5E91A

Tgf-beta receptor type 2 kinase domain (e431a,r433a,e485a,k488a,r493a,r495a) in complex with 3-amino-6-[4-(2- hydroxyethyl)phenyl]-n-[4-(morpholin-4-yl)pyridin-3-yl] pyrazine-2-carboxamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
297
Chain Sequence
ELLPIELDTLVGKGRFAEVYKAKLKETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLASAMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVASMADNVLADAGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of apo and inhibitor-bound TGF beta R2 kinase domain: insights into TGF beta R isoform selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords TGF-beta receptor type-2
total genus 94
structure length 297
sequence length 304
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5e91A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5e91A01
3GQIA 2VO3A 4CFVA 3I6UA 2WAJA 4FOBA 4L68A 3VBQA 4B0GA 2H8HA 2WQMA 3GU7A 3OTVA 3V3VA 4AS0A 4EOQA 2CNQA 4YPDA 2PVJA 4JJRA 1BI8A 2J5FA 2CN8A 4M69B 4CXAA 2YDIA 4S2ZA 5GIOE 3F61A 4PX6A 4ZZMA 3QALE 3TIYA 2WHBA 1PMVA 4FIFA 2CKEA 5HBJA 4U7ZA 3FHIA 4R5YA 3MY0A 3FZRA 4DEIA 5E4HA 5AP7A 4KAOA 4XX9A 1SVGA 3LCTA 3DS6A 3U6IA 3VRYA 4F1OA 4OTQA 1AGWA 5J9YA 3QHRA 3F5PA 4Y95A 1O6LA 1YOJA 3DBFA 3F7WA 4RX9A 5EW8A 4Z7GA 2X8IA 2YEXA 3AT4A 4AACA 1GAGA 4AZEA 4YZCA 2OBJA 4WNKA 5FG8A 5F20A 3EL8A 3F7ZA 4IZ7A 3VS7A 4U6RA 3VUGA 4QMMA 5HIBA 4QMWA 3C50A 4HNIA 2XH5A 2WMSA 3O8TA 2WIHA 3OOGA 3QTQA 4XOZA 4EKLA 1OM1A 1MRYA 2PZ5A 1UA2A 2JEDA 3KXNA 3OT3A 2ITUA 4IC8A 3AD5A 4OT5A 4R6VA 2NRUA 4RFMA 3ULZA 3VBYA 4Q9ZA 2GHGA 2W1HA 4Y83A 3GOPA 4WG5A 5M06A 3PA5A 3UTOA 3TZ9A 4BTKA 3DNEA 3QTZA 4QD6A 4RC2A 1PF8A 4M68A 5EQEA 3PYYA 1ATPE 1QMZA 3MFUA 4CT2A 4CYIA 4MXAA 3G90X 4C61A 4C34A 3BWJA 3FXWA 3ZSHA 3FY2A 4EZ5A 1NA7A 3R01A 2GNHA 2WD1A 4LL5A 5D11A 3R04A 1R0EA 3G0EA 3LJ2A 4NM7A 2QU5A 4YJOA 4AZFA 4EC9A 5GZAA 3TJDA 4RJ5A 2WTJA 2YCFA 1H4LA 2UW6A 1RJBA 4FZ6A 2OIQA 3IDBA 3UG1A 4UY9A 2Y8OA 5DWRA 4F7SA 3LMGA 3UQCA 3R7IA 4ANMA 2JIIA 4R5SA 5AUZA 2GNFA 4D5HA 2J0JA 3F9NA 4EQMA 4QTEA 4YTFA 2C6MA 5EYKA 2VWXA 4EORA 4H05A 5AUYA 4FR4A 2VV9A 3C0HA 4BDBA 4Z3VA 3VF9A 4KIKA 3QLFA 4YTCA 5KKRB 5C27A 3BQCA 3UOLA 2JITA 3FMJA 5KO1A 4OTDA 4XHKB 3K5UA 3FXXA 1XKKA 2I40A 3LCKA 4O27B 3VJNA 4EK5A 4EK8A 4F9CA 1P14A 1WBOA 4FTRA 3CJGA 2HYYA 4O7WA 4HPTE 3KY2A 4FZAB 1U54A 5IA3A 3O8PA 4NZWB 4O81A 1PYEA 1BKXA 4DGMA 5LOHA 3N9XA 5AIKA 3G15A 3AT2A 4E73A 5AEPA 1YW2A 4FC0A 4WSYA 3VS5A 1UVRA 3U55A 4C4EA 4D4RA 5IQCA 2RFEA 3D7TB 4DEBA 3HV4A 5J5SA 3QRKA 1H1QA 4IAAA 4AXAA 5J9LA 4CGAA 3ZBXA 1S9IA 2VNYA 3JS2A 3QUPA 3UBDA 3RWQA 4AU8A 5L2WA 3GU4A 4XV9A 3ZFXA 4YLLA 2BFYA 1GNGA 1W83A 1YWNA 1ZYJA 4IQ6A 5CAUA 2IW9A 2UZNA 3S2PA 2J4ZA 4E20A 3OWJA 4YC8A 1QPCA 4NEUA 2CN5A 1H28A 3I5NA 3GCVA 2V7AA 2FGIA 1OBDA 5KNJA 3QQFA 5KHXA 3QZIA 1T45A 4RJ6A 3LCDA 2B0QA 4QMLA 3WZDA 2YJRA 2JBPA 5J7HA 3A7GA 3KCFA 5AP1A 1U5RA 3QCXA 4RVMA 1CSNA 2WTIA 3HDNA 4ZY5A 3HAVA 1UV5A 4I3ZA 4C38A 3O23A 4IAFA 2G15A 1UU8A 5CX9A 3LQ8A 3NW7A 3H9RA 3Q9ZA 5EKOA 5F94A 5EFQA 3V5PA 3PDTA 3DK3A 4AW5A 4PMMA 4PDPA 2BMCA 4AGUA 2R3LA 3FDNA 4OTGA 4D2RA 2CKOA 4R7HA 1ZZ2A 2W0JA 3KULA 4XG2A 1Q8YA 4NH1A 5HE2A 3SD0A 4EQUA 4N6ZA 5IMXA 3E8DA 4YO6A 2XB7A 4YJTA 3U6HA 3R22A 2O65A 4I22A 4JRVA 5GJFA 3KKVA 5I9YA 4FSTA 4HVHA 4YHFA 2YM7A 4GK2A 1OL6A 1JKKA 3EQRA 4DBNA 2W1EA 1XQZA 4UZHA 2BKZA 1OBGA 5CZIA 4FKJA 4FL3A 3QX4A 5AM7A 4CZTA 4EHGA 4UMRA 5A4TA 4IB1A 5EYCA 1FGKA 4ZTMA 4C59A 3QF9A 4EOLA 5EM5A 5HG5A 4ZOGA 5I5ZA 4CMTA 1OB3A 2PU8A 3KRRA 5AADA 3COHA 3L8PA 3EIDA 5AUTA 3RK9A 3UO6A 3VC4A 4HVDA 3DJ7A 1PXOA 3FSKA 2B4SB 4ALVA 4CFNA 3SVVA 4DTBA 2YCRA 3CTHA 3PJ2A 4R1VA 1WBWA 4WT6A 3E7VA 2CGXA 4H3PA 3Q2JA 4A9TA 1WCCA 2JKMA 3CD8A 3GC9A 3LE6A 4XG8A 4XYFA 3AGMA 4EYMA 2HW7A 2WEIA 5IISA 3UYSA 3PJ8A 4AN3A 3C0GA 3V5WA 5L6PA 1RW8A 3IW7A 2ITTA 4I20A 4UMTA 3DCVA 5JQ8A 3WIKA 2QOOA 1WBTA 3QZFA 4DEGA 3DTCA 2YISA 5EOBA 3HMPA 5F95A 2X39A 2ERZE 4W8EA 3HV3A 1ZZLA 3I5ZA 4FI1A 4OTIA 4D9TA 3KGAA 4UWYA 3UDBA 4R3RA 3NZ0A 4EK6A 4U0IA 5CU0A 1OI9A 2XEZA 4DITA 5IQDA 3RALA 2XCKA 4NK9A 3BYMA 3EHAA 2VGOA 5JH6A 4GG7A 5KMJA 2QI8A 3ZFYA 4FKPA 1GIHA 2PVFA 3QLGA 4AGCA 5J7BA 5J79A 2BUJA 2XJ1A 2Z7LA 1Q4LA 4KRCA 4IAKA 3ZDUA 1ZOHA 3EN4A 4DLJA 5KCVA 4O0VA 4G9CA 4YUQA 5M09A 4PP9A 1UNGA 1XHAA 3VHEA 3ZRMA 2W1DA 2CPKE 3R7OA 4UALA 1Y6BA 3COKA 5JGDA 5BMSA 3ANQA 3H30A 4J52A 4F1MA 2UV2A 3B2TA 4RBLA 1APME 4OW8A 3VWAA 4NTSA 2W9ZB 5CT7A 2ZB0A 4J53A 4MNFA 4X2KA 5HG8A 1H1SA 1DM2A 4DG0E 1O6KA 2GQGA 3QYZA 2WOUA 2XKCA 4WD5A 5FDPA 2RGPA 4O83A 5IQFA 3I81A 3WF7A 3U6JA 2J90A 4ZZOA 2DYLA 2OFUA 4AOJA 4IM2A 3R00A 1OZ1A 5CZHA 5T6KA 2IJMA 4B8MA 3RAIA 4CTBA 5IQAA 4GFGA 2F7EE 2IVVA 4CZYB 1GY3A 4F0IA 5ETIA 3E62A 2WELA 3CLYA 2WTDA 5J1WA 1GZOA 3Q4TA 2REIA 4F9WA 1LEZA 5BVWA 4JDHA 3ATSA 4X0MA 3NUPA 4O2ZA 3WYXA 2B9HA 4APCA 1O9UA 3CR0A 1FVTA 3EKNA 3NYOA 3BI6A 4U45A 1QPEA 2DQ7X 4CFUA 3DBDA 3D2IA 5FM2A 4BTMA 1XH4A 2XBJA 4N4SA 2X4ZA 3SV0A 4FK3A 4JVGA 3ODZX 4H58A 4MH7A 1KE5A 5CAQA 4R77A 4IZ5A 3Q5IA 4J8MA 5JFXA 4CKIA 3HP5A 1M52A 1PMNA 3U4UA 2P4IA 4CVAA 2JD5A 3S1HA 5L4QA 3C5IA 5IQBA 3R8ZA 3RPYA 1G8AA 3G6GA 2PVYA 