TC9A 3KPMB 4TTGA 3NCJH 5I73C 3PHOB 5DO2C 4OCMC 4LQFH 4HW6A 4X9HA 2HLFC 1I8MB 4CNIA 3X17A 2EIZB 2QJDA 5I75B 5EWIH 1UJ3B 4G6KL 2W60A 5GIRA 3AB0C 1EERB 2Q1EA 2ITCA 4LSRH 3VXRE 5T5FL 1DQQB 1KT2A 1BGXL 3MGTA 3BEVA 1QRNE 4GW1B 2YD3A 4NRZB 4H1LH 4FA8A 3BN3B 4NO3B 3MRKB 1DN0A 1CD9B 2OLDA 1LEIB 3MRQB 1XGRA 1ZLUH 2VDRH 1YEFL 3PXJA 1S9XA 3QDJE 2OS7A 3PE9A 1K8DA 1CDBA 5GRWA 5J06A 3K2MC 3AM8A 1HILA 3ARSA 4Y8DC 3QQ3A 4LHQB 1CDJA 3WO4C 4C56D 1S5HA 2H3NA 2ZSWA 4TSAH 2B39A 2OTUB 4L5FH 4HJGA 4WTZA 3SE9H 4C56B 1HCFX 4PJ5D 2GJJA 1Q0YH 4PJ5B 4LSVL 2MFNA 3S4SB 4GUPA 1Q94A 5FAAA 3U4BL 2QSCL 5BXFB 3MRJA 5GS2H 1BVZA 2VXQL 5CILH 3TVMC 1Q9LB 4H88H 1QOKA 1PDKA 1GGTA 2V2XA 3S5LG 3MA9L 4KMTH 2HN7B 4LQFL 3MRCB 5DGQA 3ZYJA 1E4XH 5C0DB 4UUJB 3V4VH 5HI4D 3OXRB 4Y4FD 3QDGD 2OJZH 5IBUG 2F15A 3IETB 3PP3H 4R6UA 4Y4FB 3QDGB 2ARJB 4NKMA 4UDUA 4LSRL 3T09A 1YDPB 4ORGB 4ODBD 5LWYH 4M9PA 3VFRA 4OZGF 4JVUA 1UWEL 3F65A 3F7YA 3VFSA 5L0QB 4NO5A 4FQHA 3V95A 3IXTB 1A8JH 4CVXA 4Z76A 1AQKH 1XF4A 4CDGC 3CLEH 1QNZH 2HFTA 1OT1A 2OJEA 3UMTA 4KUCF 4GJTB 1V3LA 4WV1B 4P23C 5KSUA 4L5FL 3SE9L 3DVFA 1ZLVH 4OJFL 2NTFB 2CMRH 2NY0D 2B5IC 1G7IA 5I1AA 1BOGA 5IW6A 4JZJB 2NY0B 4FQ2L 4YDLB 4YDKH 1Q1JL 2EIEA 4OD2B 3O3AB 5MEQB 3MRPB 4P46D 1JV5A 5CILL 4X7CC 5IW1B 5ACMA 1UCTA 1ZK9A 4P46B 1S78C 1IGIL 1YYMH 2AK4D 4KU1A 1PG7H 5AZ2H 3WNNA 1OF2A 3BKMH 2AK4B 1X5XA 4KMTL 1IL1A 4A6YA 3SE3A 4CN4A 1HHKA 5F7HA 2DIBA 2UVEA 3S36X 2F8OA 1K4CB 1N7MH 3V4VL 4NBXB 1E28A 2OJZL 1ZGLA 2VDMH 3WLWC 2Y6SD 3N1FC 1W72L 3O9WD 4PJFA 2CRIA 4GG8A 4UOW0 4XP6L 5D9SB 1YMHB 3GMNB 4PJ7A 3O9WB 4UNTA 1DUYA 4B50A 5DJ8A 3DJ9A 2RFXB 5KVDH 3MV8D 4C4KO 4M03A 3KS0H 1T20A 5D96C 4APQA 4WUKH 3MV8B 1AQKL 1PY4A 2YZ8A 3F7RA 1F00I 1FDLH 4WGWB 5E2VL 3TBTB 3NPZB 3QCVH 3QR2A 4J3SA 1QNZL 5C0JB 3RZCA 2J8HA 3O8XC 4QHKI 1RHFA 1X5IA 4R9HA 3NFPA 1JN6A 4ODVH 5I6XB 4IRJD 3OAUH 5DD0L 1T1WB 3LQZA 5I75C 3GSOA 4U1NB 1JTOA 1UJ3C 4IRJB 5L7XH 1BX2B 3PWNA 1O7VA 1NFDE 5FYJL 4AEHH 1F3DH 5E2UH 4KDTA 3QEHB 4R96B 5DJ2A 1GCFA 3AXLB 4JDVA 3U6RB 2UYLB 4NPYB 3SGJC 2E27L 5MP6L 4IDLA 1RK1A 1U92B 1QPPA 1P6AB 1MEXH 3JV5A 4YAQB 3OPZL 2YD7A 1LO5A 4KMLB 4UIMB 1CL7I 5E5RB 