5E99L

Bovine fab fragment f08_b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Fab F08_B11 light chain
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L01
2EH8L 1R5WA 1NH6A 3STZA 3CZFB 2IANB 4FHBD 2Z4QB 3EJYC 4F7EB 3UJJL 3NOIA 1JGEB 1YY9C 1FFPB 2HT2C 4OLZL 3WMSA 1DQJA 4O4YH 4WUUD 5JQHC 3EO1A 1HHKA 4HV8B 1IKFH 4GKNA 1UH2A 1IFHL 1I7TA 4JM4L 5KS9B 5EO0B 5CBEA 4U1SB 4YPJA 4KJYB 3PNWB 3L95A 5ACZB 1MIMH 2EDDA 3ZE0F 1VADA 3DXAD 3T2QA 5C0EA 1WBYB 1MCOH 5ITFA 1JJUA 2Z92A 3EYSL 4JM2F 1Z6JT 1K8DB 1RIVL 1H3XA 5IVXE 4IOFC 5CP3H 2GK0B 4LF3A 1AD9B 3BUTA 1DBBL 3L5JA 4QOKD 3VRJA 2Q87A 5JQ6L 3RZCD 1RI8A 2ID5A 1A6AA 2P7TA 5I75C 3HKFA 3UTQA 5EOTB 5FYJE 4M7LH 4P9HL 2M26A 4AG4H 1MAKA 2D7NA 4S0TD 3C8KB 4Y8AA 2EIZA 5B8CB 4WFHD 5JNYB 4YDLB 3IXAA 3CFIC 2NXYC 3QPQD 1ULVA 1C8PA 4G7YL 3TYFB 1Q9OB 2YN5A 1RJYA 3F7PC 5D7IF 25C8H 1DLFH 1FZKB 2X6MA 4OIIL 4ORZC 1KUMA 3KNBA 2DQHH 32C2A 3D69B 3MRDB 2YA0A 1JNJA 1MJJA 1BECA 2VXUL 3QQ9C 3CMGA 4FP8H 5EZJB 1H3WM 4JJ5A 2C26A 2GJ6D 4WV1C 5LGJA 3IRZA 4MJ2A 3HE7C 1X4ZA 1HDMB 4L8BA 4QRPA 2YD2A 1I8IB 1PG7H 3MV9A 3D3VE 4LK4A 3QG6A 5GSRA 3C09B 4OCYH 2C3WA 1BP3B 1E4KC 2PYEE 4KPHH 4X6DF 4BKLB 3RA7L 4GW1A 1ZHNA 3TO2A 1DN0B 5MEQA 2EYTA 1GIGL 2G60H 4U1LB 5IMOB 2CDFA 1Q9WA 3FN3A 4I9WE 4OLZH 1DVFB 4UQ3B 3WNLA 1BQLH 4DQOH 2DS4A 3UO1L 1M4KA 1VENA 1A6WL 2X7LB 3NFSH 4TUJB 3P2TA 4P3DB 3MOBH 1JK8A 4TN9A 5DJ2B 4AIXA 1JHKL 5CCKL 1CT8B 3JWNC 1DL7L 1HI6A 4FQXA 3Q1SL 1TLKA 4JHBA 1RUKH 3VD9A 3ZHDA 3HA0A 4FFWC 1H3UA 4LLQB 1AD0A 5KVFL 1J18A 2XXMB 2RBLA 3IFNH 2P45B 2P24B 4FFYH 5IB3B 2UYLB 3RVTD 4KUCD 1OWWA 3QEHA 1RQ5A 5KANG 3IDUA 1I1CA 3UTPD 2OR9L 1DBML 3ULSA 3VFPA 4PJ8D 2WMPA 1J1PL 4N9GB 4UMGA 4LVNC 4FQQA 4Y4FB 4YZFF 3T3PF 4X6CF 1AKJA 3LCYA 2FX8H 4PRDA 1HKLH 1B90A 2X4UB 4YJZL 5DRWB 3GMRB 4XP9L 4Y4FD 3RIAF 4XBPB 1ORQB 4PJIF 1HYSD 3M1BA 1BFOB 4P5KA 3RHWK 5DA0B 1MCFA 4QRTA 3HMXL 1ITBB 4CNIA 5D2NE 3JTSA 4MNQD 1FG2A 3RL1A 35C8L 3PF2A 2A9ML 3MUGA 2AJUH 2Z31B 4XMKL 3NGBC 4Y5YC 3VRLF 2EC9U 5DURB 5A2IH 4OV5B 3NTCL 5KTEH 5DI8B 1YC8A 3QPXL 5C8JA 2ZNWA 2HLAA 4BZ1H 1GOGA 3CLEL 1AGEA 1FYTB 1HHHA 3DX7A 4QF1B 3PJSA 1C5CH 4Z5RB 2VDNL 3V8OA 5ETUB 1HXMB 3QEQD 4I2XA 4QLRA 1NCBL 4QTIH 1YMHA 2YD1A 4EN3C 5B39A 3VXSB 3FB6B 1YEFH 2XPGB 5CWSB 4LU5L 5JOPE 5B4MC 2NXZB 5C7XH 3GMQA 1CXKA 1RMFL 5F6HJ 1E4KA 3DETC 5JW5A 4LGRB 3FB7B 3QAZC 5CCKH 1R5IA 3K2MC 2FEEL 4LLDB 4MQSB 3CU1A 5EPMB 2X40A 4FQCL 1QEWA 4M1DH 3D25A 2ZPKH 1V7MH 4EI5D 4UNTA 4R4FL 4XP4L 1T6WA 4M6NH 1P2CA 3QUYA 2OBGA 1TZHB 5I1JH 1K8IB 1ACYH 3QIBA 1JF1B 4P4RA 3CSGA 1OT2A 4ZSOE 3OKLA 5D7SL 4H8WL 3D0VA 3MFGB 5GGTL 2WM0A 4FFVC 4ZAKC 1S7SA 3BJLA 5JR1L 4JFPA 5F7MC 1DSFH 1I85A 1BBDH 1S5HA 3V7AE 3VCLB 5I1EH 4NRXB 5C0ND 3UBXB 2IALA 3SGKA 1OAYL 4NN7C 5EZLB 1NGYB 1UWXH 3PXHA 5I9QB 3QDJA 3PDOB 1G6RH 2A73A 3HNVL 4M6OL 3BEVB 1CFTB 4YO0A 2Q3ZA 5ANMA 4OLUH 5E24E 2P46B 1FZOA 5F9AC 3RGHA 3V0VB 3IFLH 2BVTA 1UJ3A 1JGUH 1V3JA 3N9GL 2ERJC 2P1YA 2ZUQC 1XCQB 2X05A 1QLRB 1KIPB 1FH5L 1QHOA 