5E99L

Bovine fab fragment f08_b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F08_B11 light chain
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L01
3V5DB 4G9FA 1MUJA 3SKUD 2WP3T 3LEYL 4GXUN 3KYMB 2DQUH 4JG0H 1L6XA 3V0WH 3CMOL 4FFWD 4LSDA 4U6XB 2P5WA 4O2CB 4XHJD 4JJ5B 4NO0A 1NFKA 4YFLI 3H3PH 3HAEB 3UYRH 1W0VA 5I73C 4BYHA 2CUHA 5HGHB 2R1WB 3TM6A 5KAQF 2HFEB 4YDJB 2LU7A 2X1OA 1YNTB 2FEDD 2B8OT 1MFDL 1BIHA 1R5VB 4ZODA 4NQCB 4ZS6C 3KYNB 4JO2L 4P9HL 4OZIB 5JORA 4DGIL 5HYQA 4K71C 3QUXC 4CVWA 1T83A 3AAZA 4Y5YC 4ZPTA 3CU7A 4JFOA 1S9WB 3HE7D 3PDOA 4PRPD 4UU9B 3O11A 4OLZL 4S1DC 4JQXA 4MD0B 5ACMA 3QFJA 3LPGA 4D0DA 3QUYA 4PRHE 4LP4A 4JHWH 2C3XA 1RJZB 1UM5H 3TYGL 2M1KA 5IESL 2J4WH 3A6CL 1OD7A 4QRSA 2VSCA 3OG6B 4HIIB 3STBA 4OGXH 4OLEA 4RDQG 4B53A 2PW2A 1MJ8H 2KL6A 5J13C 2GSGA 3FB8A 4OZGB 1HHIA 4IHOB 5I1HL 4QHKI 3ZYOA 4HKBA 4ZD3H 1UXWA 2N4IA 4YK4C 1ZLSL 3PNWB 2XWBA 3R06B 4TULH 2NY5L 3W5NA 3RTQA 1KTLA 4JEGB 1PG7H 5TH2A 4DFHA 3STLB 4R4BB 3ARWA 4YBQC 1FJ1A 3MYJB 1JMZA 4HIHA 2BHUA 4M43L 2P8PA 5CLWA 4FXLA 2HVJA 4M8VA 3EHBC 1R6VA 2CO6B 3V7MA 4GFTB 3HRZA 1Z9LA 3MXWL 5DJ6B 5CZXC 1DQTA 3FFDA 3ZYJA 5F9DC 3EBAA 3ILQD 3QRGL 4XGZB 1IC4L 4RNRA 1J1PL 4Y19A 4H1LG 5GJSL 1JZ8A 4G9FE 3W11D 5EZLB 2GITA 1NPUA 4JCLA 4PD4J 4YXHH 3O6FD 2BC4A 1AHWA 5J6GB 1VFOA 3D39E 5JLZA 4JY5H 32C2A 3AS1A 3CDCA 2P5WE 2ZCHH 1CFTA 3BYTA 5BXFB 1MRFL 4X6CA 3F65A 5ITFB 4MA7L 4FS0A 1JZ7A 1HI6B 3NTCL 3VMNA 2HJKB 1HEZA 1CE1L 4J6RH 3CZJA 1T66C 4H0GA 5T1LA 3SDXA 4OGAD 4DN4H 5FKPA 1NCWL 5D7IB 4R3SB 1U93B 1EVUA 3T4YB 2V6HA 3ZYIA 1UG9A 3VMOA 2QADD 1U8MB 4OCRL 2AVGA 4I3SL 3INUL 2DLFL 2NZ9D 5C0JB 3BEVB 1SBSH 3QFJE 4MJIB 4IS6A 4RZCB 3DROB 4Z18A 1KLUA 4WUUB 3ARBB 2YRPA 2ZSWB 2RAMA 5MEQA 3G6DL 1QSFB 5E4EB 5IMLA 2AABH 1KC5H 2MQ0A 1GCFA 2EC9T 4WFED 1MH5A 3T2NH 1BOGA 4LSSH 1T2QL 4ODVH 3HAEG 3U48A 4I5BB 4ZFOB 2RJMA 1Q9KB 2R0LH 3I2CH 1EFXD 2A2QT 1WIOA 5TDOB 1UADC 4PS4H 3LPWA 3U30C 1QSZA 1EGJH 5HYJA 1N3NB 2A9NL 3TO4D 4MB3A 4S1QH 4PLKD 1NLBH 3CFCL 3SQOH 1AJ7L 4KTDL 4QTIH 5D72L 2VLLB 2ADIB 1NANI 2WANA 3BEWA 4G6FB 1S5IH 3SO5A 1MREH 3O3UN 4LCWB 3OSKA 4MQXC 5CMAA 1LE9B 2B5IB 1FGVH 1DR9A 1JWMA 4A2LA 1V3JA 4AM0B 1BWWA 3ARTA 2A83A 4HG4K 1Q9WA 4TTGA 2V2WB 5AD0A 4KJQC 1I75A 4NQDB 3MC0A 1L7TH 4Y19E 3VW3H 4TVPE 2ARWA 4P99A 3GMNA 4NCC2 2FL5B 1NGWA 2ZOKA 3IS0X 2JLLA 2ZKHH 3RWIB 4ETQB 3KYKL 3ARED 4GUPB 4L3AA 5L6YH 1OOAA 1S9YB 1KNOB 4XNMA 4X6CE 2HT3C 2D7QA 1LEKB 1DANT 4K3HA 4XNXL 4AEFA 1A0QH 2FECL 1UM6H 1PQZB 4UT7L 5SX4I 3FAWA 2D9CA 4JN1L 2NY1B 1XR8A 3E2HB 5IIEA 4EDWH 3SDDC 4JM4L 3SDXE 4MNQA 3IDJA 5ID0B 2Y36H 3QO1B 2ICWA 2DIBA 5IF0A 3W9DA 4LPWA 1OHQA 1CIUA 4BJLA 4HJGB 1DBAH 3NGBC 3U1SL 5IBLD 4TSBH 4K7PH 1CGSH 4QXGL 4U1HA 4PJ5E 4QRQB 1JUFA 2NX5A 4KXZI 1ZT7A 3E6HB 1A02N 3QUXA 1KCVL 1XR9A 2XZCL 4Y5YA 1RJCA 1CD1B 1SEBA 1TVBA 3ARDC 1A7QH 4XPFH 2UWEA 1DSFH 2PYED 3WSQL 2LAGB 1GOHA 3LB6D 5KZCB 3KDMB 3QIUC 2FZ3B 4AH2A 3RWEB 3I02A 1JJUA 2NQCA 2VL5A 1AIFA 2Z8VC 3FCTA 3OKEB 5DEFB 1HIML 5I16B 1V3MA 1U8IA 3REVA 3MLSL 1JV5B 4Z7WF 3V5KA 4NKMA 2WWKO 4JDZB 2C5DC 3F7VB 2BMKA 2HT2C 5HYJE 5JQHC 3GMLB 4NZTH 4LLUA 2P44B 3MRPA 3QXDB 4D0BA 1LEGA 1KJ3L 2XYCA 2I60L 1U8JB 1BZ7B 4LDEB 4MXWH 5AZ2L 3EYVA 3ZHKA 5E9DA 4L4TD 5DURB 1NCUA 4EI5B 5E8DH 3FMGH 5A2IH 2BY1A 1MSPA 4MXVF 2OJEA 5F7NC 5EO0A 4GKOA 3QEGL 3V0VB 1A9EA 1QPPA 3G6JF 5DJYB 1GZPB 2MCPL 4KQ3L 5K59E 1OTTD 1F97A 3S6CA 1G7IA 1CU4H 5IQ7H 2NYYC 3L5JA 5DMGD 4Q9QL 3RA7L 5EU5A 3QUKA 1GXEA 3FQRA 4Q6IC 2A73B 3KR3H 2EDWA 4G8GA 3KYOA 1KELL 2AXFA 5F88A 1NGXB 4WU5B 2Q8AH 2OI9B 3SCMD 4PJ8C 1KN2L 1FPTL 4I18B 4PTTA 2X41A 2VO5A 3NVQA 4MNQE 2GK0B 1CICB 1H8NA 1MHPH 4Z77A 1NC2B 3DYPA 4LQFH 1S7VB 2IALB 3BISA 1IC7L 4NP4H 5IMMA 3LS5L 1XCTA 4JO3L 2VLKD 4HLZG 1TENA 1U8QB 1ITBB 2NX5E 4XNQB 2BSRB 4CVXB 4MNGA 4HF5L 1A9BA 1K6QH 4F3FA 2DB8A 1NGZB 1X5HA 2HKHH 2YMXH 4Y8DC 4OI7A 1YY8B 4PGDB 1GAFL 2EYRB 3GSNH 2EC9U 1KPUA 3LEVL 4MJ5A 5D5ME 3BSZL 1OF2B 3I9GL 3VFUB 3ABZA 2IANB 1EERB 4HEME 4RGMC 2EH7H 5GXBB 1G7JA 4UOW1 1JPST 1XIWC 1PLGL 2HG5A 1QO3A 3OWEA 1RHFA 3RL2A 3B2UD 3WL9B 4NNYA 2AV1A 5HHOA 4Q9RL 5T1MB 1XGTB 4TN9A 4K94L 4ALAH 4RMQA 1KGCD 1LQSR 3IS1X 3CAFA 2JE8A 1IC1A 3GJEA 4GS7B 1ZTXH 2G9HA 3MNWB 2JKXA 5GGVH 3I75B 5D1ZC 3QCVH 4WI5A 5C8JA 5F9AC 3MRDB 4DW2H 5C9KA 4KKLC 3C6SB 1TVDA 5C0RL 3G08A 2RCSH 2HYMA 4KVNL 3LQMA 4N0UA 3PP4H 2AK1L 1N5AB 5IWLC 5E9DE 4WFGE 3KPOB 3VXUA 2YWZA 4AEIH 1F3JB 3JWOH 5I8CB 2BNUA 1MFBH 2HH0H 2CLVB 2FX8H 2IH3A 2ZUXA 1DE4A 1UACH 4M48H 5I75C 1FIGH 2IGFH 3HNTH 4PR5A 1F4XH 4XX1E 4KKAC 3QYCA 4Y5VB 1XGUA 4P5KB 4ETYA 1ZGLP 2OS7A 2F8XC 5E2WH 4Q2ZA 2A9MH 4TSCL 2C3VB 3LMJL 5D1QB 2JELL 1DUZB 1X6LA 3DJ9A 4E9LA 4RWYH 4G8GE 1FZKA 2DKUA 5JTWA 3OR7B 5JW3L 2ATKA 5KVFH 3DETC 4QRTA 5IFHL 3G5XB 2ZNXA 3UXFA 3BMWA 3IU3A 3K2UL 4QOKD 4KK8D 4JRXD 1QFHA 1A7OL 3V4VH 1FL6A 1DL7L 1FAIH 1FCGA 3U46A 5D7KD 3WO3B 1OAQL 3DVGB 5ICYA 1AXTH 1K2DB 3ZKNC 3V8OA 2MWCA 4EDXB 1A14L 2EXWC 3SDDA 1CDYA 5JXAH 3Q3GA 4NZRL 4OV6F 1P1ZA 5IMKA 1DQQB 4OI9A 2ZUYA 1WIUA 3P4OA 2VAAA 3U0TB 1QBLL 4F8QA 