5E96A

Crystal structure of aminoglycoside 6'-acetyltransferase type ii
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
155
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHEHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside 6'-acetyltransferase
publication title Comprehensive characterization of ligand-induced plasticity changes in a dimeric enzyme.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 44
structure length 155
sequence length 179
ec nomenclature
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5e96A00
2Q4VA 3TO9A 3FNCA 2REFA 4MY3A 4XPLA 3R9EA 4E8OA 2Q0YA 5KTAA 3FIXA 4KOSA 3TTHA 3VWEA 2G0BA 4MI4A 2JDCA 2ZXVA 2ZW6A 4CAWA 2HV2A 2QMLA 1CJWA 5HH1A 3F5BA 3S6GA 4FD7A 2AE6A 1I1DA 1QSOA 3RYOA 2I00A 1YVKA 5KTCA 1S7LA 4L89A 4Y49C 5F47A 1IB1E 4RI1A 3R9GA 1S5KA 4CRYB 4E2AA 4CRZB 1Z9UA 2Y0MA 4QC6A 3R95A 2AJ6A 3FXTA 2G3AA 2WPWA 4R3KA 4UA3A 3GYAA 4HNXB 1MJ9A 4UBRA 3CXSA 4Y49B 5H86A 4MJ8A 2J8RA 3KKWA 1KUYA 1V0CA 4M85A 3LD2A 2X7BA 2Z10A 2B3VA 3NE7A 1Y7RA 2VI7A 1YREA 3SXNA 3F0AA 2VQYA 3S6FA 2DXQA 4KOXA 2Q4YA 1Z4EA 2FIWA 4ZBGA 4PK2A 4IUSA 3FBUA 4AVBA 5JPHA 4XNHC 1FY7A 3PGPA 4CAXA 4H6UA 1Y9KA 3CXQA 3DSBA 2JLMA 3SHPA 2FCKA 1CM0A 4PSWA 3N7ZA 3DNSA 2I79A 1MJAA 3FRMA 1I12A 1XMTA 2BSWA 3I3GA 4F6AA 2GIVA 4KVXA 4JXQA 2B58A 2G3TA 3I9SA 5C88A 2OB0A 2R8VA 3D3SA 1SQHA 2VEZA 4AVAA 3QAHA 1S60A 3WR7A 1XF8A 2H5MA 1VKCA 4PV6A 1PUAA 2C27A 4AG9A 1XIXA 1M4IA 1L0CA 1Y9WA 3TO7A 5J8FA 4U5YA 1MJBA 5DWNA 4PSXA 4R57A 4AB7A 4F0YA 2CY2A 4LX9A 3TFYA 4KOTA 5H84A 1I21A 1NE9A 2WPXA 4JWPA 2A4NA 2CNSA 4MY0A 4B5OA 2JDDA 3EY5A 3DR6A 2VBQA 2F5IA 2OZUA 2IL4A 3OWCA 4ONUA 3G3SA 1PU9A 2NMTA 4X5KA 2FIAA 4HNWB 1YVOA 5KTDA 2D4OA 1YGHA 3BLNA 3T9YA 1KUVA 2JEVA 4K30A 1KUXA 3GY9A 4M3SA 3TOBA 4KVOE 4MHDA 5J8CA 1S7KA 1VHSA 4NF1A 3ZZIA 4OLLA 3SXOA 4AG7A 4KOWA 5GCNA 3TCVA 4R3LA 3F8KA 1Z4RA 1M4DA 2P6GA 2VXKA 1QSNA 3G8WA 2B5GA 2PSWA 3TOAA 3VWDA 4L8AA 4XPKA 1XEBA 1K4JA 2FL4A 2Q44A 4JJXA 1M4GA 1N71A 4H6ZA 1RXTA 1OZPA 2PR8A 2B4DA 4KVME 2P0WA 4XPDC 2D4PA 2Z11A 3E0KA 4NCZA 3EO4A 2ARHA 1BOBA 2B3UA 2PC1A 4XNHB 3UY5A 1KZFA 4J3GA 4KLWA 4XPDB 5ISVA 2R98A 5FVJA 1B87A 4FD6A 4EVYA 1IICA 4OADA 3D2MA 2ZW5A 4LUAA 3P2FA 2Z0ZA 1IIDA 1QSMA 3EXNA 3EC4A 1Q2CA 5JQ4A 4HKFA 1YLEA 5I0CA 1IYKA 4QVTA 3R96A 2B5GB 3ZJ0A 4R87A 4KOYA 1YK3A 4DNCA 2PR1A 3DDDA 2BEIA 3W91A 2FXFA 5EBVA 2ATRA 3P2HA 4KOVA 4PK3A 5C82A 4KZTA 2FS5A 3R9FA 4KORA 3C26A 4MBUA 4ORFA 4QBJA 2EUIA 4I49A 3S6HA 3FB3A 3FYNA 2J8NA 4CAVA 3PZJA 2REEA 4H89A 2PQ8A 5CNPA 4JXRA 2OH1A 1S3ZA 2EVNA 4II9A 1B6BA 3JVNA 3D8PA 2B4BA 1GHEA 3W6XA 3GKRA 5HMNA 4FD4A 5E96A 3TE4A 3DR8A 4KOUA 3PP9A 2BL1A 4NSQA 1ON0A 1IYLA 4CS0B 3R1KA 5F48A 2R7HA 1TIQA 4RS2A 3V8IA 4B5PA 2VZYA 4YGOA 2ZW7A 4E0AA 3K9UA 3TT2A 1WK4A 5IV0A 1RO5A 2HUZA 1Q2DA 4IF5A 1LRZA 5EC4A 4JLYA 3BJ7A 4U9YA 2O28A 2Q04A 2VZZA 4KUAA 3QB8A 4BMHA 5F46A 1XE4A 4AVCA 1J4JA 1UFHA 2GE3A 2GANA 1QSRA 1U6MA 5DWMA 2J8MA 3W6SA 2OZHA 2Q7BA 3TO6A 2P6FA 2FT0A 1NSLA 3BJ8A 4QB9A 2QIRA 3H4QA 4KLVA 2FSRA 2PDOA 1WWZA 1M1DA 1S7FA 2PRBA 2P6EA 2OZGA 4KUBA 5IX3A 4OAEA 4YFJA 2HQYA 1S7NA 2OU2A 2CNMA 3IWGA 4UWIA 4HNYB 3T90A 1M44A 4NEXA 4UWJA 4R9MA 5F49A 2FE7A 2QECA 4U9ZA 1P4NA 4B5PB 2ZPAA 1YR0A 5IB0A 3MGDA 3EFAA 1MK4A 1P0HA 2ZW4A 3JUWA 3CXPA 3B8GA 1QSTA 2BUEA 2B4DB 2RC4A 2KCWA 1Q2YA 2K5TA 4GS4A 2R1IA 1NMTA 4YRHA 1R57A 1YX0A 1BO4A 4QUSA 3D2PA 3LODA 3S6KA 2CNTA 4NXYA 4JD6A 3IGRA 4FD5A
chains in the Genus database with same CATH superfamily