4BWXA 4E6CA 1XH7A 5CNOA 3MFSA 5AR7A 3PA3A 1WVXA 3E5AA 4XBUA 3KMUA 3I60A 4BIEA 5KBQA 2RFSA 3NUNA 5D9HA 1PXNA 3HL7A 4HJOA 3TL8A 4BICA 2E9NA 5CANA 5JEBA 2XNNA 4NTTA 4UBAA 5IKWA 3WF8A 1ZMWA 4U9AA 3QQGA 2Q0BA 2VO6A 3E8EA 3M1SA 3PP1A 3W32A 2CKPA 5M53A 4U42A 5HE3A 4QQCA 5KE0A 5CF8A 4IADA 2GPHA 2OH0E 4TYHB 4O0WA 4RRVA 3SXSA 3LW0A 2C6DA 3U4WA 2B9IA 4MHAA 4QPAA 4ZP5A 1FVRA 4F1TA 1OKYA 2BZHB 2UZDA 2J0MB 2QO9A 3O17A 2QHMA 3MTLA 3NYNA 4QYHA 3BBTB 2I0YA 3CPBA 4BCJA 1OIUA 4O21A 1MRVA 4A07A 4EH7A 4V0GA 3CIKA 5DRDA 3SW7A 3NUYA 4A4LA 5C03A 2PUNA 1IG1A 3WBLA 2GMXA 5FXSA 5EHYA 3HVCA 3QU0A 3FLWA 3PZHA 4IACA 4S33A 5EM6A 5HBEA 4M3QA 5K0XA 2XK4A 2HZIA 3OROA 3V8SA 3W18A 3ZSIA 4FICA 5CF4A 3Q04A 3QAME 3FKNA 3ZDIA 2YA9A 5E1SA 2VX3A 5I9WA 1FINA 4DCEA 3II5A 3T8OA 5ANDA 5AWMA 2ZM3A 3ZM4A 5CI7A 1H25A 3UYTA 4JS8A 4I6QA 4C62A 4EUUA 3EJ1A 3EN7A 4GT5A 5FTOA 3NYVA 1YI3A 2OO8X 4D28A 5IMEA 3KK9A 1FQ1B 2RFDA 2QODA 3HNGA 4QMOA 5DT4A 3CSVA 4YSMA 4O7ZA 3D0EA 5IU2A 2RG6A 4JDIA 2EWAA 5TO8A 1GIJA 4BDEA 4D2TA 3TEIA 1DI8A 2XUUA 4EOMA 4FSQA 3H9FA 3DZOA 1Q8TA 2VD5A 4I5MA 2EB3A 5AP4A 2C4GA 1KWPA 3OOMA 4TN6A 4CSVA 4EOKA 3AXWA 3I0QA 2FH9A 3D94A 3OXTA 2EB2A 5HD7A 2HOGA 4C4FA 4KBKA 3UZRA 1JNKA 4RX7A 4ZSLA 5AR8A 2A0CX 2XIXA 4E4MA 2UW7A 4ZLOA 2WGJA 3SX9A 5AR2A 1PJKA 2W05A 3MVHA 3PUPA 3FAAA 1J91A 5F4NA 3PWDA 2DUVA 2VTQA 2QCSA 4GJ3A 5HGIA 2WMQA 4WRSA 4ZLYA 4C4IA 1JQHA 4JQ7A 2GNLA 3V01A 4C33A 1OL7A 4IXPA 3NIZA 5G1XA 5HVYA 4DH5A 2WMTA 1XH9A 4D0XA 2PYWA 5JN2A 3I0OA 2OICA 3W2SA 3ZU7A 3OC1A 2B53A 3H0YA 2W4KA 3EN6A 3CS9A 3A99A 4BDGA 2B9FA 3G33A 4HYUA 3KVWA 3G2FA 3SG8A 2ZJWA 3CY2A 4U79A 3F2AA 3PPZA 3KK8A 4O7NA 3FQEA 3FI3A 3DKFA 4IX4A 4B4LA 3HEGA 3OBJA 1J7IA 3GFWA 4MF1A 5FWKK 2O64A 4BBMA 2NRYA 4FGBA 4GVJA 4EOOA 1OKWA 3VJOA 4FIGA 4O7VA 2XCHA 4HZSA 4R78A 3I7CA 4I5HA 2ZOQA 4J8NA 5EM8A 2PVKA 4GFOA 3Q6WA 2FSMX 5HO8A 3NNXA 5FBNC 3Q4ZA 4E3CA 4FT9A 4MXZA 3VS0A 4DAWA 4AFJA 2J0IA 4RQKA 4AGWA 3ATTA 3HRBA 4LGHA 5AUVA 4RX8A 4XG3A 5E8YA 1XH8A 3KULB 1FOTA 4FKGA 3GCQA 4I1ZA 4JG6A 1BL6A 4NFNA 4RA4A 5ACKA 4N0SA 2GU8A 4O7LA 5HTIA 4OTHA 2UW8A 1H00A 1U5QA 3GC0A 3NPCA 3RHXA 3D5VA 1WVWA 2F49A 1UNHA 2ETRA 3FLSA 3KMWA 2ZDUA 3KU2A 2NO3A 4XJ0A 3FZ1A 5D41A 4RIYA 2EUFB 4IJ9A 2QKWB 3MFTA 3GT8A 3QUDA 4BDHA 5CALA 4GH2A 3M2WA 1VEBA 2X8DA 5CU4A 4BGGA 3ENHA 3C0IA 1YXTA 4FIJA 4UYNA 2W1FA 3M42A 4P7EA 4PDSA 5AM6A 3RCJA 3TACA 4UMUA 3AMAA 4M0YA 4NKAA 2XKEA 1OUYA 4QMSA 3VRZA 4BHNA 3H3CA 3RVGA 4MD9E 3WILA 4U3YA 4X2JA 4QP9A 3LZBA 4L01A 4L46A 2QURA 4E6DA 4RX5A 3DQXA 4QYFA 3QA8A 5FEDA 1YDRE 3DLSA 2R3PA 4Y8DA 4FV9A 3KRJA 3LFCA 4JDKA 4TWPA 1CTPE 2Q0NA 1JKSA 3RNYA 3L8VA 5C8KA 5JFWA 2YZLA 1KOBA 2QLUA 2VNWA 3LHJA 2UUEA 3MV5A 3FLNC 3NUXA 2QOFA 3OWPA 3POZA 5I9UA 3DB6A 4YNEA 3RPVA 4BCNA 1ZWSA 2WQOA 3ORZA 3QC4A 2C1AA 4PY1A 4RLKA 1P4FA 2ETKA 3EYHA 5BVEA 4GKHA 1R3CA 3D9VA 4AE9A 4MWHA 1QPDA 3V04A 2ZAZA 4G5JA 4MCVA 3NW5A 5H8BA 4ANQA 1DAWA 4HGLA 2PY3A 4EWQA 5IDNA 3OY3A 4G3FA 2IVTA 2B7AA 4JLCA 2VUWA 3CP9A 2A2AA 5EI2A 4Q9SA 4BIDA 5A6NA 5DVRA 1T46A 2G2HA 4FV2A 3FLZA 3RM6A 3VQHA 1F5QA 3EKKA 3IW8A 4BTJA 2SRCA 3NLBA 4NCTA 3DNDA 4N70A 3V6SA 4EBWA 3Q4CA 3P08A 4JX3A 4CQGA 5I9ZA 5KKRC 4BN1A 3ZFMA 1BMKA 4FEWA 3ORNA 4O0XA 3MJ1A 2PTKA 2R7IA 4ONAA 4L52A 4IM0A 4IBMA 4P5QA 4YU2A 3Q96A 2XNBA 1J1CA 2QOBA 4YJPA 3TIZA 4KIQA 2PZYA 3IS5A 3NMUF 2Z02A 5E8XA 4FG7A 4JR3A 5FTQA 5AMNA 5BQ0A 3SXFA 2XYNA 3NVKI 3GXLA 4PDYA 2JBOA 4QP6A 4USDA 4BYIA 3E8CA 3Q53A 5ITAA 3BLQA 3MB6A 5DNRA 5LMAA 5IA1A 3PY3A 4MXYA 4IX5A 5AAEA 2EXEA 4C2VA 2R0IA 4FTMA 5CEOA 1JWHA 3TV7A 3UNZA 1YKRA 3DPKA 4RPVA 2P55A 4GIIA 4X3JA 5LMKA 1Q8ZA 4IDTA 3PG1A 4BZDA 3QD3A 5HX8A 4LQMA 4MD7E 4FGRA 2X1NA 3BX5A 4PUZA 4W8DA 3HV6A 4ASXA 2WTKB 3AOXA 4BCMA 4DGLC 4F7LA 3TDWA 4GYGA 5JFVA 4KB8A 2PMNX 5EDQA 4MK0A 3BU6A 4QTBA 4USFA 3OY1A 3TT0A 3UC4A 1JKTA 4BCQA 3FLQA 4I41A 2E2BA 5IA0A 5K5XA 3IECA 3QXPA 4F6WA 4AWIA 1V0PA 5CTPA 2QOCA 1PY5A 3NX8A 4QPSA 3W2QA 4B8LA 2VTAA 3QCYA 4WRGA 3SOCA 4ACHA 5JQ5A 5H8EA 3KN6A 4CTCA 4ZSGA 2UZEA 5AIRA 3HV7A 4FYOA 5HO7A 2QR7A 2G9XA 4O0UA 3UODA 4QQJA 5CY3A 3T9IA 5ICPA 2JFLA 1J3HA 4BI2A 3OFMA 3QRUA 2AC5A 2RFNA 4BY9E 4IVDA 3ULIA 3BIZA 3QX2A 3IQ7A 4Y85A 5A4QA 2QOIA 3O0GA 5BVDA 1LR4A 3JYAA 4O38A 3MIYA 3A8XA 2C5XA 1ZYSA 5E9EA 4F64A 3GNIB 3IK3A 5HIEA 2YAKA 2J5EA 2CLXA 3LVPA 2YLEA 3GUBA 4AE6A 5TR6A 4WG3A 3LFNA 5DIAA 4G6LA 4DE4A 4XRJA 3R8PA 2BKKA 3RMFA 3LPBA 1S9JA 5ETCA 3G9LX 4TNBA 2QNJA 2YDKA 2ONLC 4ARKA 4USEA 2YITA 2IVUA 3KXMA 3FI2A 4BCPA 1FBNA 2GS6A 3VBTA 4FIHA 2PULA 4NU1A 1M7NA 3FBVA 1PXMA 2ZDTA 4I4FA 2YIQA 3PE1A 3Q32A 3COIA 4O22A 2QHNA 2Z8CA 1IR3A 4JIAA 4XBRA 5IQIA 2XZSA 3E3BX 5E92A 4N57A 3THBA 4WNOA 2HCKA 4J95A 4FV5A 1IA8A 4KIKB 3QCQA 3LCSA 4A9UA 3F5XA 4W4YA 5DGZA 3G6HA 4ZTLA 3UMWA 4A9YA 2WQNA 4X2FA 4EBVA 3OXZA 4ZSAA 2FSOX 3BV2A 3FY0A 5A4EA 3EOCA 4AN9A 4IAYA 4JG8A 3EZRA 2BHHA 2YZAA 4P4CA 4CKJA 3IW5A 4FV1A 3SHEA 1YXUA 4BB4A 4TWNA 2GQRA 3DFCB 3LJ0A 5L2SA 3QA0A 2OJIA 3CKXA 1E1XA 3PIYA 5K3YA 1W84A 3R1SA 4F7NA 4YR8A 2ZMDA 3AGLA 3UP2A 5IQHA 4JG7A 2X7OA 1ND4A 4ZMFA 5HNBA 3ORXA 1OGUA 3P7AA 3FYJX 1Q99A 2J7TA 5JKGA 2OKRA 4I6BA 2XK9A 2X2LA 4ITJA 