2FRGP 3V6ZB 3L7FA 2K9UA 3NTCH 4MD4A 2PTTA 1CGVA 3CVHB 4XAWL 3ZE2E 1RUML 2APFA 1ND0A 1DQLH 5GGQH 1AIFB 5GS1A 2ADJB 2DWDA 4OZHB 1XGTB 1EEZB 3IFNL 5KSVA 2Y5TA 5F8QC 1E27B 3CSYA 5DFVC 4GRMA 1FAIH 3PV7A 1U6AH 2YUWA 3SE8L 4NJ9L 4LSPH 4QOKE 1A0QH 4OD3L 2D7TH 3ULUF 4G8EA 1VFBB 4MJIE 3L3GB 3QXDA 4NT6B 1Q9LB 4PJEE 3QUYD 3V7MA 1Y0LB 1MJ8L 3ROLA 4F7CA 3KPLA 2BJMH 1UCTA 1A9BB 4O58L 4CADA 1I85C 1TJHL 5JHLH 1OD9A 1U3HA 4RSVA 1RMFH 5IBLD 4MWFA 1FNEB 5E5MA 5D1XD 1BJ1H 3SE9L 4ZFOA 1LEIA 2UV3A 1JZ2A 1SJVA 1F8TH 4LMQI 1GZQB 3THMH 4FXKA 1AXTH 3QDJD 5F6HI 2VXSL 5CD5D 3QQ9D 4IHOB 4BZ2L 1GL4B 3J8F7 1RZIA 2SEBB 3CC5A 3ZDXE 3T8XB 2VLJD 1BBDL 4Z7VA 2LTQB 3CPLA 5ID0A 2EKSA 1DBJL 1CDHA 4H8WH 2ADFH 4EKXA 5T3XH 4JFDB 4X7EC 4PRBB 3GHBL 4HQQL 3STZB 1WT5A 4RQQB 1OAZL 5EO9A 2IANA 2OL3L 4XTRC 5IMKB 3CVIL 2BVYA 5J1AB 1UXWA 1FGVH 4M6OH 3BW9A 3GIZL 2VDRL 1MRCH 4AIZB 1KLGB 3N85L 4JRXB 5E99H 4IOSD 4Z7WF 4LEXH 4MNGE 4XMLL 1RJLB 4KJYA 1IEBA 3SPVB 1YUHA 1H15B 5FUZL 2JB5H 1MSPA 4DGIL 2WP3O 3VDAA 3HI1B 2GHWB 3DIFA 5FUOH 3IDIA 2XA8H 2YMXL 2AEIT 1MUJB 4WI3A 3O9WD 4PJEB 4PRNB 1EVUA 5L2KA 1M05A 4HFWA 2EDTA 1BZ7B 1WK0A 3KPSE 2JIXD 3ZL4L 3QIUD 4FFZH 2RCSH 3E2HB 3WDJA 3K4DA 4LSPL 1U9KA 4J3VA 4G9DA 4O58H 2H9GB 5MERA 1D9KA 4PGJA 1WJ3A 4S11A 5ISZA 2EIZB 3V5HA 1T1XA 2Z35B 3EFDL 4GOSA 2FH8A 1HYSC 3WN5C 5BXFA 5DD0L 4C56E 2EE9A 1KYOK 2APXA 4GLRI 4TSAH 4WHTB 3KYNA 1J86A 2ICWJ 5M7QA 2C3HA 1H0DB 3SDXE 1OF2B 1SY6A 1EGJH 1X4XA 1MCOL 3T04D 2F8OA 3MRDA 1S78D 3VFGL 4DVRL 2VDPL 3UYOD 1OQXA 3E8UL 1I9EA 4F8TA 4ODBD 4LBEA 1MPAL 1SBSH 1WFTA 4MVBD 1S7TB 3SBWA 2F58H 5LGJB 2QQLH 2H45A 5ALBH 3CFCH 1I8IA 5I8KL 3SJVA 5IGXH 3DX6B 4HWNA 1QR1A 3KPPA 4KRMB 4R0LB 2JELH 1YPZB 4M1CD 4ZQKB 3TJEL 4QYOB 3VXRB 3I85A 5BQ7A 1AY1L 1FRGH 4U6XB 4BZYA 4S0SD 5TQ0L 4P5TD 2Q6WA 3X14A 2IH1A 5EU5A 5F9JA 1AQKH 1FGVL 3GSRB 4I1NB 4IRSB 4E41B 4FRWA 4QTHB 3UBXI 1WUNT 2PR4H 1SVZA 4P3DA 4KI5D 5DJ2A 2W0FA 5C6TH 3O3AA 3UBXG 2J1KA 2CRMA 2PW1B 5CJBA 4F58L 3TPUB 4FQXB 3SKJH 3NZHH 1ZEAH 1FGNL 5E8EB 3SDDB 1KULA 4NO0D 4NKMB 1IGML 3B9EA 4NIKB 1JTPA 5IHUH 4DOHE 5DFVD 4NM4L 3PWPB 2HRLA 3O2WL 2VXSH 1V3MA 3QJHB 1JL8A 1BFTA 4NSKB 5J0BA 1NPUA 1YEJH 1CFQB 4PGBB 5EU6E 2YKLL 2Y6SD 3DMMA 4HCRA 1JNLL 2YA2A 4ZYKA 1B0GB 3OKDB 1KACB 4Z7VF 3I6GB 1NC2A 3MLPA 3P0YL 4G8GD 3REWA 2H8PB 2R2CA 3WFEH 5IBUB 3QXAA 3MBEA 1FC1A 3QUXD 3KDMB 1G7JA 4XCCH 1ZHBB 1BFOA 2AJUL 2PF6A 4ZDHB 3K2UH 3WBDA 1BOGA 3LKRB 1S9XB 2R1WB 5KSBE 4NO5A 4X99B 1EO8H 2A83A 3S36L 4HUNB 4JRXE 2JB5L 4DGIH 3GSNB 4ODUA 1MHEB 1NC4D 4PYGA 3P11L 2GSGB 3U82B 2GAZA 2QKIA 1HXMA 4UB0L 4I2XB 5D1QC 4DVBB 4Z7NF 5JXEA 2PW2B 2EE6A 5I6XB 3PWJB 1BIIB 2DOCA 3VXSA 1AR2A 3BH8B 1JWMA 3I6LD 4OIAA 4YDIH 1I7UA 2IMNA 3QJFB 1SJEA 4KXZI 3TNNA 3VXPA 1S7UA 4NKIH 1J0IA 1T03L 4XNQB 3W0WE 2ESVB 2YD5A 4XXCA 1PZ5A 3HZVB 4YHPA 2O26U 4E0RA 3AMLA 5EOCL 1A1OB 1LGVA 3CFEA 5FYLD 1MFDL 3PIQB 1DN2A 3MRNB 4QOKB 2G9HB 4Y2DD 3DVNB 4XAKE 1WZMA 1PG7W 1MAJA 4XPAL 3QIUA 4XC1H 1YMME 4G3YL 3INUL 5MENE 3QIBB 4PJCF 