2Q4VA 3VATA 2PJAA 2PJ0A 3TO9A 3FNCA 3SI0A 2REFA 3NH5A 4MY3A 2VL1A 4NGMA 2GLJA 2Z3NA 4XPLA 2CIJA 1AMPA 3R9EA 2G9DA 4E8OA 2Z3MA 4OKOA 3RZAA 1F2PA 2Q0YA 5KTAA 3FIXA 4KOSA 3TTHA 4CGNA 4UEEA 3RAMA 2G0BA 3VWEA 4NGSA 4MI4A 3B3VA 2XEFA 2JDCA 3WC6A 2ZXVA 4CYQA 3BHXA 2ZW6A 4MRIA 4CAWA 2HV2A 2QMLA 1CJWA 1Z2LA 5HH1A 3F5BA 4B11A 3PB9X 3S6GA 4OIWA 1Z8XA 2IMOA 4FD7A 2AE6A 1VHEA 4WWVA 1I1DA 3PB4X 4OC2A 1HEEA 1QSOA 3RYOA 4ZYQA 2V8VA 2I00A 1IOFA 1YVKA 4NGNA 5KTCA 1S7LA 4L89A 4Y49C 2C1CA 2O4HA 3BI0A 5F47A 5K8PA 2DEAA 1IB1E 2Q51A 3S9NA 3IO1A 4RI1A 3SJFA 3R9GA 1S5KA 4MCRA 4CRYB 4E2AA 2ZEPA 2PJ4A 4CRZB 4DYOA 1Z9UA 2Y0MA 4QC6A 3R95A 2DPSA 3WC7A 4UFXA 2AJ6A 3FXTA 4F8ZA 2G3AA 2WPWA 4R3KA 4UA3A 3GYAA 4HNXB 4UF4A 1MJ9A 4UBRA 3V38A 3CXSA 4PQAA 4GM5A 4Y49B 5H86A 4MJ8A 5HVFA 1YQEA 2WSAA 3PEIA 2J8RA 4X2TA 3KKWA 1KUYA 1V0CA 2EWBA 2V77A 4M85A 3LD2A 2X7BA 3KR4A 2Z10A 3I1UA 3MRUA 5G21A 2B3VA 3NE7A 1Y7RA 2VI7A 1YREA 4P10A 3RNZA 1ELMP 3SXNA 3LACA 3F0AA 2VQYA 3S6FA 3DLJA 2PJ2A 2ABZA 2DXQA 4KOXA 3IC1A 2Q4YA 1FNOA 4CGPA 3FECA 4KSAA 2ZEMA 5JM6A 4A30A 4CYNA 4KS9A 4Q7AA 1ARLA 1Z4EA 2FIWA 4ZBGA 2AFXA 4C2YA 1ZO0A 1BAVA 1CX8A 3A9LA 2ANPA 3VH9A 4PK2A 4IUSA 3FBUA 4OC3A 5DS0A 3H5ZA 4OP4A 4CGLA 4AVBA 4CAFA 2C6CA 5JPHA 4XNHC 4MFZA 1LCPA 1FY7A 1QMUA 1ELLP 3FJUA 2O53A 2QVPA 3HLPA 3PGPA 4C7IA 4CAXA 4H6UA 4NGQA 2AFSA 5ELYA 2CTCA 2F8HA 1YW6A 3H8GA 4P4EA 2ZEDA 1CP6A 1Y9KA 2ZOGA 3CXQA 3GLJA 1UWYA 4P4JA 3DSBA 2JLMA 4IHMA 4A38A 4A37A 3SHPA 2BO9A 2JBJA 2FCKA 1JQGA 2POKA 3K9TA 1CM0A 4DUKA 4PSWA 3S9MA 3GUXA 4UCNA 3JTKA 3N7ZA 3D7HA 1M4LA 3DNSA 5D29A 2I79A 1TF9A 1XBUA 1MJAA 2PIYA 4NFRA 1XOVA 3FRMA 2Z3PA 3IJ3A 3GIUA 1I12A 1XMTA 2BSWA 3N5FA 4NJQA 3VARA 4OC4A 4UIAA 3I3GA 4BBHA 4F6AA 2GIVA 4KVXA 3WABA 4JXQA 2B58A 3KHZA 3TX8A 4OC1A 2G3TA 2Q43A 3I9SA 2OB0A 5C88A 3SJXA 5LYIA 2R8VA 3PB7X 3D3SA 1SQHA 2VEZA 4AVAA 4C2XA 2V8HA 1IY7A 3QAHA 3SI1A 1S60A 3WR7A 1XF8A 4G1PA 2H5MA 2Z3LA 1VKCA 1BPMA 3BXMA 4PV6A 4NGRA 1PUAA 2HB6A 3B3WA 3CPAA 3FF3A 3KL9A 2C27A 4MHYA 4AG9A 4DJLA 5CBMA 4CPAA 1YSJA 2AFOA 1XIXA 5LRGA 1M4IA 1L0CA 1Y9WA 2XEIA 4FAIA 1XRYA 1F2OA 5AG4A 2PJ3A 1YMEA 3CDXA 4U5YA 3KZWA 3TO7A 5J8FA 1MJBA 3NFZA 4PSXA 1CP7A 4R57A 4OMEA 4NGTA 4MXUA 5DWNA 4R76A 5G1ZA 4AB7A 4F0YA 2CY2A 4LX9A 4B10A 3TFYA 4KOTA 4P45A 1R3NA 2IJZA 2WZNA 5H84A 1I21A 1NE9A 2WPXA 1ZLIA 3QNVA 4JWPA 5HVHA 4BD9A 2A4NA 2CNSA 4MY0A 1LANA 4B5OA 4UCMA 2JDDA 3EY5A 4ZY0A 3DR6A 4P4FA 3D67A 2VBQA 2F5IA 3D7GA 2OZUA 1CPXA 2PE3A 2IL4A 3OWCA 1YW4A 4ONUA 5J1QA 2PJ7A 1LFWA 1Z8LA 1PU9A 2OR4A 3G3SA 3H8EA 4B14A 2NMTA 2ZENA 4X5KA 2FIAA 1H8LA 4HNWB 3KGQA 2GLFA 4P44A 4P4BA 4M6IA 1YVOA 3PBEA 1LAMA 3IU2A 3PFOA 4MFKA 5KTDA 8CPAA 2D4OA 1YGHA 3BLNA 3T9YA 1KUVA 2JEVA 4IK2A 4K30A 1KUXA 1ZG8A 2EK8A 3GY9A 2PJCA 3RBUA 3WC5A 4TWEA 4UEZA 2QJ8A 1IGBA 4M3SA 3TOBA 4KVOE 4M6HA 4MHDA 5J8CA 4NJRA 4CGOA 1Z5RA 1S7KA 1VHSA 2ZEGA 4NF1A 3ZZIA 4OLLA 3SXOA 5AG6A 2PVWA 4Q36A 4OC5A 4AG7A 2PJ8A 2V8DA 4KOWA 5GCNA 3TCVA 1FT7A 3B3SA 4R3LA 3F8KA 1Z4RA 1TKFA 4FWUA 1M4DA 1Q7LA 2P6GA 2AFUA 1QSNA 2VXKA 3CT9A 3G8WA 3D68A 2B5GA 2PSWA 3TOAA 3VWDA 4L8AA 4XPKA 3B2YA 1EE3P 4X8IA 1XEBA 1K4JA 3NE8A 2FL4A 3HUVA 2Q44A 4JJXA 1M4GA 5AG7A 3SI2A 1N71A 2V8GA 4H6ZA 2YNCA 1RXTA 1OZPA 5K8OA 2PR8A 2GFQA 4UFVA 2B4DA 4KVME 5CPAA 2P0WA 4UCPA 4EFDA 4XPDC 2C6PA 5JH9A 2IQ6A 5JGFA 1PCAA 2D4PA 2Z11A 3E0KA 4MMOA 3D4UA 2ZELA 4NCZA 4ZI6A 1Y0RA 1ZG9A 3EO4A 5D8NA 1NSAA 2ARHA 1TKJA 1BOBA 2B3UA 2PC1A 4XNHB 4AXVA 4H2KA 3UY5A 4MFPA 1KZFA 4J3GA 2ZEEA 3PRTA 4KLWA 4MCQA 4XPDB 4A32A 2R98A 5ISVA 5FVJA 1B87A 3FH4A 1RTQA 5IB9A 4FD6A 2DF5A 1IICA 2DPTA 2QYVA 4JYWA 2EK9A 4EVYA 4OADA 5LRKA 2AFZA 4PXEA 3D2MA 2FVGA 2ZW5A 1TKHA 4NGPA 4LUAA 3P2FA 2Z0ZA 4W9YA 4MCPA 1IIDA 3KR5A 4A33A 1QSMA 3EXNA 4EWTA 2RB7A 3EC4A 3SJEA 4GXHA 1Q2CA 2PJ1A 4RN7A 5JQ4A 2YNCC 2WYRA 4YWYA 3ISZA 1DTDA 4HKFA 1YLEA 2WUUA 5I0CA 5AGEA 5A28A 1IYKA 4QVTA 3R96A 2B5GB 3ZJ0A 4PPZA 4A95A 1TXRA 3FEEA 4R87A 2Z3KA 4KOYA 1DE4C 2GU2A 4F9UA 5K8MA 4TNUA 4KSFA 1YK3A 3D66A 5BWAB 4DNCA 3NH4A 3B35A 2AFWA 2PR1A 1QQ9A 2BEIA 3DDDA 3JRUA 4KSIA 3W91A 3S9LA 2FXFA 5EBVA 1VHOA 2ATRA 3P2HA 4KOVA 4PK3A 3MN8A 5C82A 3IWEA 4KZTA 2FS5A 2PJ5A 4KORA 3R9FA 4EMEA 4PXDA 1Z8WA 2Q4ZA 1Z8TA 3C26A 4MBUA 2CF4A 4ORFA 1YLOA 4LQ6A 4JZ0A 2OOTA 4PXCA 4QBJA 2EUIA 4I49A 1IOIA 3S6HA 3FB3A 3FYNA 4M6GA 2J8NA 4WJBA 4CAVA 2PJ9A 1CBXA 3PZJA 4B12A 5I4MA 2REEA 2C6GA 4H89A 1R43A 2PQ8A 3L2NA 5CNPA 3SJGA 4ZY1A 2ODFA 2ZEFA 1ARMA 1HDUA 2NYQA 4P6YA 3LMSA 3KASA 3NA6A 2XEGA 4JXRA 4ZX9A 1GYTA 2OH1A 1ZLHA 4IAVA 1S3ZA 2PCUA 4LQGA 3QAYA 4P4DA 5AG5A 2EVNA 4II9A 1B6BA 2ZEOA 4R6TA 4X3RA 1BPNA 1OBRA 4CYPA 3K2KA 3JVNA 4FUUA 4MFJA 3TC8A 