1F0QA 5JSMA 4KKEA 1DAYA 2X2MA 4BFMA 5HLNA 4C3FA 3JUHA 3U54A 1H26A 1M7QA 3OCSA 3OD6X 1Y91A 4KIPA 3QRJA 5DR6A 3T3UA 3MH3A 4YTHA 3C7QA 1NW1A 4PL4A 1Y8GA 5KMLA 5CVHA 4FNYA 1VR2A 2ITOA 3O8UA 3QD4A 1ZARA 4JQEA 4LRMA 4MXOA 4YC6A 5DEYA 4G5PA 2HXQA 2VTLA 3CQUA 1SMHA 4LUEA 2WMRA 2LAVA 2IW6A 4QMNA 5IH6A 4G31A 2OJFE 4RVKA 1FGIA 4XP2A 4FVPA 3F3WA 4CMUA 5M4IA 3DKCA 1Y8YA 2UW3A 1V0BA 3RJCA 2RIOA 2QOKA 2WTCA 3COMA 2R5TA 3NS9A 3SRVB 1QL6A 2CHLA 3QTXA 4LV8A 3LIJA 2C47A 3U9CA 5TF9A 4C8BA 5CF6A 3RINA 4PWNA 5CEMA 5LCKA 2ZM4A 3TNWA 2BRBA 4E4XA 3UOJA 3FMNA 3UMXA 1UNLA 1YWRA 2EU9A 1ZYDA 4J1RA 1CKIA 3IG7A 4EOSA 3PVGA 2UVZA 4NIFB 5BVNA 3ORPA 5LWNA 1YXXA 4XG9A 4ASEA 1YI6A 4JNWA 2JKQA 1VYWA 2IZUA 3DBEA 3CE3A 3D7ZA 3IDPA 4FL1A 4IIRA 2VTOA 2X6EA 5EYDA 5IH5A 1J7LA 4G3DA 1XO2B 4JL9A 4ZTNA 2F57A 3MPMA 4EH4A 2GFSA 4DH8A 1E1VA 2HZ4A 3DBCA 3R1YA 4M69A 2P3GX 2NPQA 2UZTA 1B39A 2OH4A 2W99B 4EHVA 3RNIA 4BC6A 2WOTA 4JQ8A 3KRXA 4PV0A 2C0IA 5EM7A 3ZYAA 3KMMA 3OZ6A 5K5NA 4BR3A 2PMLX 3BE2A 3EFWA 3IOKA 5M56A 2XK8A 5H9BA 3A62A 3Q4UA 3RAWA 2VTRA 3D4QA 2QO7A 2J51A 3RK5A 3U51A 4F6SA 1WBSA 3F88A 5DR2A 2GCDA 3B2WA 3I4BA 2CGVA 1PYXA 1I09A 3SC1A 3HYHA 1P5EA 3ZZEA 2RKUA 4JBVA 2OXYA 4KKGA 4WSQA 4P5ZA 4UN0C 5DRBA 4RGJA 4RZVA 4BI0A 3Q5ZA 2BRGA 2YM3A 4BCFA 1UKHA 1Z9XA 2HWOA 4A9SA 1A9UA 2WB8A 4XV3A 3HMOA 3BYVA 3PSCA 3R71A 4QMZA 1AD5A 1XH6A 3QBNA 5I9XA 3OW3A 1A48A 2ZV2A 3AC1A 3P86A 2C1BA 4EZ7A 3KL8A 1NT2A 4E4LA 5FLFA 3TNQB 4DT9A 1KSWA 4FTUA 3R0TA 4I0RA 1B6CB 1IRKA 2PUUA 5FEQA 2C3JA 5FQDC 5DMZA 3P79A 3TZ8A 3Q6UA 4U41A 4IFGA 2O8YA 4JDJA 3E63A 3BYOA 4CV9A 4K1BA 2BFXA 4O7RA 3GP0A 2AYPA 4X7QA 4DGOA 2WMAA 2WQEA 2B9JA 4IAZA 3FL4A 1Y6AA 4FOCA 5DT0A 3K54A 4FT0A 4GU6A 4J98A 4MWIA 3CGFA 4JAJA 4L3JA 3QZGA 4WNMA 4NFMA 2BZJA 1URWA 2ITXA 4BDIA 4FA2A 4WHZA 4S34A 4IW0A 4GK3A 3MA6A 2Y4IB 1UWJA 2XP2A 3MPAA 1UU7A 3G9NA 2R3NA 2W1GA 2XM9A 3JVRA 5K9IA 3OTUA 4IVCA 3TUBA 4MXXA 4EJ7A 3CEKA 1H1WA 4FT3A 3R7EA 2WTKC 4AW2A 3JPVA 3FZSA 4UEUA 3Q60A 3SAYA 3NVMB 1OPKA 4FIIA 3DOGA 1BLXA 1YDSE 5AP0A 4B6LA 4F0GA 2EXCX 5E8SA 5FRIA 2UZBA 4ZLZA 5BUIA 4AG8A 3ZM9A 3DT1A 1YRPA 3EQIA 4K0YA 3GC8A 3F3TA 1ZAOA 3R30A 3WZJA 4AUAA 3ORLA 3VW8A 1PXLA 3IW6A 2YCQA 2W5HA 1WZYA 4HYIA 3OCTA 3GEQA 4EL9A 4OBQA 3HMNA 2PUPA 4FTNA 4KSPA 4XG4A 3UVQA 3VS2A 3HMIA 3VHKA 4BWPA 4EOPA 3QKMA 2GHMA 3PPKA 3FUPA 4IE9A 4BCGA 2R7BA 4I5CA 4HCVA 2FA2A 4I5PA 2WIPA 5KMKA 5HTCA 3PG3A 2WMWA 5BX0A 3QUEA 3VAPA 3BHVA 2JKKA 1L8TA 4RT7A 5K4JA 3F2RA 5TOZA 4YLJA 4AT4A 2QOLA 4O84A 3MGYA 2C0OA 4O0YA 5JZJA 4FKWA 5I4NA 3CPCA 4Y5QA 5E8VA 4G16A 1IEPA 5ANGA 3ZRLA 4XP0A 4ANNA 3B8RA 3D5UA 2XEYA 3NAXA 5A4CA 3ZMMA 4EQCA 3HKOA 1PXKA 2ITQA 2X7FA 4MQ1A 3WF6A 1HCKA 3DZQA 2IG7A 4BDAA 3V8TA 5EG3A 4IEBA 3HV5A 4QP7A 2OZAB 4II5A 3PJ3A 3FKOA 2R64A 5L8LA 2O5KA 3IPHA 3MY1A 4D4VA 1R0PA 3OUKA 4QMPA 1W8CA 4K8AA 3LKMA 4RIXA 3DXNA 5HD4A 2BVAA 3TZMA 5IEXA 3A7FA 3QFVA 5IDPA 5AUXA 1M14A 3VUHA 4JT3A 3F3ZA 4KRDA 3HA6A 1U4DA 4EK4A 4IHPA 4IZAA 4M67A 1JSUA 3G51A 2R3IA 3NCZA 5AV3A 4C58A 5IUIA 5JFSA 3AG9A 1DS5A 2HELA 2HWPA 4U40A 3O71A 5HCYA 4E5BA 5BYYA 4FV3A 5LQFA 4AX8A 3UZTA 5DA3A 4O6LA 3WZEA 3QWJA 1VYZA 4FSRA 2ZV9A 4RMZA 2CJMA 3GQLA 3CGOA 3QTSA 4FSNA 5CAPA 2O0UA 2JDTA 4HOKA 2JDOA 2UW5A 2R9SA 1ZRZA 2V0DA 3R7YA 2UW0A 3BKBA 4QPMA 2Z7SA 3A60A 4RIYB 4E26A 1KV1A 2W4OA 3N51A 4FYNA 3F5GA 4OTFA 3CC6A 5J5TA 2QVSE 5HO6A 2HY81 2WQBA 3V6RA 1WBVA 3AC2A 4I6FA 5DHJA 3ZLWA 4C2WA 4CRLA 4W4WA 4X3FA 3EH9A 3Q9WA 4MQ2A 5C01A 1RE8A 2W1CA 3EMGA 3RPOA 4CFXA 4ZMEA 3E8NA 4YHTA 4FV6A 3SXRA 2PE0A 2HZNA 1A06A 4C35A 1H0VA 3R8VA 4DFUA 4AA5A 2CMWA 3FLYA 4C3PA 2YWVA 2QO2A 3GU5A 2A1AB 2YWPA 4YPSA 4UXQA 2JC6A 3W8QA 5JT2A 3QCSA 5DYJA 1W98A 5CQUA 1BX6A 2X8EA 1Q3DA 5M51A 1XR1A 4FVRA 3BLRA 1OMWA 3EQBA 2CCIA 5DFPA 2WMVA 4BCHA 4E93A 2GHLA 4OTPA 2XKFA 4JI9A 4ERKA 2BRNA 2CDZA 2DS1A 4LOOA 5LJJA 2GFCA 4RZWA 4FTAA 3KN5A 4A06A 2OG8A 4UMQA 4CG9A 3EQFA 3LFQA 2Z7RA 2R3RA 4UWCA 3ZTXA 3BYUA 4FG8A 4IB0A 3DJ5A 2KULA 4FNZA 4FNXA 5LXMA 2V7OA 1FMKA 4K77A 4AW1A 2IPXA 4PMSA 4EH6A 2GNGA 4JR7A 5HLPA 4F9BA 2OLCA 2XMYA 4CNHA 4FNWA 4KBAA 4O0RA 3FQSA 2R3KA 3NAYA 3HGKA 5EDRA 4AQCA 4OLIA 3BELA 4FT7A 4UZDA 2PE1A 5A14A 4BCKA 2C3KA 5BYLA 1MP8A 4XMOA 4LMNA 3KVXA 3ZC6A 4BZNA 5CVGA 1YXVA 3IGGA 4JBOA 3MSSA 2OI4X 1YOLA 3Q52A 5HX6A 2P2HA 5JZNA 5EKNA 3TG1A 4WUAA 4KUJA 5IA4A 1TQMA 2YAAA 2OIBA 2YDJA 4KABA 4TRLA 2PVRA 3S95A 2IZSA 5EQPA 4DBXA 3FKLA 3WF9A 3MWUA 4XV1A 5HE1A 2WU7A 3F2NA 3VUKA 4I0TA 3HAMA 2XNGA 3LM5A 5IPJA 3EWHA 4IWDA 4KBCA 5ETAA 4J71A 1OPJA 1Q41A 4V01A 1Z57A 3C4FA 3EFJA 1FMOE 4QP4A 5DBXA 5FP5A 5AAFA 1XBCA 3FYKX 3IOPA 3KQ7A 1ZYCA 3GI3A 3LLTA 4RLLA 5BVKA 2JIVA 3MVJA 3QKLA 4C4HA 1H0WA 4KSQA 3PE2A 3BGQA 4IWQA 4YBJA 1JPAA 5HG7A 5IA5A 3U87A 3D83A 3TN8A 1PHKA 3FI4A 3PJ1A 4BDDA 3DKGA 1PMEA 1OIYA 1PMUA 1YHVA 3MS9A 4X3FB 5DLSA 3BLHA 5EH0A 3QQUA 4ANSA 1ZY5A 3W8LA 4I4EA 4CD0A 4RWLA 5IH4A 3DB8A 4MKCA 3KXZA 1JAMA 4O96A 2OXDA 5DOSA 2R0UA 4L8MA 3CTJA 5DI1A 4EONA 3W2OA 4BHZA 5H8GA 5E8WA 1H01A 3VULA 3K2LA 1R78A 2PVMA 1NVRA 4ZTRA 5CT0A 3UE4A 3ZUTA 4M8TA 1IAJA 2BRHA 3L8XA 1DI9A 1RQQA 3SOAA 4I93A 4PNKA 4R3PA 3QQHA 4L3LA 2BPMA 