3B3IB 4IIQB 2C3VB 5D2NB 4KJQD 1NMAH 1KB5H 3U30B 1CFSA 2VDML 4XBPA 2VR4A 2BRRH 1FLRL 4G7YH 5KANG 4GRMA 1J8HE 2PCPB 5J3HD 1N3NA 1KTKE 1PGRB 2CUIA 1BQLH 2WNGA 4O58H 3ARDA 5DZNA 2VXUL 1B0RB 4M61A 4ONFH 4OZIB 4YDVB 4IOSD 2MMXA 4XP4H 2VLLB 3T0EA 25C8H 3QCVL 1DN2A 1BFSA 1TZHA 4X0KB 4NZDA 1GOFA 4FQJH 3RWDA 1T2JA 2A6DB 1IC7L 1S7SA 4ODVL 5GISH 5BW7C 5ADPH 4R8WH 1QFPA 1Z5LA 2R23B 5EUOB 5GGVH 2NR6D 5CKGA 5L7XL 5HI4C 1LP9B 5CWSA 3X12B 4Y4FC 1CYGA 4KVNH 4AEHL 5GJSH 5IB4A 1NBQA 4PJFF 4R7NA 4F3FB 2M26A 1AY1L 2ARJQ 4OI8A 4PJ7F 4NUGH 4HFUL 4I48B 3STBA 1NLDH 4MD5A 4WHTB 5CJXA 1T5XA 5L0QC 2JB6A 2CKBB 1P4BL 3WYRA 5DUBB 4XCNB 2DN7A 2FR4B 4KK9D 1NMAL 4KHXL 4L1HA 1KB5L 3FB6B 1A14H 3G5VB 1ZT4B 1BJ8A 4WV1C 1U8MA 2KQNA 1N6QH 4L4TA 4WO4A 2GIYA 4MJID 1R6VA 2BOCB 3LEXA 5FUCE 3QJFA 4MJIB 2VAAA 4HG4J 4ODXA 3JTSA 3BP6A 4JZJC 2I24N 1GPOL 2NY0C 4ONFL 1WVZA 3QDJA 4YDLC 3OHXA 1H3VA 2GUOB 5T1KA 4RIRA 4PJBB 2VKWA 4HWBL 3BUTA 3T8XA 1ZSDB 5HVHB 25C8L 2CK0H 3P73B 4P46C 4TVSa 4LIQH 3IRZA 4H8WC 5DEZA 2CDFB 2H9GB 5GISL 4LPVA 5ADPL 1YMMD 4RISH 4KC3B 4LARH 1ZKAA 4U2ZA 1YMMB 3LKSA 4RZCB 4WHCA 1GSMA 2HFFA 4LPYA 3ROLB 3VFGH 3TN0D 2Y6SC 3ULSA 3O9WC 1ZOXA 1FAIH 5FCUH 4NUGL 3GKWH 4H25B 4ODTL 1CXFA 1KPVB 4XNMA 1QHPA 4XNZB 4PJCB 1TJIL 4EZMA 4HIIA 3BZFB 3AS2A 1U8OA 4M4PA 2FD6H 3P77B 3D2UA 3QRGH 1H3UA 4EI6A 1N6QL 2GK0B 2RAMA 1FZJA 1EGJL 3SBWC 4OFKA 4E42A 3BH9B 2NLJB 1L0YA 5I6XC 5B22A 3RWIA 4ZUUA 1FIEA 4X6CE 1PQZA 1BWWA 1D5BB 2A9NH 4IRJC 3K2UL 4WI6A 4L4VD 3LKQB 1LK3L 3CFJA 4L4VB 1HK6A 4NNXA 5DK0A 1IBGH 1Q9OA 4LLUA 3RBSA 5E00A 4LIQL 4ONHB 5IP4A 3MV7B 1NANI 4DQOL 4GKSA 4PRHD 3EHBD 4N9GB 3VFMA 4IIQC 4FFZL 5EOCL 5D2NC 5GZOD 1AC6A 1CK0H 4Z7VB 5I1IL 4PRHB 2VL5B 3DV4A 1A7BA 3U30C 5L6YH 2BRQA 2OR9H 4KJQC 3BISA 2GSGA 3HLAA 5EZOL 1U95B 3VWJA 5IESL 3PNWA 1NAMH 2K3TA 1G6RA 3RDTD 4H8WL 3QUYA 5J3HC 3RDTB 4NFDA 1TETH 4YHYB 3RX8A 1BVKB 2K7PA 3V52H 4UTAL 1NAKH 1LGVA 3TYFB 1RUAH 5DK2B 1UVQA 2XA8H 1FFOB 2VKXA 1TJHL 4L8CA 4K55A 4J1UB 2D03L 1HXYB 3U0WH 7CGTA 2Z31A 4PS4H 1QBMH 1C16B 1M4KA 1W0YT 4JJ5B 1MAMH 2VN4A 3KLHD 4B5EA 4B7IA 2P8LB 4M6AA 1NCBH 1MAJA 3BQUA 2IBZX 3L3DB 2EH8L 3ARFD 4WCYH 5JUEH 