5HVGA 3D8PA 4UFWA 3KQZA 2B4BA 4UEFA 1GHEA 3W6XA 4A94A 4C68A 4R7MA 3GKRA 1ZG7A 4UIBA 5HMNA 1LAPA 4FD4A 5E96A 4OC0A 3TE4A 3DR8A 4KOUA 4B6ZA 4F9VA 3PP9A 1AUGA 3B3CA 5THWA 1X10A 2BL1A 2PJBA 1ON0A 1IYLA 2Z3OA 3PFEA 4K3NA 4NSQA 3FVLA 3R1KA 4ZY2A 4CS0B 5F48A 2EO8A 2R7HA 1HDQA 1TIQA 2XEJA 4O23A 4RS2A 3V8IA 3D7FA 4B5PA 3CZXA 3DGVA 2VZYA 4YGOA 5K8NA 4CYOA 2ZW7A 3WT4A 3IWWA 4E0AA 4ZGYB 5F09A 4R8FA 3K9UA 4MFLA 1WK4A 3TT2A 5IV0A 1RO5A 1A2ZA 1IU8A 2HUZA 1Q2DA 2CTBA 1Y7EA 4IF5A 1LRZA 5EC4A 1Y0YA 3BJ7A 4JLYA 4U9YA 4A39A 2F7VA 2O28A 2Q04A 4ONWA 4FBEA 2VZZA 4KUAA 5A27A 3ISXA 3KI9A 2PRQA 3QB8A 1PYTB 4Q38A 3BI1A 4BMHA 2YNEA 4F0XA 5F46A 4P4IA 1XE4A 4AVCA 1J4JA 1UFHA 1JWQA 1XMBA 2ZEHA 2GE3A 3FMCA 2J9AA 1XJOA 2GANA 2JEWA 1QSRA 1U6MA 5DWMA 7CPAA 2J8MA 2BCOA 3KQXA 5LRJA 1CPSA 2PIZA 2OZHA 3IFEA 3W6SA 2Q7BA 2RFHA 4C7HA 3TO6A 2P6FA 2PJ6A 4CGMA 2FT0A 1NSLA 2Q7SA 2BOAA 1VGYA 1CG2A 3BJ8A 4HPSA 4QB9A 5LYLA 2QIRA 3H4QA 4MFQA 4KLVA 2CXAA 2FSRA 2PDOA 3GB0A 1WWZA 1M1DA 1S7FA 3FEDA 4PXBA 1LOKA 2PRBA 2P6EA 2OZGA 4KUBA 4MHZA 5IX3A 4OAEA 6CPAA 2HC9A 3D7DA 2HQYA 3T8WA 3V7ZA 1S7NA 4YFJA 3IIBA 5HXDA 2OU2A 2CNMA 3IWGA 4UWIA 3B7IA 1XFOA 4HNYB 4MCSA 4C2ZA 2I3CA 2JBKA 3LWUA 3T90A 4CAEA 1M44A 1X12A 4NEXA 5LYDA 4YU9A 4UWJA 5LYFA 4R9MA 1AYEA 3PB8X 4RUHA 4A2ZA 3KHXA 5F49A 2FE7A 2QECA 4MHPA 3IU1A 4U9ZA 2ZOFA 4BINA 4OIDA 3RO0A 4Z65A 1P4NA 4B5PB 2YNDA 5G22A 2ZPAA 2GREA 1YR0A 1BLLE 1TF8A 1F57A 5IB0A 3MGDA 3EFAA 1MK4A 1P0HA 2ZW4A 4ZX8A 5EMIA 5G20A 1VIXA 3JUWA 3CXPA 3B3TA 3B8GA 1QSTA 2BUEA 3PB6X 4B13A 2B4DB 2RC4A 2KCWA 1Q2YA 2K5TA 2YGWA 3CPXA 4GS4A 1KWMA 2R1IA 4A31A 3H8FA 3FX6A 3IEHA 1NMTA 2PVVA 3NH8A 4YRHA 1R57A 1YX0A 2EBJA 4MHNA 1BO4A 4QUSA 3D2PA 2NSMA 3LODA 3S6KA 2CNTA 4NXYA 4JD6A 2AFMA 3IGRA 4FD5A 3PBBA
chains in the Genus database with same CATH topology
2Q4VA 3TO9A 3FNCA 2REFA 4MY3A 2Z3NA 4XPLA 3R9EA 4E8OA 2Z3MA 2Q0YA 5KTAA 3FIXA 4KOSA 3TTHA 4CGNA 3VWEA 2G0BA 4MI4A 2JDCA 4CYQA 2ZXVA 2ZW6A 4CAWA 2HV2A 2QMLA 1CJWA 5HH1A 3F5BA 4B11A 3S6GA 4FD7A 2AE6A 1I1DA 1QSOA 3RYOA 2I00A 1YVKA 5KTCA 1S7LA 4L89A 4Y49C 5F47A 1IB1E 4RI1A 3R9GA 1S5KA 4CRYB 4E2AA 4CRZB 1Z9UA 2Y0MA 4QC6A 3R95A 2DPSA 4UFXA 2AJ6A 3FXTA 2G3AA 2WPWA 4R3KA 4UA3A 3GYAA 4HNXB 1MJ9A 4UBRA 3CXSA 4Y49B 5H86A 4MJ8A 2WSAA 2J8RA 3KKWA 1KUYA 1V0CA 4M85A 3LD2A 2X7BA 2Z10A 5G21A 2B3VA 3NE7A 1Y7RA 2VI7A 1YREA 3SXNA 3F0AA 2VQYA 3S6FA 2DXQA 4KOXA 2Q4YA 4CGPA 4KSAA 4A30A 4CYNA 4KS9A 1Z4EA 2FIWA 4ZBGA 4C2YA 1ZO0A 3A9LA 4PK2A 4IUSA 3FBUA 4CGLA 3H5ZA 4AVBA 4CAFA 5JPHA 4XNHC 4MFZA 1FY7A 3PGPA 4C7IA 4CAXA 4H6UA 1Y9KA 3CXQA 3DSBA 2JLMA 3SHPA 2FCKA 1CM0A 4PSWA 4UCNA 3JTKA 3N7ZA 3DNSA 2I79A 1MJAA 3FRMA 2Z3PA 1I12A 1XMTA 2BSWA 3I3GA 4BBHA 4F6AA 2GIVA 4KVXA 4JXQA 2B58A 2G3TA 3I9SA 5C88A 2OB0A 2R8VA 3D3SA 1SQHA 2VEZA 4AVAA 4C2XA 3QAHA 1S60A 3WR7A 1XF8A 2H5MA 2Z3LA 1VKCA 4PV6A 1PUAA 2C27A 4AG9A 1XIXA 1M4IA 1L0CA 1Y9WA 5AG4A 3TO7A 5J8FA 4U5YA 1MJBA 5DWNA 4PSXA 4R57A 5G1ZA 4AB7A 4F0YA 2CY2A 4LX9A 4B10A 3TFYA 4KOTA 5H84A 1I21A 1NE9A 2WPXA 4JWPA 2A4NA 2CNSA 4MY0A 4B5OA 4UCMA 2JDDA 3EY5A 3DR6A 2VBQA 2F5IA 2OZUA 2IL4A 3OWCA 4ONUA 4B14A 3G3SA 1PU9A 2NMTA 4X5KA 2FIAA 4HNWB 1YVOA 3IU2A 4MFKA 5KTDA 2D4OA 1YGHA 3BLNA 3T9YA 1KUVA 2JEVA 4K30A 1KUXA 3GY9A 4M3SA 3TOBA 4KVOE 4MHDA 5J8CA 4CGOA 1S7KA 1VHSA 4NF1A 3ZZIA 4OLLA 3SXOA 5AG6A 4Q36A 4AG7A 4KOWA 5GCNA 3TCVA 4R3LA 3F8KA 1Z4RA 1M4DA 2P6GA 2VXKA 1QSNA 3G8WA 2B5GA 2PSWA 3TOAA 3VWDA 4L8AA 4XPKA 1XEBA 1K4JA 2FL4A 2Q44A 4JJXA 1M4GA 5AG7A 1N71A 4H6ZA 2YNCA 1RXTA 1OZPA 2PR8A 4UFVA 2B4DA 4KVME 2P0WA 4UCPA 4XPDC 2D4PA 2Z11A 3E0KA 4NCZA 3EO4A 2ARHA 1BOBA 2B3UA 2PC1A 4XNHB 3UY5A 4MFPA 1KZFA 4J3GA 4KLWA 4A32A 4XPDB 5ISVA 2R98A 5FVJA 1B87A 4FD6A 2DPTA 1IICA 4EVYA 4OADA 3D2MA 2ZW5A 4LUAA 3P2FA 2Z0ZA 4A33A 1IIDA 1QSMA 3EXNA 3EC4A 1Q2CA 5JQ4A 2YNCC 4HKFA 1YLEA 2WUUA 5I0CA 5AGEA 5A28A 1IYKA 4QVTA 3R96A 2B5GB 3ZJ0A 4A95A 4R87A 2Z3KA 4KOYA 4KSFA 1YK3A 5BWAB 4DNCA 2PR1A 3DDDA 2BEIA 3W91A 2FXFA 5EBVA 2ATRA 3P2HA 4KOVA 4PK3A 5C82A 3IWEA 4KZTA 2FS5A 3R9FA 4KORA 3C26A 4MBUA 4ORFA 4QBJA 2EUIA 