5E96A

Crystal structure of aminoglycoside 6'-acetyltransferase type ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
155
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHEHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive characterization of ligand-induced plasticity changes in a dimeric enzyme.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords Aminoglycoside 6'-acetyltransferase
total genus 44
structure length 155
sequence length 179
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5e96A00
2OZUA 3TOBA 1U6MA 4KVOE 2BL1A 2DXQA 3EC4A 4X5KA 3NE7A 4CRZB 2J8RA 3F8KA 4GS4A 2PR1A 2NMTA 1UFHA 2B4DA 2PDOA 2QECA 2OB0A 4CAXA 3FB3A 3FRMA 3PP9A 4XPDC 1Z4RA 1M4GA 4PK3A 2Z0ZA 2ZW6A 4CRYB 4Y49C 3KKWA 4HNYB 4YRHA 2REEA 2REFA 2QIRA 3SXNA 3IWGA 4AVBA 3EY5A 2P6GA 2Q4YA 1SQHA 1YK3A 4MY3A 5C82A 2OH1A 3QAHA 2VBQA 1BOBA 4I49A 1RO5A 1Y9KA 4JXRA 3ZJ0A 2BEIA 2R1IA 1Q2DA 5EC4A 1QSRA 2GANA 2KCWA 5KTAA 4OADA 2B5GB 1L0CA 3JUWA 1Z9UA 4HNWB 1NSLA 3W6XA 2F5IA 3SHPA 2PC1A 4E2AA 5F49A 1YVKA 2FIWA 1VKCA 1IYLA 2PRBA 3LD2A 4JD6A 4PSWA 3T9YA 4FD4A 3TT2A 2C27A 3P2FA 4KOTA 1ON0A 4UWJA 2O28A 1YR0A 5IB0A 2Q44A 4KZTA 3H4QA 1Y7RA 2J8NA 4HNXB 2P6FA 1I1DA 3P2HA 2GIVA 3CXSA 2B3UA 1S7NA 5IX3A 4R87A 2FSRA 3BJ7A 2FIAA 2G0BA 1M4IA 4KOVA 5F48A 3TO7A 1XEBA 3DR8A 1S60A 1BO4A 3EXNA 2FT0A 5ISVA 4JJXA 4Y49B 4KUAA 2A4NA 2ZXVA 4QC6A 2PSWA 2B4DB 4MJ8A 3WR7A 4NEXA 5DWNA 3R9GA 4CS0B 4XPKA 4R9MA 4AG7A 3QB8A 1YVOA 1S3ZA 4U9ZA 4E0AA 1RXTA 3TO9A 1I21A 4YGOA 1Z4EA 5GCNA 2VEZA 1M1DA 2FS5A 1KUYA 2ARHA 4FD7A 4AG9A 1IICA 1YX0A 4XPDB 4DNCA 1B87A 2JDDA 2Z11A 4JWPA 4UWIA 3EO4A 2WPXA 2P0WA 4IF5A 4PK2A 1MJBA 3D3SA 3TFYA 1Q2CA 2CNTA 4U9YA 4XNHB 5H86A 3TOAA 2ZW5A 1XF8A 4KVXA 4ZBGA 3FYNA 2R7HA 1P0HA 1J4JA 5EBVA 1MK4A 1R57A 1PU9A 2GE3A 2Q4VA 1QSNA 4KVME 4B5PB 3G8WA 3I3GA 5J8FA 5JPHA 2AJ6A 2B58A 4NXYA 3DDDA 5C88A 3VWDA 4NF1A 2ZW4A 3OWCA 4K30A 3S6KA 3FBUA 1CJWA 2WPWA 4H6UA 3I9SA 5KTDA 2VXKA 3W91A 2EVNA 2VZZA 2Q04A 2Q0YA 4QBJA 4CAWA 1S7LA 1QSMA 2CY2A 4R3LA 4AVAA 5J8CA 4ONUA 2J8MA 3DNSA 1XE4A 4KLWA 4KOWA 5FVJA 1P4NA 2Z10A 3UY5A 1N71A 2ZPAA 1GHEA 4R57A 3R96A 1OZPA 4R3KA 1K4JA 3CXQA 3FXTA 1KUVA 3D8PA 4ORFA 4KOYA 2FXFA 5CNPA 1KUXA 3EFAA 2BSWA 3RYOA 2HUZA 4NSQA 5HMNA 4QVTA 2CNSA 4BMHA 1V0CA 1MJAA 2D4PA 3V8IA 3TO6A 1WK4A 1M44A 4KUBA 1WWZA 2D4OA 2HQYA 3TE4A 3R1KA 1NMTA 4KOSA 5E96A 3N7ZA 2VZYA 4OLLA 3FIXA 1PUAA 1M4DA 3GYAA 4HKFA 2R8VA 4UA3A 5IV0A 4L8AA 4KOUA 4YFJA 4L89A 1IIDA 3BJ8A 2VI7A 1NE9A 3D2PA 1S7FA 2PR8A 2ZW7A 1IYKA 4H6ZA 3DSBA 2H5MA 4E8OA 2I79A 2Y0MA 1YLEA 1S7KA 4XPLA 4H89A 1YREA 3R95A 3TTHA 1QSTA 4KOXA 5JQ4A 2OZGA 4M3SA 5F47A 2B3VA 4KORA 4AB7A 4QUSA 2AE6A 3IGRA 4M85A 3R9EA 4MI4A 3F5BA 2FL4A 4U5YA 3ZZIA 3F0AA 1I12A 3B8GA 4F0YA 2IL4A 2QMLA 4J3GA 3SXOA 5I0CA 2OU2A 2B4BA 3S6GA 2P6EA 4CAVA 3G3SA 4XNHC 2PQ8A 1YGHA 1KZFA 5F46A 4B5OA 3PGPA 1XMTA 2B5GA 3JVNA 2FE7A 3C26A 2EUIA 1S5KA 4FD6A 2JDCA 2G3TA 1FY7A 1VHSA 3GKRA 5HH1A 4II9A 1IB1E 1B6BA 4IUSA 3W6SA 2RC4A 3DR6A 3R9FA 1QSOA 1XIXA 2R98A 2K5TA 2I00A 5KTCA 4LX9A 3S6FA 1CM0A 4PSXA 5H84A 3BLNA 1MJ9A 4KLVA 2X7BA 1Q2YA 1Y9WA 1LRZA 4MY0A 3PZJA 1TIQA 4EVYA 2VQYA 4LUAA 4AVCA 4NCZA 2BUEA 3CXPA 3VWEA 2ATRA 3E0KA 4B5PA 2FCKA 4PV6A 2CNMA 2HV2A 4FD5A 4JXQA 4OAEA 3MGDA 5DWMA 4MHDA 2JLMA 2G3AA 2OZHA 4RS2A 2Q7BA 3GY9A 4MBUA 3T90A 4RI1A 4UBRA 3D2MA 3TCVA 3K9UA 4F6AA 4QB9A 3FNCA 3S6HA 2JEVA 3LODA 4JLYA
chains in the Genus database with same CATH superfamily