4MNGE 4PJEB 4WI4A 3S96B 3D18A 2BOCA 3VI3F 5E4EC 2R1YA 4X6BB 3PJSA 3DLQR 4LAQH 4KJWD 3VFWB 3AU1A 2R4SL 2ID5A 3KPLA 4UT9H 1TCRA 2IPKA 3Q1SL 3QEQA 3MGOA 3BH9B 3BDYL 3ARDA 3R1GH 2FR4B 4YHNA 1Q72L 3DPBA 2ZPKL 1D7FA 3PIQA 5HHOE 4JFDD 5GIRA 3QIUA 1SY6L 1GGIH 3SJVD 3OKDB 4X4YB 3WS6C 4BH8B 4CL7A 4EI6A 1BP3B 2X10A 1U3YA 5F97E 3OXRA 1A7RL 1D5ZA 4C59B 4GXVL 2DTMH 5E99L 1GIGH 5DRXB 4XPGL 4X6EB 1BGXH 4N0UE 5BZWB 3PP3H 3OR6B 2DJSA 3KGRA 2B5IC 3VXUE 2A1WH 1CE6A 4G8IA 5H2BB 4HXBL 4R2GD 5KOVC 4NQUA 2YUVA 4ZS7L 4UUJB 3RGVB 5L8KB 4XC1H 5BQ7B 3CFEA 2ZSVB 3QA3A 4OSUH 5E6IC 3CFJA 3QNZB 1DBKH 1ADQL 2BFVL 5MERA 3LS4H 1ZWIA 4MA8H 4MMZC 2EDQA 3GK8L 4XNZB 1L4IA 3QUMB 1YJDL 4WWID 3WFZA 3OAYH 3QWOB 4M1CD 2ZZUT 2YS4A 4NRZB 2VB5A 2CMRL 3QUZD 3VWJD 5F1SA 1DTUA 4Q6IA 5I1IH 3E2HC 2QEJA 4LARH 1KXTB 4JJ5A 1HXMB 2PTTA 2PETA 4HC1L 4QNPE 4YAQA 3GMQA 3PGDA 4IRSD 4PJ8A 4UIKL 4CDHA 5BVJA 3LN4B 5HGHA 2R1WA 4WW1B 3LEYH 3WNPA 1NDMA 4YDJA 3CSYB 1MIMH 1YYLL 4U3XA 4Y16D 5DR5L 5IB3A 5D2LF 5DD1L 3CDGB 1S7RB 3ARGC 3L7FB 3CMOH 4NQCA 3KYNA 3D25A 1YEJH 1L0XA 4JN2B 2BOBB 3RVTD 4HFUH 4JM2C 4N0FB 4W68A 4FNLL 3SO3B 4KROC 4M6ML 4NRXA 4F7TB 3VRJB 3RHWF 1FNEA 2D7MA 5ECJE 5EIIB 4RFEA 4OFKA 3C8DA 4Y1AB 5EUKA 1I7TA 1S7UA 2EH8L 3JV5A 5D96C 3TBTB 3QEQE 4R26L 4S1SH 5EU6A 5HVHB 4DUXA 1I7UA 4DKAA 2LU3A 1IAII 2ADFL 2IEPA 5I17A 3LKOB 3GSUA 5ALBH 2CIIB 4H8WL 4MX7A 3BP6A 2Q8BH 4OLZH 4X4MA 5I1KL 1XIWA 4LLMB 1BQUA 3B43A 3M17B 4JKLA 5B4MC 4NJ9L 4PRHD 5EOQL 3WD5L 4I0PB 1I9RL 3L3HA 3MLTA 4GRWH 3TYGH 4DCQB 1NFDB 5DSCB 5AUMB 5ID1B 5DJXB 3A6CH 3CPLB 4MMXC 2ZUSA 3Q6FB 3AVEA 2BDNL 2JB5L 3MYJA 2ENYA 4EI5C 5D1ZA 2ITCA 5I1HH 5AEAA 3KLAB 1A3RL 1ZLSH 2QR0B 5CP3H 2NY5H 2Y5TB 1T04B 3QDMD 5IWLA 2PKDA 5DJ6A 5JUEL 3TGXA 4TOYH 2ESVA 5GRVL 1TJHL 4U6YB 4J8RB 2I5YL 4RMVA 1VPOH 2VISB 3D3VB 2VABB 4MDJB 4M43H 1WWCA 2MNUA 1CIDA 2ICWI 4KK5D 1VEMA 2DYPB 4GW5A 1A6WL 4U2YA 4POUB 1MI5A 1KPVA 1Q9LA 4Y4FC 3T2QA 5CWSB 4PRNA 3MXWH 2WUBL 5I18L 1P4BL 5GS0D 4ODHL 5HGAA 5DJ2B 1YEKH 5L2KB 5BXFA 2FJHA 3BPCB 1AQKH 1QYGL 4G9FD 3WHE0 2D4DA 1MEXH 3L3JB 2D7OA 2HJKA 1PKOA 1PEZA 4NQCE 4CW1B 5EU7C 2DM2A 3T4YA 5GSVA 1CTNA 2P5WD 1FVDB 2BHZA 3BIAX 1CXKA 1B9ZA 1MRFH 4GRLB 1YECH 1U8MA 2H9GA 4MHHI 3NTCH 1U8OA 5C0JA 4IRJD 3MBEC 3DROA 2W07A 1C12B 4OF8A 5EU6E 3O6LL 4DN3L 1U8HA 4DOHB 1QSFA 1QBML 3BXNB 2VKXA 2MOVA 3INUH 3I6KA 1B4JL 1UB5A 3DURB 3F6LA 4PGEB 2HLFC 2MHAB 1XAUA 1KPRB 1XCQA 3QUYD 4WWKB 2A6IB 1ZA6B 5HYEA 5I6XC 4XPHL 2FJFB 1FLTX 2WWKT 5M94B 1Y18B 5LBSH 3V4UL 1JFQH 3WS6A 1WCBA 1ZVHA 1T2QH 1T0NA 4P0DA 1EAPA 4KZEH 1XF3B 1HE7A 3U7YH 5IHUL 1IM9B 3IB4A 3TV3L 3FO9B 4I77L 4HHAB 4PP1C 3EFFB 1ED3B 3FN0L 1HYRC 1J18A 1T5WB 3D0VB 4K8RL 5HXMA 3OJMB 4NHUB 4GRMB 3QQ9C 1ZHBA 2QL1A 3T0AA 1XGPA 2ESVE 3Q5YA 4NN5B 2A9NH 2H8PA 3G5VA 2V2WA 1KEGH 1AP2B 3TPUB 4FZ8L 3CFCH 4LSQL 4KTDH 5C7XL 1JYNA 4LSUH 5D1QC 5E6IA 3RWGA 4PY8I 3U9UB 5D2NC 1MI5E 4EN3B 2GJ6A 4PB9L 1JRHH 1P69B 3IETB 3QWRA 4QHMB 2WM0A 4KKBC 5JOEA 1JMXA 4JFHE 5T3XD 1DZBA 3MLZL 3CSGA 3RBGA 2EDBA 3IU4H 1DQJA 4TVPD 3HR6A 1ONQB 5B21A 2VQTA 3HB3C 1J11A 1RIVL 4TVPL 2OP4L 5TQ0L 5LGHH 3ELAT 5CUSL 5ID0A 4G3YH 3CC5B 1FV1A 2XACC 3KPNB 3QQNA 3FQNA 3LN5B 5DJDB 1VFBA 4HS8L 2R2BB 4DEPC 3WIIH 3WIHA 3ARGA 2Q6WA 4JN1H 4Y5XC 1N4XL 4QRQA 3RWJB 3BE1L 5DJ0B 5T1LD 3TCLA 2BRRL 3E6HA 1HCFX 3MRFB 2DI7A 2X7LB 4HXAL 4JM2A 5D7SL 4P3CL 4XI5C 1G9NH 4Z7WB 2ZWLT 4N0YH 2J7LA 3VFGL 5HPOA 1ETZA 2Z35B 1AFVL 1OWRM 4LSVL 1KJMB 2GJJA 4KHXL 2ZUUA 3OKOA 3FQWB 3HPLA 3N1FC 4NQXB 5I1CH 1A6ZB 2FZ3A 2W60B 1C1EL 3X3GH 1QLFB 5A16B 5F6IB 4L9LC 5INCA 1S7TA 2XZCH 2JK5A 2Z93A 4LMQE 2IH1A 2Z9TA 3S35X 2GJZB 1KCUL 4JDZA 4G6ML 4GRWF 5MHSD 4CN4A 5DRZB 4HIXL 2DN7A 1A3QA 2XQBL 3GKWH 1U58B 1NBZB 1B4RA 1CLCA 2QTEA 2XY1A 4NKDA 3G6JB 3MREA 2DJ4A 1R3HB 2OSLB 3L5IA 2CD0A 3EJYD 5J3HD 2YXMA 5GS3A 4QHKJ 4D94A 4L8BB 4I4WA 1XMWA 1WCQA 4WTZA 2W91A 2YR3A 4EI5A 4QXUL 5HYJD 5H94A 3EYOB 1TMCB 5EO1A 4O00A 4K2UH 4WENB 3VFNB 1B88A 2L4OA 2VXQH 2XN9D 4M6OL 1BFOA 1IAIL 1GZPA 1MY7A 3MLWL 4IEFB 4K23L 5ETUA 1CLOH 4KJYB 5C6TL 5AZ2H 2Q3AA 2GJ6E 3ARZA 4KI5F 5HHNB 3VD5A 2YD5A 4JFFB 4L1HA 4NHCH 5J0BA 3VXOB 3VFPA 5IMOA 1MFNA 1K4CA 1UWXH 3O3BA 4Y4FA 2EE9A 2OL3B 5HI4C 1WZKA 1WUNT 4KQ3H 5DMKB 5GS2H 4ZQKB 2GK0A 4N8VB 1PVHA 1Z5LA 2Z4QA 1KELH 1GHFH 4EIZC 1JNLL 5H37H 3QIWD 1IZJA 5FGCE 3QH3A 5FAAA 4ZO7A 4JFPB 1B6DA 3DVIA 3B9KB 4XNQA 4MNQD 1JBJA 4JFYB 4BH7B 2P5EB 4X5XA 3FZUC 3S97C 2KDGA 5GRJH 1IARB 1YY8A 4HT1L 4ZXBB 5HVHC 3T77A 3MBEA 3L95A 5L8JB 2WUCL 5KVDL 1IC7H 3ZE0E 3LS5H 5IJVB 1MWAA 3KPMA 5FYLH 4HS6B 4ZS6D 3S35L 3ETBF 5F7YC 4J3VA 1SVZA 2NX5D 1I8KB 5E56A 5C09E 1F6LL 4OM1H 3IDMB 3QUXD 2UUDK 4NYLA 5IKCA 4OIBA 5I74C 4I0PC 5K9OB 4X4XA 5GRZA 4QRUA 2JB6B 4S1DD 1QNZH 3FFCB 5CJQL 3BSZH 5EBMB 1A4KB 1AGBB 1OP3H 1U9KA 3MNWA 3NACH 1BIIB 4RBPH 3I75A 1U41A 4BZ2L 4WTWA 1HWHB 5F3BA 1E4WL 2J6EH 5CCKH 4Q9RH 1WWBX 2Y9RT 2W0LA 3SKOB 1N5AA 2PTVA 3HC0A 5EBWB 4XPAH 1MCJA 5J12B 3VG0L 4XCFL 4XWGL 1W2KT 5K33A 2OBGA 2CLVA 3BWAB 1MQKH 5HTSA 1FCCA 1A7NH 2D03L 5D71L 3ZDZF 2XV6B 5CJ8A 4LVEA 