4I49A 3S6HA 3FB3A 3FYNA 2J8NA 4CAVA 3PZJA 4B12A 2REEA 4H89A 2PQ8A 5CNPA 4JXRA 2OH1A 1S3ZA 5AG5A 2EVNA 4II9A 1B6BA 4CYPA 3JVNA 4MFJA 3D8PA 4UFWA 2B4BA 4C68A 1GHEA 3W6XA 3GKRA 5HMNA 4FD4A 5E96A 3TE4A 3DR8A 4KOUA 3PP9A 2BL1A 4NSQA 1ON0A 1IYLA 2Z3OA 4CS0B 3R1KA 5F48A 2R7HA 1TIQA 4RS2A 3V8IA 4B5PA 2VZYA 4YGOA 4CYOA 2ZW7A 4E0AA 4ZGYB 3K9UA 4MFLA 1WK4A 3TT2A 5IV0A 1RO5A 2HUZA 1Q2DA 4IF5A 1LRZA 5EC4A 4JLYA 3BJ7A 4U9YA 2O28A 2Q04A 2VZZA 4KUAA 5A27A 3QB8A 4BMHA 4Q38A 4F0XA 2YNEA 5F46A 1XE4A 4AVCA 1J4JA 1UFHA 2GE3A 2GANA 1QSRA 1U6MA 5DWMA 2J8MA 4C7HA 3W6SA 2OZHA 2Q7BA 3TO6A 2P6FA 4CGMA 2FT0A 1NSLA 3BJ8A 4QB9A 2QIRA 3H4QA 4MFQA 4KLVA 2CXAA 2FSRA 2PDOA 1WWZA 1M1DA 1S7FA 2PRBA 2P6EA 2OZGA 4KUBA 5IX3A 4OAEA 4YFJA 2HQYA 1S7NA 2OU2A 2CNMA 3IWGA 4UWIA 4HNYB 4C2ZA 3T90A 4CAEA 1M44A 4NEXA 4UWJA 4R9MA 4A2ZA 5F49A 2FE7A 2QECA 3IU1A 4U9ZA 1P4NA 4B5PB 2YNDA 5G22A 2ZPAA 1YR0A 5IB0A 3MGDA 3EFAA 1MK4A 1P0HA 2ZW4A 5G20A 3JUWA 3CXPA 3B8GA 1QSTA 2BUEA 4B13A 2B4DB 2RC4A 4GS4A 1Q2YA 2K5TA 2KCWA 2YGWA 2R1IA 4A31A 1NMTA 4YRHA 1R57A 1YX0A 1BO4A 4QUSA 3D2PA 3LODA 3S6KA 2CNTA 4NXYA 4JD6A 3IGRA 4FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4V A;  3TO9 A;  3FNC A;  2REF A;  4MY3 A;  4XPL A;  3R9E A;  4E8O A;  2Q0Y A;  5KTA A;  3FIX A;  4KOS A;  3TTH A;  3VWE A;  2G0B A;  4MI4 A;  2JDC A;  2ZXV A;  2ZW6 A;  4CAW A;  2HV2 A;  2QML A;  1CJW A;  5HH1 A;  3F5B A;  3S6G A;  4FD7 A;  2AE6 A;  1I1D A;  1QSO A;  3RYO A;  2I00 A;  1YVK A;  5KTC A;  1S7L A;  4L89 A;  4Y49 C;  5F47 A;  1IB1 E;  4RI1 A;  3R9G A;  1S5K A;  4CRY B;  4E2A A;  4CRZ B;  1Z9U A;  2Y0M A;  4QC6 A;  3R95 A;  2AJ6 A;  3FXT A;  2G3A A;  2WPW A;  4R3K A;  4UA3 A;  3GYA A;  4HNX B;  1MJ9 A;  4UBR A;  3CXS A;  4Y49 B;  5H86 A;  4MJ8 A;  2J8R A;  3KKW A;  1KUY A;  1V0C A;  4M85 A;  3LD2 A;  2X7B A;  2Z10 A;  2B3V A;  3NE7 A;  1Y7R A;  2VI7 A;  1YRE A;  3SXN A;  3F0A A;  2VQY A;  3S6F A;  2DXQ A;  4KOX A;  2Q4Y A;  1Z4E A;  2FIW A;  4ZBG A;  4PK2 A;  4IUS A;  3FBU A;  4AVB A;  5JPH A;  4XNH C;  1FY7 A;  3PGP A;  4CAX A;  4H6U A;  1Y9K A;  3CXQ A;  3DSB A;  2JLM A;  3SHP A;  2FCK A;  1CM0 A;  4PSW A;  3N7Z A;  3DNS A;  2I79 A;  1MJA A;  3FRM A;  1I12 A;  1XMT A;  2BSW A;  3I3G A;  4F6A A;  2GIV A;  4KVX A;  4JXQ A;  2B58 A;  2G3T A;  3I9S A;  5C88 A;  2OB0 A;  2R8V A;  3D3S A;  1SQH A;  2VEZ A;  4AVA A;  3QAH A;  1S60 A;  3WR7 A;  1XF8 A;  2H5M A;  1VKC A;  4PV6 A;  1PUA A;  2C27 A;  4AG9 A;  1XIX A;  1M4I A;  1L0C A;  1Y9W A;  3TO7 A;  5J8F A;  4U5Y A;  1MJB A;  5DWN A;  4PSX A;  4R57 A;  4AB7 A;  4F0Y A;  2CY2 A;  4LX9 A;  3TFY A;  4KOT A;  5H84 A;  1I21 A;  1NE9 A;  2WPX A;  4JWP A;  2A4N A;  2CNS A;  4MY0 A;  4B5O A;  2JDD A;  3EY5 A;  3DR6 A;  2VBQ A;  2F5I A;  2OZU A;  2IL4 A;  3OWC A;  4ONU A;  3G3S A;  1PU9 A;  2NMT A;  4X5K A;  2FIA A;  4HNW B;  1YVO A;  5KTD A;  2D4O A;  1YGH A;  3BLN A;  3T9Y A;  1KUV A;  2JEV A;  4K30 A;  1KUX A;  3GY9 A;  4M3S A;  3TOB A;  4KVO E;  4MHD A;  5J8C A;  1S7K A;  1VHS A;  4NF1 A;  3ZZI A;  4OLL A;  3SXO A;  4AG7 A;  4KOW A;  5GCN A;  3TCV A;  4R3L A;  3F8K A;  1Z4R A;  1M4D A;  2P6G A;  2VXK A;  1QSN A;  3G8W A;  2B5G A;  2PSW A;  3TOA A;  3VWD A;  4L8A A;  4XPK A;  1XEB A;  1K4J A;  2FL4 A;  2Q44 A;  4JJX A;  1M4G A;  1N71 A;  4H6Z A;  1RXT A;  1OZP A;  2PR8 A;  2B4D A;  4KVM E;  2P0W A;  4XPD C;  2D4P A;  2Z11 A;  3E0K A;  4NCZ A;  3EO4 A;  2ARH A;  1BOB A;  2B3U A;  2PC1 A;  4XNH B;  3UY5 A;  1KZF A;  4J3G A;  4KLW A;  4XPD B;  5ISV A;  2R98 A;  5FVJ A;  1B87 A;  4FD6 A;  4EVY A;  1IIC A;  4OAD A;  3D2M A;  2ZW5 A;  4LUA A;  3P2F A;  2Z0Z A;  1IID A;  1QSM A;  3EXN A;  3EC4 A;  1Q2C A;  5JQ4 A;  4HKF A;  1YLE A;  5I0C A;  1IYK A;  4QVT A;  3R96 A;  2B5G B;  3ZJ0 A;  4R87 A;  4KOY A;  1YK3 A;  4DNC A;  2PR1 A;  3DDD A;  2BEI A;  3W91 A;  2FXF A;  5EBV A;  2ATR A;  3P2H A;  4KOV A;  4PK3 A;  5C82 A;  4KZT A;  2FS5 A;  3R9F A;  4KOR A;  3C26 A;  4MBU A;  4ORF A;  4QBJ A;  2EUI A;  4I49 A;  3S6H A;  3FB3 A;  3FYN A;  