1KXTB 3L7EB 3EHBD 3MV7A 3D0VB 4QRSB 3IDJB 1CI5A 5DEFB 3QFJB 3WXWL 1PG7X 3T0EE 3RWHB 3PHQB 2OTUA 3RGVB 3UPRA 5DK0B 3V4VL 43C9B 4S1QL 3UBXA 2LAAA 1G6RL 5D7LB 5IW1B 2K1MA 4EIGB 1ZT1B 3O4LA 3D39B 5DD6B 5I8CA 2A73B 4CBPA 5DUBB 4WO4D 4XPFH 2GEEA 3FMGH 2EDBA 3WHE0 5GGSB 2XT1B 1MIEL 4LVNB 3QRGL 2JJVA 1NGWB 5HPOA 3WIHL 3RBGA 1TETH 1QSEA 1UJ3B 3IS0X 2VLJB 1I8MA 1W0WB 1JWSA 3D0LB 3NFNB 3GSXA 1QLRA 1MHPH 5GXBB 2DD8L 2VLLA 5I1JL 1KIPA 2VIRA 4LQFH 4WGVB 3ZE1F 5HI5C 4F7PA 3MJ7B 1JRHH 3QA3A 5D1XC 4FQXC 3W9DA 5IHUL 3L6FB 1NBYA 5C0GA 1AFVL 2P43B 2I5YH 3G6AB 3CSYB 2X89A 2EXYC 3BSZL 4I18B 4M7LL 1NMCB 3VGGA 3ALXA 3IVKA 4LPTA 1VFBA 2AJ3B 3KPOB 3EHBC 1N59B 1NGXA 3L3GA 4NT6A 4PG9B 1JZ5A 3RJDA 1ZGLA 2EO1A 2GQHA 4GG8B 5ECJE 5CGMA 2OK0L 5JIKA 2WUCH 1U95A 5JLZB 1FLTX 1T03H 3JWOH 4MD5A 3SE9H 4J8RA 5KBNC 5HGBB 3K4AA 3EYUH 4NKOA 4PJCB 2E6JA 2R39A 1LEIB 1CD9B 3CDGA 5E00A 4QT5B 2RGSA 2O5XH 4P2RA 2V17H 3G6JE 2D7MA 3ZDYE 1S5IL 2AXJA 5T5FH 1NCWH 5ID0B 3LKQA 3FZUD 4NQUA 3O9WC 1S7VA 2NY4C 3BKJL 3RDTB 2J8UA 4JGUA 3MJGX 4IM8A 2R0KL 2IH3B 4HGKC 1R5VB 1IM9A 3O4OC 4JFHE 5FV2A 2Q3AA 1IGIH 2P44B 4U7KA 1XF3B 2FB4H 3T0XA 1XF5B 5DLMH 1UM6L 3WD5H 2W92A 3QRGH 1L9MA 2H1PH 1QA9A 4EOWH 1DVFD 3WSQL 3FRPA 2HVJA 1Z3GH 4RFEA 2AW2A 3BRDA 4GRLB 1JPTH 3K74B 5D8JL 5CZVH 4G6JH 3W0WB 5JHDB 1QSZA 1KPVA 3ROOA 5D4QA 4Y1AB 4X6CE 1P4IH 3RVVD 4HKBA 4OKVB 4U0RB 3SE4C 3ZSSA 4Y19D 2DQCH 2AEPH 2Z9TA 4CJ1A 4E42B 4JPVH 3OGCA 3EFDH 5L2KB 1OGAE 1KTKE 5FDYA 3ZE1E 3CCHA 4AYFA 4KROC 1K3IA 5D1ZC 4JANB 2M1KA 4OGXH 3GSNL 1NQBA 2XZQH 4RDQF 1GGUA 5MERB 4P2RD 5CKGA 1T83A 5ISZB 4KHTH 1T1XB 1KB5B 3Q2CA 3HRZB 1AGFB 1JPST 4GMSL 4Y2DB 1HHIA 4WHTA 1CIUA 3UTTD 3MNWA 3KYNB 3QQ3A 5T1KB 1A9EA 3FO2A 1H0DA 4FQ2H 4MQ7B 5E03A 3GO1H 5B39G 3ARUA 3MNZA 2B39A 4OCNC 3HE7D 3W9EB 5E6YA 2WIMA 4UDTA 4U3HA 5T1KD 5ENWA 4F8QA 3WUZA 4Q2ZA 3UX9B 1WAAE 3HI6L 3T1FB 3W2DH 3CFCL 2EIDA 4BELD 5I9QC 3B6SA 4PG2C 3H3PL 1J1XL 4E9LA 3MRJA 2JE8A 1R5WB 4MXWL 2FEDC 3DX6A 2D9QB 1CLZL 3C2AH 5I30L 1MVUA 3G5ZA 2W9EH 5A40E 2BNRB 1DQJB 5EU6D 3TZVC 4JN2A 1X3DA 3WSQH 4D0CB 3GSWA 2YUVA 3VXTA 4PJ5D 4MVBC 4ZPVA 4H5SB 5AZEH 3LV3B 4E41A 3PNWA 4NQCD 2HAZA 4YFLI 1VADB 5ITFB 1ZTXL 4Z78B 1U8NA 5C0EB 4JG1L 1CFVL 4X5LA 1DBBH 2LV4A 3MRGB 1KCRL 4WHCA 3IDGB 2MPAL 4F37F 4PB9L 3TN0B 2B4CL 1U8LB 4F7MA 2PO6C 3RJQB 1D5XA 4X7SH 1OM3H 2DIAA 3TO4A 3ILPB 5SWZA 3REVB 3UZEA 5FA3B 1OVZA 4K2UL 3SKOA 1TVBA 4JPVL 1B0GA 3OKDA 4OD1L 2E6QA 4J3SA 4Q9QH 5IBTL 1WFNA 4HCRH 5AG8A 1F3DJ 3REWB 4HMEA 4PP1D 3CXHK 4RWHA 4JRYB 4X9GA 4WI4A 3V2AR 3VGHA 1FZKA 1FJ1B 4JZOB 2X9YA 5EBLA 4FQ2L 1AI1H 3KDMA 3ZYJA 1L0XA 3U0TB 4OLVL 5FCSH 4DN3H 2C3VB 3CVHL 5GJTH 3SDAB 1XGYL 4NO5B 4I77H 1DBAL 4Q74A 1CGXA 3WUWG 4QRPB 4H88H 1P7KB 4HZAA 5HHXL 1KCSH 3MODH 2X4RA 2YWZA 3WDHA 2VJXA 3U48A 5KS9E 3Q3GB 3SE8H 3BAEH 5FGBC 2DBLH 5ID1A 5MEQB 3FRUB 5L9DL 1DVFA 2JCCA 3QQ4A 3VMOA 1NEZG 4Y1AE 4MHHG 2FH6A 4DVBA 4TUJA 3S4SB 2MCG1 3LRSB 3CX2A 2AJVL 3IDMB 3QJFA 1OTSC 4MQXD 5IBUG 5IVNA 2FYYB 4WHDA 