2AK1H 2X2YA 5HI5C 2VLRA 5E1AB 1IQDB 4WFGD 4XMPL 1C16A 1F11A 5D1QA 5HYSA 2Z91B 1A3LH 3DVNA 2XY2A 5DQ9B 5D2NA 2ICEA 5GGTA 3EHBD 3A6BL 2DQIL 2XQYG 1R5WA 1RUMH 5GRUH 5CZXD 2DI8A 1M6OB 4HPOL 4F15B 5ADPH 5E8NA 1FFOB 5EWIL 5L88H 1BD2B 5LGJA 1FBIL 5CGTA 4OLYL 3QIBD 4G8GD 1ND0A 5C3LD 3I84A 4S1RH 1JF1A 4NUGL 3VH8B 3NCJL 4OF5A 5DXWA 5EU7E 1HH6B 4GKNA 3U0TA 1DL7H 2EYTB 1WGOA 1MCRA 4GQ9H 2V7HA 3O3EA 5INDB 1OAQH 3S96A 4F2MB 1RIHH 2AJYL 5DWUL 4Y5XA 4JJHA 1BF8A 2DWDB 4JFZL 4OJFL 1L0YA 1T66D 4MA1B 4HZAA 5ERWB 1H9VA 4P3DA 5KN5A 1D9KC 3RDTB 2OQJA 3QDGD 4RGNE 1IGCH 2NY4B 4L3EA 1ZSDA 5D8JH 3TBWA 4N8VG 5EA0H 3O9WD 3MCLL 3UC0L 1KCLA 4OCMC 3VI4E 2I9TB 4IOFC 6CGTA 5DUBB 4OZFH 2GFBB 1XH3B 5FM5M 2ZCKL 4L9LA 5DC4B 2QSCL 3IFLH 4AYFA 3EOBA 5EZJA 3L7EA 5L0QB 3NIGF 3BDYH 4PJBE 4ZUVA 3U7AA 3G5YB 2H41A 4G8EB 5ICXB 4LOUD 1JF5A 3LRSB 3LV3B 5BZWA 3IAGC 2APWA 5EC2B 4PJHB 1SY6H 1CK0L 5FB8A 4DVBA 2YC1A 1MCWW 5JHDD 3EO1B 4X7TA 4LNRB 1JIBA 3EOAB 2J8UB 5DK2A 1GGCL 5DHXB 5BQ7A 2QQLH 1NCDH 3QG6A 1KB9K 4GXVH 5CBAA 4XPGH 5FCUH 4AIZB 1AGCB 4EUPB 5FDWB 2QQNL 2VLRE 5H35B 5C0CE 2FCBA 5IVXF 3C09B 3VXUD 3SDYL 5AAWA 4DK3A 4NWUH 3HNSH 1KJVA 5D2NE 1HQRB 3VDCA 5D2LB 1ADQH 2DWEA 4NO5B 4ERSL 2DQTL 4EBQL 4Q9BA 2XXCB 1RV6X 2ZG1A 4KJQD 1KB5H 1HXMA 1OQOA 3IVKA 3U4EB 1QTYT 3WS3B 1D5MB 3DUUB 3JZ7A 4MD4B 4Z7QE 4Q0XL 3LN4A 4U1MA 4WW1A 4JANB 4PG9A 3CSYA 5I1JH 2C3HA 1B0RB 2G5BA 4ZOEA 2CMRH 3W9EA 3CDGA 3SKMA 4ZAKD 3QHTC 2A0LC 5CZVL 3KPTA 4K3DH 2HT3D 4FQIL 2RHEA 1P4LB 5E4IA 1ACYH 2FEEI 1YEEH 3NABL 3GSVB 4LMQI 3SDDD 1EJ6A 1JHLL 1OTSD 4Y1AA 2Q86B 5E8PB 1B0WA 1YMMB 2BSSA 1ZHKB 3GMMA 1FZOB 4L3EE 3WLBB 1TLKA 4OCYH 3FQXA 4OI8A 1A7BA 4WJ5A 3GZKA 1JPFA 2CIIA 4FNLH 2NY3B 2AEWA 1IEAA 4NQSA 5DHVB 5C6PB 4MB5A 1KTRL 4LLMA 1H3PH 3B5GA 3KXFB 3GFUA 1KBGH 1JI2A 1X5FA 3MR9B 3NCYS 3VH8G 3QEQD 4I0PA 3ARDD 3ZL4L 2R69L 3CPLA 4K7FA 4ZNCD 5SWQB 3ZE1E 2P4AB 1IM3A 4H8WH 3TBSA 1MF2L 3QIUD 4AEEA 3MJ7B 1T21A 3O3AB 5GZNC 1UKQA 2W9EL 3S98A 2OLDA 1NAKH 2HKFH 3KLAA 3PWJA 3S9DB 1I9RH 3D69A 5EG6C 1N64H 4P23B 1AKJD 2JCCB 3BH8B 3MJ9A 4JKPL 1XGQB 2E8YA 2BDNH 5MEOB 4U6YA 2JB5H 1YNKL 3U36B 2ZOLB 1UM4L 3TA3C 4FA8A 2VABA 4PLJD 4ELKA 2DYPA 2VRAA 4OF7A 4MAYC 4KMTL 2QBWA 4LGRB 4OBSA 3S37X 4XCNA 4JAMB 1CGUA 3AMKA 4HKXA 3MJGX 3RHWK 5JUEH 3CFIC 1I9JH 2A6KB 1CLYH 1TJHH 3LKPB 5FOBA 2I5YH 5DJ2A 3NN8B 3S34L 3T1FA 4BELD 3FT3B 3O4LA 3ZSSA 4UTBL 3WHXA 3BPCA 1U8PB 2DLIA 3Q5TA 1V3KA 2E7BA 5C0FA 2DD8H 3KPQA 1T3FB 4MVBC 4F33A 3IJSA 2NYYD 4JPVL 1B3JA 2OCFD 4LKXB 1URLA 4PJDF 35C8L 1J0YA 4F80A 4PB0H 4UOJA 1D6VL 4FQLL 4JY4A 3IDYC 4O02L 2V5RA 3EDFA 4EUPG 4M00A 1QYGH 1OAUH 4OZHF 1YC8A 4NQEA 2GSIA 3MRJB 5D7LE 5F71A 5JDSB 1IBGL 1FORH 1OSPH 2PYFB 4JCMA 4Y1AE 4P59H 1JNJA 3R8QA 3FHQA 4NQCD 3TNMB 2LE9A 3TWCH 4M5YL 4L1DA 4P2CG 5FA4A 3OKLA 4H26B 3BXNA 1DDHB 1V8HA 1ZAGA 3ULUH 3BUYA 3SKJL 4G6JH 4QWWC 4XZUB 3PWVB 1D9KA 1J1XH 4F9LC 3VFSB 2BVPA 5CEZE 4NN6C 3FT2A 1WFUA 3B2VL 2A6IA 4Z7OF 4RX4A 1WC7A 5EU6D 3O6LH 2FHFA 4LIQE 4WGWB 4QGYA 5C07B 4JREB 2XFXB 1F13A 5TGBB 3GI9L 2CDEB 1A6VL 3RY4A 1Q94A 4X9GA 1XIWD 5DVLA 1MPAH 5IB4A 4HDIA 2ADJA 1Z9SA 1U8NA 5DEGA 3EFFA 1QEWB 4YJZL 3MRGB 3D0VA 1R3LA 2BXZA 4GRMA 4PJ9B 5IK3B 1DEEB 1UZ6F 1SMOA 3MA9L 4Z78B 3S37L 5T3ZE 4QRRB 2P45B 3P9WB 1H3GA 3TV3H 3BHBA 3U7WL 1B0GA 4KKLD 1Q38A 1RJYB 2VDRL 1G6VK 2Z8SA 2J2ZA 4JKKA 1NEUA 4XBGA 1FL3B 1RD6A 1XF5B 2CRIA 1LDPL 1G1YA 3S36H 2XZAH 3IETA 4YHOL 3ZDYF 2ESVD 4F15C 4HWNA 4JZOA 4D9QD 3FQUB 3O4LE 4FZ8H 1LO4H 4TUJB 5C7XH 1D5XA 1BFVL 2CPCA 1FL5B 4KKAD 4BQCA 3EUUA 4IM8A 1ONQA 2P8LB 3QXAB 1PYWB 1RZIA 1HHGA 1DQML 2G60L 1ZT4B 4X5LA 2BCKA 4V2CB 4OUOA 1G7QB 4UOW0 3CC5A 2ED7A 3VA2C 3KPNA 3SQBA 1DQDL 4NKIL 3UTPE 1ZE3C 2OR7A 4B7IA 3LN5A 1S9XB 3B83A 2R2BA 3IJYB 1A22B 1VDGA 4NQEE 3R8BB 3T0EC 5KG9A 1NMAL 3KLDA 3RWCA 1QFUH 1CG9A 1FYTA 1YEDB 5CUSH 4V2BA 4CU6A 3THML 4HULB 4JPWL 4OD2A 3PP3K 3WXVL 4WW2B 3RDTC 2A77L 2H6PB 2C4XA 4Z7WA 2EZ0C 3RVUD 4HS8H 2WINA 4MLSA 4KTEH 1BEYL 4NQXA 2GY5A 2NY2C 1MJ7L 1J7VR 1N4XH 4MJID 5I8EB 4G6KH 1T1XB 5ACZA 5DVMA 2WZPD 3DI3B 4WGVB 4WUUD 3DX6A 3BZ4A 5D1XC 4OIAA 4P3CH 1QRNA 1UB6B 1K8DB 3MA7B 5DS8B 1QSFD 4G43B 1F42A 1K5NB 4HUNB 4ZO9A 3OAYK 4YGVB 1X5XA 3RVVC 4Q7DA 3BKYL 2VDOH 5DMIL 4OCWH 1FZJB 1XFPA 3G6JA 2HTKC 3D6GA 2FJGB 2OSLA 3T0BA 1LHZA 2FEEL 3QPQD 4XP1H 4IDJH 4OGYL 5CGYC 1KCUH 2EKJA 2YEZB 4RISL 4XCCL 4ZUTA 4Y2DC 3RKDD 5BZDA 1G9MH 3EFDL 4XMLL 4GAYB 3X11B 2K3TA 4FQ1L 3W81A 2P7TB 3P4NB 3QG7H 4G6FD 1F5WA 3F58L 3NIFF 5IFJB 1GJIA 3RVWD 3A67L 3TA3A 5E5UB 4PLNC 1IGFL 3UTTB 4LSRH 1HYSC 4QXUH 2VITA 3TNNB 4ELMF 4UI2A 4TPRH 4WU7B 1J1OH 4MAYA 5C0AB 3IXAA 2DQCL 1FC1A 5B39B 5E6ID 2PO6C 3MLWH 3O2WH 4FQJL 5C6WH 2ICWJ 4K23H 4PJ7B 3C5ZB 5C6TH 5F21B 1CF8L 1QVOB 1W0YT 3KJ6L 4MYWB 3UTSB 1NC4B 3PWNA 4MJ6B 1RFDH 2ARJA 3QWRD 1ZEAH 3DBXA 1NUNB 3PWPA 1P4IL 2FDBP 3O4OB 4MCZB 5DJCA 1CT8B 3OKKA 1I7ZA 4JFPA 1AE6L 2NY1D 2I24N 1FYTE 4I3RL 3NCCB 4H25B 4NN7B 1T0MB 4R90L 4NO3B 3VFRA 3CUPB 3PDDA 1SVCP 1KULA 4Z7WE 2H32H 1T22B 5A2JH 1A1NA 5I0DA 1JNLH 2R23B 2NY3C 3ARGD 1GVIA 3MV8B 1EGJA 