2J8N A;  4CAV A;  3PZJ A;  2REE A;  4H89 A;  2PQ8 A;  5CNP A;  4JXR A;  2OH1 A;  1S3Z A;  2EVN A;  4II9 A;  1B6B A;  3JVN A;  3D8P A;  2B4B A;  1GHE A;  3W6X A;  3GKR A;  5HMN A;  4FD4 A;  5E96 A;  3TE4 A;  3DR8 A;  4KOU A;  3PP9 A;  2BL1 A;  4NSQ A;  1ON0 A;  1IYL A;  4CS0 B;  3R1K A;  5F48 A;  2R7H A;  1TIQ A;  4RS2 A;  3V8I A;  4B5P A;  2VZY A;  4YGO A;  2ZW7 A;  4E0A A;  3K9U A;  3TT2 A;  1WK4 A;  5IV0 A;  1RO5 A;  2HUZ A;  1Q2D A;  4IF5 A;  1LRZ A;  5EC4 A;  4JLY A;  3BJ7 A;  4U9Y A;  2O28 A;  2Q04 A;  2VZZ A;  4KUA A;  3QB8 A;  4BMH A;  5F46 A;  1XE4 A;  4AVC A;  1J4J A;  1UFH A;  2GE3 A;  2GAN A;  1QSR A;  1U6M A;  5DWM A;  2J8M A;  3W6S A;  2OZH A;  2Q7B A;  3TO6 A;  2P6F A;  2FT0 A;  1NSL A;  3BJ8 A;  4QB9 A;  2QIR A;  3H4Q A;  4KLV A;  2FSR A;  2PDO A;  1WWZ A;  1M1D A;  1S7F A;  2PRB A;  2P6E A;  2OZG A;  4KUB A;  5IX3 A;  4OAE A;  4YFJ A;  2HQY A;  1S7N A;  2OU2 A;  2CNM A;  3IWG A;  4UWI A;  4HNY B;  3T90 A;  1M44 A;  4NEX A;  4UWJ A;  4R9M A;  5F49 A;  2FE7 A;  2QEC A;  4U9Z A;  1P4N A;  4B5P B;  2ZPA A;  1YR0 A;  5IB0 A;  3MGD A;  3EFA A;  1MK4 A;  1P0H A;  2ZW4 A;  3JUW A;  3CXP A;  3B8G A;  1QST A;  2BUE A;  2B4D B;  2RC4 A;  2KCW A;  1Q2Y A;  2K5T A;  4GS4 A;  2R1I A;  1NMT A;  4YRH A;  1R57 A;  1YX0 A;  1BO4 A;  4QUS A;  3D2P A;  3LOD A;  3S6K A;  2CNT A;  4NXY A;  4JD6 A;  3IGR A;  4FD5 A; 
#chains in the Genus database with same CATH topology
 2Q4V A;  3VAT A;  2PJA A;  2PJ0 A;  3TO9 A;  3FNC A;  3SI0 A;  2REF A;  3NH5 A;  4MY3 A;  2VL1 A;  4NGM A;  2GLJ A;  2Z3N A;  4XPL A;  2CIJ A;  1AMP A;  3R9E A;  2G9D A;  4E8O A;  2Z3M A;  4OKO A;  3RZA A;  1F2P A;  2Q0Y A;  5KTA A;  3FIX A;  4KOS A;  3TTH A;  4CGN A;  4UEE A;  3RAM A;  2G0B A;  3VWE A;  4NGS A;  4MI4 A;  3B3V A;  2XEF A;  2JDC A;  3WC6 A;  2ZXV A;  4CYQ A;  3BHX A;  2ZW6 A;  4MRI A;  4CAW A;  2HV2 A;  2QML A;  1CJW A;  1Z2L A;  5HH1 A;  3F5B A;  4B11 A;  3PB9 X;  3S6G A;  4OIW A;  1Z8X A;  2IMO A;  4FD7 A;  2AE6 A;  1VHE A;  4WWV A;  1I1D A;  3PB4 X;  4OC2 A;  1HEE A;  1QSO A;  3RYO A;  4ZYQ A;  2V8V A;  2I00 A;  1IOF A;  1YVK A;  4NGN A;  5KTC A;  1S7L A;  4L89 A;  4Y49 C;  2C1C A;  2O4H A;  3BI0 A;  5F47 A;  5K8P A;  2DEA A;  1IB1 E;  2Q51 A;  3S9N A;  3IO1 A;  4RI1 A;  3SJF A;  3R9G A;  1S5K A;  4MCR A;  4CRY B;  4E2A A;  2ZEP A;  2PJ4 A;  4CRZ B;  4DYO A;  1Z9U A;  2Y0M A;  4QC6 A;  3R95 A;  2DPS A;  3WC7 A;  4UFX A;  2AJ6 A;  3FXT A;  4F8Z A;  2G3A A;  2WPW A;  4R3K A;  4UA3 A;  3GYA A;  4HNX B;  4UF4 A;  1MJ9 A;  4UBR A;  3V38 A;  3CXS A;  4PQA A;  4GM5 A;  4Y49 B;  5H86 A;  4MJ8 A;  5HVF A;  1YQE A;  2WSA A;  3PEI A;  2J8R A;  4X2T A;  3KKW A;  1KUY A;  1V0C A;  2EWB A;  2V77 A;  4M85 A;  3LD2 A;  2X7B A;  3KR4 A;  2Z10 A;  3I1U A;  3MRU A;  5G21 A;  2B3V A;  3NE7 A;  1Y7R A;  2VI7 A;  1YRE A;  4P10 A;  3RNZ A;  1ELM P;  3SXN A;  3LAC A;  3F0A A;  2VQY A;  3S6F A;  3DLJ A;  2PJ2 A;  2ABZ A;  2DXQ A;  4KOX A;  3IC1 A;  2Q4Y A;  1FNO A;  4CGP A;  3FEC A;  4KSA A;  2ZEM A;  5JM6 A;  4A30 A;  4CYN A;  4KS9 A;  4Q7A A;  1ARL A;  1Z4E A;  2FIW A;  4ZBG A;  2AFX A;  4C2Y A;  1ZO0 A;  1BAV A;  1CX8 A;  3A9L A;  2ANP A;  3VH9 A;  4PK2 A;  4IUS A;  3FBU A;  4OC3 A;  5DS0 A;  3H5Z A;  4OP4 A;  4CGL A;  4AVB A;  4CAF A;  2C6C A;  5JPH A;  4XNH C;  4MFZ A;  1LCP A;  1FY7 A;  1QMU A;  1ELL P;  3FJU A;  2O53 A;  2QVP A;  3HLP A;  3PGP A;  4C7I A;  4CAX A;  4H6U A;  4NGQ A;  2AFS A;  5ELY A;  2CTC A;  2F8H A;  1YW6 A;  3H8G A;  4P4E A;  2ZED A;  1CP6 A;  1Y9K A;  2ZOG A;  3CXQ A;  3GLJ A;  1UWY A;  4P4J A;  3DSB A;  2JLM A;  4IHM A;  4A38 A;  4A37 A;  3SHP A;  2BO9 A;  2JBJ A;  2FCK A;  1JQG A;  2POK A;  3K9T A;  1CM0 A;  4DUK A;  4PSW A;  3S9M A;  3GUX A;  4UCN A;  3JTK A;  3N7Z A;  3D7H A;  1M4L A;  3DNS A;  5D29 A;  2I79 A;  1TF9 A;  1XBU A;  1MJA A;  2PIY A;  4NFR A;  1XOV A;  3FRM A;  2Z3P A;  3IJ3 A;  3GIU A;  1I12 A;  1XMT A;  2BSW A;  3N5F A;  4NJQ A;  3VAR A;  4OC4 A;  4UIA A;  3I3G A;  4BBH A;  4F6A A;  