1FNOA 2OZUA 4MFKA 2RFHA 3TOBA 5ELYA 1U6MA 5BWAB 3H8GA 4KVOE 4M6GA 2BL1A 2DXQA 2PJ2A 2PJ9A 2NSMA 3EC4A 4X5KA 5DS0A 4WJBA 4Z65A 3GUXA 3NE7A 2Q4ZA 4CRZB 4BINA 2J8RA 3S9LA 2PIZA 3F8KA 4X8IA 1IY7A 3PB7X 2Q51A 2GLFA 4F9UA 4GS4A 3GLJA 2PR1A 3B35A 4OKOA 2YNCA 2NMTA 1UFHA 2B4DA 2PDOA 3BHXA 2QECA 2OB0A 4CAFA 3K9TA 1IOIA 3KR4A 2PJ0A 3KQZA 3QNVA 4RUHA 3GIUA 4CAXA 2WSAA 4CYNA 3FB3A 1ZLIA 2AFSA 4OC4A 3D7FA 4YU9A 3QAYA 1TKFA 2PJCA 3FRMA 3PP9A 4R6TA 4XPDC 4B14A 1Z4RA 1M4GA 4PK3A 4Q7AA 2ABZA 1X10A 4UCNA 5LRJA 5HVFA 5AG7A 2Z0ZA 3CT9A 2ZW6A 4CGPA 4CRYB 5HXDA 4Y49C 3KKWA 4HNYB 4YRHA 1Z5RA 2REEA 4NJQA 2REFA 2FVGA 2PJ8A 2QIRA 3KR5A 3SXNA 1XRYA 3D4UA 3IWGA 4AVBA 1UWYA 3EY5A 3NH8A 1AYEA 2P6GA 2O53A 4R7MA 4B11A 3MN8A 2Q4YA 1SQHA 1YK3A 3NE8A 4MY3A 1GYTA 3FMCA 4DJLA 2OH1A 3QAHA 5C82A 2VBQA 2JBKA 1BOBA 4I49A 5A27A 1RO5A 4ZY0A 1ELMP 1Y9KA 4JXRA 3ZJ0A 1YQEA 2AFXA 3DGVA 2GFQA 3WC5A 2BEIA 2R1IA 3B3SA 2V8DA 3PBBA 4UEFA 5G21A 1Q2DA 2Z3OA 2V8GA 5EC4A 1QSRA 2GANA 4NFRA 4OC5A 1CX8A 2KCWA 5KTAA 4MCPA 2AFMA 4OADA 2B5GB 1L0CA 3JUWA 1Z9UA 4HNWB 2BOAA 4KSAA 4GM5A 3KI9A 1CP7A 1NSLA 3FECA 2EWBA 5F09A 3W6XA 2F5IA 2AFZA 4UF4A 3SHPA 2PC1A 4E2AA 5F49A 4UEEA 3DLJA 4K3NA 5A28A 4P44A 2CTBA 2ZENA 4MFQA 5IB9A 2ODFA 5JH9A 5J1QA 2Q7SA 3MRUA 4IHMA 1YVKA 2FIWA 2DPTA 1VKCA 4ZY2A 1IYLA 1XJOA 1ARLA 1CPXA 2C6CA 2EO8A 2PRBA 1PYTB 2ZEPA 3LD2A 4JD6A 3T9YA 4FD4A 3H8FA 3TT2A 2ZOGA 2C27A 2DEAA 3P2FA 4KOTA 5G22A 2PJBA 1ON0A 4UWJA 1JWQA 2I3CA 1OBRA 3H8EA 3ISXA 2O28A 5D8NA 4M6IA 4OC1A 3WABA 1YSJA 1YR0A 3IJ3A 3RNZA 3IIBA 2Q44A 5IB0A 4KZTA 4CPAA 3KZWA 2C6GA 5LRKA 3H4QA 1Y7RA 3IWEA 3K2KA 2J8NA 4HNXB 1Y0RA 2P6FA 3JTKA 4F8ZA 1I1DA 4FBEA 4B12A 3P2HA 3N5FA 3WC6A 3ISZA 2AFWA 1H8LA 2GIVA 1XFOA 3CXSA 4UIAA 2PIYA 2B3UA 4KSFA 1S7NA 1ARMA 1KWMA 1R43A 2DPSA 4ZY1A 5IX3A 1Z2LA 1IGBA 4NJRA 4B6ZA 1YLOA 4R87A 2FSRA 2PJ1A 3BJ7A 2FIAA 2G0BA 4UEZA 4PXDA 1M4IA 1LANA 1LCPA 2JBJA 4MCSA 5LRGA 1VGYA 3PBEA 4NGSA 5HVGA 4KOVA 5I4MA 1CBXA 3CPAA 4MMOA 5F48A 4C7IA 3TO7A 1XEBA 1BAVA 2Z3PA 2IMOA 3DR8A 1S60A 1BO4A 1A2ZA 4FWUA 3EXNA 4P4IA 5LYLA 4OC2A 3PB4X 3B3CA 3RZAA 2FT0A 4MCRA 5K8PA 5ISVA 2PCUA 4JJXA 4Y49B 1FT7A 4KUAA 5THWA 2A4NA 2ZXVA 4KS9A 4QC6A 1LAPA 2AFOA 2PSWA 2B4DB 4AXVA 4B13A 4FAIA 4MJ8A 3WR7A 3RBUA 2EBJA 2ZEOA 4NEXA 5DWNA 2ZEFA 3R9GA 5JM6A 4ONWA 5G1ZA 3PB8X 1LFWA 4XPKA 4CS0B 1HDUA 4R9MA 4OMEA 4AG7A 1QMUA 8CPAA 3KHXA 2F7VA 3QB8A 7CPAA 3NA6A 1YVOA 1S3ZA 4U9ZA 4E0AA 1RXTA 4P10A 4B10A 2CIJA 2YNDA 3TO9A 1I21A 4YGOA 1Z4EA 5GCNA 2VEZA 1M1DA 2FS5A 2ZEEA 1KUYA 2ARHA 4FD7A 4AG9A 1IICA 4G1PA 2CF4A 1YX0A 4XPDB 4MFPA 4TNUA 4NGNA 4PXEA 4DNCA 4DUKA 1B87A 4PPZA 2JDDA 2Z11A 4JWPA 1IU8A 1TF9A 4R76A 4UWIA 3EO4A 2WPXA 3WC7A 2Z3MA 1YW6A 2P0WA 4IF5A 4PK2A 1MJBA 1LOKA 1BLLE 3D3SA 3D68A 3TFYA 3PFEA 1Q2CA 2CNTA 4U9YA 4XNHB 5H86A 3TOAA 2Z3KA 3B3TA 5LYFA 2ZW5A 1XF8A 4KVXA 4OC3A 4ZBGA 3FYNA 2R7HA 4Q36A 4CGOA 1F2OA 3L2NA 1P0HA 2OR4A 1J4JA 5EBVA 1MK4A 1Q7LA 2PJAA 4A38A 1R57A 4C7HA 1PU9A 2GE3A 2Q4VA 1AMPA 3FEDA 1QSNA 2POKA 3NFZA 5G20A 4OC0A 2HC9A 2Z3LA 3SJGA 5K8OA 4KVME 4B5PB 4ZI6A 3I1UA 2XEFA 2XEIA 4P4JA 5K8NA 3G8WA 3I3GA 1HDQA 1Y0YA 2PRQA 3KQXA 2AJ6A 5J8FA 5JPHA 2PVVA 2B58A 3B2YA 4NXYA 3DDDA 3FH4A 5C88A 4P6YA 3VWDA 4NF1A 2ZW4A 3OWCA 4K30A 3FVLA 4NGRA 4OP4A 5AG4A 3CPXA 2V8HA 4UCMA 2GLJA 3FBUA 4YWYA 3S6KA 4NGPA 2IJZA 1CJWA 2QVPA 1XBUA 4KSIA 2WPWA 2PJ7A 2WZNA 4JYWA 4H6UA 3I9SA 5KTDA 2VXKA 2F8HA 2EVNA 2VZZA 3W91A 2ZOFA 2Q04A 2Q0YA 3T8WA 4QBJA 3PB9X 1XMBA 5K8MA 4ZX9A 4CAWA 5CBMA 1S7LA 1QSMA 2CY2A 4R3LA 4AVAA 5J8CA 4ONUA 2J8MA 1PCAA 3DNSA 1XE4A 4KLWA 4KOWA 5FVJA 1P4NA 4UFWA 2Z10A 3V7ZA 3UY5A 1N71A 2ZPAA 4A2ZA 1GHEA 5AGEA 1VHEA 2XEGA 4R57A 3R96A 2YNCC 2YNEA 1OZPA 2AFUA 4R3KA 5EMIA 1K4JA 3CXQA 1TXRA 5AG5A 3FEEA 1KUVA 3B7IA 3D8PA 3FXTA 3IEHA 4KOYA 3KGQA 4ORFA 4A30A 4EWTA 2YGWA 2FXFA 5CNPA 3FF3A 1KUXA 3EFAA 2QJ8A 4OIDA 3D66A 4IAVA 2PJ4A 4HPSA 4BBHA 4C2ZA 2BSWA 3RYOA 2HUZA 3BXMA 3V38A 4NSQA 1HEEA 3CZXA 4QVTA 5HMNA 1Y7EA 2CNSA 3PFOA 1V0CA 4BMHA 1CG2A 4H2KA 1MJAA 4A31A 2D4PA 2RB7A 2GU2A 3V8IA 3TO6A 1WK4A 1M44A 4KUBA 1BPMA 1WWZA 2BCOA 2D4OA 2HQYA 2OOTA 3S9MA 3TE4A 4NGQA 3PB6X 4O23A 3R1KA 1DTDA 1NMTA 1R3NA 3D7HA 4KOSA 5E96A 3N7ZA 4C2XA 2VZYA 4OLLA 2WUUA 3FIXA 1PUAA 1M4DA 3GYAA 4HKFA 4FUUA 3SI1A 4A94A 2R8VA 4NGTA 3VH9A 1AUGA 4ZYQA 2V8VA 4UA3A 5IV0A 3LWUA 5AG6A 4L8AA 4IK2A 4KOUA 4YFJA 4L89A 2Q43A 1IIDA 3BJ8A 2VI7A 4P4DA 3SJEA 1NE9A 4UCPA 3D2PA 2VL1A 1NSAA 1S7FA 2PR8A 4CGMA 2ZW7A 3LMSA 1VIXA 1IYKA 2NYQA 4H6ZA 3DSBA 1TKJA 1Z8LA 4DYOA 2H5MA 4F9VA 2Z3NA 4E8OA 2ZELA 4MCQA 2XEJA 2I79A 2Y0MA 3H5ZA 3B3VA 1YLEA 3IO1A 2O4HA 3VATA 4UFVA 1S7KA 2C1CA 4XPLA 4H89A 1YREA 2DF5A 3R95A 5JGFA 