5AG8A 2A9NL 4ZTPL 5FYLH 3ARFB 1QUNA 2NR6C 1JNNL 1CGWA 5E8EA 3HZKB 1HINH 4L8BB 5CD5D 3OJ2C 2H8PA 5A2IH 1GGUA 1NC2A 4YR6A 3MREB 1JGLL 2WK2A 1JNHA 1KC5H 3JWDH 3M1BB 2A73B 4KI5E 1GYAA 5AD0B 1I7RB 4KK9C 2QQNL 4ZFOB 1H8SA 3ILPA 5DVKA 2OR9L 4KAQH 1MIMH 1JNJA 3CSGA 1S9WA 3STLA 3MSPA 4L8DA 3Q6GH 3T08A 3R0NA 4ZNEE 5FF6A 4FZEL 2EDHA 5GRUL 1NCCL 1A6ZB 2X4NA 2B1AL 2X1PA 3V52L 2EIDA 3KAAA 1RUAL 2DM7A 2F74B 2XA8L 2C9AA 2D7PA 3O2DL 3IFPA 5HVHC 1S9YA 4LOUD 4U4BA 5DD6B 2IPKB 1J8HA 4FABH 4HC1A 5SV3A 2YXFA 1MAML 2Y1VA 3AY4C 1UENA 2KPNA 2E7BA 4LK4A 1KIPA 3N1GC 3PL6A 3DYOA 1IAMA 3BEWB 1T1YB 4XRCA 5FYLL 1INEH 3FB5B 1HINL 1IKNC 2F5BH 4F15B 1TJGH 3MUZ1 2MCPH 2VZSA 3UO1L 4CMMB 5C7XH 5KG9A 2I9LB 4JO2H 3IU4L 2I60H 2X1WL 5DVNA 3MRIA 4M00A 5FXCH 4NC0B 3BJLA 4XNZC 2IANA 2YN3A 4OCWL 4ZFZB 3L3GB 2IMMA 1KC5L 3U9UB 4Y7MA 1T7WA 3BE1H 3WFHA 4NSKB 2YPLA 4IM8A 2O26U 2AK1L 4KAQL 2WSKA 1MIML 1ACZA 4QYOA 5SWSE 1A2YB 3Q6GL 4HS3B 2CKBL 1A6AA 2WLZA 3UC0H 3T3PE 1NDMB 3T2OA 5BO1H 3RNKA 4LLDA 2EICA 3WNKA 2IPUG 4TNVF 1ADQA 3E6FB 1R3HA 4UI2A 5IK3A 1EO8L 4O2CB 1EHLH 1DBBH 3V6FB 4ETYA 3FO0H 1MHPL 1P84K 3OXSA 5DJ0A 5ESVA 4F2MA 3O6MH 4MB3A 1EEZB 3JV4A 2H6PA 5ERWA 1NUDA 2F54D 3EHBC 3PGCA 3P30H 3MLVH 5GZOC 1NFDF 2Z35A 5IMKB 2F54B 3W5NA 4PGCB 3EFDH 2XZCH 1MCQA 3EYFA 1HDMA 5F7WC 3IS1X 4ISVA 1LEGA 4KI1A 5CSZA 4HIXH 1GZQB 4M6NH 4R4BA 3IDNA 4WWID 3RDTC 5INCB 3S5LB 4X6FB 5D7IE 4YHYC 3QDAA 2HLAB 5I8OL 4AENB 5AAWA 1T7YA 3AC0A 5HPMA 4ZPVB 3QNXB 1SBSL 5DS8A 1YQ2A 1ZLVK 3HAEA 5IBUB 5JORA 3KPRE 3BE1L 1TVDA 4J4PD 4JO4L 4NQEE 1TTGA 4IMLB 5HYJD 4MNGE 1DANU 1NGQH 4JFPB 5E8OA 5LG1A 1AO7E 1BBDH 4R0LB 4N90E 4U6VL 5HYJB 1BMGA 4Y5YB 3TO2B 4FXKB 3KLHC 2JCCB 3V6OE 1L7IL 4OGYL 3QXDA 5ADOL 4YHKH 3ZKND 3G6AA 3ARFC 4UU9A 5C0AE 3HNTL 2DJSA 5M94B 1E4JA 2VISB 3DGGB 3GJEB 5CD5C 4X98A 4FP8H 1P4LB 1DQDH 3U1SH 1MCJA 5HHME 5FYJE 4MJ6A 4KTDL 1BPVA 4BFIA 3PF2A 4X6CA 4LNVA 5B21A 5HBBA 1RZ8B 3OKDB 4Z18A 1OARH 1QSZA 3CXDH 4XI5D 4LLVB 5FCSH 5FB8B 5DJXB 2QL1A 3P30L 1RJLA 2FSEA 3QUMH 3A67H 4QHKJ 2XZCL 4TN9A 3INUH 3HZYB 5DRNA 4ONGH 2ZG1A 1EX0A 3CCHA 4HIXL 1HSBB 4G8FB 5ISZE 4KJYA 1JWMA 1CR9L 1DQTA 3FCTB 2W92A 3F7VB 