2GIV A;  4KVX A;  3WAB A;  4JXQ A;  2B58 A;  3KHZ A;  3TX8 A;  4OC1 A;  2G3T A;  2Q43 A;  3I9S A;  2OB0 A;  5C88 A;  3SJX A;  5LYI A;  2R8V A;  3PB7 X;  3D3S A;  1SQH A;  2VEZ A;  4AVA A;  4C2X A;  2V8H A;  1IY7 A;  3QAH A;  3SI1 A;  1S60 A;  3WR7 A;  1XF8 A;  4G1P A;  2H5M A;  2Z3L A;  1VKC A;  1BPM A;  3BXM A;  4PV6 A;  4NGR A;  1PUA A;  2HB6 A;  3B3W A;  3CPA A;  3FF3 A;  3KL9 A;  2C27 A;  4MHY A;  4AG9 A;  4DJL A;  5CBM A;  4CPA A;  1YSJ A;  2AFO A;  1XIX A;  5LRG A;  1M4I A;  1L0C A;  1Y9W A;  2XEI A;  4FAI A;  1XRY A;  1F2O A;  5AG4 A;  2PJ3 A;  1YME A;  3CDX A;  4U5Y A;  3KZW A;  3TO7 A;  5J8F A;  1MJB A;  3NFZ A;  4PSX A;  1CP7 A;  4R57 A;  4OME A;  4NGT A;  4MXU A;  5DWN A;  4R76 A;  5G1Z A;  4AB7 A;  4F0Y A;  2CY2 A;  4LX9 A;  4B10 A;  3TFY A;  4KOT A;  4P45 A;  1R3N A;  2IJZ A;  2WZN A;  5H84 A;  1I21 A;  1NE9 A;  2WPX A;  1ZLI A;  3QNV A;  4JWP A;  5HVH A;  4BD9 A;  2A4N A;  2CNS A;  4MY0 A;  1LAN A;  4B5O A;  4UCM A;  2JDD A;  3EY5 A;  4ZY0 A;  3DR6 A;  4P4F A;  3D67 A;  2VBQ A;  2F5I A;  3D7G A;  2OZU A;  1CPX A;  2PE3 A;  2IL4 A;  3OWC A;  1YW4 A;  4ONU A;  5J1Q A;  2PJ7 A;  1LFW A;  1Z8L A;  1PU9 A;  2OR4 A;  3G3S A;  3H8E A;  4B14 A;  2NMT A;  2ZEN A;  4X5K A;  2FIA A;  1H8L A;  4HNW B;  3KGQ A;  2GLF A;  4P44 A;  4P4B A;  4M6I A;  1YVO A;  3PBE A;  1LAM A;  3IU2 A;  3PFO A;  4MFK A;  5KTD A;  8CPA A;  2D4O A;  1YGH A;  3BLN A;  3T9Y A;  1KUV A;  2JEV A;  4IK2 A;  4K30 A;  1KUX A;  1ZG8 A;  2EK8 A;  3GY9 A;  2PJC A;  3RBU A;  3WC5 A;  4TWE A;  4UEZ A;  2QJ8 A;  1IGB A;  4M3S A;  3TOB A;  4KVO E;  4M6H A;  4MHD A;  5J8C A;  4NJR A;  4CGO A;  1Z5R A;  1S7K A;  1VHS A;  2ZEG A;  4NF1 A;  3ZZI A;  4OLL A;  3SXO A;  5AG6 A;  2PVW A;  4Q36 A;  4OC5 A;  4AG7 A;  2PJ8 A;  2V8D A;  4KOW A;  5GCN A;  3TCV A;  1FT7 A;  3B3S A;  4R3L A;  3F8K A;  1Z4R A;  1TKF A;  4FWU A;  1M4D A;  1Q7L A;  2P6G A;  2AFU A;  1QSN A;  2VXK A;  3CT9 A;  3G8W A;  3D68 A;  2B5G A;  2PSW A;  3TOA A;  3VWD A;  4L8A A;  4XPK A;  3B2Y A;  1EE3 P;  4X8I A;  1XEB A;  1K4J A;  3NE8 A;  2FL4 A;  3HUV A;  2Q44 A;  4JJX A;  1M4G A;  5AG7 A;  3SI2 A;  1N71 A;  2V8G A;  4H6Z A;  2YNC A;  1RXT A;  1OZP A;  5K8O A;  2PR8 A;  2GFQ A;  4UFV A;  2B4D A;  4KVM E;  5CPA A;  2P0W A;  4UCP A;  4EFD A;  4XPD C;  2C6P A;  5JH9 A;  2IQ6 A;  5JGF A;  1PCA A;  2D4P A;  2Z11 A;  3E0K A;  4MMO A;  3D4U A;  2ZEL A;  4NCZ A;  4ZI6 A;  1Y0R A;  1ZG9 A;  3EO4 A;  5D8N A;  1NSA A;  2ARH A;  1TKJ A;  1BOB A;  2B3U A;  2PC1 A;  4XNH B;  4AXV A;  4H2K A;  3UY5 A;  4MFP A;  1KZF A;  4J3G A;  2ZEE A;  3PRT A;  4KLW A;  4MCQ A;  4XPD B;  4A32 A;  2R98 A;  5ISV A;  5FVJ A;  1B87 A;  3FH4 A;  1RTQ A;  5IB9 A;  4FD6 A;  2DF5 A;  1IIC A;  2DPT A;  2QYV A;  4JYW A;  2EK9 A;  4EVY A;  4OAD A;  5LRK A;  2AFZ A;  4PXE A;  3D2M A;  2FVG A;  2ZW5 A;  1TKH A;  4NGP A;  4LUA A;  3P2F A;  2Z0Z A;  4W9Y A;  4MCP A;  1IID A;  3KR5 A;  4A33 A;  1QSM A;  3EXN A;  4EWT A;  2RB7 A;  3EC4 A;  3SJE A;  4GXH A;  1Q2C A;  2PJ1 A;  4RN7 A;  5JQ4 A;  2YNC C;  2WYR A;  4YWY A;  3ISZ A;  1DTD A;  4HKF A;  1YLE A;  2WUU A;  5I0C A;  5AGE A;  5A28 A;  1IYK A;  4QVT A;  3R96 A;  2B5G B;  3ZJ0 A;  4PPZ A;  4A95 A;  1TXR A;  3FEE A;  4R87 A;  2Z3K A;  4KOY A;  1DE4 C;  2GU2 A;  4F9U A;  5K8M A;  4TNU A;  4KSF A;  1YK3 A;  3D66 A;  5BWA B;  4DNC A;  3NH4 A;  3B35 A;  2AFW A;  2PR1 A;  1QQ9 A;  2BEI A;  3DDD A;  3JRU A;  4KSI A;  3W91 A;  3S9L A;  2FXF A;  5EBV A;  1VHO A;  2ATR A;  3P2H A;  4KOV A;  4PK3 A;  3MN8 A;  5C82 A;  3IWE A;  4KZT A;  2FS5 A;  2PJ5 A;  4KOR A;  3R9F A;  4EME A;  4PXD A;  1Z8W A;  2Q4Z A;  1Z8T A;  3C26 A;  4MBU A;  2CF4 A;  4ORF A;  1YLO A;  4LQ6 A;  4JZ0 A;  2OOT A;  4PXC A;  4QBJ A;  2EUI A;  4I49 A;  1IOI A;  3S6H A;  3FB3 A;  3FYN A;  4M6G A;  2J8N A;  4WJB A;  4CAV A;  2PJ9 A;  1CBX A;  3PZJ A;  4B12 A;  5I4M A;  2REE A;  2C6G A;  4H89 A;  1R43 A;  2PQ8 A;  3L2N A;  5CNP A;  3SJG A;  4ZY1 A;  2ODF A;  2ZEF A;  1ARM A;  1HDU A;  2NYQ A;  