4MHPA 4W9YA 3TTHA 1QSTA 4KOXA 5HVHA 5JQ4A 1Z8WA 2OZGA 4M3SA 5F47A 4P4EA 1F2PA 2B3VA 4CYQA 4KORA 6CPAA 4BD9A 1YW4A 2ANPA 4M6HA 4UIBA 4QUSA 4AB7A 2AE6A 3IGRA 4CAEA 4M85A 4X3RA 4MI4A 3R9EA 3F5BA 4GXHA 3NH5A 2C6PA 1M4LA 2FL4A 4U5YA 1JQGA 3ZZIA 3F0AA 1X12A 1I12A 3B8GA 3LACA 4F0YA 2IL4A 2QMLA 4J3GA 3SXOA 4A32A 5I0CA 2OU2A 4A37A 2B4BA 3S6GA 1F57A 2HB6A 2P6EA 3A9LA 4PQAA 4WWVA 3G3SA 4CAVA 4CYPA 4XNHC 2PQ8A 1YGHA 1KZFA 5F46A 4B5OA 1CP6A 3IFEA 3PGPA 1XMTA 2B5GA 2J9AA 3JVNA 2FE7A 3C26A 1VHOA 2EUIA 4PSWA 1S5KA 4FD6A 2JDCA 3PEIA 2JEWA 1Z8TA 1FY7A 2G3TA 3FX6A 1VHSA 3GKRA 3D7DA 5HH1A 4II9A 4MRIA 3IWWA 4MFJA 3BI1A 1IB1E 1B6BA 1CPSA 2PVWA 2GREA 3PRTA 4LQGA 1RTQA 4C68A 4IUSA 4JZ0A 3FJUA 4PXBA 3W6SA 2RC4A 3B3WA 4TWEA 2EK8A 1BPNA 3DR6A 3SI0A 4LQ6A 2PE3A 3R9FA 2PJ3A 1ELLP 3IU1A 3RO0A 1QSOA 1XIXA 2PJ5A 2R98A 2CTCA 2K5TA 2I00A 1ZLHA 4X2TA 5KTCA 4UFXA 2ZEHA 2G9DA 3D67A 1Z8XA 4LX9A 3S6FA 1CM0A 1TF8A 3IC1A 4NGMA 4PSXA 4EFDA 4CGNA 3WT4A 5H84A 3BLNA 1MJ9A 4KLVA 3RAMA 1DE4C 2X7BA 1Q2YA 3KL9A 1Y9WA 1TKHA 3BI0A 3TX8A 1LRZA 2BO9A 4MY0A 2EK9A 4MFZA 3PZJA 4F0XA 1TIQA 1XOVA 1ZO0A 1QQ9A 2VQYA 4RN7A 3HUVA 4A39A 4LUAA 4AVCA 2ZEDA 4MHNA 3SI2A 4CGLA 4NCZA 2BUEA 3CXPA 5CPAA 3VWEA 2ATRA 3E0KA 4P4FA 4CYOA 1ZG7A 4B5PA 2IQ6A 2FCKA 4PV6A 1ZG9A 3KHZA 4PXCA 2CNMA 2HV2A 4FD5A 4P4BA 4JXQA 4A95A 2ZEMA 4OAEA 2PJ6A 1LAMA 3MGDA 5DWMA 5D29A 3IU2A 3GB0A 4MHDA 3NH4A 2JLMA 4MXUA 2G3AA 3SJFA 1EE3P 2OZHA 4RS2A 2Q7BA 4ZX8A 4A33A 2QYVA 4R8FA 3VARA 4ZGYB 3GY9A 4MBUA 3SJXA 3T90A 4EVYA 1ZG8A 4RI1A 3HLPA 3D2MA 4UBRA 4C2YA 2V77A 4MHYA 3TCVA 4MFLA 3D7GA 3CDXA 3K9UA 3KASA 4MHZA 5LYIA 4F6AA 3TC8A 1YMEA 2WYRA 3FNCA 1IOFA 3JRUA 4QB9A 4P45A 3S6HA 2JEVA 3LODA 4EMEA 4JLYA 4OIWA 3S9NA 2CXAA 5LYDA 2ZEGA 4Q38A
chains in the Genus database with same CATH topology
2OZUA 4MFKA 3TOBA 1U6MA 5BWAB 4KVOE 2BL1A 2DXQA 3EC4A 4X5KA 3NE7A 4CRZB 2J8RA 3F8KA 4GS4A 2PR1A 2YNCA 2NMTA 1UFHA 2B4DA 2PDOA 2QECA 2OB0A 4CAFA 4CAXA 2WSAA 4CYNA 3FB3A 3FRMA 3PP9A 4XPDC 4B14A 1Z4RA 1M4GA 4PK3A 4UCNA 5AG7A 2Z0ZA 2ZW6A 4CGPA 4CRYB 4Y49C 3KKWA 4HNYB 4YRHA 2REEA 2REFA 2QIRA 3SXNA 3IWGA 4AVBA 3EY5A 2P6GA 4B11A 2Q4YA 1SQHA 1YK3A 4MY3A 5C82A 2OH1A 3QAHA 2VBQA 1BOBA 4I49A 5A27A 1RO5A 1Y9KA 4JXRA 3ZJ0A 2BEIA 2R1IA 5G21A 1Q2DA 2Z3OA 5EC4A 1QSRA 2GANA 2KCWA 5KTAA 4OADA 2B5GB 1L0CA 3JUWA 1Z9UA 4HNWB 4KSAA 1NSLA 3W6XA 2F5IA 3SHPA 2PC1A 4E2AA 5F49A 5A28A 4MFQA 1YVKA 2FIWA 2DPTA 1VKCA 1IYLA 2PRBA 3LD2A 4JD6A 4PSWA 3T9YA 4FD4A 3TT2A 2C27A 3P2FA 4KOTA 5G22A 1ON0A 4UWJA 2O28A 1YR0A 5IB0A 2Q44A 4KZTA 3H4QA 1Y7RA 3IWEA 2J8NA 4HNXB 2P6FA 3JTKA 1I1DA 4B12A 3P2HA 2GIVA 3CXSA 2B3UA 4KSFA 1S7NA 2DPSA 5IX3A 4R87A 2FSRA 3BJ7A 2FIAA 2G0BA 1M4IA 4KOVA 5F48A 4C7IA 3TO7A 1XEBA 2Z3PA 3DR8A 1S60A 1BO4A 3EXNA 2FT0A 5ISVA 4JJXA 4Y49B 4KUAA 2A4NA 2ZXVA 4KS9A 4QC6A 2PSWA 2B4DB 4B13A 4MJ8A 3WR7A 4NEXA 5DWNA 3R9GA 5G1ZA 4CS0B 4XPKA 4R9MA 4AG7A 3QB8A 1YVOA 1S3ZA 4U9ZA 4E0AA 1RXTA 4B10A 2YNDA 3TO9A 1I21A 4YGOA 1Z4EA 5GCNA 2VEZA 1M1DA 2FS5A 1KUYA 2ARHA 4FD7A 4AG9A 1IICA 1YX0A 4XPDB 4MFPA 4DNCA 1B87A 2JDDA 2Z11A 4JWPA 4UWIA 3EO4A 2WPXA 2Z3MA 2P0WA 4IF5A 4PK2A 1MJBA 3D3SA 3TFYA 1Q2CA 2CNTA 4U9YA 4XNHB 5H86A 3TOAA 2Z3KA 2ZW5A 1XF8A 4KVXA 4ZBGA 3FYNA 2R7HA 4Q36A 4CGOA 1P0HA 1J4JA 5EBVA 1MK4A 4C7HA 1R57A 1PU9A 2GE3A 2Q4VA 1QSNA 5G20A 2Z3LA 4KVME 4B5PB 3G8WA 3I3GA 5J8FA 5JPHA 2AJ6A 2B58A 4NXYA 3DDDA 5C88A 3VWDA 4NF1A 2ZW4A 3OWCA 4K30A 5AG4A 3S6KA 4UCMA 3FBUA 1CJWA 2WPWA 4H6UA 3I9SA 5KTDA 2VXKA 3W91A 2EVNA 2VZZA 2Q04A 2Q0YA 4QBJA 4CAWA 1S7LA 1QSMA 2CY2A 4R3LA 4AVAA 5J8CA 4ONUA 2J8MA 3DNSA 1XE4A 4KLWA 4KOWA 5FVJA 1P4NA 4UFWA 2Z10A 3UY5A 1N71A 2ZPAA 4A2ZA 1GHEA 5AGEA 4R57A 3R96A 2YNCC 2YNEA 1OZPA 4R3KA 1K4JA 3CXQA 5AG5A 3FXTA 1KUVA 4A30A 3D8PA 4ORFA 4KOYA 2YGWA 2FXFA 5CNPA 1KUXA 3EFAA 4BBHA 4C2ZA 2BSWA 3RYOA 2HUZA 4NSQA 5HMNA 4QVTA 2CNSA 4BMHA 1V0CA 1MJAA 4A31A 2D4PA 3V8IA 3TO6A 1WK4A 1M44A 4KUBA 1WWZA 2D4OA 2HQYA 3TE4A 3R1KA 1NMTA 4KOSA 5E96A 3N7ZA 4C2XA 2VZYA 4OLLA 2WUUA 3FIXA 1PUAA 1M4DA 3GYAA 4HKFA 2R8VA 4UA3A 5IV0A 5AG6A 4L8AA 