3QFDA 3ULUF 3K4DA 3WIHL 4GW1A 1I8KA 7CGTA 3L5XL 3IDMA 4UINH 4JM2D 2BSTB 3F8UB 2GCYB 1QRNE 4QT5B 3DXAA 1MCNA 3JWOC 5T33L 4X99B 3CZFB 4X9FA 5KVDH 4M7ZB 1HHJA 2QJDA 3GHBL 5EBMA 4F9LA 3LKRB 5KZCD 4MXVE 4MD5B 1IGYA 3L5WB 5EDXA 4ZSOB 3SY0B 4PRDA 4ACPA 1KXQE 2GI7A 4NPYA 5IOPB 3G6JE 4PJFB 3TO4B 2DL2A 2H1PH 4LK4A 1MQ8A 1GL4B 3HC3L 3SKOA 2VOTA 3MRNA 5IB1B 2Y06H 5E2UL 5B4MD 3W0WE 3BWAA 4U4BA 5MP6H 3MBXL 4YXLH 1UFUA 3BD5A 2Z31B 1LK3L 3VXQB 1OAZL 1E4WH 2F8VA 3WJLC 1K8IB 5IROC 3TCXA 1BM3L 1JN6B 1JNNL 3WE6B 1I3VA 4KRPC 3RPKA 5TE6L 2EDXA 1F4YL 5DURD 3I50H 4EI5D 1MRCL 1JPGB 4PBXA 4ZMAT 2ENSA 3MOBH 4BUHA 2XA3A 5DQ9A 3N1GC 1E6JH 3AREB 1ZHNA 1XGYL 4UB0H 1M6OA 1UXSA 5JIKA 5BV7H 4PY8J 4IMLA 5LQBH 4YC2C 1HILB 5JW4R 1BD2A 3WNMA 3STZA 4BKLB 5F1IB 3SDAB 1K9TA 3GSOA 1TCMA 3PWPE 3TVMB 4XH2A 4HBQA 4KKNA 5AZEL 4Y4KC 4Y4FD 3VD7A 3A6BH 2DQIH 1CFNA 3UPRB 2VC2L 2DRUA 1PJ9A 3F7YA 3NAAL 4L3CB 1HH6A 3WFEL 4P2OC 4JR9H 2EYTA 3CK0H 4NT6B 3T0WA 1CICD 2O61A 2W0FB 4FXKB 4I2XB 3T0EA 4HPYL 2LV4A 4JGMA 5FO8B 2MCG1 3QULA 5CKAA 2AJSH 1WBZA 2ZNWA 1PEWA 3WFBH 1INQB 4YHLH 2FGWH 3TYFB 2GT9A 5E7FA 1G0DA 4MQSB 3UYOD 5B39G 3RDTA 3QWQB 2ZUQB 3DMMC 2PR4L 4GKSB 4HGMA 5DMYA 3DXAE 2I9TA 4TRPL 3MBED 2W9LA 4OFYD 4G80B 2D3VA 4OJFH 1N6QL 1AH1A 3H8NA 4BQ9A 1JPTH 3KHQA 3ZT5A 3MGAA 3HKFA 3V52H 4BFGA 2XKNA 2UZXB 1G6RL 4HQQL 1MWAL 5D1XA 3N9GH 3GJFB 4X6DF 1EO5A 5ILTL 3EO0A 4ENEC 1L9MA 1I8IB 5ICXA 4CADB 3MRBB 5CLTA 5F7DA 4C4KO 3MCLH 3LRSA 2P8MA 5ABDE 1FE8L 4KDWA 2HLFD 1T5XB 4ZO8A 3EO1A 5I71C 3PQYE 3MUZ1 4XP5H 3MMEA 4LNRA 1MNUH 5CEXB 2EIEA 5HI3C 4L4TB 3K80A 5GRYA 1SJEB 1LD9B 4ONFL 3K1KC 3OAUH 2UYLB 1GYAA 1T1WB 2XTLA 2GEEA 4Y2DA 2DMKA 1JWUA 2OTWA 4LCCC 5IV2B 3WO4C 3VXPB 1AGCA 1FNLA 3H42L 5HHME 4FG6C 4OD3L 4DGYH 4TSAL 3ARSA 1PY4A 3JUYA 3ZKXB 4M6NL 4PP1D 4LBEA 1FG2B 1OLLA 2YK1H 5D2LA 4O5LL 3NPSC 1WBXA 2F54A 3FKUS 4UILL 4XB8A 1TZGL 5I1AA 2QQNH 3D87B 1G1CA 2VLRD 1BD2E 1RZKH 3BZEA 3MODL 3CIQA 2PO6A 5D1QD 1CFBA 1EMTL 2R15A 4BSWA 3H0TB 5A3IC 3QAZB 3VU2A 5GGTL 1B0RA 3GSNA 4G5ZL 5D9SA 3C08L 3KPRA 3ME0A 2MKWA 4KKBD 4YE4L 4ERSH 3DYOA 2XPGB 1QFOA 4KK6D 2LVEA 3QNYB 3TJEH 1SM3L 5EIQA 2VLKB 3QP3A 4NO2A 4YO0B 5ISZA 3T0EE 4J12A 3HB3D 1VFAA 1KYOK 4Z7NE 2CLRA 3GSVA 5C0BB 2HLAB 2EDKA 5CP7A 5FYKL 3HR5A 2IQ9L 1HHHA 4YUEH 3IT8D 2VZ1A 3OJ2C 2Q86A 4LCYA 1KIPA 1ORSB 4FQIH 3GJFK 4FQQB 1CFSB 2EYSA 3NABH 3GBNL 2WAHA 5EORL 4YR6A 3ARQA 1U2CA 3FO0H 2NY5C 3LHPL 1JHLH 2WK2A 4XAKD 3MRMA 1PY9A 2C1OA 2EE2A 3WUZA 4R4NC 4X8JB 4YIQB 2XRAH 2D0FA 3RUGF 4M6AA 1KT2B 4HK3N 2O5XL 1HINH 1ORQB 1GGUA 1UWXK 3MJ7A 4KI5C 2XWTB 4F7MA 5LWYL 3O3AA 4OD1H 4HUUB 1N8ZA 4P4RA 2OK0L 4JPIA 5EB9A 4U3HA 3DUSA 4ORGB 3JV0A 4X98B 2Z8WC 2R8SH 5D5MF 3O0RL 3W82A 4MZ3A 3BH8A 1YPZF 4Z7VF 1S7WB 1XGQA 4HFWB 4J3UA 1MF2H 4M5ZH 3Q2CA 3N1QC 5DD5L 4M93B 3WJLA 1BZ9A 2CR6A 1QR1A 4FP8H 5IROA 1A6TA 3FOLA 4JQIH 3O3DA 3QHZL 5F93C 2F54E 2GTWB 4HH9A 1YNKH 4XCEA 3ZTNH 1SYVA 1T2XA 1MVUB 3QEHB 4QOKB 1TPXC 4JFEB 3O8XC 5DFWH 2HMID 3L3OA 3QI9B 2V5MA 5FV1L 2LVCA 3KPRE 3BOVA 4J3OC 2E6JA 5I9QB 3BMVA 4LLAA 2E9WA 4K3EL 3S34H 3UTOA 2O5ZL 5KSAC 3NA9L 3K46A 4UTBH 1MOEA 4Y4KA 1BVLB 4HGWB 5HI4D 1OP3K 3BKCL 3DV6B 3W2DH 3DSFL 4PRAA 5ISZE 3BN3B 4RBPK 1AO7E 4CDGC 4YPJA 3MRJA 4P2OA 5JDSA 4P5MB 1AQDB 3KLHC 2AV7B 4GBXC 4LASL 2B1HH 3OKMB 3TNMA 3WDIA 5IT2H 1KIUA 3UJIL 2X4SB 4O02H 5H37G 4P57B 3LQZB 1S7QB 5FKAB 2IPUK 5KANI 3GNMH 2EXYC 4X0KB 3PHQA 4YHZL 2HRPL 3UJTH 1RIUH 3C60B 3DMMA 5EUOF 3OF6A 3RAJL 1RU9L 1TDQA 4JFDB 4Y1AD 5H8DA 3FZUD 2HJFA 5GGSB 3CDYA 3UZVB 5DD3L 4ODTL 1VKXA 2NLJA 2QHRH 4UV4L 5L2JB 1WF5A 2XFXA 3MLUL 5JOFB 3SKJH 2CDEA 2VDKL 2R2EA 1UENA 1WWAX 4BQ6A 3ROOA 3B2VH 3PABB 1KEMH 1EEUA 3TN0C 3MLXH 4ONGL 4I0PD 1QEWA 5CEZL 2RQ8A 1J87A 1CGWA 3CCHA 1I4FA 2EEDA 4P5TB 4JZJC 5HGBA 1MJUH 3HS0B 4PV8B 5EZIL 4HG4J 5DFTA 3FO1B 5I1GH 1RJYA 1MCCA 4LCCA 3H2WA 1FL3A 4EEEA 4LVHB 1ZLVH 5GZOC 4U7SA 2IPUG 2P43B 3F7RA 3MJ9L 3MA9H 5B3NA 3FQUA 3WDJA 4AENB 3VWJB 2O93L 5T3ZL 3U7WH 5KW9H 1RZ8A 2DYPD 2X4OA 4N8CL 5TE7L 3TVMC 1UWGH 4KUCF 2FH8A 1PYWA 1G9NC 1LDPH 5HI5D 2XNAA 4YEEA 3FOMA 2X4PA 1G7QA 5DK3A 1IAKB 5C9JB 2VQUA 1TVHB 1ODAA 4LPYA 4JRYE 4ISVB 2F15A 3CFBA 4YHIA 3IJYA 1KG0B 3Q6GH 5IW3A 1HXYA 1X5LA 5IEKB 1JK8A 1YEDA 2HFGL 4L5FL 2H2SC 4JKMA 1DQDH 1EEZB 5ESVB 4NKIH 3SGDH 3H9ZA 4J23A 4GRLD 5IFAL 1BX2B 1V7ML 2FRGP 4NQED 1X5AA 4XP4H 43C9B 1NAML 2C7UA 3LIZL 5CILL 5M95B 2FNBA 2H3NB 3Q0HA 1QACA 3THMH 4ZO6A 12E8L 1U8KB 3GI8L 1H0DB 2DM4A 4G8FB 1D5IL 4U0QB 2A77H 1FFRA 4HWEL 4WFFD 3DTXA 1MELA 1X5KA 4HGKC 1K5NA 1NLDH 3IFPA 1MHCB 5CP3A 4QY8A 4YGVA 4PRHB 2X4NA 4I9WE 1MJ7H 5DF0A 1D9KD 2B7DT 1FZJA 1WLHA 5F9JB 2VR4A 4WWKD 5L7XL 5TE4L 3T1WA 4OAWA 3HMXL 2FJGA 2YKLL 3P4MB 2C3GA 4RX4D 5AG9A 1TZHA 5LKNA 3GIVB 4IOFD 2VXVH 2YEZA 2DKSA 3QNXA 3DGGB 1PG7X 4GAJL 4QHLA 1QHPA 4GAYA 5DMIH 1CFVH 2Y72A 5E8OA 4EXPX 3WIFB 3BO8B 4JZNB 2YHGA 3ZKXC 1OARH 5IFJA 1RJLB 3IRZA 2YD1A 2VMFA 1LE5B 4XCCH 1BFTA 3UTTA 2QLVB 4TQEH 2Z8RA 4XMLH 1JNHA 1KTKE 2Y5EA 5F7KC 4JG0L 1FH5H 5C0AA 3V0WL 2VAJA 3MLVH 3F58H 2FBJH 3TEUA 3HZMB 