4AM0B 3ZT7A 3B9AA 3LKPB 3QWOB 2PUQT 2W59A 4KGLA 4NZTH 1UCBH 1ADQL 2APBA 1GC1L 4JO1H 4OF8A 3QO1B 4PJBE 5L88L 5HBBA 2VLMD 3LPGA 3WKML 3ARTA 5GRJL 3WUWB 1YN7A 1WT5C 1FLRH 3QEHB 4EDXA 4ZTOL 1HSBB 1JV5B 4WI5A 1EH9A 4POZC 5JW4N 2R0LL 3QIUB 4OF5A 4A6YH 1MCCA 4R90H 3VFPB 4BYHA 1YY8A 2VZSA 1PJ9A 1B2WL 3L7EA 4KKCC 5C9JB 2R2BA 4N9GA 4QRSA 2P8PA 1H5BB 1EX0A 1FL5B 5A3IC 3C60B 3VD5A 5DEFA 3MLSH 2VC2H 4QHLB 1H3VA 1T1WB 4Z7WB 5E08L 4PJFE 2OTUB 5AUMB 2X4UA 3RGVA 5GIRA 5J6GB 3ULUL 4P5KB 5T1LB 5JO5A 1ZT1A 3O4LB 4X0KA 2F53B 3PXJA 3FO9A 1TMCB 5L6YH 2BNQD 2Y25A 5BW7A 3U7WH 1AHWC 1FL6A 4J4PD 1YECL 4D8PA 1R3HA 1QSEB 2NY7L 4FA8A 2RHEA 3MLRH 2HP4A 3QDAA 5LGHH 1OLLA 4B0MM 2IG2L 5C8JB 2VLLB 3ALWA 2P5EB 2X10A 1N4XL 2WIIA 5B8CC 3ARGA 4X6BB 1REIA 4LRIC 1FNGB 5CEZD 4YHOH 4TRPL 3EJJX 5ETUA 2ESVD 2GIYA 5ICYA 3RPIA 4MDJB 3KXFB 3F7YA 5HHXH 1ZANL 3F6LA 4OCSH 1MFBH 3H7LA 1DANT 4GG6E 1UM5L 3DRTB 5FOBA 4I18A 4QRQA 1GGCH 2EDEA 1JP5A 1IILE 3GMQB 4POZD 4J3TA 4NQCA 1EHAA 3G08B 4QHKI 5DEZA 2D4FA 3KPOA 1UYWH 4ZUSB 1N59A 3VWJC 4OBRA 4YFEA 3CMOL 1TJGH 4L9DA 2MFNA 4PJFA 1DQMH 1QBLL 3ZKQD 5LKNA 3AXLA 4KJPC 5GRJH 4N1CA 1IC4L 4K7PY 4MAUL 1JTOA 1W8OA 1T89C 2VR5A 1TZHA 3NZ8B 1L0QA 4BH8B 4G9FA 2YZ8A 3TO4D 2ZJSL 1WVZA 1S7SB 1MJUH 1S3KH 4JFPB 2EDKA 4RDQG 2H41A 3HS0A 1JFQH 1S5HB 3BGFB 1YPZF 2NCMA 3HR5B 1YN6A 3MRCB 3JUZA 3R06A 4UT6H 1P5UA 4PJ7A 4YHKH 2IALB 1PSKH 2V2XB 2Q8BH 3BQUD 1T0NA 4LARH 2FR4A 1CDCA 3NA4A 5DHVA 2IH3A 1CFTA 4YO0B 3SDYH 3GSUA 3W81A 1CFBA 1A7OH 4NRZB 1CE1L 1MCPL 4X5XA 2FD6H 4NKDB 1CL7I 1VPOH 2VDMH 1BFVL 4PV8A 1SYVA 2JJTA 3IF1B 5IM7B 4D3CL 2C3GA 1LO2H 1SEQH 4KVCL 1PEZA 3JV5A 2GFBA 1NGZA 4Y5VC 4DFHA 2A74B 4Y4HD 1QP1A 4YHNA 4Z0XB 1JHLH 3PGDB 5DS8A 1T1ZA 4GRLA 4X9IA 2IBBA 5DXWA 2FGWH 5TH2B 5CUSL 4OZHA 5F3HB 4MLIA 2XWTB 5E4EB 1P4IL 2CO6B 3L3OA 3EYSH 5DR5H 1VFAA 5KSUA 2IADB 4LSRL 1RZGB 3KPNB 4XVUD 2X2YA 3LQAC 5EU7C 1U91B 4ZS7H 1W0VB 4PJBB 2DQUH 4JHAL 3S97C 3BIBX 1S7RB 3QXDB 4X8XA 3TBYB 4H0GA 3OGOE 4HUVA 3TT3H 1X5HA 4ZMAT 2ED7A 1Y0LA 3OXSA 4Y5YB 3WJJA 3MOBL 1JYWA 5E9DD 3WDIA 1S9VB 2BSRA 4HBCL 2D03L 5D7JD 1RZ8B 5A16B 2FSEB 3X3GL 1QFWI 3BE1H 2BCKB 1NUDA 3HE6D 4ZFOB 1TPXC 1T6VN 4GQPH 4FXKB 3VWKA 1L6ZA 3AS1A 4WEMB 3BD3A 1ZGLM 1BZ9B 1MRDL 4OM1H 3VRLE 3WFDL 4MQ7A 1PG7L 4IIQC 1PQZB 4QHUA 3LEVL 5DJZA 2V5MA 5A2LH 1TCRA 3W9EA 6FABH 2FLBT 4L4TB 3Q48A 2ADFL 2CRIA 1EZVX 5GS2H 2AJXL 4N5EC 4GKSB 1RVFH 1FFNB 1VACB 3KYMB 4NO3A 4PJXA 4ZO8A 1XR9A 1CGYA 4P46A 3BDXA 5E1HB 5GS2D 4OUUA 2Z8VC 5E5UB 1YA5A 1RIUL 4FQIH 4HF5L 4GRLD 4N0UB 2FJFB 5F7DA 7FABH 4TPRH 3OAYH 1ITCA 2B0SH 1KBGH 2VDML 1HEZA 4WUKL 4KVCH 5DJXB 3GSWB 1XCTB 1UEYA 3BKYL 4ELME 3OB8A 1RUKL 4ZPVB 1UYWL 3WFZA 4HX1B 2C7UB 4X6CB 4KUZH 4Z18A 1EEUA 1JHLL 4JG1H 1TJGL 1TZIB 4F57H 2AKRA 4HD9A 4LFHG 3Q5YA 4HWBL 4Y4HB 1U8NB 1CQKA 3IFOA 1PLGH 3HI1A 1OARH 1P4BH 4ODWA 5GS0D 3IDGA 4P23C 4NBZB 1EUUA 1MUJA 1G1YA 1KOAA 1I7ZA 2EC8A 1CLYL 3MRMB 4XB7A 1YNTA 2EDLA 5SX5H 1G7QB 5IOPB 1CLZH 1D5XB 2A77L 1BQHB 1ROWA 2MWCA 