4KOUA 4YFJA 4L89A 1IIDA 3BJ8A 2VI7A 1NE9A 4UCPA 3D2PA 1S7FA 2PR8A 4CGMA 2ZW7A 1IYKA 4H6ZA 3DSBA 2H5MA 2Z3NA 4E8OA 2I79A 2Y0MA 3H5ZA 1YLEA 4UFVA 1S7KA 4XPLA 4H89A 1YREA 3R95A 3TTHA 1QSTA 4KOXA 5JQ4A 2OZGA 4M3SA 5F47A 2B3VA 4CYQA 4KORA 4AB7A 4QUSA 2AE6A 3IGRA 4CAEA 4M85A 3R9EA 4MI4A 3F5BA 2FL4A 4U5YA 3ZZIA 3F0AA 1I12A 3B8GA 4F0YA 2IL4A 2QMLA 4J3GA 3SXOA 4A32A 5I0CA 2OU2A 2B4BA 3S6GA 2P6EA 3A9LA 4CAVA 3G3SA 4CYPA 4XNHC 2PQ8A 1YGHA 1KZFA 5F46A 4B5OA 3PGPA 1XMTA 2B5GA 3JVNA 2FE7A 3C26A 2EUIA 1S5KA 4FD6A 2JDCA 2G3TA 1FY7A 1VHSA 3GKRA 5HH1A 4II9A 4MFJA 1IB1E 1B6BA 4C68A 4IUSA 3W6SA 2RC4A 3DR6A 3R9FA 3IU1A 1QSOA 1XIXA 2R98A 2K5TA 2I00A 5KTCA 4UFXA 4LX9A 3S6FA 1CM0A 4PSXA 4CGNA 5H84A 3BLNA 1MJ9A 4KLVA 2X7BA 1Q2YA 1Y9WA 1LRZA 4MY0A 4MFZA 3PZJA 4F0XA 1TIQA 1ZO0A 4EVYA 2VQYA 4LUAA 4AVCA 4CGLA 4NCZA 2BUEA 3CXPA 3VWEA 2ATRA 3E0KA 4CYOA 4B5PA 2FCKA 4PV6A 2CNMA 2HV2A 4FD5A 4JXQA 4A95A 4OAEA 3MGDA 5DWMA 3IU2A 4MHDA 2JLMA 2G3AA 2OZHA 4RS2A 2Q7BA 4A33A 4ZGYB 3GY9A 4MBUA 3T90A 4RI1A 4UBRA 3D2MA 4C2YA 3TCVA 4MFLA 3K9UA 4F6AA 3FNCA 4QB9A 3S6HA 2JEVA 3LODA 4JLYA 2CXAA 4Q38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZU A;  3TOB A;  1U6M A;  4KVO E;  2BL1 A;  2DXQ A;  3EC4 A;  4X5K A;  3NE7 A;  4CRZ B;  2J8R A;  3F8K A;  4GS4 A;  2PR1 A;  2NMT A;  1UFH A;  2B4D A;  2PDO A;  2QEC A;  2OB0 A;  4CAX A;  3FB3 A;  3FRM A;  3PP9 A;  4XPD C;  1Z4R A;  1M4G A;  4PK3 A;  2Z0Z A;  2ZW6 A;  4CRY B;  4Y49 C;  3KKW A;  4HNY B;  4YRH A;  2REE A;  2REF A;  2QIR A;  3SXN A;  3IWG A;  4AVB A;  3EY5 A;  2P6G A;  2Q4Y A;  1SQH A;  1YK3 A;  4MY3 A;  5C82 A;  2OH1 A;  3QAH A;  2VBQ A;  1BOB A;  4I49 A;  1RO5 A;  1Y9K A;  4JXR A;  3ZJ0 A;  2BEI A;  2R1I A;  1Q2D A;  5EC4 A;  1QSR A;  2GAN A;  2KCW A;  5KTA A;  4OAD A;  2B5G B;  1L0C A;  3JUW A;  1Z9U A;  4HNW B;  1NSL A;  3W6X A;  2F5I A;  3SHP A;  2PC1 A;  4E2A A;  5F49 A;  1YVK A;  2FIW A;  1VKC A;  1IYL A;  2PRB A;  3LD2 A;  4JD6 A;  4PSW A;  3T9Y A;  4FD4 A;  3TT2 A;  2C27 A;  3P2F A;  4KOT A;  1ON0 A;  4UWJ A;  2O28 A;  1YR0 A;  5IB0 A;  2Q44 A;  4KZT A;  3H4Q A;  1Y7R A;  2J8N A;  4HNX B;  2P6F A;  1I1D A;  3P2H A;  2GIV A;  3CXS A;  2B3U A;  1S7N A;  5IX3 A;  4R87 A;  2FSR A;  3BJ7 A;  2FIA A;  2G0B A;  1M4I A;  4KOV A;  5F48 A;  3TO7 A;  1XEB A;  3DR8 A;  1S60 A;  1BO4 A;  3EXN A;  2FT0 A;  5ISV A;  4JJX A;  4Y49 B;  4KUA A;  2A4N A;  2ZXV A;  4QC6 A;  2PSW A;  2B4D B;  4MJ8 A;  3WR7 A;  4NEX A;  5DWN A;  3R9G A;  4CS0 B;  4XPK A;  4R9M A;  4AG7 A;  3QB8 A;  1YVO A;  1S3Z A;  4U9Z A;  4E0A A;  1RXT A;  3TO9 A;  1I21 A;  4YGO A;  1Z4E A;  5GCN A;  2VEZ A;  1M1D A;  2FS5 A;  1KUY A;  2ARH A;  4FD7 A;  4AG9 A;  1IIC A;  1YX0 A;  4XPD B;  4DNC A;  1B87 A;  2JDD A;  2Z11 A;  4JWP A;  4UWI A;  3EO4 A;  2WPX A;  2P0W A;  4IF5 A;  4PK2 A;  1MJB A;  3D3S A;  3TFY A;  1Q2C A;  2CNT A;  4U9Y A;  4XNH B;  5H86 A;  3TOA A;  2ZW5 A;  1XF8 A;  4KVX A;  4ZBG A;  3FYN A;  2R7H A;  1P0H A;  1J4J A;  5EBV A;  1MK4 A;  1R57 A;  1PU9 A;  2GE3 A;  2Q4V A;  1QSN A;  4KVM E;  4B5P B;  3G8W A;  3I3G A;  5J8F A;  5JPH A;  2AJ6 A;  2B58 A;  4NXY A;  3DDD A;  5C88 A;  3VWD A;  4NF1 A;  2ZW4 A;  3OWC A;  4K30 A;  3S6K A;  3FBU A;  1CJW A;  2WPW A;  4H6U A;  3I9S A;  5KTD A;  2VXK A;  3W91 A;  2EVN A;  2VZZ A;  2Q04 A;  2Q0Y A;  4QBJ A;  4CAW A;  1S7L A;  1QSM A;  2CY2 A;  4R3L A;  4AVA A;  5J8C A;  4ONU A;  2J8M A;  3DNS A;  1XE4 A;  4KLW A;  4KOW A;  5FVJ A;  1P4N A;  2Z10 A;  3UY5 A;  1N71 A;  2ZPA A;  1GHE A;  4R57 A;  3R96 A;  1OZP A;  4R3K A;  1K4J A;  3CXQ A;  3FXT A;  1KUV A;  3D8P A;  4ORF A;  4KOY A;  2FXF A;  5CNP A;  1KUX A;  3EFA A;  2BSW A;  3RYO A;  2HUZ A;  4NSQ A;  5HMN A;  4QVT A;  2CNS A;  4BMH A;  1V0C A;  1MJA A;  2D4P A;  3V8I A;  3TO6 A;  1WK4 A;  1M44 A;  4KUB A;  1WWZ A;  2D4O A;  2HQY A;  3TE4 A;  3R1K A;  1NMT A;  4KOS A;  5E96 A;  3N7Z A;  2VZY A;  4OLL A;  3FIX A;  1PUA A;  1M4D A;  3GYA A;  4HKF A;  2R8V A;  4UA3 A;  5IV0 A;  4L8A A;  4KOU A;  4YFJ A;  4L89 A;  