3PXZA 4WUNA 3UVRA 4EOIA 3T9TA 2BZKB 2ITNA 3H0ZA 3UQGA 4E7WA 3FMLA 4G1WA 5M4UA 2J6MA 2VU3A 4BDCA 2JDVA 4AZSA 1Q97A 3QD2B 5CAOA 4N6YA 3R02A 4RIWB 4L44A 4KINA 2YLFA 5LMBA 4CG8A 4HCUA 2ITZA 2OJ9A 3RBWA 3RTPA 4YZNA 5IEVA 3PVUA 4C36A 2JIUA 2BDWA 3DTWA 1YQJA 2UZUE 3CD3A 3ROYA 3OHTA 3BHHA 3BPRA 3LXPA 3OMVA 2W1ZA 4FSMA 4QYYA 4DH7A 5GZ8A 2C6IA 1G5SA 4MNEB 2BIYA 2QONA 3QWKA 3ROCA 3BGPA 1Q62A 3FMMA 3R7GA 4UYAA 4XCUA 3WYYA 5CASA 5LWMA 3FMDA 5FXRA 1MRUA 4ZSJA 2P33A 3FC1X 2PL0A 4ID7A 5HIDA 2JGZA 4FZDB 3A7IA 4BGQA 2VTIA 2W96B 1WAKA 4EI4A 4RC3A 4DFZE 4TXCA 3SGCA 3GU8A 5AV2A 4CFFA 2BAKA 3GGFA 5L3AA 4D58A 5TKDA 4DTAA 4M14A 3R9RA 2ZM1A 3NYXA 2JFMA 2XVDA 3L9LA 3DQWA 1GIIA 4GJ2A 3UVPA 3FEGA 5BYZA 3ZLSA 2BCJA 5GNKA 3FZOA 3RWPA 4YGAA 2FSTX 3QTRA 4P90A 2HY0A 4YHJA 4ITIA 1SNXA 2C68A 3HUBA 3OVVA 3E93A 3PIZA 5A4LA 4PQNA 3MFRA 4U8ZA 4WO5A 3EQDA 2J0KA 5JMSA 1TQIA 3QZHA 2PVNA 1WBPA 4NM0A 3R7UA 3ZLXA 4Z7HA 5AA8A 2CNUA 4FEXA 4FKLA 3TDVA 1SYKA 4XS2A 5TE0A 4FTCA 3MJ2A 2C6OA 3ZUUA 2E9VA 4D1ZA 2UVYA 3FHRA 2E9PA 1EH4A 2BZIB 3PY0A 2YM4A 4G6NA 1XWSA 4KD1A 4FKUA 5AV0A 4IB3A 1OKZA 4D4YA 3C4XA 3D5XA 5GZ9A 5CNNA 2WMXA 3NGAA 4KA3A 4AOTA 4EC8A 1I44A 2UW4A 4IX6A 3PPJA 1LP4A 2J9MA 3QQKA 5G6VA 4D2VA 4F09A 4GFMA 5HZNA 4ZIMA 1WVYA 1QCFA 3OCBA 2PPQA 4BCOA 4F70A 2IZRA 2I6LA 4A9RA 4BCIA 1YDTE 1ZOGA 4DEAA 3F69A 3UIBA 3MN3A 2ITWA 1XJDA 1PXPA 3W10A 4MEDA 4BGHA 4FEVA 3H4JA 3DDPA 3ZLYA 1GZKA 1H08A 4E5WA 1ZY4A 4DGGA 4V04A 2I0VA 4I94A 3RAHA 1IAHA 4BF2A 5I3OA 3PSDA 2OIDA 2Y4PA 3BHYA 3SA0A 3NRMA 4G17A 3DK7A 2ITVA 3ACJA 4O6EA 3LM0A 1OECA 3QC9A 4FSYA 4Q5HA 3MY5A 2C5OA 2X2KA 1UU9A 2XIRA 3HECA 4UB7A 3WI6A 4ACGA 3A8WA 3QRIA 4IZYA 3AC3A 3QTWA 3PZEA 4BBEA 3E92A 2B54A 4MVFA 3HLLA 1JSTA 4FUXA 4HVGA 5M08A 4YLKA 4PL5A 4QQ5A 4ZK5A 4NWMA 2PSQA 2XA4A 4CKRA 1LUFA 4OBPA 5ANOA 3I6WA 2UW9A 3O50A 5DT3A 4F4PA 4RWKA 2QU6A 2PMOX 3FL5A 4GL9A 3SW4A 2VTNA 2W5BA 3QQJA 1H27A 3GU6A 2VZ6A 5KZIA 3BZ3A 4PPBA 4O7YA 4BBFA 4ZS0A 5J8IA 5AR5A 4DH1A 3F82A 3R6XA 2BIKB 4GIHA 5J87A 5T3QA 4C4GA 4KWPA 1MUOA 4L7SA 3EQPA 4NCTC 4PRJA 1UU3A 3NUUA 5M4FA 4IM3A 5AP5A 4ALWA 4EH3A 2W9FB 5DR9A 5D12A 3BHTA 5M4CA 4BTFA 2PWLA 2G2FA 4GCJA 5EOLA 4DEEA 3LLAA 3E64A 3H9OA 1WBNA 4MBLA 5FD2A 4W4XA 5AR3A 4NIFA 2Y6OA 4FL2A 3L8SA 5KUPA 4CYJA 2YM6A 3LMIA 1HOWA 2W06A 1OL2A 3UZPA 2Y6MA 5DN3A 4QOXA 5KZ0A 1B38A 5CU2A 4U43A 5AP3A 2I7QA 2FSLX 4BRXA 4JRNA 4LOQA 3U9NA 3G0FA 4LMUA 2P0CA 5ANJA 5EI8A 4YNOA 5BNJA 2X0GA 4TW9A 3R28A 1ERKA 4IWOA 2PHKA 4YC3A 5HCXA 1XH5A 3ID6C 4IMYA 5LVPA 4YO4A 5KMIA 2XNMA 2PZRA 2FYSA 1Q3WA 1IA9A 4NSTA 2WMUA 3ITZA 5AX9A 4O1PA 3ZOSA 5M44A 3MW1A 4IVBA 4FSUA 3UIMA 4ENYA 2ONLA 4O2PA 3R9DA 3H10A 2ZMCA 4YJVA 2BAJA 1V1KA 4FKVA 2C5VA 4D5KA 5LVNA 4M7IA 5M57A 5ANKA 4I24A 5M07A 5FXQA 5CEKA 1IASA 2V5QA 4NT4A 4FKIA 3R21A 5AP6A 5ANEA 2VWBA 4FV8A 4BL1A 5C9CA 3I7BA 4FV4A 4RJ8A 2QD9A 4RG0A 4EOJA 3U8WA 4FTQA 3HMMA 5CXHA 3W2CA 5B7VA 2YFXA 3G5DA 4M15A 4TNDA 1OL1A 5CSXA 4E8AA 4XEYA 2YM5A 4U97A 1ZYLA 4K2RA 3EQGA 5FEEA 4ANLA 4QQTA 2XIYA 2VAGA 4R8QA 2XIKA 1NVSA 2YCSA 3Q2MA 3DFAA 3TM0A 3LOKA 2RL5A 1OIQA 4DH3A 3TUCA 4Z9LA 4DLIA 3KA0A 5M55A 3DAKA 5E8UA 2BROA 4PTEA 3NCGA 3FMHA 4DA5A 3D2KA 1YVJA 3DKOA 1SZMA 1J1BA 5HE0A 2Y7JA 3ET7A 4QRCA 1OUKA 2I0HA 3NIEA 2IW8A 2Z60A 3OXIA 2E9UA 2R3OA 5JRQA 3P78A 1SM2A 4O0SA 5CS6A 5D10A 5AR4A 2JKOA 4B7TA 3N4UA 4K11A 1OPLA 2XNEA 4K18A 4LGDA 4W9XA 1BL7A 4YTIA 4CV8A 4I92A 3RI1A 3KC3A 3KFAA 4GUEA 1MQ4A 4LM5A 3VS6A 3ZONA 4G2FA 2OJJA 3OT8A 5EW3A 5L8KA 3I1AA 4FSWA 4LI5A 5IG1A 2EXMA 3KXHA 3EYGA 4EH8A 3R73A 2F2UA 2R3GA 4GMYA 2R3JA 1PW2A 4AN2A 3F3UA 3LXNA 3PIXA 3KF7A 3WARA 5D7AA 4ZS4A 3IGOA 3KXGA 5B2MA 5AUUA 4LGGA 4XUFA 5LVLA 2UZOA 3BWFA 5E90A 1Y57A 4O0TA 4DC2A 4TWOA 5AAGA 4Y46A 4E5AX 3GFEA 3RCDA 2Y9QA 4F08A 5A46A 5L6OA 3A7HA 5DE2A 5B2LA 4BKZA 2HK5A 4TYEA 3IW4A 4CCBA 4NM3A 2VTSA 3O2MA 4MAOA 2B52A 2Z7QA 2VO7A 4JXFA 4CFMA 2GS2A 2W4JA 4FZFB 4EWHA 5C26A 3OEZA 3EB0A 3LXKA 1Q8UA 3R63A 2OF4A 2X9FA 3CBLA 5KBRA 1WFCA 4RQVA 4ZTQA 3CXWA 3ETAA 5B0XA 4ZJJA 3UOKA 4YMJA 5ACBC 3UNKA 2A27A 3LFEA 5EYMA 5GJGA 4ANBA 4FKQA 2XF0A 4EUTA 4NYEA 3QD0A 4H1JA 3CTQA 4NKSA 5JK3A 1HCLA 4JBPA 4CFWA 1JVPP 4RIOA 1LEWA 1GZNA 3IO7A 4JIKA 4RJ7A 3V5TA 4AA0A 3TNHA 3HZTA 3SDJA 4X2NA 4TYGA 4AZVA 2BR1A 4LUDA 3R1NA 5GHVA 5HVJA 3MI9A 3TCPA 5K4IA 4CRSA 2LGCA 5A6OA 3K5VA 3FSFA 4EJNA 1X8BA 2DWBA 3TTJA 4CCUA 2CSNA 3P5KA 3RGFA 4FTIA 4MBJA 4NJDA 5CVFA 2WTWA 4QNYA 2QOHA 2ITYA 4KIOA 2PMIA 4WOVA 3WZUA 2GNJA 2QG7A 3ACKA 5LVOA 4Y5HA 2YJSA 4RWJA 2Q83A 5HNGA 4YJUA 3ZZWA 4LG4A 3A4OX 3BCEA 2XJ0A 3WOWA 3C4WA 3FJQE 2CNVA 4BDJA 5CENA 3DXPA 4C0TA 4S32A 2J2IB 1JBPE 3SKCA 3TV4A 3VO3A 4OAUC 4TWCA 2PVHA 3LQ3A 4XOYA 3DY7A 1NVQA 3AQVA 4G3EA 4PPAA 1KE8A 4U5JA 4FZ7A 4HGSA 5E91A 3SLSA 2BILB 4DGNA 5HLWA 5E7RA 2VTJA 4V0GB 2PZPA 3C4EA 4GW8A 3P4KA 4A7CA 3F3VA 4CZUA 3Q9XA 2HW6A 4HYHA 4DFXE 4FKOA 2YERA 2VTPA 4WBBB 4KNBA 5AX3A 1UKIA 5FUTA 3ORIA 3DJ6A 3QTUA 2O3PA 4TPTA 3E7OA 2NNWB 3UP7A 3UC3A 5HHWA 4C57A 2G2IA 4OR5A 3OW4A 3PRFA 3QTIA 3VUDA 5D7VA 4FVQA 3OUNB 5HEZA 3UIXA 3F66A 4FX3A 4JAIA 5HOAA 3VVHA 1CM8A 3TNIA 4ALUA 3C4CA 2QKRA 4LRJA 2BDFA 4FV0A 2C6KA 