5HHVH 3U2SA 3WFBH 2EDQA 3CDGB 1I1CA 2WQRA 5FIEA 4NQUA 4GLRI 4K23H 3KPPA 3BD3A 5D7KD 1M7DB 2EDTA 5ID0B 4HUNB 5C8JA 3JSSA 4LOUC 5IVNA 2DF3A 2OL3H 2VDLL 3MOAH 4FOMA 5ANMA 3VFTB 3H8NA 1XF5A 2Y5TA 5E9DE 5H94B 2PYED 3GGWB 5I18H 4K7FA 4DEPB 2X1QA 2DQGL 3NBNA 3GMRB 2BX5A 3HRZB 4EXKA 4F8TA 4F15C 4KMQA 5KW9L 3BI9X 3DO3A 3DVGA 4KXZH 4NZRH 5HDQH 4BSWB 2E8YA 2EXYD 3U1SL 1QFUH 5TE6L 1GOGA 4XNXL 1C12B 2DAVA 3WFEH 1U93A 3NZ8A 4JVWA 3GSUA 1Y6NR 3P40A 4OUUA 5LVEA 3NABH 2CUHA 1WIPA 2IPTL 1OARL 3CNKA 5GHWH 2VO5A 3O6FB 1VCAA 2Z4QA 1CE6A 4Z7QE 3S9DB 3CFKB 3ESVF 2I9TB 2OTWA 3D87B 1PVHA 4BFEA 2CH8A 3P0VH 5EBMB 5GRVL 1GAFL 5IJKA 4PGBA 4YGVB 3LS5L 3STZA 2HG5B 2UZIL 1UXSB 5HHVL 4YQXH 2FCBA 5AUMA 1F6FB 3I50L 4ZFOL 2VE6B 3V7MA 5HDLA 2Q8AL 5TGBA 4K23L 5EU6A 3IVKA 4S0SD 4LRIA 1T0PB 4NQCD 3W2DH 3TBSA 4ZNEA 4NQCB 4D0CB 1AD0B 1G1YA 5EC2A 2EYRA 3ISWA 2FBJH 4NQSA 5F7YC 4JPKL 4XPAH 1YEDA 4X6CF 5ACZB 4Z95H 2ESVD 4LEOB 4NQVB 4ELME 4Z78A 4LCUA 1UB6A 1XFPA 2ESVB 2QR0B 5D72L 3VCLB 4PJ5E 5F9AC 4EUPB 4I77H 3ROOA 1DZBA 4NZRL 2OYPA 1FRGH 3HE6A 4DKAA 3VFWA 4AK1A 5DVOA 1EZVY 5GHWL 4GMSL 4O2FB 4JFXA 2EDEA 2IGFL 2DQCL 4KK5D 2X4PA 3SPVB 4J4PC 2E9WA 4R0LC 1T04A 1F90L 4Y5YC 3L7FA 1G6VK 3MRGA 5I16A 1FZMA 1T89C 2LAAA 4JQIL 5LBSL 3ZKNC 2D0FA 3KPOA 2CDEB 1N8ZB 2CLZB 3MCG1 3FQUA 1TNMA 3S35H 4R3SA 1IGFH 4KK6D 5EO0A 5GRXG 5SWSA 2VDKH 3RY5A 3H6JA 4YPGA 1BQUA 2P49B 2FEDD 2FYYA 4M7KH 1IM9A 5F1NB 4TVPD 3ULUF 4H0GA 1CD8A 2ZOKB 2BC4A 1J7VR 2FBJL 2FX8H 4N0YL 4JFOA 5E8NA 1U8JB 4Z95L 4LIQE 5DFWH 3NFNA 5F7MC 2HT3D 3GSRA 3MBEA 4XI5C 1KN4L 3SDCD 1RJZA 2IALB 4OLWL 3SDCB 5CZKA 5HYIA 4LSTH 5EULV 1S8DA 3E6HA 2N7BA 1FRGL 1CDYA 3AVEA 4QRSA 1FORL 1JPGA 1KACB 1MHHA 2BNQD 2AEWA 5ID1B 2BNQB 4KI5F 2H26B 1JTTA 3C5ZA 5IT2L 3NIGE 4NFBA 1X5LA 1ZANL 4NGHH 1F02I 3ORJA 3AS3A 5HGAA 4LU5H 1S7TA 4CVZA 4LAJH 2DM2A 5D7IA 1TPXB 3VXME 4DEPC 2EC9U 1A4JA 3QRFM 5T1MB 5IFHL 4LBEA 1GH7A 1UQSB 3FQTA 4D0BA 3CIQA 4E0RB 4RGND 3S35L 4NQEA 2ORBH 4RGNB 4CU8A 4ZD3H 1AO7A 2EXYC 3MXVL 3SDAD 1KCSL 4OI7A 1DDHB 2JIXD 4FQLH 4M7KL 3KGRA 3V6OA 3SDAB 1QQDB 2JIXB 2FX8L 2EZ0D 1XZ0A 2D9CA 3QDMD 4WRLA 3TA3D 1AD9A 5C0AA 3ARUA 3QDMB 1JZ8A 