1IID A;  3BJ8 A;  2VI7 A;  1NE9 A;  3D2P A;  1S7F A;  2PR8 A;  2ZW7 A;  1IYK A;  4H6Z A;  3DSB A;  2H5M A;  4E8O A;  2I79 A;  2Y0M A;  1YLE A;  1S7K A;  4XPL A;  4H89 A;  1YRE A;  3R95 A;  3TTH A;  1QST A;  4KOX A;  5JQ4 A;  2OZG A;  4M3S A;  5F47 A;  2B3V A;  4KOR A;  4AB7 A;  4QUS A;  2AE6 A;  3IGR A;  4M85 A;  3R9E A;  4MI4 A;  3F5B A;  2FL4 A;  4U5Y A;  3ZZI A;  3F0A A;  1I12 A;  3B8G A;  4F0Y A;  2IL4 A;  2QML A;  4J3G A;  3SXO A;  5I0C A;  2OU2 A;  2B4B A;  3S6G A;  2P6E A;  4CAV A;  3G3S A;  4XNH C;  2PQ8 A;  1YGH A;  1KZF A;  5F46 A;  4B5O A;  3PGP A;  1XMT A;  2B5G A;  3JVN A;  2FE7 A;  3C26 A;  2EUI A;  1S5K A;  4FD6 A;  2JDC A;  2G3T A;  1FY7 A;  1VHS A;  3GKR A;  5HH1 A;  4II9 A;  1IB1 E;  1B6B A;  4IUS A;  3W6S A;  2RC4 A;  3DR6 A;  3R9F A;  1QSO A;  1XIX A;  2R98 A;  2K5T A;  2I00 A;  5KTC A;  4LX9 A;  3S6F A;  1CM0 A;  4PSX A;  5H84 A;  3BLN A;  1MJ9 A;  4KLV A;  2X7B A;  1Q2Y A;  1Y9W A;  1LRZ A;  4MY0 A;  3PZJ A;  1TIQ A;  4EVY A;  2VQY A;  4LUA A;  4AVC A;  4NCZ A;  2BUE A;  3CXP A;  3VWE A;  2ATR A;  3E0K A;  4B5P A;  2FCK A;  4PV6 A;  2CNM A;  2HV2 A;  4FD5 A;  4JXQ A;  4OAE A;  3MGD A;  5DWM A;  4MHD A;  2JLM A;  2G3A A;  2OZH A;  4RS2 A;  2Q7B A;  3GY9 A;  4MBU A;  3T90 A;  4RI1 A;  4UBR A;  3D2M A;  3TCV A;  3K9U A;  4F6A A;  4QB9 A;  3FNC A;  3S6H A;  2JEV A;  3LOD A;  4JLY A; 
#chains in the Genus database with same CATH topology
 1FNO A;  2OZU A;  4MFK A;  2RFH A;  3TOB A;  5ELY A;  1U6M A;  5BWA B;  3H8G A;  4KVO E;  4M6G A;  2BL1 A;  2DXQ A;  2PJ2 A;  2PJ9 A;  2NSM A;  3EC4 A;  4X5K A;  5DS0 A;  4WJB A;  4Z65 A;  3GUX A;  3NE7 A;  2Q4Z A;  4CRZ B;  4BIN A;  2J8R A;  3S9L A;  2PIZ A;  3F8K A;  4X8I A;  1IY7 A;  3PB7 X;  2Q51 A;  2GLF A;  4F9U A;  4GS4 A;  3GLJ A;  2PR1 A;  3B35 A;  4OKO A;  2YNC A;  2NMT A;  1UFH A;  2B4D A;  2PDO A;  3BHX A;  2QEC A;  2OB0 A;  4CAF A;  3K9T A;  1IOI A;  3KR4 A;  2PJ0 A;  3KQZ A;  3QNV A;  4RUH A;  3GIU A;  4CAX A;  2WSA A;  4CYN A;  3FB3 A;  1ZLI A;  2AFS A;  4OC4 A;  3D7F A;  4YU9 A;  3QAY A;  1TKF A;  2PJC A;  3FRM A;  3PP9 A;  4R6T A;  4XPD C;  4B14 A;  1Z4R A;  1M4G A;  4PK3 A;  4Q7A A;  2ABZ A;  1X10 A;  4UCN A;  5LRJ A;  5HVF A;  5AG7 A;  2Z0Z A;  3CT9 A;  2ZW6 A;  4CGP A;  4CRY B;  5HXD A;  4Y49 C;  3KKW A;  4HNY B;  4YRH A;  1Z5R A;  2REE A;  4NJQ A;  2REF A;  2FVG A;  2PJ8 A;  2QIR A;  3KR5 A;  3SXN A;  1XRY A;  3D4U A;  3IWG A;  4AVB A;  1UWY A;  3EY5 A;  3NH8 A;  1AYE A;  2P6G A;  2O53 A;  4R7M A;  4B11 A;  3MN8 A;  2Q4Y A;  1SQH A;  1YK3 A;  3NE8 A;  4MY3 A;  1GYT A;  3FMC A;  4DJL A;  2OH1 A;  3QAH A;  5C82 A;  2VBQ A;  2JBK A;  1BOB A;  4I49 A;  5A27 A;  1RO5 A;  4ZY0 A;  1ELM P;  1Y9K A;  4JXR A;  3ZJ0 A;  1YQE A;  2AFX A;  3DGV A;  2GFQ A;  3WC5 A;  2BEI A;  2R1I A;  3B3S A;  2V8D A;  3PBB A;  4UEF A;  5G21 A;  1Q2D A;  2Z3O A;  2V8G A;  5EC4 A;  1QSR A;  2GAN A;  4NFR A;  4OC5 A;  1CX8 A;  2KCW A;  5KTA A;  4MCP A;  2AFM A;  4OAD A;  2B5G B;  1L0C A;  3JUW A;  1Z9U A;  4HNW B;  2BOA A;  4KSA A;  4GM5 A;  3KI9 A;  1CP7 A;  1NSL A;  3FEC A;  2EWB A;  5F09 A;  3W6X A;  2F5I A;  2AFZ A;  4UF4 A;  3SHP A;  2PC1 A;  4E2A A;  5F49 A;  4UEE A;  3DLJ A;  4K3N A;  5A28 A;  4P44 A;  2CTB A;  2ZEN A;  4MFQ A;  5IB9 A;  2ODF A;  5JH9 A;  5J1Q A;  2Q7S A;  3MRU A;  4IHM A;  1YVK A;  2FIW A;  2DPT A;  1VKC A;  4ZY2 A;  1IYL A;  1XJO A;  1ARL A;  1CPX A;  2C6C A;  2EO8 A;  2PRB A;  1PYT B;  2ZEP A;  3LD2 A;  4JD6 A;  3T9Y A;  4FD4 A;  3H8F A;  3TT2 A;  2ZOG A;  2C27 A;  2DEA A;  3P2F A;  4KOT A;  5G22 A;  2PJB A;  1ON0 A;  4UWJ A;  1JWQ A;  2I3C A;  1OBR A;  3H8E A;  3ISX A;  2O28 A;  5D8N A;  4M6I A;  4OC1 A;  3WAB A;  1YSJ A;  1YR0 A;  3IJ3 A;  3RNZ A;  3IIB A;  2Q44 A;  5IB0 A;  4KZT A;  4CPA A;  3KZW A;  2C6G A;  5LRK A;  3H4Q A;  1Y7R A;  3IWE A;  3K2K A;  2J8N A;  4HNX B;  1Y0R A;  2P6F A;  3JTK A;  4F8Z A;  1I1D A;  4FBE A;  4B12 A;  3P2H A;  3N5F A;  3WC6 A;  3ISZ A;  2AFW A;  1H8L A;  2GIV A;  1XFO A;  3CXS A;  