4RA5A 3QGWA 4X6RA 3C13A 3PJCA 4D2WA 2W1IA 2ZVAA 3NW6A 2OGVA 4X21A 3TI1A 3R7VA 2J50A 4PPCA 3NEWA 3HX4A 3ZO4A 4TYHA 3GC7A 3ZXTA 3DDQA 4UX9A 3ZS5A 3S0OA 3VIDA 2JDRA 2G1TA 4PMPA 4F6UA 5JGBA 4DT8A 5I9VA 3ORMA 4GU9A 3Q3BA 2BAQA 4JOAA 3VBXA 2AC3A 5CXZA 4FIEA 4FTOA 3DGKA 5CSPA 2H96A 4RWIA 4AGDA 4EEVA 1U54B 3R8MA 1P2AA 4L7FA 4XLVA 3UNJA 2B1PA 2CGUA 2GTMA 5C8MA 4HVSA 3ENMA 3ZEPA 5EI6A 4QMYA 4RFYA 2GNIA 1NXKA 2W17A 1U59A 3KEXA 3Q9YA 3KRLA 4BKYA 3NR9A 4QTAA 4FG9A 4BIBA 5C1QB 3RAKA 2OSCA 2C6LA 5LARA 1Q24A 2C30A 2OJGA 4ZTSA 3KCKA 5I0BA 2IN6A 3AD4A 5HTBA 1OKVA 2W5AA 2WFYA 4QP1A 5AV1A 5B2KA 5HVKA 3LJ1A 2P2IA 3ODYX 1YHSA 3TKUA 4D1XA 3AMYA 3GCUA 4PNIA 4W4VA 5FDXA 2RSVA 4ZTHA 3E88A 4YJRA 4DHFA 2XNPA 2VWYA 5D1JA 4EHZA 5IQGA 3CCNA 2CLQA 4L9IA 3ZHPC 5A3XA 3QL8A 3GVUA 4O82A 4QT1A 4L00A 1V0OA 4HW7A 3VF8A 2BDJA 4ERWA 3V8WA 5FM3A 3TNPC 3ZRKA 3BU3A 3PXFA 4GK4A 4YJQA 4QMUA 3FMEA 3R8LA 4D55A 1Q8WA 2C5YA 4FT5A 3WZKA 3O96A 2B55A 5KMOA 4OAVB 4IAIA 3HRCA 3MB7A 2YM8A 4D2SA 3HRFA 4O1OA 5FGKA 3MPTA 3P7BA 3UO4A 3A7JA 4E6AA 5HQ0A 3GOKA 4OT6A 4RJ3A 4XP3A 5F9EA 5BUEA 3I79A 4BYJA 5AFVA 2GDOA 4H36A 2XKDA 4GG5A 5AJQA 2GSFA 2VTHA 3MTFA 1YOMA 4QO9A 4EH2A 1U46A 1GZ8A 2F9GA 4K33A 3GB2A 5HICA 2G01A 4ZJIA 1URCA 4NL0A 4R7BA 4CLJA 3FWQA 1JKLA 5AUWA 3GBZA 4H3BA 3DBQA 4C7TA 3TXOA 4AFEA 5E8ZA 5CSWA 4NW5A 3SG9A 3PP0A 4QMQA 4F7JA 3O51A 1PXJA 4U81A 3TTIA 2YHVA 3DAEA 4RVTA 5HBHA 3V5QA 1MQBA 5BVOA 4G3CA 2X7GA 4OGRA 2HIWA 1Q61A 1W0XC 2ETMA 2VWWA 1O6YA 4G3GA 3ZC5A 2YIYA 4DCAA 4FE2A 5EQYA 1RDQE 1W82A 2UZLA 2RF9A 3PA4A 4Y73A 4DINA 4KS8A 3WE4A 3PVBA 3IDCA 3BU5A 3HP2A 1H1PA 4AP7A 4ACDA 2H9VA 3C1XA 2HENA 2JLDA 2VRXA 3DA6A 2X81A 4FV7A 4W9WA 4YZBA 3UG2A 3W16A 4EYJA 4Z16A 3S3IA 4EZ3A 4PP7A 2XRWA 5IUHA 4OUCA 4K6ZA 4X3FC 3DU8A 4XG7A 4R1YA 3ZXZA 5L2TA 3CJFA 5KX8A 2O2UA 3PFQA 4F99A 3HDMA 4H39A 3BEGA 3N4VA 3E3PA 4U44A 3GCSA 4ENXA 4YZMA 1ZXEA 5AV4A 2VTTA 4EKKA 1REKA 4I6HA 1KUTA 4U80A 3V51A 4G9RA 3VNTA 4ANOA 2PVLA 4QYEA 4I23A 3ALNA 5GJDA 1KOAA 4C37A 5EHOA 2PUIA 4DF3A 3MDYA 4DEHA 2R3FA 3KREA 2CGWA 3KRWA 4BWKA 2ZYBA 3R2YA 4IB5A 4HVIA 5DEWA 2V55A 2JAVA 4BDFA 4E1ZA 3C5UA 5KMNA 4LRKA 1YWVA 2KTYA 2BRMA 5HU9A 4QP3A 3WF5A 2XYUA 4ZZNA 4DFBA 5J1VA 1PKGA 4MNEA 3AC4A 4DG3E 5L2IA 3D15A 4XV2A 3ORTA 1PKDA 3MH2A 4M66A 4MBIA 3BRBA 2F4JA 2WTVA 4ASZA 4LL0A 4Q2AA 3R83A 4EHEA 3ZCLA 4B99A 3NNVA 2V62A 4X6QC 1AQ1A 3VUMA 4WG4A 4FEQA 2ZV7A 1R1WA 3C4ZA 3JY0A 1BUHA 1FPUA 3P0MA 4S31A 3W2RA 5BUJA 3VW6A 4AW0A 3OEFX 5LVMA 2WKMA 2R3MA 4G34A 2V22A 3LCOA 4IH8A 1STCE 2A19B 4FUYA 4TY1A 1GJOA 4YURA 3TJCA 3FC2A 3BGZA 3D14A 1JSVA 2WMBA 4AZWA 5IZFA 2ZB1A 4ZEGA 5L2QA 5FP6A 5J95A 3DAJA 2QR8A 3VS4A 1OITA 2O63A 1PXIA 4V05A 4D2PA 4TYJA 3WIGA 1CKPA 3EQHA 3EFKA 4PTGA 4RSSA 4AA4A 4D0WA 3RPRA 3CY3A 3VN9A 1K3AA 1VZOA 1BI7A 2UZVA 2XK6A 1P4OA 4GV1A 4YP8A 4C4JA 3BE9A 5BVFA 2BTRA 2VO0A 5DG5A 4WIHA 4F9YA 5HCZA 4FEUA 3L1SA 4MD8E 4I0SA 3FXZA 1M2PA 3PXQA 3QRTA 2F7ZE 4IC7A 4M97A 1K9AA 3EQCA 2WO6A 5ETFA 4QTDA 3R9HA 2OK1A 4L45A 4YJSA 3RPSA 3W55A 2RG5A 3QYWA 3LFSA 4IDVA 3LFBA 4IJPA 3FZPA 3RP9A 4M0ZA 2VWIA 3IKAA 5IQEA 4NM5A 3PY1A 4GSBA 4MYGA 4UMPA 1M17A 3BQRA 4ZSEA 5KMMA 3EZVA 1KE6A 3MA3A 5LMKC 4FTKA 5GIPE 1YHWA 5KHWA 4XRLA 3VBVA 4QP2A 1KE9A 1Z5MA 5HESA 2EVAA 3KF4A 4YZ9A 4O7SA 4DFNA 3C51A 3AMBA 5C4LA 1GOLA 2QG5A 4L67A 1LPUA 1R39A 3DK6A 4HGEA 4BI1A 4GEOA 1Q5KA 4MF0A 2IO6A 3NSZA 4TZRA 3RKBA 4HCTA 4TL0A 2QOQA 2XK7A 2VWVA 3CQWA 4FTJA 4RVLA 2PZIA 1W7HA 2F2CB 4R7IA 4XG6A 3N4TA 3F5UA 3QGYA 4F65A 2XNOA 2XK3A 3A2CA 3C9WA 4J96A 5CU6A 3S4QA 3VQUA 3VUIA 2JAMA 4DG2E 4E6QA 5A9UA 1TQPA 1YI4A 3QHWA 5CWZA 4F0FA 3OWLA 3RK7A 2QLQA 4QMVA 5HNIX 1L3RE 2FO0A 4LOPA 5HI2A 2OZOA 2X4FA 3NWWA 4FK6A 4RIWA 3PSBA 3UOHA 3JR1A 4BKJA 3MESA 4L3PA 3RM7A 3QQLA 3F6XA 4FKTA 4O86A 1SVHA 4GUBA 2ITPA 2GTNA 3LFFA 5BMMA 3NNWA 4LYNA 3AC5A 4KKHA 1ZMUA 4FF8A 4H1MA 3W2PA 4WBOA 1SNUA 2X9EA 3ANRA 4GT4A 5CYIA 3ZBFA 3S00A 3ERKA 4UV0A 1QPJA 1G3NA 4GT3A 3PVWA 3LAUA 3PXKA 3R8UA 1G8SA 3K3IA 4DFLA 4QMXA 2YIRA 4D4SA 3VS1A 3W1FA 4HPUE 3OS3A 5HKMA 1XBBA 3MVMA 3PXYA 2QQ7A 4CEGA 3CQEA 5JRSA 3UJGA 5H3QA 5T68A 3FPMA 4FTLA 5E8TA 4MXCA 4R3CA 3CKWA 4ZJVA 2IVSA 4OTRA 4IANA 2R3QA 4HYSA 2YIWA 2YN8A 3E87A 2YIXA 3PXRA 4ITHA 1YXSA 4BDKA 2H6DA 4EH9A 3SQQA 4ACCA 4C02A 2HZ0A 2R3HA 5J9ZA 1JOWB 3V5LA 3ZUVA 5FTGA 2YABA 1E9HA 3ALOA 4AT3A 2E9OA 4FKRA 3L9MA 1OL5A 3UPXA 5DH3A 4TT7A 2C6TA 2AUHA 2QC6A 3O7LD 3NUAA 3P23A 3MIAA 3P7CA 5K0KA 3UGCA 4FBXA 1CKJA 2ACXA 4ZY6A 3OF0A 4ORKA 3A4PA 3JY9A 2OW3A 4EH5A 3LQ5A 3LMHA 4J7BA 4EK3A 4AAAA 1VJYA 4F9AA 2ERKA 3P1AA 2OF2A 1JLUE 4GVAA 4RFZA 3EN5A 4IX3A 3ZH8A 5DPVA 3L9PA 4TTHB 5CSHA 2OXXA 4O91A 4GKIA 5HU3A 3KXXA 5L8JA 4CMOA 4LV5A 3PLAE 3TUDA 3ORKA 2JDSA 3REPA 2ESMA 3R9NA 3K3JA 4D1SA 4IVAA 4Z55A 3DV3A 2HXLA 2WXVA 3NDMA 4S30A 5CEQA 4ASDA 3B8QA 3IONA 5IEYA 4J97A 2BTSA 2X6DA 2Y4IC 4RC4A 4JX7A 5CEIA 3PTGA 5IF1A 2BHEA 5C8NA 4DTKA 4M13A 2XJ2A 3TWJA 4BZOA 2W7XA 2HAKA 4QP8A 5EK7A 1KE7A 4PF4A 3OWKA 4RIXB 3UO5A 2GS7A 2C0TA 2WNTA 5CI6A 4I21A 4DYMA 5E1EA 4GYIA 4BVUA 5L6WL 4ACMA 5JGAA 3V5JA 1BYGA 2OZAA 4NJ3A 4Y72A 4IWPA 4NUSA 3PWYA 1KV2A 2XS0A 2XBAA 3P9JA 3HUCA 