3TA3B 1D6VL 1C1EH 1VGEL 5HHOD 3I2CH 2DQJH 1ZXQA 5HHOB 3A6BL 4OTXL 3HI6H 4YFLI 3BWUC 2B1HH 4JY6B 1IT9L 3KWWB 5GPRA 2XYCA 1F3JB 2BOBB 2V2WB 2BHYA 1P9MA 5L88L 4D9QD 2LTQB 5EZLA 1FNHA 4F7TB 4QHLA 3FMGH 1SEBA 1KPRA 3X3GL 4HKXB 4MSWA 4ZUTB 2ID5A 1G7JA 4Y5VA 2B2XH 5INDB 4LU5L 4BQ9A 1FVEA 5ISZA 1X5HA 1B4RA 4LEXL 5F3BB 4P5TD 5IVXA 3NA9H 3OJDB 4IHOB 5DURD 3T3PF 1I7UB 1UZ6E 5DURB 3IDGA 4X5WA 3LKNA 4PRDB 4AIZB 4RFOH 4LPCA 1R3LA 3HC4H 4M8QA 1VKXA 5FYLE 4ZFFA 4QY8A 1CDCA 4OQTH 4U0QB 5GZND 4X6EA 5E9DA 5HHPB 2G5BB 5DJCA 4UQ2B 2Q76B 1PZ5A 1J10A 4EDXB 3EO1A 3FO9B 5EUOE 1F58H 4M6MH 4MDIB 1AKJD 1C1EL 1DQMH 1MCBA 5DD1H 4KK5C 1DEDA 4U7MA 1A1OB 1LP9E 3I2CL 2DQJL 4G43B 3MXWH 4X4ZA 2VERN 5D7IF 5FM5M 5A3ID 4XCYB 4F7PA 1GRWA 5C92A 3K8KA 5D5ME 5DVLA 1H5BB 2YPVH 1JTPA 3FMGL 3QCTH 5EN2A 3RL2B 4G8GD 3UTPD 2WUCL 3KLDA 4KK6C 4G8GB 3SCMA 1KB5A 1QBLH 4H5SA 5SWZE 2FEDC 3NA9L 2YA1A 4FXLA 3GUTB 1JRHL 1FL5A 3HI1B 1UACL 1W8OA 1V7NL 2XNAA 3PABB 3V0VA 2FEEL 4HMEA 2HT3C 2Z8SA 4LCCA 1MNUH 3SDCC 1OT2A 1MCHA 3P4LA 3VGFA 3WN5B 3TBYB 1MRFH 4OQTL 5K9KB 3BKCL 5LAXA 3RHWF 3T65A 1B88A 5DT1L 2QHLA 1ACYH 5ALBH 1S7UB 3BH8A 1VFAA 4ELMA 3VDBA 4K2UL 3DRTB 5MEPA 1KEGL 1SYVB 3GMQB 5D6CA 3SKUD 1AGBB 3FTGA 4RX4A 4LSPH 3RL1A 1D5MA 2BP3A 4LPWA 3NCMA 1F58L 3V5KB 1JZ7A 1DQML 3MXWL 1QD0A 3OKNA 1TPXC 3BIBX 1FYTD 1KPUB 2ADGB 4HV8A 2DQFB 1DLHA 2EECA 4F7EA 3QUKA 1UJTA 1FYTB 5IB2B 4P59H 3SDDA 4NQDE 1T80A 5H8DA 4Q9RL 5KS9B 1J11A 3FFCD 1IAKA 3GRWH 3GK8L 3EJJX 4RGNC 1HEZB 3FFCB 1K2DA 2PW1B 4J3UA 1BVLA 5TDNB 4X5LA 1TZIA 1C5CL 4OFVA 3T4YA 1V3KA 2FL5A 1BFTA 4G6AD 1WBYA 3SDAC 1UG9A 1RUML 3LV3B 4HS6A 4JGMA 3RWEB 4M3KB 1VFBB 3TV3H 4J3OC 4HAFA 4DN4H 3TA3C 1V3JA 5CLWA 1T03H 2R29H 1MNUL 3BIKB 1OAUH 5DJZB 2G9HA 1RU9H 3T1FA 1E4WH 1KG0A 1OAQH 4TVPL 5CJOL 4MYWB 2YPKB 5SX4I 2WIIA 3EDJA 1MOEA 2JJTA 4LASH 1P7KA 4OAWA 3L9RA 3MV7E 2LTQC 5SWQB 2HYMA 3FHQA 3OWEA 4LSPL 1WWAX 4Z7QF 2LAGB 4DUWA 3RY6C 2QSTA 5JW4M 1FV1A 1DE4B 1A6PA 1HHIB 1A7OH 5ACLA 3J8F7 2DI9A 1U58A 3F6LA 1OOAA 5CHNB 5EPMB 4MJ5B 4JPVH 4MNQE 3JV0A 5EUKA 4Q0XH 1OTTD 4CVUA 1ZA6A 4P3DA 5E6ID 1YNTA 2HKHH 2ZUVA 5E6IB 2C7UB 2ICEA 5TE7H 4PG9A 5ICXB 3D18A 