3LSOB 5SWZB 1D9KB 3EDEA 2AEQH 5ILTL 3T3PE 3SDCB 1TVBB 3B83A 3QFJD 4YWGL 4HDIA 4QO1A 4CVUA 5BS0B 1OP3H 3RI5K 5F6IC 1DBKL 3FHAA 5E9DB 4X98B 4RGMB 8FABA 5HYEA 1I9JL 3BD5A 2N4IA 4JRYA 1B0RA 3GMPB 3JVGA 5EZIL 1FJ1A 3B9KD 4TNWK 4M48H 4LLUB 3B9VA 1NFKA 2R2EB 3WHXB 1LO2L 2W07A 5KTEL 1XIWD 3O6KL 2R23A 3K0WA 5M95B 2NY5H 4YXKL 5J9PA 4LHUA 4WW2A 1CU4H 4DN4H 2UZIH 3EYFA 1GC1C 4LLAA 1S7TA 4LQFL 4J4PA 2QQNH 4X80L 2MKLC 2V5RA 4MHHI 2V17L 3SJVB 1C7TA 3RVXD 3RVUC 4R0LA 4H1LG 4ZQKA 4XVJL 1SYSA 3ARDC 3DV4A 2C5DC 1FBIL 1ODAA 5C0JB 2O61A 5TFSH 4NYLA 4JHAH 3X14B 2JCCB 3L3IA 1NCBH 3QQ4B 5I73C 3HUJB 3LKOB 4YDJB 3ORJA 3ISWA 3TT3L 4QTHA 4UV7L 5CSZB 5IVOA 1T4KB 5TE6L 2W0FB 2WBJA 1Y18B 4LCUB 4PS4H 4X8JA 3TPUA 4OZFA 4CKVX 2J8UE 2F8VA 1XGQB 1DUYA 5E8EA 2MMXA 1A2YA 1B2WH 3CFJA 2I9LB 2BVPB 4WI9A 2DQIH 5DQDH 3PWPA 1HH9A 1DSFL 4S2SB 2B5IC 3QJHA 4P2RE 3WFHB 4HH9B 3SKNA 4KAQL 4LSTL 2EE2A 4GUPB 1ACYL 1IARB 2V5TA 1FORH 3C08L 4M7KH 4PG2A 1X6NA 3BKJH 3RNQB 3HAEH 1D5IL 3M07A 3PHOA 3TBWA 2JIXB 1T1WA 4KHXH 4Z7WA 5I71C 1MIML 3CIQA 3JBG7 5EUKA 4CVXA 4WVRA 3RUGE 1AO7A 1I9JH 2JB6A 4GMTL 3MGOB 4GBXD 4ZXBB 3KPQB 4FZEL 4RAVA 2J3SA 4ZDHA 5T1LA 4DJMA 1FH5H 1I1RA 4LPWA 2DLGA 3WS6A 3H7BB 1LWRA 5IQ9B 1WSST 1ZV5A 3OR6A 4KK8D 4P3CL 1WICA 2CK2A 1AHWB 3BYYA 4WTWA 2HKFH 2ZOLA 4MSWA 3QUZB 4NP4H 1FZMA 1OAQH 4K3EL 1J8HD 3W2DL 1J7VR 2CRYA 4XVJH 3RX5A 5BVJB 1INEL 2NTFB 5MHSD 3Q5OA 3ULUE 2FL5B 4MA8L 1HQRA 3NIGE 3S88L 3GSQB 3MBXL 3AY4C 2WW8A 3FL7A 1SJEB 3RL2A 2XZQL 1YZZA 5L0QC 4ONGL 4L3EB 2ESVA 5JW4R 3ARVA 3X3FH 5KN5A 2HFGL 3G04B 1AXIB 4FG6D 2CR6A 3GB7A 4UV7H 5DD5H 1AR1D 1DJSA 4UU9A 3MRNA 1JPFA 3HRPA 3TH3T 5IR1A 3DVNA 3P73B 5FDWA 3BPLB 4PJHA 4RAHA 4ZUTA 4AEIH 4BH8A 3P4MB 3BP4A 3P77A 4HG4K 4PY7B 1NAKL 2CIKB 5KSAC 3IDJA 2G2RA 2JK5A 5J56B 3QFJA 1KIQB 4UIMA 4MDIB 2X44D 5JXEC 1CE1H 1MCPH 2DDQL 2N56A 4JFDD 3ESUF 3R06B 1NMAH 3TA3D 1S7WB 4LSVL 4K94L 3FFCB 5FGBA 5C0FA 3JZ7A 1KV3A 3Q1SH 3EYOA 1U41A 4M7KL 5I8CB 5HHMB 4N0CD 2G5BB 4UTAL 4UOW0 1G6RB 2X4TB 1KYOJ 1QFUH 4LFHD 3K3QA 4KHXL 1M7IB 5DT1H 2UY7A 3IKKA 4XPTH 3HMWH 5DWUH 5C6WH 1KCVH 3ABZA 3GJFA 3DSNA 4MQXC 2VLJA 3GSVB 5FYLH 3FT4B 3AROA 4EDWL 1CFVH 1NGZB 3T65A 2L4OA 2HLFD 4NP4L 3DGGB 2WSKA 2VUOA 4Z0XA 3PGDA 3KR3L 4XCYA 4U6YB 4RGMC 2VB5A 3FQRA 5JOFB 4LSRH 3L3OB 4NGHH 5DHXB 3C09C 4CJ0A 5BV7H 5LWYH 2HMID 3OJ2C 3QHZL 1S9WB 4I48A 3G6DH 5LCVL 3GNML 3CUPA 3NFPB 2BSTA 1N6UA 3R1GH 2NZIA 2CD0A 1BAFH 1IGJA 1FC2D 2AJZB 4HUWB 3OXSB 1RIHL 3IAPA 3IETA 4M6NL 2YEZA 1QRKA 3ZSTA 4KRPD 2LQRA 2EIBA 1P5VA 4OZGB 3V0WH 4NZTL 2DM7A 1IM3A 2O5XL 3CVHH 5CINL 1WGOA 2YHGA 1WBXA 2E6PA 4NC1E 4P2RB 5T5NG 4JPIA 4FOMA 4LU5H 3BHBB 3B2VH 4LDOB 5E6IB 3U2SA 3CSPA 2JJSA 2X4QB 1CS6A 5C0CD 4L4TA 1WISA 1D9KD 2XFXB 3LKQB 5E4EC 4JCMA 2HJFA 1L9NA 3BDYL 2PNDA 1XR9B 1U8HB 5HI3C 3MREB 2D3VA 4P46B 4TQEH 1KN2L 1WWBX 3V4PL 5I17B 1RJZA 3EYQD 4RRPG 5IHBA 3HE6C 2WQRA 5D7KE 1FVCB 3CH8A 1J12A 1J87A 1DEEA 2GCYA 2EECA 3CNKA 1JGEA 4IRJB 1Z5LA 1S78C 2HVJB 3IFPB 1HEZB 3UYPA 