3R9OA 4QNAA 3O7LB 5EHLA 3FV8A 3FPQA 2BALA 4RJ4A 5IA2A 1OIRA 2I1MA 2ZV8A 3ZO1A 5GINE 4H3QA 5AP2A 2R4BA 3MH0A 5FBOA 4L6QA 1XBAA 1ZOEA 3EFLA 4B9DA 5LCJA 4LFIA 5CU3A 3D7TA 3ZEWA 4YZDA 2F7XE 4FMQA 4DEDA 4J99A 4NW6A 3QXOA 2VX1A 3PRIA 3DXQA 1UWHA 2CKQA 3R1QA 1F3MC 1J7UA 3POOA 2FUMA 1NY3A 3UIUA 3ZSGA 2GQSA 4FODA 5EDPA 4KS7A 3VBWA 4F63A 4YBKA 5CLPA 4Q5EA 2UVXA 3ELJA 1FVVA 3AC8A 4AF3A 4D9UA 2I0EA 4TYIA 3A61A 2PK9A 1M2QA 2OFVA 1WMKA 2C69A 2NP8A 2XIZA 2CCHA 5CQWA 3ZO3A 4QMTA 1H8FA 2A4LA 2UZWE 2WZJA 3FE3A 3UQFA 4ZAUA 3BYSA 4O7TA 3DLZA 4GS6A 2FB8A 3ZO2A 4C3RA 2J0LA 4P2KA 5ANIA 2OWBA 4TKSA 3OCGA 4APPA 3LFAA 1H07A 2WU6A 3VS3A 3KB7A 4K9YA 4OTWA 5CSVA 1H1RA 3MH1A 4M84A 3L9NA 4MTAA 5CF5A 1SVEA 4CLIA 3GENA 2VN9A 5EW9A 4GRBA 4MX9A 2H34A 3TV6A 3LXLA 3GCPA 3RZFA 3T3VA 5IUGA 3TKIA 3M11A 2C3IB 5BPYA 2VTMA 1ZMVA 3AD6A 1TKIA 4UWBA 5H2UA 3W33A 2Y0AA 3BHUA 4G6OA 4PL3A 5A54A 4XNEA 5CEPA 3RHKA 5I3RA 4WKQA 4IFCA 3VUTA 3SRVA 1OVEA 2YACA 2C6EA 4QTCA 3FI8A 3EN9A 4FKSA 2IWIA 1CDKA 3OP5A 4OBOA 3AT3A 1K2PA 4X2GA 4FSZA 4ZXTA 3NNUA 3WE8A 5AA9A 4XLIA 2PE2A 5HORA 2Z2WA 4M12A 2OU7A 2WEVA 3PLSA 4WA9A 4JBQA 1REJA 4L42A 1CMKE 3UPZA 3EL7A 3QKKA 5F1ZA 4A4OA 4YSJA 1TVOA 4L43A 3FQHA 3OBGA 4HNFA 2VX0A 1M2RA 4FTTA 2C3LA 2VWUA 3HA8A 2FVDA 2XRUA 4QYGA 4E4NA 1ZLTA 3BEAA 4HGTA 4L53A 3MBLA 4AZTA 3JXWA 4ZY4A 2XM8A 2R2PA 1H24A 2VGPA 3OG7A 2IZTA 4WNPA 4A4XA 5C4KA 2C5NA 3MVLA 3TKHA 3TZ7A 4YJNA 4AT5A 3JVSA 4HZRA 3MYGA 3BBWA 3BV3A 4UXLA 4AOIA 1PRYA 3NUSA 4PDOA 4U3ZA 4XH6A 2VWZA 5HG9A 4PTCA 3RZBA 4PMTA 3LFDA 4CT1A 5CAVA 4DN5A 3D5WA 3FMKA 3R2BA 4DFYA 2WPAA 3FZTA 5TT7A 4CQEA
chains in the Genus database with same CATH superfamily
3GQIA 2VO3A 4CFVA 3I6UA 2WAJA 4FOBA 4L68A 3VBQA 4B0GA 2H8HA 2WQMA 3GU7A 3OTVA 3V3VA 4AS0A 4EOQA 2CNQA 4YPDA 2PVJA 4JJRA 1BI8A 2J5FA 2CN8A 4M69B 4CXAA 2YDIA 4S2ZA 5GIOE 3F61A 1G8KA 4PX6A 4ZZMA 3QALE 3TIYA 2WHBA 1PMVA 4FIFA 2CKEA 5HBJA 4U7ZA 3FHIA 4R5YA 3MY0A 3FZRA 4DEIA 5E4HA 5AP7A 4KAOA 3UDZA 4XX9A 1SVGA 3LCTA 3DS6A 3U6IA 3VRYA 4F1OA 4OTQA 1AGWA 5J9YA 3QHRA 3F5PA 4Y95A 1O6LA 1YOJA 3DBFA 3F7WA 4RX9A 5EW8A 4Z7GA 2X8IA 4FJVA 2YEXA 3AT4A 4AACA 1GAGA 4AZEA 4YZCA 2OBJA 4WNKA 5FG8A 5F20A 3EL8A 3F7ZA 4IZ7A 3VS7A 4U6RA 3VUGA 4QMMA 5HIBA 4QMWA 3C50A 4HNIA 2XH5A 2WMSA 3O8TA 2WIHA 3OOGA 3QTQA 4XOZA 4EKLA 1OM1A 1MRYA 2PZ5A 1UA2A 2JEDA 3KXNA 3OT3A 2ITUA 4IC8A 3AD5A 4OT5A 4R6VA 2NRUA 4RFMA 3ULZA 3VBYA 4Q9ZA 2GHGA 2W1HA 4Y83A 3GOPA 4WG5A 5M06A 3PA5A 3UTOA 3TZ9A 4BTKA 3DNEA 3QTZA 4QD6A 4RC2A 1PF8A 4M68A 5EQEA 3PYYA 1ATPE 1QMZA 3MFUA 4CT2A 4CYIA 4MXAA 3G90X 4C61A 4C34A 3BWJA 3FXWA 3ZSHA 3FY2A 4EZ5A 1NA7A 3R01A 2GNHA 2WD1A 4LL5A 5D11A 3R04A 1R0EA 3G0EA 3LJ2A 4NM7A 2QU5A 4YJOA 4AZFA 4EC9A 5GZAA 3TJDA 4RJ5A 2WTJA 2YCFA 1H4LA 2UW6A 1RJBA 4FZ6A 2OIQA 3IDBA 3UG1A 4UY9A 2Y8OA 5DWRA 4F7SA 3LMGA 3UQCA 3R7IA 4ANMA 2JIIA 4R5SA 5AUZA 2GNFA 4D5HA 2J0JA 3F9NA 4EQMA 4QTEA 4YTFA 2C6MA 5EYKA 2VWXA 4EORA 4H05A 5AUYA 4FR4A 2VV9A 3C0HA 4BDBA 4Z3VA 3VF9A 4KIKA 3QLFA 4YTCA 5KKRB 5C27A 3BQCA 3UOLA 2JITA 3FMJA 5KO1A 4OTDA 4XHKB 3K5UA 3FXXA 1XKKA 2I40A 3LCKA 4O27B 3VJNA 4EK5A 4EK8A 4F9CA 1P14A 1WBOA 4FTRA 3CJGA 2HYYA 4O7WA 4HPTE 3KY2A 4FZAB 1U54A 5IA3A 3O8PA 4NZWB 4O81A 1PYEA 1BKXA 4DGMA 5LOHA 3N9XA 5AIKA 3G15A 3AT2A 4E73A 5AEPA 1YW2A 4FC0A 4WSYA 3VS5A 1UVRA 3U55A 4C4EA 4D4RA 5IQCA 2RFEA 3D7TB 4DEBA 3HV4A 5J5SA 3QRKA 1H1QA 4IAAA 4AXAA 5J9LA 4CGAA 3ZBXA 1S9IA 2VNYA 3JS2A 3QUPA 3UBDA 3RWQA 4AU8A 5L2WA 3GU4A 4XV9A 3ZFXA 4YLLA 2BFYA 1GNGA 1W83A 1YWNA 1ZYJA 4IQ6A 5CAUA 2IW9A 2UZNA 3S2PA 3BL9A 2J4ZA 4E20A 4DHJA 3OWJA 4YC8A 1QPCA 4NEUA 2CN5A 1H28A 3I5NA 3GCVA 2V7AA 2FGIA 1OBDA 5KNJA 3QQFA 4QEBA 5KHXA 3QZIA 1T45A 4RJ6A 3LCDA 2B0QA 4QMLA 3WZDA 2YJRA 2JBPA 5J7HA 3A7GA 3KCFA 5AP1A 1U5RA 3QCXA 4RVMA 1CSNA 2WTIA 3HDNA 4ZY5A 3HAVA 1UV5A 4I3ZA 4C38A 3O23A 4IAFA 2G15A 1UU8A 5CX9A 2XAMA 3W0PA 3LQ8A 3NW7A 3H9RA 3Q9ZA 5EKOA 5F94A 5EFQA 3V5PA 3PDTA 3DK3A 4AW5A 4PMMA 4PDPA 2BMCA 4AGUA 2R3LA 3FDNA 4OTGA 4D2RA 2CKOA 4R7HA 1ZZ2A 2W0JA 3KULA 4XG2A 1Q8YA 4NH1A 5HE2A 3SD0A 4EQUA 4N6ZA 5IMXA 3E8DA 4YO6A 2XB7A 4YJTA 3U6HA 3R22A 2O65A 4I22A 4JRVA 5GJFA 3KKVA 5I9YA 4FSTA 4HVHA 4YHFA 2YM7A 4GK2A 1OL6A 1JKKA 3EQRA 4DBNA 2W1EA 1XQZA 4UZHA 2BKZA 1OBGA 5CZIA 4FKJA 4FL3A 3QX4A 5AM7A 4CZTA 4EHGA 4UMRA 5A4TA 4IB1A 5EYCA 1FGKA 4ZTMA 4C59A 3QF9A 4EOLA 5EM5A 5HG5A 4ZOGA 5I5ZA 4CMTA 1OB3A 2PU8A 3KRRA 5AADA 3COHA 3L8PA 3EIDA 5AUTA 3RK9A 3UO6A 3VC4A 4HVDA 3DJ7A 1PXOA 3FSKA 2B4SB 4ALVA 4CFNA 3SVVA 4DTBA 2YCRA 3CTHA 3PJ2A 4R1VA 1WBWA 4WT6A 3E7VA 2CGXA 4H3PA 3Q2JA 4A9TA 1WCCA 2JKMA 3CD8A 3GC9A 3LE6A 4XG8A 4XYFA 3AGMA 4EYMA 2HW7A 2WEIA 5IISA 3UYSA 3PJ8A 4AN3A 3C0GA 3V5WA 5L6PA 1RW8A 3IW7A 2ITTA 4I20A 4UMTA 3DCVA 5JQ8A 3WIKA 2QOOA 1WBTA 3QZFA 4DEGA 3DTCA 2YISA 5EOBA 3HMPA 5F95A 2X39A 2ERZE 4W8EA 3HV3A 1ZZLA 3I5ZA 4FI1A 4OTIA 4D9TA 1ST4A 3KGAA 4UWYA 3UDBA 4R3RA 3NZ0A 4EK6A 4U0IA 5CU0A 1OI9A 2XEZA 4DITA 5IQDA 3RALA 2XCKA 4NK9A 3BYMA 3EHAA 2VGOA 5JH6A 4GG7A 5KMJA 2QI8A 3ZFYA 4FKPA 1GIHA 2PVFA 3QLGA 4AGCA 5J7BA 5J79A 2BUJA 2XJ1A 2Z7LA 1Q4LA 4KRCA 4IAKA 3ZDUA 1ZOHA 3EN4A 4DLJA 5KCVA 4O0VA 