4WGVB 3FJTA 1FGNL 3VXMA 5GZNC 3BDXA 1X7QB 5F89A 3REWA 1F4WH 1A22B 1XF1A 3MJ9H 3CSYB 3K4DA 4ELMF 1HSAB 3BD4A 4AIOA 5C0RL 2R8SL 4E9LA 4DK3A 3QFJD 5DRXB 3G5ZA 1C5DB 5IQ7L 3UJJL 1NMBL 3WO3B 3QFJB 4PR5A 4OCRH 2P5EE 2XPGB 1RU9L 3FN3A 3PWVA 1YN7A 4BKLA 1E4WL 4BZ1H 4PY8I 1ZGLM 4TRPH 5FA4A 3VWKA 3TBWB 2PN5A 1UYWH 4I2XE 4LASL 5A3IC 4RBPK 2VR5A 2N7AA 2A74A 1H5BC 1BF2A 2H2SD 4NO0A 4P9HC 4WTZG 1MY7A 1XGTB 1X5AA 2DQHH 4DGVH 5CEZL 2WINA 3REVB 1RJYA 4B41A 1I3GH 1J1OH 3UTZB 2X4RA 4ZXBA 4RGOL 1AXTH 4JPVL 4YX2L 2FECL 4Y2DD 1NAMA 3FQXB 2R0KL 4RA3A 5TH2A 5KVMC 4Y2DB 1QA9B 2CDGA 1I1RA 4K3JH 5I8EA 3FOLB 1EXUA 4X9FA 5J1SC 4DVBA 3QH3A 4M7JH 3RPIA 3WN5C 5TE7L 5J1TC 3GO1H 3WJJC 5JR1H 3C6SA 1CVSC 1I7ZA 2IC2A 3FAXA 4KKLD 5BOZG 2V5MA 1JGEA 5IEKA 1KN2H 2C5DC 4WJ5B 1J87A 1M7IA 3FT3A 1ZLWH 1H0DA 5C2BL 3WIHH 3KXFA 4G42B 1Y0LA 5FA3A 3B5HA 2MPAH 4OCRL 5CGTA 3EO0A 2VWEC 1J0IA 1I9IL 1U91A 4TRPL 5D71H 1KJ3H 1XMWA 4NHUA 1FPTH 5KAQF 2X1OA 4WFHE 4LVHB 2EDDA 2W07A 3HMXH 3KPQB 1MCDA 5DVMA 2R4SL 2Y9RT 1QR1A 1MJUH 3GB7B 4U1KB 1A7RH 5J6GA 3H9HA 3DTXB 4JFYB 4ZUSA 1JGVH 3PWLA 4DZBA 4ENED 1XGUB 3JUYA 4YHPA 4G6AC 1AXTL 5D70H 3IFNH 4XPHH 1G9NH 4HS8L 3RGHA 3N9GH 5D5MA 4FQXD 2DWEB 1ORSA 3KR3H 3ARBA 1LO4H 3GBNL 4XZUB 1I8LC 2VABA 4GSDH 1XGPB 4FQXB 4Y0GA 2DYPA 1EPFA 3WHXA 3FB8B 3OF6D 5H35A 4NOFA 1DBJL 3VXSD 6FABL 4PP2A 5SWZA 3VXSB 2PNDA 3DV6B 2RIKA 3DUUB 3IDJA 3QG6B 5B39B 1DSFH 3X13B 4G7VH 2KZWA 1EJOH 1NCNA 1F11B 5C0EA 4ZYKA 3WIHL 1VADB 5LQBH 1KIQB 3MA7B 2W59A 3AAZB 2NY5C 2I5YH 1FJ1B 3HZMA 2BNUB 5BZWA 3SJVD 4AT6B 4TUOA 1KJ3L 3SJVB 2FX7L 1T83A 4MQ7B 3D39D 4OGAD 1CBVL 2L4OA 3D39B 1OTTC 1C5BH 1Y6KR 5JDSA 1MJUL 4HWZA 1A7RL 5E99L 1S7XA 5E6IC 4X6DB 4XMLH 3OKKA 1JGVL 1MVUA 3EUUA 5D6DC 5F6HI 1WT5A 1TVBA 1OM3H 3OTTA 2JK5A 2PF6A 1KCUL 1I1YB 5KJRH 2VLME 4MD4B 4NQDA 4R7DB 4QGTA 3N9GL 1UZ6F 3MCLL 4W4OA 4JFFD 5CZXD 1LO4L 3CPLB 4D9RE 1AP2B 4TUJA 1ZS8A 4EN3A 1IQDA 4I3RH 5A16B 5IOPA 3CH1A 3BP7B 2A77L 2R2HA 4ALAH 1CICA 1I8IA 3QSKB 1DSFL 3QJHA 4G7VL 1A1NA 2FWOB 1UB5B 1B0GA 2P48B 5IBLD 1F5WA 5EUOF 1N0LA 4XXDB 2H2SC 5T1DL 2GITB 3MLRL 1MCPL 5CIPH 2I07A 1LP9F 4ZS7H 2VLRD 3DVIA 3CC5A 3NCBB 2VLRB 