1BQSA 4PJIA 5FYLL 1RZKC 3IDYB 2X4PA 4UTAH 1XCTA 1K2DA 1LO0H 3EO1B 1CGWA 4HLJA 3QDMA 4GKNB 2NY5C 3QIWC 4HGMA 2WBJD 2C7UA 4X6CA 4UTBH 1J0YA 4RGNC 5JHDA 3NPSB 3L95B 1KPVB 4DGVH 4NQEB 1UM4L 5DMJB 5CGYC 2DM4A 4HKBB 4OKVA 3BIKB 2Q76B 3VI4F 1RUQL 3X11A 4E42A 3L3DA 3VRJB 3RRQA 3U4EA 2EDRA 1I7ZB 4KKAD 4RGNB 5GRVK 5HDBE 1K5NB 3RUGA 3ULVL 1YNTB 1IGTA 4MA3B 5FF6B 1A6AB 5E2UL 2F54E 4JANA 4XWGH 3OV6A 1U2CA 4ZFGL 3LSOA 3SDXF 1OAUH 5HHQB 3WKNA 1N7ML 2NY1B 2PO6D 3C8KA 1NL0H 2X4NA 3NABH 4NZJA 4WWKC 1WBZB 3OZ9L 3SE3A 4HKZB 2VKWA 5B8CA 3RVXC 4QWWC 3D18B 3IXAB 3O8XB 2W65B 4X98A 2X1XR 4Y4KD 1B0RB 4LCYA 3SCMD 1GGYA 3SKMB 3KNBB 5CJ5A 3EBAA 2FO4A 1WWWX 3G5VA 1OARL 5CJOL 1OAKH 1WWCA 4ORGB 1A6VL 1VGKB 4K7PX 2V5YA 3NCCB 5C0AD 1RSFA 4O51A 3EDFA 3RVWC 4K8RH 3ARFD 1UVQA 4WUUE 3V6FB 2DKMA 5EUOE 3HFMH 3L5IA 1D7FA 5BO1L 4YDKL 3T4AB 5IMMB 3S96A 2Z31C 3WFBH 1H3TA 2EC9T 4LCWE 5F44A 4ODSH 4GKZB 4OI8A 4GW1B 2VDLH 3D5OF 2EYTB 1RZJC 4U1LA 3ESVF 3R1GL 5KSAB 3L3IB 3MA7A 5T5NF 1CK0H 4WY7L 2XACC 4OZGF 2DQIL 4OQTH 2QBWA 1OB1B 4Z8FL 5JHDE 4PRPE 2XQBH 1JK8B 4W4NA 4Z78A 4R2GB 4LCUA 4DUVA 3QUYC 1Y6KR 2QHRL 4OZFB 3ZO0A 3UTZA 2NQCA 2A38A 1BZQK 2HFTA 8CGTA 5KW9H 3V52H 3TN0C 4X80H 2ZOKA 2QJDA 1U3HC 2ED9A 3AB0B 5JORB 1QSEE 2DTMH 4OGZA 3K1KC 2ILLA 2AJYH 5E2UH 3NIGF 4GQ9L 4NFBA 3GJFH 3DOSA 3WIIH 4RGND 3SKOB 4N0YH 3LEXB 2DB8A 1KPRB 5EZOL 1BBJB 4L4TE 4L4VD 2D2OA 2XTLA 1RUAL 1JMZA 1VEPA 3I6LE 5F96H 2NPLX 3TBWB 3I6KB 1B4RA 1AKJB 1LP9F 4I4WB 1EFQA 4CVXB 4G8GB 1CICA 1M1SA 1YNLH 5FYKE 2R0ZH 1AO7B 4WIQA 2JB6B 5EBLB 2ZCLL 5DQJB 2QHLA 2ZSWA 4DW2H 1P9MC 4PJ5E 3PGCB 1OW0C 1KJ3H 2UVEA 4LAQH 3WJJC 3DUSB 3KLHD 2FBOJ 1D9KC 2JLLA 2E7HA 2X4RB 4HEPG 1EIBA 3CSBA 4HXAL 4PJBF 5DI8A 4LRIA 2HLAB 3NAAH 2Q7NA 2MCPH 1AGEB 3RTQB 4M6ML 5DMGC 3OKMA 3P4LA 4KK5D 5F7EL 1I9RL 3NH7H 1FFQA 3VFWB 1FYHB 4TNWF 4RMRA 2FL5A 3QIWA 1NC4B 3WO4B 2EEDA 1PEWA 4Y4HC 4JVUA 1G9NC 4CN6A 4AM0A 3FB7A 3OQ3B 5FYKL 1IAOA 1WCBB 4OFVA 3TBVA 3G04A 1FVEA 2IMMA 3FQTB 5KZCD 2YRPA 4ZFFB 4KU1A 3AS0A 5FA4B 1MLCA 5FO9B 4L4VA 1P6AB 2DM3A 3OSKA 4D94A 2OCFD 2G75A 2D9CA 1S5IH 3MRFA 5GZNC 1N0XL 2DBLL 1HQ4A 3BH9B 3BUYA 4ZSOA 4JKPH 3PQYB 3V6BR 5C71A 3WFEL 1MHHA 2E9BA 2AQ3A 5TGBA 1HWGB 4PYHA 2AI0H 2ARJA 4M1GH 1AC0A 5EZOH 1KIQA 4L4TD 1TDQA 2A77H 4F9PC 4ELKB 1PKQE 2AJSL 4GQ9H 3O3UN 4OLYL 3V6OC 2WV3A 5C0FB 1BGXL 1XGRA 3EYOB 4X0KB 2XNAB 5HD8C 3DX9B 3BEVA 1I9IH 3QNXA 4AL8L 5L88H 1LEGA 2I24N 2WWMC 2WAHA 1M7IA 2OMBA 2YPLB 3D1MC 3VH8B 1I8LC 4OZHE 4I2XE 1MY5A 5HY9B 2HRPH 5C0CB 1KEMH 2XZAL 3RIFK 1L7IL 4M7JH 1QTYT 4I13B 2WIIB 3MXVH 3ARBC 3BKML 1ZWIB 5EB9A 1TIUA 1NCCL 4JEGB 5ESQB 3B3IA 2DYPD 2B8OT 2VLKB 3KG5A 4I0PB 4WUUB 3T2NL 4PBVC 3F7YB 1XGTA 4NKIL 5KSVB 5B21A 1QOKA 1B4JH 3UZVB 3PQYE 1U3JA 3DRTA 4ZOBA 3ZKXB 5JPMB 3HG1B 3LKSB 5SV3A 4EI5B 3G08A 3LRGA 1X7QA 4PRHD 5TFSL 2A9NH 4P2OC 3BZEB 3EGSA 1I3GL 1Q9LA 4JFHD 4RBPH 2AJZA 3GI9L 4MQTB 4BQ9A 4I3GA 4EBQH 1J0KA 3PL6A 3RZCB 1F90L 4CADB 3O6ML 4I18C 3AXLB 3P9WB 4RWYH 2ZZUT 4Q9RL 1WZ1H 