4G9CA 4YUQA 5M09A 4PP9A 1UNGA 1XHAA 3VHEA 3ZRMA 2W1DA 3BL7A 2CPKE 3R7OA 4UALA 1Y6BA 3COKA 5JGDA 5BMSA 3ANQA 3H30A 4J52A 4F1MA 2UV2A 3B2TA 4RBLA 1APME 4OW8A 3VWAA 3PUFC 4NTSA 2W9ZB 5CT7A 2ZB0A 4J53A 4MNFA 4X2KA 5HG8A 1H1SA 1DM2A 4DG0E 1O6KA 2GQGA 3QYZA 2WOUA 2XKCA 4WD5A 5FDPA 2RGPA 4O83A 5IQFA 3I81A 3WF7A 3U6JA 2J90A 4ZZOA 2DYLA 2OFUA 3W0NA 4AOJA 4IM2A 3R00A 1OZ1A 5CZHA 5T6KA 2IJMA 4B8MA 3RAIA 4CTBA 5IQAA 4GFGA 2F7EE 2IVVA 4CZYB 1GY3A 4F0IA 5ETIA 1TFFA 3E62A 2WELA 3CLYA 2WTDA 5J1WA 1GZOA 3Q4TA 2REIA 4F9WA 1LEZA 5BVWA 4JDHA 3ATSA 4X0MA 3NUPA 4O2ZA 3WYXA 2B9HA 4APCA 1O9UA 2AQXA 3CR0A 1FVTA 3EKNA 3NYOA 3BI6A 4U45A 1QPEA 2DQ7X 4CFUA 3DBDA 3D2IA 5FM2A 4BTMA 1XH4A 2XBJA 4N4SA 2X4ZA 3SV0A 4FK3A 4JVGA 3ODZX 4H58A 4MH7A 1KE5A 5CAQA 4R77A 4IZ5A 3Q5IA 4J8MA 5JFXA 4CKIA 3HP5A 1M52A 1PMNA 3U4UA 2P4IA 4CVAA 2JD5A 3S1HA 5L4QA 3C5IA 5IQBA 3R8ZA 3RPYA 1G8AA 3G6GA 2PVYA 4BWXA 4E6CA 1XH7A 5CNOA 3MFSA 5AR7A 3PA3A 1WVXA 3E5AA 4XBUA 3KMUA 3I60A 4BIEA 5KBQA 2RFSA 3NUNA 5D9HA 1PXNA 3HL7A 4HJOA 3TL8A 4BICA 2E9NA 5CANA 5JEBA 2XNNA 4NTTA 4UBAA 5IKWA 3WF8A 1ZMWA 4U9AA 3QQGA 2Q0BA 2VO6A 3E8EA 3M1SA 3PP1A 3W32A 2CKPA 5M53A 4U42A 5HE3A 4QQCA 5KE0A 5CF8A 4IADA 2GPHA 2OH0E 4TYHB 4O0WA 4RRVA 3SXSA 3LW0A 2C6DA 3U4WA 2B9IA 4MHAA 4QPAA 4ZP5A 1FVRA 4F1TA 1OKYA 2BZHB 2UZDA 2J0MB 2QO9A 3O17A 2QHMA 3MTLA 3NYNA 4QYHA 3BBTB 2I0YA 3CPBA 4BCJA 1OIUA 4O21A 1MRVA 4A07A 4EH7A 4V0GA 3CIKA 5DRDA 3SW7A 3NUYA 4A4LA 5C03A 2PUNA 1IG1A 3WBLA 2GMXA 5FXSA 5EHYA 3HVCA 3QU0A 3FLWA 3PZHA 4IACA 4S33A 5EM6A 5HBEA 4M3QA 5K0XA 2XK4A 2HZIA 3OROA 3V8SA 3W18A 3ZSIA 4FICA 5CF4A 3Q04A 3QAME 3FKNA 3ZDIA 2YA9A 5E1SA 2VX3A 5I9WA 1FINA 4DCEA 3II5A 3T8OA 5ANDA 5AWMA 2ZM3A 3ZM4A 5CI7A 1H25A 3UYTA 4JS8A 4I6QA 4C62A 4EUUA 3EJ1A 3EN7A 4GT5A 5FTOA 3NYVA 1YI3A 2OO8X 4D28A 5IMEA 3KK9A 1FQ1B 2RFDA 2QODA 3HNGA 4QMOA 5DT4A 3CSVA 4YSMA 4O7ZA 3D0EA 5IU2A 2RG6A 4JDIA 2EWAA 5TO8A 1GIJA 4BDEA 4D2TA 3TEIA 1DI8A 2XUUA 4EOMA 4FSQA 3H9FA 3DZOA 1Q8TA 2VD5A 4I5MA 2EB3A 5AP4A 2C4GA 1KWPA 3OOMA 4TN6A 4CSVA 4EOKA 3AXWA 3I0QA 2FH9A 3D94A 3OXTA 2EB2A 5HD7A 2HOGA 4C4FA 4KBKA 3UZRA 1JNKA 4RX7A 4ZSLA 5AR8A 2A0CX 2XIXA 4E4MA 2UW7A 4ZLOA 2WGJA 3SX9A 5AR2A 1PJKA 2W05A 3MVHA 3PUPA 3FAAA 1J91A 5F4NA 3PWDA 2DUVA 2VTQA 2QCSA 4GJ3A 5HGIA 2WMQA 4WRSA 4ZLYA 4C4IA 1JQHA 4JQ7A 2GNLA 3V01A 4C33A 1OL7A 4IXPA 3NIZA 5G1XA 5HVYA 4DH5A 2WMTA 1XH9A 4D0XA 2PYWA 5JN2A 3I0OA 2OICA 3W2SA 3ZU7A 3OC1A 2B53A 3H0YA 2W4KA 3EN6A 3CS9A 3A99A 4BDGA 2B9FA 3G33A 4HYUA 3KVWA 3G2FA 3SG8A 2ZJWA 3CY2A 4U79A 3F2AA 3PPZA 3KK8A 4O7NA 3FQEA 3FI3A 3DKFA 4IX4A 4B4LA 3HEGA 3OBJA 1J7IA 3GFWA 4MF1A 5FWKK 2O64A 4BBMA 2NRYA 4FGBA 4GVJA 4EOOA 1OKWA 3VJOA 4FIGA 4O7VA 2XCHA 4HZSA 4R78A 3I7CA 4I5HA 2ZOQA 4J8NA 5EM8A 2PVKA 4GFOA 3Q6WA 2FSMX 5HO8A 3NNXA 5FBNC 3Q4ZA 4E3CA 4FT9A 4MXZA 3VS0A 4DAWA 4AFJA 2J0IA 4RQKA 4AGWA 3ATTA 3HRBA 4LGHA 5AUVA 4RX8A 4XG3A 5E8YA 1XH8A 3KULB 1FOTA 4FKGA 3GCQA 4I1ZA 4JG6A 1BL6A 4NFNA 4RA4A 5ACKA 4N0SA 2GU8A 4O7LA 5HTIA 4OTHA 2UW8A 1H00A 1U5QA 3GC0A 3NPCA 3RHXA 3D5VA 1WVWA 2F49A 1UNHA 2ETRA 3FLSA 3KMWA 2ZDUA 3KU2A 2NO3A 4XJ0A 3FZ1A 5D41A 4RIYA 2EUFB 4IJ9A 2QKWB 3MFTA 3GT8A 3QUDA 4BDHA 5CALA 4GH2A 3M2WA 1VEBA 2X8DA 5CU4A 4BGGA 3ENHA 3C0IA 1YXTA 4FIJA 4UYNA 2W1FA 3M42A 4P7EA 4PDSA 5AM6A 3RCJA 3TACA 4UMUA 3AMAA 4M0YA 4NKAA 2XKEA 1OUYA 4QMSA 3VRZA 4BHNA 3H3CA 3RVGA 4MD9E 3WILA 4U3YA 4X2JA 4QP9A 3LZBA 4L01A 4L46A 2QURA 4E6DA 4RX5A 1W2FA 3DQXA 4QYFA 3QA8A 5FEDA 1YDRE 3DLSA 2R3PA 4Y8DA 4FV9A 3KRJA 3LFCA 4JDKA 4TWPA 1CTPE 2Q0NA 1JKSA 3RNYA 3L8VA 5C8KA 5JFWA 2YZLA 1KOBA 2QLUA 2VNWA 3LHJA 2UUEA 3MV5A 3FLNC 3NUXA 2QOFA 3OWPA 3POZA 5I9UA 3DB6A 4YNEA 3RPVA 4BCNA 1ZWSA 2WQOA 3ORZA 3QC4A 2C1AA 4PY1A 4RLKA 1P4FA 2ETKA 3EYHA 5BVEA 4GKHA 1R3CA 3D9VA 4AE9A 4MWHA 1QPDA 3V04A 2ZAZA 4G5JA 4MCVA 3NW5A 5H8BA 4ANQA 1DAWA 4HGLA 2PY3A 4EWQA 5IDNA 3OY3A 4G3FA 2IVTA 2B7AA 4JLCA 2VUWA 3CP9A 2A2AA 5EI2A 4QDVA 4Q9SA 4BIDA 5A6NA 5DVRA 1T46A 2G2HA 4FV2A 3FLZA 3RM6A 3VQHA 1F5QA 3EKKA 3IW8A 4BTJA 2SRCA 3NLBA 4NCTA 3DNDA 4N70A 3V6SA 4EBWA 3Q4CA 3P08A 4JX3A 4CQGA 5I9ZA 5KKRC 4BN1A 3ZFMA 1BMKA 1XMMA 4FEWA 3ORNA 4O0XA 3MJ1A 2PTKA 2R7IA 4ONAA 4L52A 4IM0A 4IBMA 4P5QA 4YU2A 3Q96A 2XNBA 1J1CA 2QOBA 4YJPA 3TIZA 4KIQA 2PZYA 3IS5A 3NMUF 2Z02A 5E8XA 4FG7A 4JR3A 5FTQA 5AMNA 5BQ0A 3SXFA 2XYNA 3NVKI 3GXLA 4PDYA 2JBOA 4QP6A 4USDA 4BYIA 3E8CA 3Q53A 5ITAA 3BLQA 3MB6A 5DNRA 5LMAA 5IA1A 3PY3A 4MXYA 4IX5A 5AAEA 2EXEA 4C2VA 2R0IA 4FTMA 5CEOA 1JWHA 3TV7A 3UNZA 1YKRA 3DPKA 4RPVA 2P55A 4GIIA 4X3JA 4BJJB 5LMKA 1Q8ZA 4IDTA 3PG1A 4BZDA 3QD3A 5HX8A 4LQMA 4MD7E 4FGRA 2X1NA 3BX5A 4PUZA 4W8DA 3HV6A 4ASXA 2WTKB 3AOXA 4BCMA 4DGLC 4F7LA 3TDWA 4GYGA 5JFVA 4KB8A 2PMNX 5EDQA 4MK0A 3BU6A 4QTBA 4USFA 3OY1A 3TT0A 3UC4A 1JKTA 4BCQA 3FLQA 4I41A 2E2BA 5IA0A 5K5XA 3IECA 3QXPA 4F6WA 4AWIA 1V0PA 5CTPA 2QOCA 1PY5A 3NX8A 4QPSA 3W2QA 4B8LA 2VTAA 3QCYA 4WRGA 3SOCA 4ACHA 5JQ5A 5H8EA 3KN6A 4CTCA 4ZSGA 2UZEA 5AIRA 3HV7A 4FYOA 5HO7A 2QR7A 2G9XA 4O0UA 3UODA 4QQJA 5CY3A 3T9IA 5ICPA 2JFLA 1J3HA 4BI2A 3OFMA 3QRUA 2AC5A 2RFNA 4BY9E 3W0OA 4IVDA 3ULIA 3BIZA 3QX2A 3IQ7A 4Y85A 5A4QA 2QOIA 