4UIA A;  2PIY A;  2B3U A;  4KSF A;  1S7N A;  1ARM A;  1KWM A;  1R43 A;  2DPS A;  4ZY1 A;  5IX3 A;  1Z2L A;  1IGB A;  4NJR A;  4B6Z A;  1YLO A;  4R87 A;  2FSR A;  2PJ1 A;  3BJ7 A;  2FIA A;  2G0B A;  4UEZ A;  4PXD A;  1M4I A;  1LAN A;  1LCP A;  2JBJ A;  4MCS A;  5LRG A;  1VGY A;  3PBE A;  4NGS A;  5HVG A;  4KOV A;  5I4M A;  1CBX A;  3CPA A;  4MMO A;  5F48 A;  4C7I A;  3TO7 A;  1XEB A;  1BAV A;  2Z3P A;  2IMO A;  3DR8 A;  1S60 A;  1BO4 A;  1A2Z A;  4FWU A;  3EXN A;  4P4I A;  5LYL A;  4OC2 A;  3PB4 X;  3B3C A;  3RZA A;  2FT0 A;  4MCR A;  5K8P A;  5ISV A;  2PCU A;  4JJX A;  4Y49 B;  1FT7 A;  4KUA A;  5THW A;  2A4N A;  2ZXV A;  4KS9 A;  4QC6 A;  1LAP A;  2AFO A;  2PSW A;  2B4D B;  4AXV A;  4B13 A;  4FAI A;  4MJ8 A;  3WR7 A;  3RBU A;  2EBJ A;  2ZEO A;  4NEX A;  5DWN A;  2ZEF A;  3R9G A;  5JM6 A;  4ONW A;  5G1Z A;  3PB8 X;  1LFW A;  4XPK A;  4CS0 B;  1HDU A;  4R9M A;  4OME A;  4AG7 A;  1QMU A;  8CPA A;  3KHX A;  2F7V A;  3QB8 A;  7CPA A;  3NA6 A;  1YVO A;  1S3Z A;  4U9Z A;  4E0A A;  1RXT A;  4P10 A;  4B10 A;  2CIJ A;  2YND A;  3TO9 A;  1I21 A;  4YGO A;  1Z4E A;  5GCN A;  2VEZ A;  1M1D A;  2FS5 A;  2ZEE A;  1KUY A;  2ARH A;  4FD7 A;  4AG9 A;  1IIC A;  4G1P A;  2CF4 A;  1YX0 A;  4XPD B;  4MFP A;  4TNU A;  4NGN A;  4PXE A;  4DNC A;  4DUK A;  1B87 A;  4PPZ A;  2JDD A;  2Z11 A;  4JWP A;  1IU8 A;  1TF9 A;  4R76 A;  4UWI A;  3EO4 A;  2WPX A;  3WC7 A;  2Z3M A;  1YW6 A;  2P0W A;  4IF5 A;  4PK2 A;  1MJB A;  1LOK A;  1BLL E;  3D3S A;  3D68 A;  3TFY A;  3PFE A;  1Q2C A;  2CNT A;  4U9Y A;  4XNH B;  5H86 A;  3TOA A;  2Z3K A;  3B3T A;  5LYF A;  2ZW5 A;  1XF8 A;  4KVX A;  4OC3 A;  4ZBG A;  3FYN A;  2R7H A;  4Q36 A;  4CGO A;  1F2O A;  3L2N A;  1P0H A;  2OR4 A;  1J4J A;  5EBV A;  1MK4 A;  1Q7L A;  2PJA A;  4A38 A;  1R57 A;  4C7H A;  1PU9 A;  2GE3 A;  2Q4V A;  1AMP A;  3FED A;  1QSN A;  2POK A;  3NFZ A;  5G20 A;  4OC0 A;  2HC9 A;  2Z3L A;  3SJG A;  5K8O A;  4KVM E;  4B5P B;  4ZI6 A;  3I1U A;  2XEF A;  2XEI A;  4P4J A;  5K8N A;  3G8W A;  3I3G A;  1HDQ A;  1Y0Y A;  2PRQ A;  3KQX A;  2AJ6 A;  5J8F A;  5JPH A;  2PVV A;  2B58 A;  3B2Y A;  4NXY A;  3DDD A;  3FH4 A;  5C88 A;  4P6Y A;  3VWD A;  4NF1 A;  2ZW4 A;  3OWC A;  4K30 A;  3FVL A;  4NGR A;  4OP4 A;  5AG4 A;  3CPX A;  2V8H A;  4UCM A;  2GLJ A;  3FBU A;  4YWY A;  3S6K A;  4NGP A;  2IJZ A;  1CJW A;  2QVP A;  1XBU A;  4KSI A;  2WPW A;  2PJ7 A;  2WZN A;  4JYW A;  4H6U A;  3I9S A;  5KTD A;  2VXK A;  2F8H A;  2EVN A;  2VZZ A;  3W91 A;  2ZOF A;  2Q04 A;  2Q0Y A;  3T8W A;  4QBJ A;  3PB9 X;  1XMB A;  5K8M A;  4ZX9 A;  4CAW A;  5CBM A;  1S7L A;  1QSM A;  2CY2 A;  4R3L A;  4AVA A;  5J8C A;  4ONU A;  2J8M A;  1PCA A;  3DNS A;  1XE4 A;  4KLW A;  4KOW A;  5FVJ A;  1P4N A;  4UFW A;  2Z10 A;  3V7Z A;  3UY5 A;  1N71 A;  2ZPA A;  4A2Z A;  1GHE A;  5AGE A;  1VHE A;  2XEG A;  4R57 A;  3R96 A;  2YNC C;  2YNE A;  1OZP A;  2AFU A;  4R3K A;  5EMI A;  1K4J A;  3CXQ A;  1TXR A;  5AG5 A;  3FEE A;  1KUV A;  3B7I A;  3D8P A;  3FXT A;  3IEH A;  4KOY A;  3KGQ A;  4ORF A;  4A30 A;  4EWT A;  2YGW A;  2FXF A;  5CNP A;  3FF3 A;  1KUX A;  3EFA A;  2QJ8 A;  4OID A;  3D66 A;  4IAV A;  2PJ4 A;  4HPS A;  4BBH A;  4C2Z A;  2BSW A;  3RYO A;  2HUZ A;  3BXM A;  3V38 A;  4NSQ A;  1HEE A;  3CZX A;  4QVT A;  5HMN A;  1Y7E A;  2CNS A;  3PFO A;  1V0C A;  4BMH A;  1CG2 A;  4H2K A;  1MJA A;  4A31 A;  2D4P A;  2RB7 A;  2GU2 A;  3V8I A;  3TO6 A;  1WK4 A;  1M44 A;  4KUB A;  1BPM A;  1WWZ A;  2BCO A;  2D4O A;  2HQY A;  2OOT A;  3S9M A;  3TE4 A;  4NGQ A;  3PB6 X;  4O23 A;  3R1K A;  1DTD A;  1NMT A;  1R3N A;  3D7H A;  4KOS A;  5E96 A;  3N7Z A;  4C2X A;  2VZY A;  4OLL A;  2WUU A;  3FIX A;  1PUA A;  1M4D A;  3GYA A;  4HKF A;  4FUU A;  3SI1 A;  4A94 A;  2R8V A;  4NGT A;  3VH9 A;  1AUG A;  4ZYQ A;  2V8V A;  4UA3 A;  5IV0 A;  3LWU A;  5AG6 A;  4L8A A;  4IK2 A;  4KOU A;  4YFJ A;  4L89 A;  2Q43 A;  1IID A;  3BJ8 A;  2VI7 A;  4P4D A;  3SJE A;  1NE9 A;  4UCP A;  3D2P A;  2VL1 A;  1NSA A;  1S7F A;  2PR8 A;  4CGM A;  2ZW7 A;  