4P6Y A;  3LMS A;  3KAS A;  3NA6 A;  2XEG A;  4JXR A;  4ZX9 A;  1GYT A;  2OH1 A;  1ZLH A;  4IAV A;  1S3Z A;  2PCU A;  4LQG A;  3QAY A;  4P4D A;  5AG5 A;  2EVN A;  4II9 A;  1B6B A;  2ZEO A;  4R6T A;  4X3R A;  1BPN A;  1OBR A;  4CYP A;  3K2K A;  3JVN A;  4FUU A;  4MFJ A;  3TC8 A;  5HVG A;  3D8P A;  4UFW A;  3KQZ A;  2B4B A;  4UEF A;  1GHE A;  3W6X A;  4A94 A;  4C68 A;  4R7M A;  3GKR A;  1ZG7 A;  4UIB A;  5HMN A;  1LAP A;  4FD4 A;  5E96 A;  4OC0 A;  3TE4 A;  3DR8 A;  4KOU A;  4B6Z A;  4F9V A;  3PP9 A;  1AUG A;  3B3C A;  5THW A;  1X10 A;  2BL1 A;  2PJB A;  1ON0 A;  1IYL A;  2Z3O A;  3PFE A;  4K3N A;  4NSQ A;  3FVL A;  3R1K A;  4ZY2 A;  4CS0 B;  5F48 A;  2EO8 A;  2R7H A;  1HDQ A;  1TIQ A;  2XEJ A;  4O23 A;  4RS2 A;  3V8I A;  3D7F A;  4B5P A;  3CZX A;  3DGV A;  2VZY A;  4YGO A;  5K8N A;  4CYO A;  2ZW7 A;  3WT4 A;  3IWW A;  4E0A A;  4ZGY B;  5F09 A;  4R8F A;  3K9U A;  4MFL A;  1WK4 A;  3TT2 A;  5IV0 A;  1RO5 A;  1A2Z A;  1IU8 A;  2HUZ A;  1Q2D A;  2CTB A;  1Y7E A;  4IF5 A;  1LRZ A;  5EC4 A;  1Y0Y A;  3BJ7 A;  4JLY A;  4U9Y A;  4A39 A;  2F7V A;  2O28 A;  2Q04 A;  4ONW A;  4FBE A;  2VZZ A;  4KUA A;  5A27 A;  3ISX A;  3KI9 A;  2PRQ A;  3QB8 A;  1PYT B;  4Q38 A;  3BI1 A;  4BMH A;  2YNE A;  4F0X A;  5F46 A;  4P4I A;  1XE4 A;  4AVC A;  1J4J A;  1UFH A;  1JWQ A;  1XMB A;  2ZEH A;  2GE3 A;  3FMC A;  2J9A A;  1XJO A;  2GAN A;  2JEW A;  1QSR A;  1U6M A;  5DWM A;  7CPA A;  2J8M A;  2BCO A;  3KQX A;  5LRJ A;  1CPS A;  2PIZ A;  2OZH A;  3IFE A;  3W6S A;  2Q7B A;  2RFH A;  4C7H A;  3TO6 A;  2P6F A;  2PJ6 A;  4CGM A;  2FT0 A;  1NSL A;  2Q7S A;  2BOA A;  1VGY A;  1CG2 A;  3BJ8 A;  4HPS A;  4QB9 A;  5LYL A;  2QIR A;  3H4Q A;  4MFQ A;  4KLV A;  2CXA A;  2FSR A;  2PDO A;  3GB0 A;  1WWZ A;  1M1D A;  1S7F A;  3FED A;  4PXB A;  1LOK A;  2PRB A;  2P6E A;  2OZG A;  4KUB A;  4MHZ A;  5IX3 A;  4OAE A;  6CPA A;  2HC9 A;  3D7D A;  2HQY A;  3T8W A;  3V7Z A;  1S7N A;  4YFJ A;  3IIB A;  5HXD A;  2OU2 A;  2CNM A;  3IWG A;  4UWI A;  3B7I A;  1XFO A;  4HNY B;  4MCS A;  4C2Z A;  2I3C A;  2JBK A;  3LWU A;  3T90 A;  4CAE A;  1M44 A;  1X12 A;  4NEX A;  5LYD A;  4YU9 A;  4UWJ A;  5LYF A;  4R9M A;  1AYE A;  3PB8 X;  4RUH A;  4A2Z A;  3KHX A;  5F49 A;  2FE7 A;  2QEC A;  4MHP A;  3IU1 A;  4U9Z A;  2ZOF A;  4BIN A;  4OID A;  3RO0 A;  4Z65 A;  1P4N A;  4B5P B;  2YND A;  5G22 A;  2ZPA A;  2GRE A;  1YR0 A;  1BLL E;  1TF8 A;  1F57 A;  5IB0 A;  3MGD A;  3EFA A;  1MK4 A;  1P0H A;  2ZW4 A;  4ZX8 A;  5EMI A;  5G20 A;  1VIX A;  3JUW A;  3CXP A;  3B3T A;  3B8G A;  1QST A;  2BUE A;  3PB6 X;  4B13 A;  2B4D B;  2RC4 A;  2KCW A;  1Q2Y A;  2K5T A;  2YGW A;  3CPX A;  4GS4 A;  1KWM A;  2R1I A;  4A31 A;  3H8F A;  3FX6 A;  3IEH A;  1NMT A;  2PVV A;  3NH8 A;  4YRH A;  1R57 A;  1YX0 A;  2EBJ A;  4MHN A;  1BO4 A;  4QUS A;  3D2P A;  2NSM A;  3LOD A;  3S6K A;  2CNT A;  4NXY A;  4JD6 A;  2AFM A;  3IGR A;  4FD5 A;  3PBB A; 
#chains in the Genus database with same CATH homology
 2Q4V A;  3TO9 A;  3FNC A;  2REF A;  4MY3 A;  2Z3N A;  4XPL A;  3R9E A;  4E8O A;  2Z3M A;  2Q0Y A;  5KTA A;  3FIX A;  4KOS A;  3TTH A;  4CGN A;  3VWE A;  2G0B A;  4MI4 A;  2JDC A;  4CYQ A;  2ZXV A;  2ZW6 A;  4CAW A;  2HV2 A;  2QML A;  1CJW A;  5HH1 A;  3F5B A;  4B11 A;  3S6G A;  4FD7 A;  2AE6 A;  1I1D A;  1QSO A;  3RYO A;  2I00 A;  1YVK A;  5KTC A;  1S7L A;  4L89 A;  4Y49 C;  5F47 A;  1IB1 E;  4RI1 A;  3R9G A;  1S5K A;  4CRY B;  4E2A A;  4CRZ B;  1Z9U A;  2Y0M A;  4QC6 A;  3R95 A;  2DPS A;  4UFX A;  2AJ6 A;  3FXT A;  2G3A A;  2WPW A;  4R3K A;  4UA3 A;  3GYA A;  4HNX B;  1MJ9 A;  4UBR A;  3CXS A;  4Y49 B;  5H86 A;  4MJ8 A;  2WSA A;  2J8R A;  3KKW A;  1KUY A;  1V0C A;  4M85 A;  3LD2 A;  2X7B A;  2Z10 A;  5G21 A;  2B3V A;  3NE7 A;  1Y7R A;  2VI7 A;  1YRE A;  3SXN A;  3F0A A;  2VQY A;  3S6F A;  2DXQ A;  4KOX A;  2Q4Y A;  4CGP A;  4KSA A;  4A30 A;  4CYN A;  4KS9 A;  1Z4E A;  2FIW A;  4ZBG A;  4C2Y A;  1ZO0 A;  3A9L A;  4PK2 A;  4IUS A;  3FBU A;  4CGL A;  3H5Z A;  4AVB A;  4CAF A;  5JPH A;  