3QNZA 2R69L 4OZGA 5CEXA 3VGBA 1KJMA 3VFRA 4C57C 1U3HD 1I4FA 5BZDA 4HIHA 1A7RL 3WXWH 4TUKH 2NY5L 1IM3B 1QO3A 2F54B 2VTFA 4MNQB 4NQSB 3WS3B 1AO7E 1YEEL 4PRIE 4J12A 2G5RA 3V79C 1J1XH 1DUZA 4OKDA 1MNUL 4RGNE 4PJGA 3HR5A 4Z7WE 5HYSG 4JPIB 4WHYG 3T8XA 4ZO6A 1KJ2A 5IB2B 3BGFC 4P46C 4LVEA 2DWEB 5I0ZA 4XCFL 3LD8B 1UB6A 4LHJB 3S5LB 3O8XC 1U8HA 2EDOA 5I74B 3GSUB 3OXRA 1FYTD 2VO5A 1RJZB 2C4XA 3QCUL 2C3XA 4PRBA 1AGDA 1SEQL 1I75A 4BUGA 4RQQA 4PV8B 2X9XA 4KJQC 2GK2A 2HA1A 3BZ4A 1DEEB 2WWKT 1IC7H 2B2XL 4OF7A 5L2KE 1L7TH 2GFBB 3V6OA 4PJ9B 1OD7A 4N8CL 2A74A 5IG7A 3M17A 2X4PB 3S9DB 4FFVD 4KVNL 1K2DB 3KHQA 3TBSA 5FYKH 3FTGB 4JKLA 1VHPA 3FO0L 2XWTA 3BSZH 5DQDL 3SPVA 3DVFA 1NMBH 5D2NC 2AVGA 4MNGA 2IADA 2UUDH 4V1DD 5DRZB 1OP5H 1UQSB 2MPAH 1CDIA 3QDMD 1DZBA 2Q76A 4XRCA 2VLKD 4JPKH 4NNXA 4YUEL 1HYRC 3C08H 3U4EB 2BOCB 2F19H 5IBTH 3DETD 2ADGA 4RMVA 2MJWA 1IGTB 4Y5YA 4MA8H 1YDPA 1NC2D 1OAUL 3BKCL 1ZVHA 1U92A 5H35B 4YAQB 2UWEE 5JUEH 3MROA 1NAMH 4RNRB 3VW3L 4RFNC 5ESVB 5IHZB 1SBSL 3D18A 1CD0A 1F4WH 3O8XA 3JUYA 4LEXL 1QNZL 1LEKA 4JO2L 6FABL 3LVEA 3HFML 4QHUB 2HH0H 4U3CA 5BS0D 3OR7B 3E8UH 3GBML 2FO4B 3HC3H 5EBMA 2F54D 3MCKB 1FFNA 1VACA 3KYMA 4PJXB 2DQDH 5TQ0H 1ZVSA 4C55A 4KTEL 4XNYL 1NLBH 2R4SL 3MUZ1 4OUUB 4FS0A 3QUZD 4AMKL 4OB5H 4EOWL 1XIWC 1WIUA 2JELL 1V7ML 3P0VL 5H2BB 4KJWD 3TBTB 4JRXD 3AMKA 5ACMA 2DQEL 3BKYH 1G7HA 4HUMB 5L6YL 5C09E 4UILH 5TF1L 4K23L 5CBAB 5KS9A 4MGXA 4JO1L 4WJ5A 3DYMA 5DFWH 3NN8A 2IQAB 4PJAF 3CX5K 3QPXH 1WBYA 5LGHL 1QFOA 2Z92B 3IFOB 4HAFA 4R8WL 4ELMA 1C5CL 4UINL 1RK1A 4PRID 1AD9A 4ZFOL 5EOQL 2FEDD 2F53D 2CKNA 4MAYA 3B5TA 3SDDA 2FEEI 3PWLB 5I76B 4NKMA 4X6DE 3C6LD 3W39A 4QRRD 3R0NA 1RZFL 4ZTOH 3UTQB 3O8XD 4YDKH 3HC4H 3NCYP 2I25N 1CFQA 3H0TA 3N1QC 4K94H 4JFZH 4ZO7A 2HJLA 5K9QI 1X5XA 2VLME 5BS0A 1G9NH 1IGYA 4P23D 5ESAB 2JKXA 2HTLD 4AQOA 1NC2B 3O4LD 4OZFG 5EIIA 1B6UA 1Q9OA 3I6KA 4L8SC 4P2YA 2XQBL 3OAZK 1UENA 4AJ0A 4G8GA 2R2EA 2NY6B 2EYRB 4OFDA 1CU4L 2CQVA 1MQKH 5DQJA 4RCAA 2R23B 5J9PB 5I1DA 1KJ3L 1RY7B 4WW2B 2ZSWB 4M6MH 1S9XA 2R1WA 4J1UB 4XH2A 2AGJH 1PY4A 4PLJD 4RBPK 1HOCA 2A83B 1PX4A 3T2OA 1SY6H 1TFHA 4K7FA 1U8JB 3RDTD 5CZXC 4K71C 2NW2A 1C16B 1SYSB 1ETZA 4YZFE 4JY5H 4NZDA 1ZHNB 5DUML 3TO2B 4OAWA 3GSNA 4ODUB 5AZEL 4KTEH 4XNYH 4NYLB 4NDMB 4UUJA 4JQVC 5I66B 2QR0A 3OB0K 1QFPA 3OG4B 3QIWB 1KGCD 1YEHL 2QADC 3BH8A 3C6LA 2MTPA 3Q0HA 5CLWA 5C0RH 4X8JB 1JGLH 1BEYH 1ZS8B 1YEKH 1H3PH 1Q0YL 1KFAL 1PZ5B 4LVHB 4QGYA 5DHYA 4X4ME 4IRSC 1K4DA 3RWGA 1AD0B 2W91A 1A1OA 4M1GL 4JO2H 1LO3H 2P24A 3O6FC 3HN3A 2VSCA 2UYLA 3OAUL 2G75B 3QT2A 2NW3A 1JZ6A 4U1IA 3BUYB 3BH9A 4ZSOB 4D2NA 3UAJC 1D5MA 4KRPC 5J89A 4LLVB 3MV7B 2BVOA 2FHBA 5HGDB 3SDDC 2AAVA 4FQQB 3V4VH 4XWGL 3RWHA 4O5LL 1F42A 3QXUA 4YDVA 2ZG2A 2CJUH 5IFJB 5HYQA 3GHEH 4GSDL 43C9A 2D31B 3LDBC 4XBPA 4Q9CA 1ORQA 2P48B 5JR1H 5JW4Q 1E6JH 5C86A 3D39A 2C4FT 4M7JL 4G9FD 3MUGB 5DUBA 3DX9A 2HG5B 5F71A 2ATPA 3WE6A 2Z31A 4ZTPH 5GGRY 4CMMA 1MFAL 4WU5A 4IOIA 1U8MB 4LIQL 4YHIB 4YXHL 2DRUA 