4EN3D 2IMNA 3QAZC 4R4FH 3N0PB 3H3PL 1IGFH 4MJ6A 4B7LA 1O0VA 1BBDL 1F90H 1DN0B 3O8XA 4MZ2A 5J1AA 5IVZA 3D39B 4BQ8A 2CXGA 3MGTB 1M7DA 4FQJH 2P5WB 5HHPA 1DLFL 4URTB 4NO0B 2E27L 3R4DA 3MV7A 1RI8A 5JOPE 5KSAA 4H25A 2YD9A 1TQCB 1T0MA 2DTSA 4A6YH 1CD8A 1OAXL 3U0PA 3VXMA 1T22A 4XVJH 3B9VA 4GRWE 3QDJA 4GBXA 5JMRA 1ZT1A 5JORB 1UM5L 2A0LD 5HYQB 1FYTD 3GBMH 1EO7A 3AAZB 4ZPTB 1ZVSA 4R90H 3PDOB 4QT5A 3DV4B 2UZYB 4KZDL 3QFJB 2NPLX 1ZVYA 3QUYB 3QXUA 3M8OH 4IOIA 4TULL 4Y2OA 5LG1A 5SWZA 1EXUA 4QRSB 4C58B 1H15A 2PW2B 1DBML 1CD9B 3NCBB 5GRVK 3T0VA 2ADGB 4HWUA 1QRND 4BZ1H 2GSGB 3S8WA 3FB8B 4RFNB 2XIDA 1HHIB 3D2UA 4OCSH 5ANME 2APVA 1NSNL 2XWBB 3TN0A 3S3PA 3RTQB 1KTLB 4JRWA 5TH2B 2CIKA 3ZZ1A 5J89A 1MHEA 4AG4L 2XWJA 4M93C 2L0DA 1FJ1B 4HIHB 2K1MA 3HC3H 4OTXH 4LCUA 5DK0B 3RPIA 4JZJA 4L29B 2P8PB 4O2EA 5GZND 2DI9A 4XWOC 4X7SH 3BJLA 4OLXL 2HVJB 4FHBD 2G75A 4CN6A 5LAXA 1UT9A 3BQUC 4JY5L 3MBXH 3FFDB 2C9AA 2NW2A 3OB0H 1LK3H 3QSKB 4QXTB 4DKDC 2AP2A 4RNRB 3TT3H 1IAMA 3D1MC 4OZ4A 4Y19B 3TA3D 3ZT7A 3PWLA 5TE6H 1BJ1J 4JFFD 1F4AA 1F4YH 1MRCH 2GITB 8FABA 4FQPA 5F1IA 2BC4B 4J6RL 1AHWB 3TVMA 4MAYD 4D0CA 2VDLL 4M62L 4FOMA 32C2B 5IBTL 1ZOXA 2FHCA 4M7JH 1CFTB 4FFYH 2VN7A 3MV7E 4X6CB 1TETH 4NT6A 1IGJA 4B41A 3HUJF 4P2YA 1OGAA 3GMRA 2HFFB 1SBSL 4WHYG 1HEZB 1INDH 4I2XA 3VXME 2D0HA 3PWPD 3SDXB 4NBXB 5FKPB 5AZEH 3QDJE 3VA6A 1QHOA 4Z0XA 2VC2H 3CGTA 1MFEL 1KC5L 1F3DJ 2EIBA 3C60C 3BGAA 4GKSA 2EE6A 2J5LB 2P5ED 4ODVL 4RWHA 2CSPA 4PJ5B 4IS6B 4KGLA 4ZXBD 3GB7A 4X9HA 2WSKA 2F5BL 1BJ1H 2GHWB 2R0LL 5JQ6H 2BVTA 5FGSA 4L8DA 5MEQB 4U1GB 1FVCA 2DMBA 2XOTA 5SWZE 4PS4L 1LP9F 5IMLB 5HVFB 2X44D 2PR4H 1MH5B 1EGJL 3EYSH 1BOGB 2R2HB 3CH8A 3C9NA 3QJFA 3IF1A 1I8IA 3ZDZE 4M03A 3DRTA 5FGBC 4QWWD 2VZUA 4OB5H 3SQOL 1N6QH 2R2CA 3N06B 5IVXA 4ODSL 3HHRB 3JWNC 4ZFZB 5IP4A 2IAMC 5EOCL 4LLWB 1G6RH 1FGVL 4P5TC 1F58H 3S5LB 2DQJH 1SJEA 2IWGA 4NNPH 3NA4A 5HYJB 2X5PA 1ZLUH 4FQHA 1FO0H 1OB1A 1L7TL 4HH8A 3VW3L 4WHDA 1QSEE 5E6ZA 1HSAA 1HN1A 1ZA3A 3BEWB 1VFUA 1IGML 5CMAB 3KG5A 1FG2A 2NY6C 1KCSH 2GAZB 4JDTH 2A83B 4UT6H 3ZDXF 1G7LB 1Q9WB 2IBZY 1FDLH 4ZOBA 5L6YL 4X80H 3MRHA 4GMTL 5A2LH 4WUKL 5AD0B 1ZGLA 3DX8A 3BW9A 4HJ0C 3RL1A 4OD3H 1EHNA 4TSAH 3GMPB 1UM6L 3GMNB 3IDNB 1NGWB 2ZOKB 3RZCB 3RNQA 2PXYC 3KNBA 3E3QC 2Y36L 1C8PA 1RULH 4JGJA 4XNMB 1CDUA 2IPTH 5TFSH 1CGYA 1TZGH 2IBGA 1OGAE 1I1AB 3VXTA 1BD2D 1MJJB 1V3LA 4XP9H 4TSBL 4OCNC 1XR8B 4I2XE 2XA8H 4OQTH 5IIEB 4MNQB 5CINH 4U7MA 5C0BA 5CGMA 4M1GH 2X9YA 3QZWB 3E1F1 5IF0B 4OCXL 3W9DB 3L1OL 3NIGE 1A7QL 4XPFL 4H8WC 4QRPA 5SWSA 3I6LE 3MUY1 4TVSa 1TITA 7FABH 4MQ7A 2V2TA 5DJZB 1F4WH 4FQQA 4U1HB 3WNKA 3T0ED 2NX5B 2J6EA 3UTQA 1ZT7B 4K71B 3QUXB 3CU1A 2YN5A 4FXGB 1XR9B 1VHPA 5FYKH 1MCPH 4WCYH 5B8CC 1SEBB 3WHE1 1TVBB 1RK1A 3RDTD 1GPOH 2NY4D 2EZ0D 2UVFA 1S7XB 5D5MB 1FC2D 4NDMA 4V1DE 4P46C 1RZGA 1CGXA 2I07A 1X3DA 3EOYG 4AH2B 2VL5B 3U82B 5IVXE 1AIFB 4XXCC 3FCTB 1U8IB 4MXWL 3QRFM 5D1XD 1N5YH 5J13B 2BMKB 3AB0C 3FMGL 2O5XH 4Z7UE 2WLYA 4YK4B 3RVVD 4LLUB 4HFWA 3MRPB 3MNZB 1LEGB 5LWYH 2R9HC 4WI6A 2OK0H 2ZUWA 3H7BB 3TO2A 3EYVB 4PRBA 5IQ7L 5J7CC 1XF1A 5LXGH 5E9DB 2CO7B 3O0RH 5CGYD 4KK9C 2FSEA 3DUHA 4Z95H 4PJDA 1UEYA 3KR3L 2E5EA 1A9EB 3PXJA 4F7CB 4C83A 2Q8AL 3BQUA 3QEHA 4TUKL 2UY7A 1G7IB 5DD5H 2EIZA 4WY7H 4OZHA 3TT1L 4DVRH 5EU5B 3QUKB 4LQFL 5K9JH 3FQRB 3QHZH 3S5LG 3OBAA 1E4KC 2IFGA 4G8GB 3KYOB 2AXFB 3ULUC 2F54D 5FYLE 2FATH 4NP4L 2UVEA 2PN5A 3H9SA 4FQXC 3NZ8A 2PO6D 3SHSA 3DV6A 1FIEA 1LGVA 4PTTB 3TFKC 5KVEH 5C0BE 2AV7A 5EUOB 1D5BA 2E8ZA 2KZ1B 3BPNC 2GTZA 3KPRD 4OZFA 3S3SA 3TZVB 4PJXA 4QRPE 3OKMA 2J12B 3GSNL 5T3XH 5SWSE 3HI5L 1OPGH 5IMMB 1XCTB 3CVHH 5FKAA 1REIA 1EK3A 2EH7L 3BKCH 4PREA 3GKZA 2FIRT 4MNGB 3BKMH 3C60A 4F3FB 1SY6A 1FNHA 2GY7B 5D4QA 3IXTB 4ODWA 3HZYA 1KPUB 1P84K 4MJ5B 3UJIH 2QV2A 5IW1A 5L2JA 1ZTXL 5JA9A 1G7JB 2IG2H 1IQWH 2NY3D 2HRPH 4MAUH 2WBJC 2HG5B 5IW6A 1QO3B 4RFNC 3CJJA 4DW2L 2D0GA 1E4JA 1RUKH 3RL2B 4NNYB 2AV1B 2XG4A 3KXFD 3RAJH 2RCSL 5HHOB 3PABA 5IHBA 2GYSA 3QZWG 3WEXA 5FGBA 4NBYB 1QLRA 3EYQC 5DD3H 4DKEH 3GJEB 4N9GA 4UV4H 1X6NA 2D31A 2VH5L 3IDUA 3PG2A 2G9HB 3MLUH 4HSQA 5IQ9A 2HH0L 2IAMA 1UACL 4M48L 1H8SA 2HVKA 1FIGL 2IGFL 3HNTL 4P5TA 5C8JB 4WVRA 1IL1A 1BLNA 4LVNC 3G08B 1KB5A 3FO1A 2LABA 4QF1A 4N0UB 2ED9A 4N0CD 5E2WL 3VI4F 2A9ML 2D2OA 4I3GA 2BVYA 3VXUB 5EOTA 4P23D 1C7SA 4PJDE 5HGDA 15C8L 1AGEB 3VXSA 4RWYL 2BNUB 4UTAH 2IH3B 4W6WB 2DS4A 5KVFL 4PJBF 4PJGF 4PR5B 3FB7B 1TFHA 1XGUB 5EZIH 3VWKB 4NFBA 4OZHE 4MHHG 4JFXA 4RAHA 3V4VL 3HFMH 3C6LC 3K8KA 4HX1A 4LHUA 3IDIB 1AXTL 2VN4A 4KRPD 1LEIA 2AGJH 4W81A 1FZKB 5AWNH 3ULVE 3P73B 3NFNA 2ERJB 4QRTB 2PXYA 3H9SE 3IU3B 4ISVA 2V5SA 3NFSH 1KG0A 1Z9OA 4N8CH 1FL6B 3MNVB 4XP6L 4GOSA 5ICYB 4LPTA 5DO2D 4Z7OE 1N59A 4PJXE 3NH7L 4C55A 2VLJA 5EFIA 3OKYA 1AC0A 2X1WL 1EEZA 3SDDB 4LAQL 3T4AA 1CDIA 3PGCB 4RMSA 1P1ZB 5IMKB 1AY1H 4XX1G 3P4OB 5ITBL 4Y4HB 4YXKH 1OSZA 3JSSA 3D18B 3NGBB 2HFGH 1JRHI 1U8KA 5ALCL 2BOCB 1H0DA 2R1YB 3PJSB 5ESQA 1G9MC 1GGIL 2KZWA 5FHBH 4PYGA 3AU1B 2Q20A 5IFAH 3KPLB 1UJTA 1V7NL 1TCRB 5B8CA 1UZ6E 4L4VA 