3O0GA 5BVDA 1LR4A 3JYAA 4O38A 3KIOC 3MIYA 3A8XA 2C5XA 1ZYSA 5E9EA 4F64A 3GNIB 3IK3A 5HIEA 2YAKA 2J5EA 2CLXA 3LVPA 2YLEA 3GUBA 4AE6A 5TR6A 4LDTA 4WG3A 3LFNA 5DIAA 4G6LA 4DE4A 4XRJA 3R8PA 2BKKA 3RMFA 3LPBA 1S9JA 5ETCA 3G9LX 4TNBA 2QNJA 2YDKA 2ONLC 4ARKA 4USEA 2YITA 2IVUA 3KXMA 3FI2A 4BCPA 1FBNA 2GS6A 3VBTA 4FIHA 2PULA 4NU1A 1M7NA 2XALA 3FBVA 1PXMA 2ZDTA 4I4FA 2YIQA 3PE1A 3Q32A 3COIA 4O22A 2QHNA 2Z8CA 1IR3A 4JIAA 4XBRA 5IQIA 2XZSA 3E3BX 5E92A 4N57A 3THBA 4O4BB 4WNOA 2HCKA 4J95A 4FV5A 1IA8A 4KIKB 3QCQA 3LCSA 4A9UA 3F5XA 4W4YA 5DGZA 3G6HA 4ZTLA 3UMWA 4A9YA 2WQNA 4X2FA 4EBVA 3OXZA 4ZSAA 2FSOX 3BV2A 3FY0A 5A4EA 3EOCA 4AN9A 4IAYA 4JG8A 3EZRA 2BHHA 2YZAA 4P4CA 4CKJA 3IW5A 4FV1A 3SHEA 1YXUA 4BB4A 4TWNA 2GQRA 3DFCB 3LJ0A 5L2SA 3QA0A 2OJIA 3CKXA 1E1XA 3PIYA 5K3YA 1W84A 3R1SA 4F7NA 4YR8A 4AXEA 2ZMDA 3AGLA 3UP2A 5IQHA 4JG7A 2X7OA 1ND4A 4ZMFA 5HNBA 3ORXA 1OGUA 3P7AA 3NFGB 3FYJX 1Q99A 2J7TA 5JKGA 2OKRA 4I6BA 2XK9A 2X2LA 4ITJA 1F0QA 5JSMA 4KKEA 1DAYA 2X2MA 3UDTA 4BFMA 5HLNA 4C3FA 3JUHA 3U54A 1H26A 1M7QA 3NFFB 3OCSA 3OD6X 4LV7A 1Y91A 4KIPA 3QRJA 5DR6A 3T3UA 3MH3A 4YTHA 3C7QA 4FRFA 1NW1A 4PL4A 1Y8GA 5KMLA 5CVHA 4FNYA 1VR2A 2ITOA 3O8UA 3QD4A 1ZARA 4JQEA 4LRMA 4MXOA 4YC6A 5DEYA 4G5PA 2HXQA 2VTLA 3CQUA 1SMHA 4LUEA 2WMRA 2LAVA 2IW6A 4QMNA 5IH6A 4G31A 2OJFE 4RVKA 1FGIA 4XP2A 4FVPA 3F3WA 4CMUA 5M4IA 3DKCA 1Y8YA 2UW3A 1V0BA 3RJCA 2RIOA 2QOKA 2WTCA 3COMA 2R5TA 3NS9A 3SRVB 1QL6A 2CHLA 3QTXA 4LV8A 3LIJA 2C47A 3U9CA 5TF9A 4C8BA 5CF6A 3RINA 4PWNA 4MUQA 5CEMA 5LCKA 2ZM4A 3TNWA 2BRBA 4E4XA 3UOJA 3FMNA 3UMXA 3AKLA 1UNLA 1YWRA 2EU9A 1ZYDA 4J1RA 1CKIA 3IG7A 4EOSA 3PVGA 2UVZA 4NIFB 5BVNA 3ORPA 5LWNA 1YXXA 4XG9A 4ASEA 1YI6A 4JNWA 2JKQA 1VYWA 2IZUA 3DBEA 3CE3A 3D7ZA 3IDPA 4FL1A 4IIRA 2VTOA 2X6EA 5EYDA 5IH5A 1J7LA 4G3DA 1XO2B 4JL9A 4ZTNA 2F57A 3MPMA 4EH4A 2GFSA 4DH8A 1E1VA 2HZ4A 3DBCA 3R1YA 4M69A 2P3GX 2NPQA 2UZTA 1B39A 2OH4A 2W99B 4EHVA 3RNIA 4BC6A 2WOTA 4JQ8A 3KRXA 4PV0A 2C0IA 5EM7A 3ZYAA 3KMMA 3OZ6A 1W2CA 5K5NA 4BR3A 2PMLX 3BE2A 3EFWA 3IOKA 5M56A 2XK8A 5H9BA 3A62A 3Q4UA 3RAWA 2VTRA 3D4QA 2QO7A 2J51A 3RK5A 3U51A 4F6SA 1WBSA 3F88A 5DR2A 2GCDA 3B2WA 3I4BA 2CGVA 1PYXA 1I09A 3SC1A 3HYHA 1P5EA 3ZZEA 2RKUA 4JBVA 2OXYA 4KKGA 4WSQA 4P5ZA 4UN0C 5DRBA 4RGJA 4RZVA 4BI0A 3Q5ZA 2BRGA 2YM3A 4BCFA 1UKHA 1Z9XA 2HWOA 4A9SA 1A9UA 2WB8A 4XV3A 3HMOA 3BYVA 3PSCA 3R71A 4QMZA 1AD5A 1XH6A 3QBNA 5I9XA 3OW3A 1A48A 2ZV2A 3AC1A 3P86A 2C1BA 4EZ7A 3KL8A 1NT2A 4E4LA 5FLFA 3TNQB 4DT9A 1KSWA 4FTUA 4O4CA 1OGYA 3R0TA 4I0RA 1B6CB 1IRKA 2PUUA 5FEQA 2C3JA 5FQDC 5DMZA 3P79A 3TZ8A 3Q6UA 4U41A 4IFGA 2O8YA 4JDJA 3E63A 3W0SA 3BYOA 4CV9A 4K1BA 2BFXA 4O7RA 3GP0A 2AYPA 4X7QA 4DGOA 2WMAA 2WQEA 2B9JA 4IAZA 3FL4A 1Y6AA 4FOCA 5DT0A 3K54A 4FT0A 4GU6A 4J98A 4MWIA 3CGFA 4JAJA 4L3JA 3QZGA 4WNMA 4NFMA 2BZJA 1URWA 2ITXA 4BDIA 4FA2A 4WHZA 4S34A 4IW0A 4GK3A 3MA6A 2Y4IB 1UWJA 4DHZA 2XP2A 3MPAA 1UU7A 3G9NA 2R3NA 2W1GA 2XM9A 3JVRA 4AXDA 5K9IA 3OTUA 4IVCA 3TUBA 4MXXA 4EJ7A 3CEKA 1H1WA 4FT3A 3R7EA 2WTKC 4AW2A 3JPVA 3FZSA 4UEUA 3Q60A 3SAYA 3NVMB 1OPKA 4FIIA 3DOGA 1BLXA 1YDSE 5AP0A 4B6LA 4F0GA 2EXCX 5E8SA 5FRIA 2UZBA 4ZLZA 5BUIA 4AG8A 3ZM9A 3DT1A 1YRPA 3EQIA 4K0YA 3GC8A 3F3TA 1ZAOA 3R30A 3WZJA 4AUAA 3ORLA 3VW8A 1PXLA 3IW6A 2YCQA 2W5HA 1WZYA 4HYIA 3OCTA 3GEQA 4EL9A 4OBQA 3HMNA 2PUPA 4FTNA 4KSPA 4XG4A 3UVQA 3VS2A 3HMIA 3VHKA 4BWPA 4EOPA 3QKMA 2GHMA 3PPKA 3FUPA 4IE9A 4BCGA 2R7BA 4I5CA 4HCVA 2FA2A 4I5PA 2WIPA 5KMKA 2XARA 5HTCA 3PG3A 2WMWA 5BX0A 3QUEA 3VAPA 3BHVA 2JKKA 1L8TA 4RT7A 5K4JA 3F2RA 4DDIA 5TOZA 4YLJA 4AT4A 2QOLA 4O84A 3MGYA 2C0OA 4O0YA 5JZJA 4FKWA 5I4NA 3CPCA 4Y5QA 5E8VA 4G16A 1IEPA 5ANGA 3ZRLA 4XP0A 4ANNA 3B8RA 3D5UA 2XEYA 3NAXA 5A4CA 3ZMMA 4EQCA 3HKOA 1PXKA 2ITQA 2X7FA 4MQ1A 3WF6A 1HCKA 3DZQA 2IG7A 4BDAA 3V8TA 5EG3A 4IEBA 3HV5A 4QP7A 2OZAB 4II5A 3PJ3A 2A98A 3FKOA 2R64A 5L8LA 2O5KA 3IPHA 3MY1A 4D4VA 1R0PA 3OUKA 4QMPA 1W8CA 4K8AA 3LKMA 4RIXA 3DXNA 5HD4A 2BVAA 3TZMA 5IEXA 3A7FA 3QFVA 5IDPA 5AUXA 1M14A 3VUHA 4JT3A 3F3ZA 4KRDA 3HA6A 1U4DA 4EK4A 4IHPA 4IZAA 4M67A 1JSUA 3G51A 2R3IA 3NCZA 5AV3A 4C58A 5IUIA 5JFSA 3AG9A 1DS5A 2HELA 2HWPA 4U40A 3O71A 5HCYA 4E5BA 5BYYA 4FV3A 5LQFA 4AX8A 3UZTA 5DA3A 4O6LA 3WZEA 3QWJA 1VYZA 4FSRA 2ZV9A 4RMZA 2CJMA 3GQLA 3CGOA 3QTSA 4FSNA 5CAPA 2O0UA 2JDTA 4HOKA 2JDOA 2UW5A 2R9SA 1ZRZA 2V0DA 3R7YA 2UW0A 3BKBA 4QPMA 2Z7SA 3A60A 4RIYB 4E26A 1KV1A 2W4OA 3N51A 4FYNA 3F5GA 4OTFA 3CC6A 5J5TA 2QVSE 5HO6A 2HY81 2WQBA 3V6RA 1WBVA 3AC2A 4I6FA 5DHJA 3ZLWA 4C2WA 4CRLA 4W4WA 4X3FA 3EH9A 3Q9WA 4MQ2A 5C01A 1RE8A 2W1CA 3EMGA 3RPOA 4CFXA 4ZMEA 3E8NA 4YHTA 4FV6A 3SXRA 2PE0A 2HZNA 1A06A 4C35A 1H0VA 3R8VA 4DFUA 4AA5A 2CMWA 3FLYA 4C3PA 2YWVA 2QO2A 3GU5A 2A1AB 2YWPA 4YPSA 4UXQA 2JC6A 3W8QA 5JT2A 3QCSA 5DYJA 1W98A 5CQUA 1BX6A 2X8EA 1Q3DA 5M51A 1XR1A 4FVRA 3BLRA 1OMWA 3EQBA 2CCIA 5DFPA 2WMVA 4BCHA 4E93A 2GHLA 4OTPA 2XKFA 4JI9A 4ERKA 2BRNA 2CDZA 2DS1A 4LOOA 5LJJA 2GFCA 4RZWA 4FTAA 3KN5A 4A06A 2OG8A 4UMQA 4CG9A 3EQFA 3LFQA 2Z7RA 2R3RA 4UWCA 3ZTXA 3BYUA 4FG8A 4IB0A 3DJ5A 2KULA 4FNZA 4FNXA 5LXMA 2V7OA 1FMKA 4K77A 4AW1A 2IPXA 4PMSA 4EH6A 2GNGA 4JR7A 5HLPA 4F9BA