4MA7H 3PIQB 4FN0A 4FXGB 5CEXB 5EBWB 3D9AH 4Y19E 5J13B 4QF1A 4Y2DC 2Q86A 1BP3B 1VPOL 5MHSD 5D5MF 2X4UB 3VD7A 4YFDB 5IROA 1ZHLB 4B7LA 2P47B 1RZKH 3L7EA 4M7LH 3KYOA 5DQ9A 2NY5L 5IFJB 4MB5A 4GKNB 5D7JD 2ZUTA 1ZHKA 1FNEA 4QHUB 4MGXA 5D7JB 4DCQB 4LSQH 1R3JA 4MNQA 1ZAGA 4KKLC 1T4KA 4P4KA 1BQSA 1CLOH 4RDQF 5DI8A 3U0TB 2V5YA 1CGYA 3F5WB 2GK2A 3V6ZB 2VR9A 2CO7B 4Z6AT 4Y4HA 3E3QC 4PJ8A 4P9MH 1GGCH 3B9VA 4MX7B 3TP4A 4WHYH 1KXVC 4OLVL 2GJZA 2F9BT 1HKLL 4AQ1B 3PWPD 3BKJH 5JW5B 2Z91B 4JAMA 4U1MA 1IAIH 4LVHC 3PWPB 1JK8A 4LLWB 4OT1L 4RAVB 4JG0H 3GSWA 1QSFB 4LQ1A 1RY7B 3GMLA 4I18A 2YZ1A 1MLCA 3FN0H 1U8IA 1UC6A 2APBA 3K8MA 2DDQL 4ZS7L 5DDHA 1WFTA 3RGVA 4DGIL 3QUMA 4JO1H 3TBVB 1J0HA 3EDEA 2O5YH 4ENEC 1T0NB 4YIQA 3GMMB 2V7NB 3QDHA 4FRWA 3JUZA 4XVSL 2X7LA 3QNZB 1WJ3A 4L8SB 4FQXC 2M8XA 2UWEE 4ZQKA 4HUXB 1QLRB 3RWGA 2FIKB 5A40E 4B0MM 3UBXA 4N9OB 3HNSH 1AGCB 5HDBE 2QSVA 2VYRE 1OSPL 1VACB 2E6JA 3Q48A 1FL3A 3P11H 4KZDH 4GG6B 5IFAL 2OL3A 4JPIB 4NQCE 2HJKA 4XMKH 1MJ7H 4OI9A 1JBJA 4HMCA 1G7LA 3I84A 3LRGA 2ED9A 4PREA 1XGQA 5C07E 4G9FE 4HT1L 3ARRA 2ICWI 3B6SB 4LFHG 5TDOA 1YY8B 4LP5A 2XACC 2FLBT 1NGPH 1L9MA 2VITA 4XNQB 4YNYB 1U6AL 4P2RE 4OGAC 4QT5B 3GNML 2JELH 3TZVD 4LKCA 3VXUE 5IJVA 3BUYB 4MAUH 4OGXL 1CDUA 3TZVB 1IEAB 3FN0L 3HPLA 3N06B 1QRKA 3C6LD 4Y5XB 3LAFA 1C8PA 2AJUH 3FB7B 2O5YL 4XGZA 1OPGH 4JB9L 4QRRD 3BWAA 4QRRB 5I1LA 1DBAL 2M2DA 5GSRA 4G3YH 2PO6A 1BLNB 5CZXC 4JFQA 1U8KA 5GSVB 4NNPH 3VRJB 3SKMA 5FGBC 2V5RA 3MRFA 1EDQA 1SMAA 1AXSB 3B43A 3DX6B 4KZDL 1ZT7B 3EOBA 2J88L 2R69L 1KF9B 3FO2B 3ZKMD 3CVIL 5CAYB 1NGWA 5BS0D 5IM7A 5MI0B 5IBLC 5HGDB 5BS0B 3P4OA 2ZUQB 3FRUA 3TCXA 3TO4B 5J13C 1FG2B 2IADB 3I6LE 5E6YA 1OTSD 4Q2ZB 4WY7H 1M05B 1RZIA 2NY4D 3WS3B 4OKVA 1I8KB 2P8PB 1K9TA 2NY4B 3LKPB 4NRXB 3BPLB 4IRSD 3W39B 3WXVL 2EDKA 1FNFA 4IRSB 4Z5RB 4NKOA 2GTWB 3RWFB 1ZHNB 4YH6A 1WZKA 2AJUL 3VXPB 3CZFB 5D7JC 5DJ6A 5FUOH 4HGWB 1HHJB 4X7DC 5B8CA 2BNRD 1A5FL 1XCQA 1IGTA 3D0VB 4YBQD 2BNRB 1AGEB 3QAZB 3DMMA 4DKFL 3B9DA 3L5HA 5I1DA 5GS1B 4EJ1C 1VFMA 4YGAB 4G3YL 4HKZA 4X4XA 5DZOA 4ZTOH 4UINL 2PR4H 5DJAA 1AHWA 4TTDC 2AEPL 2WANA 5JHDD 4M43L 3H0TB 4KTEH 5JHDB 4QRQB 2XN9E 