4XNH C;  4MFZ A;  1FY7 A;  3PGP A;  4C7I A;  4CAX A;  4H6U A;  1Y9K A;  3CXQ A;  3DSB A;  2JLM A;  3SHP A;  2FCK A;  1CM0 A;  4PSW A;  4UCN A;  3JTK A;  3N7Z A;  3DNS A;  2I79 A;  1MJA A;  3FRM A;  2Z3P A;  1I12 A;  1XMT A;  2BSW A;  3I3G A;  4BBH A;  4F6A A;  2GIV A;  4KVX A;  4JXQ A;  2B58 A;  2G3T A;  3I9S A;  5C88 A;  2OB0 A;  2R8V A;  3D3S A;  1SQH A;  2VEZ A;  4AVA A;  4C2X A;  3QAH A;  1S60 A;  3WR7 A;  1XF8 A;  2H5M A;  2Z3L A;  1VKC A;  4PV6 A;  1PUA A;  2C27 A;  4AG9 A;  1XIX A;  1M4I A;  1L0C A;  1Y9W A;  5AG4 A;  3TO7 A;  5J8F A;  4U5Y A;  1MJB A;  5DWN A;  4PSX A;  4R57 A;  5G1Z A;  4AB7 A;  4F0Y A;  2CY2 A;  4LX9 A;  4B10 A;  3TFY A;  4KOT A;  5H84 A;  1I21 A;  1NE9 A;  2WPX A;  4JWP A;  2A4N A;  2CNS A;  4MY0 A;  4B5O A;  4UCM A;  2JDD A;  3EY5 A;  3DR6 A;  2VBQ A;  2F5I A;  2OZU A;  2IL4 A;  3OWC A;  4ONU A;  4B14 A;  3G3S A;  1PU9 A;  2NMT A;  4X5K A;  2FIA A;  4HNW B;  1YVO A;  3IU2 A;  4MFK A;  5KTD A;  2D4O A;  1YGH A;  3BLN A;  3T9Y A;  1KUV A;  2JEV A;  4K30 A;  1KUX A;  3GY9 A;  4M3S A;  3TOB A;  4KVO E;  4MHD A;  5J8C A;  4CGO A;  1S7K A;  1VHS A;  4NF1 A;  3ZZI A;  4OLL A;  3SXO A;  5AG6 A;  4Q36 A;  4AG7 A;  4KOW A;  5GCN A;  3TCV A;  4R3L A;  3F8K A;  1Z4R A;  1M4D A;  2P6G A;  2VXK A;  1QSN A;  3G8W A;  2B5G A;  2PSW A;  3TOA A;  3VWD A;  4L8A A;  4XPK A;  1XEB A;  1K4J A;  2FL4 A;  2Q44 A;  4JJX A;  1M4G A;  5AG7 A;  1N71 A;  4H6Z A;  2YNC A;  1RXT A;  1OZP A;  2PR8 A;  4UFV A;  2B4D A;  4KVM E;  2P0W A;  4UCP A;  4XPD C;  2D4P A;  2Z11 A;  3E0K A;  4NCZ A;  3EO4 A;  2ARH A;  1BOB A;  2B3U A;  2PC1 A;  4XNH B;  3UY5 A;  4MFP A;  1KZF A;  4J3G A;  4KLW A;  4A32 A;  4XPD B;  5ISV A;  2R98 A;  5FVJ A;  1B87 A;  4FD6 A;  2DPT A;  1IIC A;  4EVY A;  4OAD A;  3D2M A;  2ZW5 A;  4LUA A;  3P2F A;  2Z0Z A;  4A33 A;  1IID A;  1QSM A;  3EXN A;  3EC4 A;  1Q2C A;  5JQ4 A;  2YNC C;  4HKF A;  1YLE A;  2WUU A;  5I0C A;  5AGE A;  5A28 A;  1IYK A;  4QVT A;  3R96 A;  2B5G B;  3ZJ0 A;  4A95 A;  4R87 A;  2Z3K A;  4KOY A;  4KSF A;  1YK3 A;  5BWA B;  4DNC A;  2PR1 A;  3DDD A;  2BEI A;  3W91 A;  2FXF A;  5EBV A;  2ATR A;  3P2H A;  4KOV A;  4PK3 A;  5C82 A;  3IWE A;  4KZT A;  2FS5 A;  3R9F A;  4KOR A;  3C26 A;  4MBU A;  4ORF A;  4QBJ A;  2EUI A;  4I49 A;  3S6H A;  3FB3 A;  3FYN A;  2J8N A;  4CAV A;  3PZJ A;  4B12 A;  2REE A;  4H89 A;  2PQ8 A;  5CNP A;  4JXR A;  2OH1 A;  1S3Z A;  5AG5 A;  2EVN A;  4II9 A;  1B6B A;  4CYP A;  3JVN A;  4MFJ A;  3D8P A;  4UFW A;  2B4B A;  4C68 A;  1GHE A;  3W6X A;  3GKR A;  5HMN A;  4FD4 A;  5E96 A;  3TE4 A;  3DR8 A;  4KOU A;  3PP9 A;  2BL1 A;  4NSQ A;  1ON0 A;  1IYL A;  2Z3O A;  4CS0 B;  3R1K A;  5F48 A;  2R7H A;  1TIQ A;  4RS2 A;  3V8I A;  4B5P A;  2VZY A;  4YGO A;  4CYO A;  2ZW7 A;  4E0A A;  4ZGY B;  3K9U A;  4MFL A;  1WK4 A;  3TT2 A;  5IV0 A;  1RO5 A;  2HUZ A;  1Q2D A;  4IF5 A;  1LRZ A;  5EC4 A;  4JLY A;  3BJ7 A;  4U9Y A;  2O28 A;  2Q04 A;  2VZZ A;  4KUA A;  5A27 A;  3QB8 A;  4BMH A;  4Q38 A;  4F0X A;  2YNE A;  5F46 A;  1XE4 A;  4AVC A;  1J4J A;  1UFH A;  2GE3 A;  2GAN A;  1QSR A;  1U6M A;  5DWM A;  2J8M A;  4C7H A;  3W6S A;  2OZH A;  2Q7B A;  3TO6 A;  2P6F A;  4CGM A;  2FT0 A;  1NSL A;  3BJ8 A;  4QB9 A;  2QIR A;  3H4Q A;  4MFQ A;  4KLV A;  2CXA A;  2FSR A;  2PDO A;  1WWZ A;  1M1D A;  1S7F A;  2PRB A;  2P6E A;  2OZG A;  4KUB A;  5IX3 A;  4OAE A;  4YFJ A;  2HQY A;  1S7N A;  2OU2 A;  2CNM A;  3IWG A;  4UWI A;  4HNY B;  4C2Z A;  3T90 A;  4CAE A;  1M44 A;  4NEX A;  4UWJ A;  4R9M A;  4A2Z A;  5F49 A;  2FE7 A;  2QEC A;  3IU1 A;  4U9Z A;  1P4N A;  4B5P B;  2YND A;  5G22 A;  2ZPA A;  1YR0 A;  5IB0 A;  3MGD A;  3EFA A;  1MK4 A;  1P0H A;  2ZW4 A;  5G20 A;  3JUW A;  3CXP A;  3B8G A;  1QST A;  2BUE A;  4B13 A;  2B4D B;  2RC4 A;  4GS4 A;  1Q2Y A;  2K5T A;  2KCW A;  2YGW A;  2R1I A;  4A31 A;  1NMT A;  4YRH A;  1R57 A;  1YX0 A;  1BO4 A;  4QUS A;  3D2P A;  3LOD A;  3S6K A;  2CNT A;  4NXY A;  4JD6 A;  3IGR A;  4FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...