3QEQB 3FB5A 3MGOB 5DT1H 2VXSH 3ARDB 3MV11 4EJ1C 1A1MA 4YHNB 2DTML 1GIGL 1JWSB 1NAMH 3DMMD 2AERT 3K1DA 3PIQB 1WQVT 1BGXL 1EBAA 5EBGA 5GIRB 5J9PA 12E8H 5CIPH 4P46A 1CXFA 3P4MA 2A1WL 1UKSA 4M3JA 4EI6B 5C07D 4XXCA 1HKLH 3ZDYE 4ELMA 4XC1L 1KIRB 2AXHA 1DBKL 4ENED 4H5SB 4JZNA 3HMXH 2KH2B 2EDHA 4MA8L 4GLRH 5FM5O 5GRWA 3RJQB 4FFVC 2XKUA 1CE6B 3G6AA 4OLWH 3VXSE 4D9LL 5ELIA 4GAJH 4PJ9D 4X4ZA 3JTTB 4MA3B 4Z5RA 1BPVA 3CFEB 3BKJL 1E27A 1NFIA 5DGRA 2Y23A 5GPRA 5HI3D 2WIIA 3CFJB 2YPVL 5MERB 4MXQC 1ZWIB 3RZCC 1C5CH 4LARL 3QCUL 3DX7B 1NBYB 4FG6D 2Y7QA 1WV7T 1DN0A 3PWUB 1MIML 1WEJL 3E3QE 1F4HA 1EJOH 1I1AC 3D39A 3MGTA 4J3XA 4LPCA 4N1CA 4Q6IB 5I66A 1G7MA 1YEJL 1E4KA 4U1SB 2PTTB 1VSCA 3QB7C 2CGRH 4HFUL 4X7FC 4ZUUB 4YAQB 3GMQB 3PGDB 4FQXA 4PJ8B 5BVJB 4AEHH 5JW5B 1BBDH 2VLJE 2K9UA 1NDMB 2MFNA 2XZQH 5A3ID 1KJ2H 5IB3B 4BSVB 1QA9A 3D25B 4S1SL 2Y07H 5IVOA 2K7QA 1DLFH 3I3EA 2E27H 1OCWH 4KPHH 1LO5A 5ALBL 5IHZA 1I8MA 4NRXB 5JW4M 1KSRA 1MAKA 1QP1A 2Q8BL 4NIKB 2AQ1A 3QHFH 1OAXH 4M9OA 3DV4A 2F19H 1FNEB 2XTJC 1UQSA 3BYYA 2W1NA 4RFEB 3BRFA 1P2CB 5EUKB 1WZLA 1I7TB 1S7UB 4L4VE 5JPNB 5EU6B 3KJ4B 1I7UB 3O6KL 3LSOA 5I17B 3FO2A 1RUQH 5HDLA 1EZVY 1WK0A 3GSUB 5D6CA 4P3WA 1T80A 4MX7B 4RGMB 2C26A 3BP6B 2ADGA 3K4AA 5GISH 3NIFE 3SE8L 5E0QA 4KZDH 5E5MA 2WBJA 1XIWB 1MCEA 1ZHLA 2BERA 3SE3C 3B6SB 4ELME 1CXEA 3L3HB 3MLTB 3EYUH 1J8HA 5BV7C 4KRNA 4DZBA 2WW8A 1CBVL 4TOYL 1DBMH 4NUJA 3FHAA 2VTFA 1VPOL 5DK0A 5D1ZB 4KI5D 2ITCB 3C8HA 2NW3A 4L29A 1I3GH 3CSPA 1NSNH 4WFHE 3MV01 3X3FH 4DZ8A 3HZVA 5I1LB 4WIQA 4GO6B 1NBQA 2ESVB 1A2YB 4H88L 4AG4H 3OX8A 2YPLE 4C56B 1YEKL 4QXTA 1EHXA 3ZLQC 5KS9F 5I75B 2LAAA 1AQKL 5FECA 1QRKA 3HUJB 4GW5B 3UTTD 1NUGA 2MPAL 1MEXL 4K07A 4OLXH 1MI5B 1KPVB 1Q9LB 5CFHA 3C6LA 2EDYA 4KJPC 4PRNB 3VD3A 5C0AD 5GGQL 4Y0GA 5HGAB 3ULUE 3C5ZD 2FJHB 1YECL 1BQHA 1CD0A 3UTSD 1NC4D 2AJVH 5HGGS 2FEDC 5LGKA 2HFFA 2Q7NA 3TZVC 3V95A 5KSVA 3O8XD 1W72H 2OXHA 2VDLH 1E0OB 4M62H 5J4MA 1Y6MR 2ZCLL 5IBTH 5GSVB 2D7TL 5BS0A 3HE7C 5I19H 4X6DA 2H9GB 1OWWA 1LVEA 1CFQB 1YNLH 1U8OB 3EO9H 4PJ5A 5MENE 4CU7A 1LK2A 2YA1A 3QDJD 3KLHD 3DNKA 4GBXD 5FEBA 1S7SB 3MZTA 1U8HB 1MFEH 3MV8D 1AGFB 3WFCH 3MRCA 5DRNA 5LBSL 1JFQL 2R2HA 2BXYA 5F9OH 2P1YA 3I6KB 2P42B 3U83A 2EE3A 3VGHA 1SYSA 1UB5B 1EHAA 4KZEL 4Z76A 4KHTL 3SKNA 3EOTL 3U7YL 4S2SA 5CBEA 1XCQB 2L7JA 1OQXA 2F5BH 4GJTB 4X9BA 4ZFZA 4LLWA 4HKZA 1J8HE 3OG4B 4GG6A 3S5LA 5I30L 1JHKH 2GKIA 2VXTH 3DARA 1WCBB 3MACH 1AR1C 1T0NB 1S5HB 1RZKC 1KEGL 1EAPB 1C5DA 3O2DH 4UBDC 1KB9J 4OUUB 4LSUL 4KKCC 3D2UD 1OT1A 4LDOB 4ODSH 4WV1B 1S9VB 1X4YA 4KDTC 5EOCH 5KSUA 3A0OA 3IAQA 4HWBH 5KVMC 1JRHL 4R7DA 4WEMB 3VDBA 1NJ9A 2JTDA 2GAZA 1G7LA 1ZHBB 1XGPB 2Z31D 3VWKC 3W11C 4Q58C 4PBVC 2H8PB 3G5VB 1VB9A 5EN2A 3MCKA 3O6FC 3B9DA 1GGBH 5E6IB 3RWGB 3IU4L 3C5JA 5IB5A 3GMPA 3IDNA 1IGMH 3QDHA 3RZCA 1LWRA 2GJ6B 5LGHL 2ERJC 1UCBH 3MRRB 4EQ3A 4G3YL 5F7HA 2H32A 4HUKB 5GZOD 5DJ8B 4GMTH 4WUKH 2YSSB 1T7YA 1I1AA 3WIIL 1DQJB 1MJJA 3MV9A 3SDAD 4P2QA 3TVMD 2QADC 3QZWA 5BS0E 1FV1B 1A47A 2WBWB 1G9NL 2B4CL 2NZ9C 3FQNB 4G9DA 4Y4HC 1N7ML 3F5WA 4N0YL 4UIMB 5L9DL 1NL0L 4HK0A 4X6DE 1VFBB 4KU1A 4BFIA 4MCYB 3RUGA 1OGAD 4PUBH 4UNUA 1I1FB 1EBPA 3ARGB 5FGCB 2Q6WB 5DJZA 3SGEH 5JDJA 5I1CL 3TCLB 5MEPB 3BPLC 3X3GL 4FXGA 4JM2B 2YPKA 4KROB 4LF3A 4CNIA 4OCXH 3L1OH 2A6JA 2VL4A 2LU4A 1ETZB 1YN7A 5D5MA 3HAEH 1S7XA 3I6LD 4ONHB 3AGVA 1OAYL 3OKOB 3HPLB 4WHCA 5HD8C 1YPZA 5C92A 4Z7VA 5D96B 3GKWL 1RURH 1RVFL 5BO1L 5C09B 4XXDA 5INCB 1S7TB 2JK5B 2Z93B 3L3DB 1MIEH 3BP7A 2IH1B 2X9XA 4GG6E 2D7NA 2AEIT 4O9HL 5C71A 2QKIB 3IFOA 3SE3A 4NC0B 1WICA 3P40A 3O41A 2VDNL 4K2UL 1RZ7H 4YZFF 5E1HB 4PJCF 4HUVA 3MNZA 2VXQL 4U1LA 3RWFB 4RIRB 3LKSA 4NKDB 4PJAF 5DD6B 3MREB 1Q9OA 1D6EA 3H7BA 4KAQH 1CLOL 4RCAA 1I9IH 4I4WB 5E2TH 5FA3B 4NHCL 5H94B 4NCDA 5EO1B 1YYML 3U0WH 2OZ4L 4F7CA 5T1KA 1BFOB 2COQA 3UAJD 5GS2D 1CXLA 5DVKA 5ETUB 4KUZH 4UDTA 5DD0H 3OAZK 2ZUVA 4YNYB 2MKLC 2CQVA 3PXHA 3VFPB 1YDPA 4D3CL 1TTUA 1DFBH 1H3VA 4BSJA 1NCAH 5IMOB 1GHFL 1K4CB 3O3BB 4Y4FB 2BJMH 3CXDL 2XI9A 3MV9E 4NGHH 2GUOB 4R0LC 3ALXA 4TUKH 4EOWH 4P2QE 1MCHA 1JGEB 3TT1H 2W9DL 4RMWA 1K4DA 5EUOA 3ECBA 1Z5LB 2Z4QB 5GRJL 5IBLC 3TZVA 1R3KA 1XF2A 1LNUA 4UQ2B 3RUGE 5DA4A 2HFTA 3QH3B 5FYLL 3CFDA 2YBRB 3X12A 4DAGL 3HE7A 1BJMA 4PRPA 1L7IL 4HKJB 4ZTPH 3WMSA 4OM1L 1JYVA 5C0BD 3LDBC 2R0ZH 4X5XB 4RRPG 2X4QB 3K0WA 2PCPA 2H26A 3KJ4C 3IXTA 3RRQA 3T77B 3MBEB 3L3KB 3L95B 2XTJE 5FUOL 4QRPD 1QNZL 3HI5H 4RDQF 1MWAB 3KPMB 2FGZA 1YPZE 4Z7VE 3NACL 3WKNA 1HDMB 5K9KA 4RGNB 1E28A 3LZFL 5IBUG 2G2RB 3A6OA 3TLRA 4NYLB 2J6EL 3U6RA 2W65A 5IKCB 5IM7A 3V6ZA 1FSKC 3S4SA 5CCKL 4X4XB 4QRUB 1IVLA 3CVIH 1R24A 1A6AA 2AW2A 2BSED 3WCYA 2EO1A 4XPAL 1U92A 5I6XB 1JGVH 1TTFA 2WMPA 1K3ZA 3V6FA 4G42B 3ZO0A 3BGMA 1MQKL 4PJBB 5C2UB 2M8XA 4XNUH 4AL8L 1A7NL 5F3BB 2X70A 5DHYA 1KTDA 1MCSA 4C57C 1JL8A 1Q0YH 5T5FH 3V0AC 5DYOA 3HC0B 3PGFH 2VXUL 5F6HI 4LCIH 1P7HL 4RAUA 1AGEA 2VH5H 1A3LL 3LEXB 2MJWA 4KDTA 2H2PC 1OP9A 1X4XA 3L3IB 5JW4Q 4XTRD 3FB7A 3HC4L 1RUML 5GRUL 5FDYA 1OD9A 3VWKA 5ADPL 2O5YH 5FO7B 2VLRB 