3LMS A;  1VIX A;  1IYK A;  2NYQ A;  4H6Z A;  3DSB A;  1TKJ A;  1Z8L A;  4DYO A;  2H5M A;  4F9V A;  2Z3N A;  4E8O A;  2ZEL A;  4MCQ A;  2XEJ A;  2I79 A;  2Y0M A;  3H5Z A;  3B3V A;  1YLE A;  3IO1 A;  2O4H A;  3VAT A;  4UFV A;  1S7K A;  2C1C A;  4XPL A;  4H89 A;  1YRE A;  2DF5 A;  3R95 A;  5JGF A;  4MHP A;  4W9Y A;  3TTH A;  1QST A;  4KOX A;  5HVH A;  5JQ4 A;  1Z8W A;  2OZG A;  4M3S A;  5F47 A;  4P4E A;  1F2P A;  2B3V A;  4CYQ A;  4KOR A;  6CPA A;  4BD9 A;  1YW4 A;  2ANP A;  4M6H A;  4UIB A;  4QUS A;  4AB7 A;  2AE6 A;  3IGR A;  4CAE A;  4M85 A;  4X3R A;  4MI4 A;  3R9E A;  3F5B A;  4GXH A;  3NH5 A;  2C6P A;  1M4L A;  2FL4 A;  4U5Y A;  1JQG A;  3ZZI A;  3F0A A;  1X12 A;  1I12 A;  3B8G A;  3LAC A;  4F0Y A;  2IL4 A;  2QML A;  4J3G A;  3SXO A;  4A32 A;  5I0C A;  2OU2 A;  4A37 A;  2B4B A;  3S6G A;  1F57 A;  2HB6 A;  2P6E A;  3A9L A;  4PQA A;  4WWV A;  3G3S A;  4CAV A;  4CYP A;  4XNH C;  2PQ8 A;  1YGH A;  1KZF A;  5F46 A;  4B5O A;  1CP6 A;  3IFE A;  3PGP A;  1XMT A;  2B5G A;  2J9A A;  3JVN A;  2FE7 A;  3C26 A;  1VHO A;  2EUI A;  4PSW A;  1S5K A;  4FD6 A;  2JDC A;  3PEI A;  2JEW A;  1Z8T A;  1FY7 A;  2G3T A;  3FX6 A;  1VHS A;  3GKR A;  3D7D A;  5HH1 A;  4II9 A;  4MRI A;  3IWW A;  4MFJ A;  3BI1 A;  1IB1 E;  1B6B A;  1CPS A;  2PVW A;  2GRE A;  3PRT A;  4LQG A;  1RTQ A;  4C68 A;  4IUS A;  4JZ0 A;  3FJU A;  4PXB A;  3W6S A;  2RC4 A;  3B3W A;  4TWE A;  2EK8 A;  1BPN A;  3DR6 A;  3SI0 A;  4LQ6 A;  2PE3 A;  3R9F A;  2PJ3 A;  1ELL P;  3IU1 A;  3RO0 A;  1QSO A;  1XIX A;  2PJ5 A;  2R98 A;  2CTC A;  2K5T A;  2I00 A;  1ZLH A;  4X2T A;  5KTC A;  4UFX A;  2ZEH A;  2G9D A;  3D67 A;  1Z8X A;  4LX9 A;  3S6F A;  1CM0 A;  1TF8 A;  3IC1 A;  4NGM A;  4PSX A;  4EFD A;  4CGN A;  3WT4 A;  5H84 A;  3BLN A;  1MJ9 A;  4KLV A;  3RAM A;  1DE4 C;  2X7B A;  1Q2Y A;  3KL9 A;  1Y9W A;  1TKH A;  3BI0 A;  3TX8 A;  1LRZ A;  2BO9 A;  4MY0 A;  2EK9 A;  4MFZ A;  3PZJ A;  4F0X A;  1TIQ A;  1XOV A;  1ZO0 A;  1QQ9 A;  2VQY A;  4RN7 A;  3HUV A;  4A39 A;  4LUA A;  4AVC A;  2ZED A;  4MHN A;  3SI2 A;  4CGL A;  4NCZ A;  2BUE A;  3CXP A;  5CPA A;  3VWE A;  2ATR A;  3E0K A;  4P4F A;  4CYO A;  1ZG7 A;  4B5P A;  2IQ6 A;  2FCK A;  4PV6 A;  1ZG9 A;  3KHZ A;  4PXC A;  2CNM A;  2HV2 A;  4FD5 A;  4P4B A;  4JXQ A;  4A95 A;  2ZEM A;  4OAE A;  2PJ6 A;  1LAM A;  3MGD A;  5DWM A;  5D29 A;  3IU2 A;  3GB0 A;  4MHD A;  3NH4 A;  2JLM A;  4MXU A;  2G3A A;  3SJF A;  1EE3 P;  2OZH A;  4RS2 A;  2Q7B A;  4ZX8 A;  4A33 A;  2QYV A;  4R8F A;  3VAR A;  4ZGY B;  3GY9 A;  4MBU A;  3SJX A;  3T90 A;  4EVY A;  1ZG8 A;  4RI1 A;  3HLP A;  3D2M A;  4UBR A;  4C2Y A;  2V77 A;  4MHY A;  3TCV A;  4MFL A;  3D7G A;  3CDX A;  3K9U A;  3KAS A;  4MHZ A;  5LYI A;  4F6A A;  3TC8 A;  1YME A;  2WYR A;  3FNC A;  1IOF A;  3JRU A;  4QB9 A;  4P45 A;  3S6H A;  2JEV A;  3LOD A;  4EME A;  4JLY A;  4OIW A;  3S9N A;  2CXA A;  5LYD A;  2ZEG A;  4Q38 A; 
#chains in the Genus database with same CATH homology
 2OZU A;  4MFK A;  3TOB A;  1U6M A;  5BWA B;  4KVO E;  2BL1 A;  2DXQ A;  3EC4 A;  4X5K A;  3NE7 A;  4CRZ B;  2J8R A;  3F8K A;  4GS4 A;  2PR1 A;  2YNC A;  2NMT A;  1UFH A;  2B4D A;  2PDO A;  2QEC A;  2OB0 A;  4CAF A;  4CAX A;  2WSA A;  4CYN A;  3FB3 A;  3FRM A;  3PP9 A;  4XPD C;  4B14 A;  1Z4R A;  1M4G A;  4PK3 A;  4UCN A;  5AG7 A;  2Z0Z A;  2ZW6 A;  4CGP A;  4CRY B;  4Y49 C;  3KKW A;  4HNY B;  4YRH A;  2REE A;  2REF A;  2QIR A;  3SXN A;  3IWG A;  4AVB A;  3EY5 A;  2P6G A;  4B11 A;  2Q4Y A;  1SQH A;  1YK3 A;  4MY3 A;  5C82 A;  2OH1 A;  3QAH A;  2VBQ A;  1BOB A;  4I49 A;  5A27 A;  1RO5 A;  1Y9K A;  4JXR A;  3ZJ0 A;  2BEI A;  2R1I A;  5G21 A;  1Q2D A;  2Z3O A;  5EC4 A;  1QSR A;  2GAN A;  2KCW A;  5KTA A;  4OAD A;  2B5G B;  1L0C A;  3JUW A;  1Z9U A;  4HNW B;  4KSA A;  1NSL A;  3W6X A;  2F5I A;  3SHP A;  2PC1 A;  4E2A A;  5F49 A;  5A28 A;  4MFQ A;  1YVK A;  2FIW A;  2DPT A;  1VKC A;  1IYL A;  2PRB A;  3LD2 A;  4JD6 A;  4PSW A;  3T9Y A;  4FD4 A;  3TT2 A;  2C27 A;  3P2F A;  4KOT A;  5G22 A;  1ON0 