4I3SH 1NGXB 2H1PL 2KL6A 1QFWH 3QWOA 1RMFH 3MLYH 2Q7YA 1RUQH 4WEBH 4PGDB 3L3JA 2WBJA 4P2QD 1KCVL 2ADJA 4P2QB 4R26L 1DVFA 2DQEH 4LF3A 1DBKH 3U4EA 3IAGC 5IGXL 3BZDA 3MNWB 3GHBH 1BQHG 1UFUA 15C8H 3QXAA 2YBRB 4DOHE 5B38G 4QXTB 1KOAA 3ULVH 5CEZE 3RWHA 4ZAKA 4BH8A 4QTHA 1R24B 4OZGB 4L8SC 3MFGB 4G9DA 1OGAA 1CFNB 35C8H 1ORQA 1T7VA 2FJFA 3NVQA 5AEAA 2H32H 3B83A 3LIZL 5EBGA 1AFVH 4NM4L 1CT8B 3B9EA 5DGRA 4PY8J 2BVPA 1DQJB 5IHUH 1CF8H 1T22B 4Y19A 3V0WL 5DJDB 4KUCD 3MLXL 2L0DA 2GTZA 4YFEA 1EEUA 3EDKA 2X5PA 1CXEA 3BGMB 4MA3B 5KSVA 5I1KL 5FO8A 3T4AB 2GCYA 4M7ZB 3MTRA 4NP4H 1QHOA 4W70A 4LCWE 2CIIA 1OGTA 5FHAH 4ESKA 4CNIB 3Q5TA 1NLBH 1WIUA 4KTEL 5CEYA 2IQ9L 2W60B 3D25A 5GIRB 1RMFL 3C60A 4L29A 1RUQL 2ITCB 2XQYK 3K1DA 1KT2B 3MGTB 4JEGB 4P2CG 1SVZA 1V7MH 3G6DL 5E2TH 32C2B 3TZVC 1WWCA 4QHNA 2DQEL 5FOBB 4NJ9L 4WEUD 3S3JA 4QXGH 4Y5XC 1DN0B 3OAYH 1XGRB 1S9XB 4KJPD 4PRBB 15C8L 4JPWL 1K8DB 1GC1C 1BAFH 1SJHA 5A43C 1HILB 4FZ8L 3QQ3B 2H3NB 2ZSWB 5KVGH 2J6EH 4HJGB 35C8L 2BSTA 5DD3H 3L5XH 2VL4A 4UT6L 1AFVL 3DNKA 3GI9H 4OLUH 4GUPB 1Q94B 5IHUL 3MRJB 1NL0H 5ITBH 5FM4A 5JW4N 1ZT1A 2Q8BL 3ZKMC 5MI0C 2V2XB 4LLYA 3OKYA 3WLBA 5I0ZA 2ZUQC 2Y23A 2GT9A 1UEYA 3LN4A 3KPSD 3ZT7A 3DX7A 3R06A 4PJXE 3HAEG 4BQ6A 4BQCA 3WFCH 4PLOB 1UZ8A 3RJQB 2YSSA 2EO1A 4NKMB 4UDUB 4M1GH 1OTSC 4OQTA 3W82A 4X4YA 1YUHA 5H37G 2NY4C 1IEBA 2CR6A 3VFRB 3BPLC 2EC9T 2N4IA 2YHGA 5C07A 4OV6F 3BX7C 5KVFH 1S7RA 3F7YB 2KZ1B 4IRSC 3VFSB 4NO5B 3EGSA 2VSCA 4CVXB 4Z76B 4MA8H 2YA0A 1MFCL 1XF4B 2MSPA 3UYPA 4OCYH 3O2WH 1A6TA 1JHKH 1WBXA 4XBEL 1HI6A 2A1WL 4MAYA 3MV9A 1A3LH 1A6WL 1LDSA 3QAZC 2OJEB 4P2RA 5GS1C 4H20H 4YBQC 4WI2A 3VXUA 5KSUB 1X5GA 5JO5A 4FMFA 3VFPA 4NC1E 3QEUA 5DD3L 5C08A 1CTNA 1QSEE 5JW3L 3MYJA 1G7IB 5I1AB 5IW6B 1RSFA 1NDGA 1YY9D 4MZ3A 4GRLA 5D8JH 5ITBL 3EW3B 5JLZA 1JV5B 4HHAB 4MCZA 4AMKH 4D9LL 1MFAL 5IBTL 1EFXD 3BMWA 1OF2B 3QXUA 5A2JH 4PIRF 1IL1B 1UKTA 2VXVL 3P0YH 4S10A 5HDOA 1HHKB 5F6HJ 4JR9L 1Q72H 4RAUB 2HWZH 1E28B 5TE4L 1ZGLB 3QQ4A 3CVHH 4S1QL 5L8JB 2CGRH 4PJFB 4M1GL 2X2YA 3DGCR 2GFBA 4GG8B 2Z92A 2YOCA 2W65A 4PJ7B 2ENSA 3WKML 5IIEA 1OAKH 2JKXA 5DHVH 1DUYB 2NW2A 5TPWL 5DJ8B 1QVOA 4APQD