1CDBA 3O6FA 5C0CB 5L88L 3IDIA 1C16B 1F11B 15C8H 3U4BL 5HYSB 3DVNB 2F5AL 3M1BA 2ICEB 5D2NB 3P73A 3PHOA 4N68A 1DANU 4S1RL 1NBVL 1R5WB 4DKFL 3BQUD 4JFED 1L0QA 4XVUC 4O2FB 2Q76A 5E8NB 3NCFB 4YGAB 5HDOA 1B90A 3MNVA 4GQ9L 3QI9D 5LGJB 5MI0B 5BMFL 2WNGA 4IJ3C 1RIHL 4WTZG 3ALWA 5EUOE 1JTPA 1ND0B 4LDLB 4HLZH 1JF1B 4YLQT 1W0WB 3ULVL 3PGCA 4F37F 5DUMH 4GKNB 1T1YA 4PRPE 4Y4HA 1IGCL 1MCWM 2UZIH 2V7HB 5D8JL 3O3EB 4XP6H 5C0IB 4GQPH 1ZLUK 4DEPB 5EA0L 2OTUA 4NSKA 4Y5XB 3NH7H 3ILPB 4YX2L 1AXSA 3IFLL 4P3DB 3ZTJH 5KN5B 3AS2A 2OQJB 1H5BB 4H0IA 1NKOA 5ITBH 4L3EB 1ZSDB 3V8CA 1FYHB 1JWSA 3C60D 3TBWB 5C86A 3FJTA 5I1EL 5ALCH 4Z7NF 3OJDB 3WLWD 4OZIF 3GSWB 4NWTL 2NNAA 4L9LB 3EOBB 1JHTA 1A21A 1V7NH 3L7EB 5EZJB 2E7MA 1I85C 2QQLL 1NCDL 1KIRA 4PIRF 2AJXH 4ZUVB 3WNNA 5IUSA 4WV1C 1ZK9A 4H5SA 5FYJH 5FCUL 5F8QC 3MTRA 5FB8B 4DVBB 2YC1B 1J0KA 3J8F7 4X7TB 4ZPVB 4NWUL 3HNSL 4U05A 5DK2B 3JTTA 4MA3A 5ADOL 1T89C 3TBVA 2IAMD 3QG6B 1PW3A 3ORJA 4P5TD 5CBAB 4TNVF 4OZGF 4LQ1A 5B38G 3I6GA 3B5TA 1U91A 1KB5L 3DX7A 1NBYA 2W0KA 2CDGB 1EFQA 4D9LH 3VXSD 1KJVB 5KSBE 1IRAY 4FFZH 1T7WA 1JZ4A 3PWUA 1KN4H 3BKJH 5TDNB 5I1JL 2YPVH 1UH4A 2DWEB 2BVOB 4XC3L 3VD9A 1M1SA 4U1SA 1CGVA 3QCUH 4K3DL 4LHUD 4HJ0D 4YHYC 2WP3O 1CR9H 4ORZC 1HH9A 3IVKB 4ZUUA 1ACYL 1YEEL 4R0LA 4U1MB 5JW5A 2W92A 4PG9B 43CAA 4U6VH 2OL3L 1L9NA 3VFMA 1WEJH 2PXYD 4UV7L 2G5BB 1MCFA 2X40A 3UTZA 3W9EB 4BSVA 3SKMB 1IT9H 3BRGC 4E5XA 4OCYL 4Z0BH 4NQTA 3E8UH 1FNGA 4KJWC 3GSXA 4HW6A 2VLJD 5D7LB 1I1YA 5HYSG 1H3PL 1WFOA 4NNXA 1P2CA 3V7AG 1ZV5A 4WFEE 4DGVH 2PYEA 1KBGL 2VR5A 5JPNA 2BSSB 1NMBH 1HHKA 3GMMB 3FQXB 4D9RE 2HAZA 4WJ5B 1JPFB 2Q87A 4U1IA 1IEAB 4ZUWA 4JO1L 1OTUC 4NQSB 5TPWH 5FUZH 5D7IF 1HKFA 2HA1A 1WAAF 4JLRB 3B6SA 5J1SC 1NAKL 2HKFL 1WISA 5DQDL 5I74B 3HPJB 1RZJH 1F6AB 1N64L 3O6KH 3L6FA 5C0ND 2YOCA 4K7FB 4HAGA 1IM3B 3TBSB 1GC1H 4R2GC 1T21B 5DFVC 3SE8H 2EECA 3H7LA 1MAJA 2PW1A 4NRYA 3T65A 3S88L 4LLQB 3PWJB 3VGGA 3D69B 4JE4B 1J0JA 2GQHA 3TH2T 1MLCA 5I1LA 5M7QA 1CBVH 1NGQH 1A2YA 1I9JL 3GO1L 1CLYL 2ILLA 4W6YB 4C56A 4WI2A 2QSQA 1BBJA 3JBG7 2R9HD 4ELKB 2CR3A 3HUJA 5JHLH 3S36X 5IGXH 2DD8L 5HPMA 3GRWL 1IKNC 3WFDH 1IAIM 4XCNB 3JTSB 4HKXB 5I1DB 4PB0L 2F58H 4F57L 4H88H 3RX7A 1DP0A 5FOBB 4K3JL 1NDGB 3T1FB 1INEL 3O4LB 1YZZA 4DJMA 1G0XA 3WHXB 1AXIB 3QEUA 5F1NB 3QQ3B 4Y89A 4Y16C 1OAUL 2WWMC 5C0FB 3KPQB 2MPAH 4F33B 1HOCA 3IJSB 4APQB 5DTFA 4CMHB 1FORL 1OSPL 1LO3H 3D39D 4NBZB 5FM8A 5GGQH 3RVTC 4P59L 4FMKA 2EDNA 3H9HB 3TWCL 5D93C 2B39A 1T1ZA 1LP9A 4JY4B 4NO0D 4OF6A 3HI1B 5C1MB 1JPSL 3LD8C 3ULUL 3FONA 4FQXD 1CFQA 1UZ8A 4G6JL 1NAMB 4NQEB 2GSIB 2OJZH 4M8QA 1WZMA 3TFKD 1J1XL 3WYRA 5KAQG 2PYEE 1YY9D 4ZFGH 2ZCLH 2D7TH 1S7SA 4S0SD 5FA4B 3OKLB 4RGNC 1OP5H 4OCLC 4MB4A 1AGFA 3ARYA 1Y0LA 4NZUL 4KI1A 2AEPL 4CJ0A 3BUYB 3MX0A 2PTUA 4ODUA 3TP4A 4PJIA 1CGTA 3BPOC 2FO1A 1D9KB 1CDHA 3BDBA 2NXZB 3QFJD 5AAMA 1JYWA 1MPAL 2BVPB 1JZ2A 3FT2B 1XEDA 5GGUA 3DGCR 1WC7B 5C0EA 3EYFB 4E41A 4HZLA 5DRWA 1KXVC 3VRLE 3R0NA 4OT1H 4U6HB 1EH9A 1BWMA 3ARXA 5BRZA 1S5HA 5IEHA 3EGSA 4JB9L 1I85A 4KHTH 1Q94B 3EOTH 2WBJD 5IB4B 4OUUA 4HDIB 2ADJB 1TJGH 1U8NB 1JGDA 4WV1A 5DEGB 1S9VA 1W8NA 4K8RD 1J8HD 4HUWA 3RTQD 1TXKA 1R3LB 3S36L 5I30H 2XZAL 5C0DA 2DQHH 4XT1C 4KK5C 1ES0A 4C56E 3F6IA 1T89A 2NXYC 5E8EB 1LO4L 4C54A 4XBPA 3BHBB 1T2JA 3HUJE 1B0GB 3MJ6A 3OZ9L 3OB8A 2DLEA 1OY3B 3VGAC 4XBGB 3GSQA 3L3GA 4RRPA 4A6YA 4LHQB 3BAEH 4PP2A 1FN4A 3MRRA 5FCSH 2YWYA 4JZOB 5DJ8A 3DHMA 1MAMH 3ROLA 3JV6A 3VFOA 5BOZG 1U8LA 1D5XB 2YSSA 4Y19D 1VACA 5MI0C 3BN9D 4WI3A 3ESUF 5I76A 1OW0C 4LFHG 3LVEA 1RZIB 5E2VH 1HHGB 1QFUL 3C6LD 4JHZA 2BCKB 4BK4A 1JI1A 5DMJB 1LP9E 4IRJC 1KYOJ 4UIMA 3QUMH 2R0KL 1RSFA 4MCYA 1MCKA 1I1FA 2CKBL 4KTEL 5KG9B 2C1PA 3RWCB 3P0YH 4E0RA 1O5DT 2AK4B 1CG9B 1FYTB 4G6KL 5MEPA 2APFA 1QFWL 3ZHLA 4OD2B 2NZIA 5BS0D 1H5BC 2B4CH 1N7MH 2ZG3A 5L9DH 1NL0H 2DLTA 4M7LL 3V2AR 4ONHA 2WINB 1JGLH 4PJIE 2VDOL 4PJ5D 4MDIB 4JO4H 4OCWL 3BZFA 5DLML 5ACZB 1EAJA 1Z0MA 2JF1A 3P11H 5C09A 5HDBF 3ES6A 1QZ1A 4WDIA 3DX6B 3L3DA 3BZ4B 1QRNB 4E41E 3G9AB 4YHMH 4XP1L 3T04D 4IDJL 5DVOA 3ZDXE 2QKIA 1G9ML 1OAYH 5BRZE 2HJLA 3WXWH 3HG1A 1RVFH 5BO1H 3RWFA 4RIRA 1XF4A 5DD6A 3EDDA 3QG7L 2YUWA 3HCVA 2P49B 1M71A 1ACZA 5FA3A 3K8MA 1R3JA 4O9HH 4ZUTB 4LSRL 5BZDB 4TPRL 4CVUA 2VDNH 1FNFA 3FQTB 1J1OL 4PG2C 3DECA 3BZDA 3W0WB 1F00I 2QQQA 4X7EC 3O2WL 5JPMA 3AROA 5JIIA 3P77A 3X13B 1QLEL 3TA3B 4YNYA 1RFDL 1UH2A 4FFVD 2VITB 4OM0H 1ZEAL 1YYMH 3QUZA 5I2IB 4MAYB 1A6UH 1IKNA 3IXAB 2OZ4H 3SE9L 3VGDA 2GUOA 2X42A 4MXQD 3RZCD 3LKQA 1JGEA 4P2RA 3PWNB 1Y6KR 2ARJB 4WNQB 4DQOL 3DBXB 4Y16A 4D3CH 3PWPB 4Y88A 5E24E 2CRMA 4UQ2A 3T09A 1I1AD 5DJCB 1QQDA 3CXDH 3OKKB 4GW4A 3MV9D 1I7ZB 2YBRA 4LSTL 4P2QD 4JHAH 1JZ6A 4OBRA 4F7PA 4HKJA 2W9DH 3IDYB 1BHGA 4UINL 2X4QA 3HMWH 3P0GB 3VFRB 5KTEH 3L3KA 1A1NB 5B3JF 4ZUSB 5SV4A 1SJXA 4PGCB 3K7UA 1G6RA 1R0AH 2GK2A 4UQ3B 1FGNH 3QFDB 4DAGH 1HDMA 4GW1B 1FO0A 3KPSB 1L7IH 5B38A 2LFGA 2G2RA 3HZKB 2HP4A 2H1PL 3DXAB 5ENWA 1WIPA 5HY9B 5FUOH 2XTJD 3SBWC 1BQSA 1HHJB 2R56L 2Y06L 5GJTL 4PJEF 4NN6B 3LKNA 1KLFA 