A;  4UWJ A;  2O28 A;  1YR0 A;  5IB0 A;  2Q44 A;  4KZT A;  3H4Q A;  1Y7R A;  3IWE A;  2J8N A;  4HNX B;  2P6F A;  3JTK A;  1I1D A;  4B12 A;  3P2H A;  2GIV A;  3CXS A;  2B3U A;  4KSF A;  1S7N A;  2DPS A;  5IX3 A;  4R87 A;  2FSR A;  3BJ7 A;  2FIA A;  2G0B A;  1M4I A;  4KOV A;  5F48 A;  4C7I A;  3TO7 A;  1XEB A;  2Z3P A;  3DR8 A;  1S60 A;  1BO4 A;  3EXN A;  2FT0 A;  5ISV A;  4JJX A;  4Y49 B;  4KUA A;  2A4N A;  2ZXV A;  4KS9 A;  4QC6 A;  2PSW A;  2B4D B;  4B13 A;  4MJ8 A;  3WR7 A;  4NEX A;  5DWN A;  3R9G A;  5G1Z A;  4CS0 B;  4XPK A;  4R9M A;  4AG7 A;  3QB8 A;  1YVO A;  1S3Z A;  4U9Z A;  4E0A A;  1RXT A;  4B10 A;  2YND A;  3TO9 A;  1I21 A;  4YGO A;  1Z4E A;  5GCN A;  2VEZ A;  1M1D A;  2FS5 A;  1KUY A;  2ARH A;  4FD7 A;  4AG9 A;  1IIC A;  1YX0 A;  4XPD B;  4MFP A;  4DNC A;  1B87 A;  2JDD A;  2Z11 A;  4JWP A;  4UWI A;  3EO4 A;  2WPX A;  2Z3M A;  2P0W A;  4IF5 A;  4PK2 A;  1MJB A;  3D3S A;  3TFY A;  1Q2C A;  2CNT A;  4U9Y A;  4XNH B;  5H86 A;  3TOA A;  2Z3K A;  2ZW5 A;  1XF8 A;  4KVX A;  4ZBG A;  3FYN A;  2R7H A;  4Q36 A;  4CGO A;  1P0H A;  1J4J A;  5EBV A;  1MK4 A;  4C7H A;  1R57 A;  1PU9 A;  2GE3 A;  2Q4V A;  1QSN A;  5G20 A;  2Z3L A;  4KVM E;  4B5P B;  3G8W A;  3I3G A;  5J8F A;  5JPH A;  2AJ6 A;  2B58 A;  4NXY A;  3DDD A;  5C88 A;  3VWD A;  4NF1 A;  2ZW4 A;  3OWC A;  4K30 A;  5AG4 A;  3S6K A;  4UCM A;  3FBU A;  1CJW A;  2WPW A;  4H6U A;  3I9S A;  5KTD A;  2VXK A;  3W91 A;  2EVN A;  2VZZ A;  2Q04 A;  2Q0Y A;  4QBJ A;  4CAW A;  1S7L A;  1QSM A;  2CY2 A;  4R3L A;  4AVA A;  5J8C A;  4ONU A;  2J8M A;  3DNS A;  1XE4 A;  4KLW A;  4KOW A;  5FVJ A;  1P4N A;  4UFW A;  2Z10 A;  3UY5 A;  1N71 A;  2ZPA A;  4A2Z A;  1GHE A;  5AGE A;  4R57 A;  3R96 A;  2YNC C;  2YNE A;  1OZP A;  4R3K A;  1K4J A;  3CXQ A;  5AG5 A;  3FXT A;  1KUV A;  4A30 A;  3D8P A;  4ORF A;  4KOY A;  2YGW A;  2FXF A;  5CNP A;  1KUX A;  3EFA A;  4BBH A;  4C2Z A;  2BSW A;  3RYO A;  2HUZ A;  4NSQ A;  5HMN A;  4QVT A;  2CNS A;  4BMH A;  1V0C A;  1MJA A;  4A31 A;  2D4P A;  3V8I A;  3TO6 A;  1WK4 A;  1M44 A;  4KUB A;  1WWZ A;  2D4O A;  2HQY A;  3TE4 A;  3R1K A;  1NMT A;  4KOS A;  5E96 A;  3N7Z A;  4C2X A;  2VZY A;  4OLL A;  2WUU A;  3FIX A;  1PUA A;  1M4D A;  3GYA A;  4HKF A;  2R8V A;  4UA3 A;  5IV0 A;  5AG6 A;  4L8A A;  4KOU A;  4YFJ A;  4L89 A;  1IID A;  3BJ8 A;  2VI7 A;  1NE9 A;  4UCP A;  3D2P A;  1S7F A;  2PR8 A;  4CGM A;  2ZW7 A;  1IYK A;  4H6Z A;  3DSB A;  2H5M A;  2Z3N A;  4E8O A;  2I79 A;  2Y0M A;  3H5Z A;  1YLE A;  4UFV A;  1S7K A;  4XPL A;  4H89 A;  1YRE A;  3R95 A;  3TTH A;  1QST A;  4KOX A;  5JQ4 A;  2OZG A;  4M3S A;  5F47 A;  2B3V A;  4CYQ A;  4KOR A;  4AB7 A;  4QUS A;  2AE6 A;  3IGR A;  4CAE A;  4M85 A;  3R9E A;  4MI4 A;  3F5B A;  2FL4 A;  4U5Y A;  3ZZI A;  3F0A A;  1I12 A;  3B8G A;  4F0Y A;  2IL4 A;  2QML A;  4J3G A;  3SXO A;  4A32 A;  5I0C A;  2OU2 A;  2B4B A;  3S6G A;  2P6E A;  3A9L A;  4CAV A;  3G3S A;  4CYP A;  4XNH C;  2PQ8 A;  1YGH A;  1KZF A;  5F46 A;  4B5O A;  3PGP A;  1XMT A;  2B5G A;  3JVN A;  2FE7 A;  3C26 A;  2EUI A;  1S5K A;  4FD6 A;  2JDC A;  2G3T A;  1FY7 A;  1VHS A;  3GKR A;  5HH1 A;  4II9 A;  4MFJ A;  1IB1 E;  1B6B A;  4C68 A;  4IUS A;  3W6S A;  2RC4 A;  3DR6 A;  3R9F A;  3IU1 A;  1QSO A;  1XIX A;  2R98 A;  2K5T A;  2I00 A;  5KTC A;  4UFX A;  4LX9 A;  3S6F A;  1CM0 A;  4PSX A;  4CGN A;  5H84 A;  3BLN A;  1MJ9 A;  4KLV A;  2X7B A;  1Q2Y A;  1Y9W A;  1LRZ A;  4MY0 A;  4MFZ A;  3PZJ A;  4F0X A;  1TIQ A;  1ZO0 A;  4EVY A;  2VQY A;  4LUA A;  4AVC A;  4CGL A;  4NCZ A;  2BUE A;  3CXP A;  3VWE A;  2ATR A;  3E0K A;  4CYO A;  4B5P A;  2FCK A;  4PV6 A;  2CNM A;  2HV2 A;  4FD5 A;  4JXQ A;  4A95 A;  4OAE A;  3MGD A;  5DWM A;  3IU2 A;  4MHD A;  2JLM A;  2G3A A;  2OZH A;  4RS2 A;  2Q7B A;  4A33 A;  4ZGY B;  3GY9 A;  4MBU A;  3T90 A;  4RI1 A;  4UBR A;  3D2M A;  4C2Y A;  3TCV A;  4MFL A;  3K9U A;  4F6A A;  3FNC A;  4QB9 A;  3S6H A;  2JEV A;  3LOD A;  4JLY A;  2CXA A;  4Q38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...