1IGYB 1WFNA 4HUMB 5F7LB 3HG1E 4PRDB 4G42A 4NPYB 2CRZA 5MP6L 2XG5A 3LZFH 3QXWA 4PJGA 1LO2L 4PJBA 4RFOH 4YXLL 5DGQA 4ONOA 3V5HA 3ISWA 4XVSH 5FO9A 2RB8A 4GG8A 3RP1A 3MRNB 5TQ2L 3I50L 2IC2A 3QDMA 5LJYH 1YEGH 1AR2A 3HRPA 1I7RA 3MOBL 3PQYB 3LEXA 4OKVB 4E42B 1E6JL 4F8TA 3L3IA 4ZG1A 4HJJH 4UB0L 3UX9B 5DJAA 4AL8H 1FFNA 1N26A 2FYYB 1M7IA 4Z9KB 1A5FH 4RAVA 5BV7L 6FABH 5LQBL 1MFCL 4U7KA 5HHMB 4YBQD 5FO7A 4O4YL 4XCYA 5E9DD 5C0CA 4PPTA 2VXUH 4OQTA 5IB2A 5CEYA 4O58H 3OHXA 1ZHNB 4JVWA 4X7CC 3HC4H 2YZ1A 1UXSB 3MO1B 1U95A 2A74A 4IMLB 5KANG 4APQC 4JR9L 4O2FA 2CJUH 2X4UB 4CMHC 3CK0L 4P2RE 5HYIA 4PFEA 5F7EH 3STZB 3U4BH 4I0KA 3BIKA 3GSOB 3QIWC 1OW0A 2F5AH 4XH2B 3GSRA 4GMSH 2AJSL 3WFBL 2VSDA 1CFNB 1NBVH 1E4XI 1W0WA 4KJPD 2FGWL 2VUYA 3F7YB 4H20L 3RVXC 4DKFH 4YHLL 1FFPA 1AD0A 1J05A 3T2PA 4EVNB 1RHHA 4IRJA 5CD3A 2O61B 3RQ3A 5C0IA 5BMFH 2DQGL 3VFTA 3T0EB 4LLDB 3TZVD 3TBYB 2EDDA 3QULB 3ILPA 3X14A 1WBZB 1X5JA 1JPTL 1KF9B 3TESA 5DUPH 3ULVH 2GT9B 3V52L 3N9GL 1H5BA 2NXZC 1JTOA 4YEFA 1TZIA 1IEBA 2DQDH 1T20B 2VZTA 3IYLW 4MSWB 3MLRH 25C8L 4JVPA 1I3RB 2NY2B 4YX2H 3OJDA 3GSWA 1FHGA 1ITCA 1H3TA 1EO8L 1FZMA 4XP5L 4LSPH 5EU4B 4JY6A 1MNUL 1GZQA 2XKNB 5D1XB 1BAFL 4X5WA 3MZGB 1CL7H 4PJGE 3EO0B 3AXLA 3OAUL 5KOMC 1F8TH 3B3IA 3FT4A 1BF2A 5F7DB 4BA8A 4LLVA 5HHOD 4P49A 4XHQA 5I1EH 2P8MB 3QQ4A 1YEHH 3ZKMC 4NWTH 4DGYL 4ZYKA 1JP5A 3QDME 4YPGB 2Q7YA 4ZPVA 5IR1A 3MMEB 4BUGA 3SGDI 3PL6B 2B2XH 2APTA 1IAOA 1KLGA 3JWDH 3ULSA 4DFIA 4KV5F 4MNHA 3DWTA 4WO4C 3D9AH 1T4KB 1N0XH 2GIYA 1DCLA 2YK1L 1YUHA 4Y2DB 5A43C 1TNMA 1JWUB 2OTWB 1AR1D 4PG2A 3HNVH 4F37K 4KUCD 2B0SH 2I9LA 1NFDF 1RZKL 4UBDD 5J6HA 2CDGA 3K3QA 5GS1B 4KKCD 1CCZA 1SJHB 4J3TA 1FVEA 5ADOH 4OIIL 4LBEB 1UYWH 3KHOA 2UUDH 3V7AE 3E6FA 4J3WA 4MQXD 4U1JB 4UZGA 1WWWX 5TDNA 3BJ91 3D85B 2BVQA 1BOYA 1A4JA 3TJHC 4Z7UF 3VWKD 3FRUB 5JZ7C 1VFMA 1WBXB 2BVOA 2F54B 3CVHA 4LEXL 5F1OB 1WT5C 5I1AB 3QIBC 4K55A 3TJEL 1B2WH 1JCKA 2VLME 4IRZL 3BZEB 3BP4A 2PO6B 1I1RA 2HT4C 3VXRA 5FYKE 3MOQA 1OAKH 3IGAB 4BSWB 5I8KH 1MLBA 3GSNB 5D9SB 3KPRB 3CFKA 4YUEL 4YHKL 4XC3H 3T3ME 2CXKA 4PRIA 4QHNB 2VIRA 4NO2B 1PX4A 5ISZB 2DQEL 1VFAB 1AO7B 3MRKA 4HBCH 1CVSC 2CLRB 5D7LA 2OL3H 3FO0L 4UV7H 5CP7B 3HR5B 1LMKA 1MCOH 2NTSP 2Q3ZA 1HHHB 2IQAA 4LCYB 5F70A 1KIPB 3O9WC 2FWOA 4Y4HD 2XRAL 1SHMA 2FIKA 5F1KC 1JGUH 4MLIA 1HINL 2EYSB 4YR6B 2X9WA 5FK9A 5GHWH 4QEGA 4TNVK 3IDXH 4OD1L 1DQLH 4NZJA 3ARRA 4JLRA 2F53A 4IIQC 5GGSY 3MRMB 1IKFH 2C1OB 3UBXA 4LOUC 3DX9B 3HPJA 2R8SL 1AGDA 1V05A 1F6AA 1Q0XH 3MRIA 3SBWA 4D9RD 2V5TA 1DLHA 4Q74A 4U6TA 1DBBH 4JO1H 5HD8D 4F7MB 4AQOA 1VADA 4M5ZL 3LY6A 1N8ZB 1G0YR 4P4RB 5KS9A 4JPIB 5DQJB 2YZ8A 1BQLH 3DUSB 1CVRA 5DQDH 4LLQA 4FP8L 4YDIH 5T1DL 1CZ8H 3LH2L 4YBHA 5JXEC 2IF7A 4JQIL 1NMCC 2HT2D 5J11C 2XN9A 2A6DA 3GGWA 3ZTNL 2HRLA 2IFFH 1KCRH 4POZC 1ZKAA 3BVNA 1RAMA 5F6HJ 1JYXA 3S88H 1BZ9B 3IDGA 1QR1B 5EH1A 1SEQH 1A6TB 3FOLB 3RWDA 5E03A 2BZDA 2LTQC 4KRPB 4Z8FL 3OQ3B 3O3DB 3JTSA 2KPNA 4XMKH 5T3XE 5I1DA 3OKNB 3GO1H 4FQCL 4D8PA 4HH9B 1NDGA 2VQ1A 1A1OB 4XCEB 1SYVB 5F8RC 5F1NA 4YDLC 3QQ3A 4UDUA 1NGPL 5D6DC 3VXRE 3W2DL 2RFXA 1DVFB 3RJDA 2DF3A 2QHLA 4ZAKC 5ESAA 3L3OB 3GRWH 4APQA 4KC3B 3FAXA 3VXNA 1HQ4A 1P7QB 4YC2B 3MROA 1H3WM 3CMGA 4M4PA 5GGRY 4F57H 2B1HL 3QIWA 3H9HA 4K3JH 5IT2L 1YEFL 4PRIE 1INEH 1WVZA 4Y4KB 3HI1A 2VWEC 4JRYB 3GNML 3ARUA 4PRAB 4PJ8D 2C4FT 2VE6B 1NAMA 1OTSC 2DM7A 4S10A 4P2OB 3UJTL 1RIUL 5CIPA 4MQTB 4EXKA 4CMMA 3ULVF 3BDXA 4F9PC 3QO0A 1RZFL 3KYAA 1JPSH 2QHRL 4JPKH 2X05A 2FX9H 4OV5B 2BNQA 3HI6H 3PHQB 4JVUA 2ORBH 3BT2H 1MHHA 2OMNA 3HMXA 3DMMB 5FFLA 2F53E 3D0LB 5MHSE 1KEML 2IJ0C 2HJFB 5HDQL 3MLXL 4PJXF 4YWGL 1L6ZA 4U1KA 4RMUA 1DBJL 3EYFA 1VKXB 3MUGA 2NLJB 4P9MH 4NZUH 5F3HB 4U6HA 2AEPH 5FF6B 1E4XL 2X4RB 2R2EB 4GSDL 1WJ3A 4TTDC 5KS9E 1MJUL 3AS0A 4LVOB 3ROOB 5C08A 2RGSA 5EPMA 1C7TA 4P4KC 5I1GL 4RSVA 3CXHK 5JIHA 4MS8C 2WIMA 2FLBT 3N1PC 3WFHB 3H3BC 2KUTA 5E95B 3REWA 1F2QA 2XN9E 5I71B 1NCCH 2CLZA 2OR8A 4PLJC 4YHPA 1IFHH 3CCHB 1I4FB 4JB9H 5E8EA 5HGBB 3LQAH 1PSKH 5D1ZD 4WO4A 5KW9L 2AXGA 3UJJH 1UWGL 4LCCB 4N90E 3WO4B 2BP3A 3P9MA 3SOBH 1AC6A 1NEZA 1KJ2A 4C56D 4YDVB 2E7HA 1X7QA 2H2PD 1RZ8B 3OZ9H 3PF2A 3NCEB 4X6FA 2X4OB 1N6UA 3Q6GL 3NPSB 1MI5D 1BVKA 1WT5A 3QIBA 4G7VH 2XNAB 3NZHH 3M45A 3FOMB 2X4PB 4LEOA 4EUPH 4JFHD 4S11A 1J12A 4FTVA 3DETD 3CFBB 4YHIB 2BY0A 1HXYB 4XP4L 4XVUD 3MUHL 2AK4A 4LPUA 3VG9B 1JK8B 3Q48A 5DZOA 9CGTA 3ZKND 3WNLA 2X1PA 4RMRA 3GUTA 4KFZC 4QLRA 1QKZH 2EXWD 3QDGA 1NLDL 4GRWB 2R0KH 3NFPA 4KVCH 2BNQE 1BECA 4J7RA 5I15H 4PTUA 2CKBH 1MRDL 4MDIA 4PJCA 3O9WA 4O51A 2C7UB 4AJ0A 1FG9C 1QFWH 2UWEE 4PJAA 3DRQA 4NM4H 4QYOA 3DTXB 1BZQK 4R7NB 2VXVL 4HIJA 3MLYH 2E7LC 3IFPB 4M7LH 4QY8B 4AIOA 2X4NB 3RNKA 3ZTJG 1N2RA 4IIQA 3ARPA 1CFVL 4XRCA 1A64A 3VJ6B 3NCYP 5DLMH 4K9EL 5C08E 4JDVA 3UZEA 5E94A 5BVPH 5JHDA 4OAWB 3PL6C 1OARL 2DM3A 1TZHB 4E41D 4YFDB 3QNXB 5ANMB 4TQEL 4ZDHA 4QHLB 5BRZD 2EIDA 3FQTA 3T8XB 1FH5L 4XVTH 5DHVH 3W0WA 5K9QI 5E8OB 5JA8B 5GS1C 5JXEA 2RBLA 5BJTA 5KJRH 3MLVL 1VGKB 3N85L 2FBJL 3BESR 3O45A 4OLVL 4R4FL 5J8OA 3X13A