3U4BH 4U33A 3QDGD 3VH8A 4P2OD 2LAGB 5EO1A 1BQUA 4OV5A 1IEHA 3H3BC 1I8MB 3QUZA 2VDQL 1JWSB 2EICA 3OPZH 3D87B 4UQ2A 1KELL 5C0BB 5C0CA 3UTOA 5IJKC 3EZ8A 3INUH 2VIRB 1II4E 4XI5D 3DX7B 4X6EB 4NZUH 3ZE0E 2ZUUA 2NTFA 2AI0L 3B3IB 4F7PB 3QI9C 1PVHA 1SHMA 4JO3H 4LMQE 2AJVH 1CXIA 1XAUA 3KAAA 3HCVB 5DJ8B 2X42A 3O3EA 3HG1A 3B43A 3NCYS 5I1AA 3EIFA 2FCBA 4NNYB 1R5IB 5C0RL 4MXVF 5KN5B 3MV8A 5GJSL 4LLDA 4P2QD 4TUKL 3BZEA 3VFNA 1FAIL 3G5YB 3U0WL 2VQ1B 4FQPA 4XP4H 1EA9C 1OY3B 1DANU 1PLGL 4IIQB 5DRXA 1VGEH 5HHVH 4MD5B 5HYIA 1KENL 4HIHB 4EQ3A 2PXYB 5GGUA 2YC1A 2B7DT 3PP4H 1GOFA 3CDGB 3KJ6L 1B0WA 2V2WB 5BRZB 1OT1A 1N26A 3D39D 1PDKA 4FABL 4PJ8C 2X4OB 2ZUQB 5JXAL 3LH2H 4GW4B 3GDBA 1JF6A 5D7JA 5IB2A 2AQ2A 1HXYA 2B0SL 5EZLA 1WC7B 1ONQA 3ZKXC 1S7VB 1GYAA 2VR9A 3WIHA 1D5ZA 4G6FD 1ADQH 4DWHA 1G6RA 4R97B 4WW2F 1R5VA 1AGDB 3DI2B 1YEGL 3FQWA 4K55A 1TJIL 4R2GC 4GXUM 1CL7L 2VDPH 3GSVA 1KN4L 2UUDK 3C5JB 5GGVH 4G6MH 4JG0H 5H37H 5LBSH 2VDQH 2XXCB 2PTTB 3UPCA 4S1SH 3S37X 4PR5B 3VFVA 1QUNA 1MAMH 1QKZH 4Y5VB 3KYKL 5IQ7H 2W38A 1T89A 4MB5A 1KTLA 4Y1AA 4JFEA 1VDGA 2ITCA 4YIQA 3SDDD 3CUPB 5A3ID 1CLOL 2ARJQ 4RFOL 1JPSH 4D9RE 3T4YB 4XRCB 2BY1A 5HDOA 2OSLA 2XTJE 4N0YL 4KZEH 1N8ZA 2BOCA 1IGJB 2J6EH 4BSVA 3PDGA 5TE6H 5FUOL 5BJTB 3L5XH 1R0AH 2ADIA 3RVTC 2IWGA 4YWGH 5FKAA 3V5DB 1KJVB 1T83C 3MV7E 1CQYA 4MWFB 3MNVA 4EI5C 2UZYB 2VAJA 3MGAA 3KR3H 3MOAL 3HI6H 1JPTL 4DW2L 2J8OA 4Y2DA 2IC2A 2B1AH 4OCWH 3PP4L 4LIQH 4LAQL 2Y07L 3QEGL 4PJDE 4U1NB 1LMKA 3AU1A 3BRFA 1QPXA 4G8IB 4R4BA 2QADB 5DSCA 2EKSB 5AAMA 4JPKL 5FYKD 4YBQD 5CD3B 3ZDYF 4ONFL 1DLHA 4ENED 1UC6A 3RZCC 5HHOA 3TWCH 5I17A 2KPNA 43CAB 1MCWW 1AGCB 3MRJB 5ACLA 3FAWA 4PP2A 4PJAA 1MRFH 3K2UL 1JGVH 5J11C 4XC1L 3QDGA 5J1AA 4U6TA 2FBJL 3BW9B 3FFDB 4AIZA 1F4WL 1MJUL 4JRXA 5TE7L 1A5FL 3DO7A 3IDYC 5C3LD 4KK6C 2MQCA 4PV9A 4XBGB 4HMCA 5DVLA 1IEBB 3NN8B 4LCWD 4NZRL 3VXQB 3BPNC 4MMXC 4H1LH 2VE6A 2CLVA 1T2JA 2DQUL 3FQXA 1H3GA 5IFAL 1UT9A 3UDWA 4U1KB 1Q9KA 5B22A 2ZKHH 1RK1B 3EDDA 2ICWA 2BVQB 3IDIB 3L3DB 3PGFH 1M71B 3G6JF 4OQTA 5E8OA 4OD1H 5T3ZE 2GSIA 1E6OH 1M05B 1YEIH 4HFWB 4MB3A 4NNPL 2QV2A 3FOLA 5FGSA 4KZEL 4LSTH 4FABH 4H26B 3QIWD 1TXKA 4LVHC 1JPSL 1FNLA 3H0TB 4NBYB 3W11D 2HJLB 1WBZA 1IGYB 2FWOB 2Z35A 1D5IH 5AAWA 2YOCA 3L5HA 5KG9B 1JRHL 3O45B 1MFDH 4OF3A 3VXUB 1MCDA 1CN4A 5D7LD 2HFEB 4NBXB 3GI8L 4Z7UE 5HI4C 1N5YL 2EYRA 4OCRH 4WW1A 3SDCC 3G5VB 4ORGA 4HFUL 1HN1A 12E8L 3MOAH 4WV1B 4I9WD 1G9ML 4U6VH 4ZAKD 3VGFA 1U8IA 4LGSB 1UVQB 1HOCB 3SQOH 2X41A 2DDQH 5JOEA 5HDQH 2X1OA 4PJ7F 1QR1B 3T4AA 4MCYA 1YPZA 2UWEF 5C08D 1OGAA 4PLNC 3Q3GA 4NC1C 4L3AA 2DQFB 3CXDH 5CIPH 3DUUA 3TF7C 1H3PL 1JWUA 2WINA 4OQTL 4KMLB 4IDJL 4UUJB 1WQVT 3CD4A 4HIIA 3HG1D 4RMTA 3HPJA 3ZDZF 3HZYB 1CLCA 2EH7L 5LXGH 3C6LB 3MV8D 5FCUL 1JNNL 5JQ6H 3X3FL 1ZS8A 4M5ZL 4M9PA 1CDUA 3LKPA 5IFAH 2A0LD 2CRZA 4JFFE 1NCDH 1LP9E 1T7YA 2BNQE 4NZRH 4F3FA 4P9HH 5CIPA 5D1ZD 2VDOH 3MX0A 4KXZH 1T66D 2NW3B 5DC4B 3GUTB 3QRFM 3DRQA 3BX7C 5DUMH 4QHKJ 4G7VH 4PRHA 4TSCL 5D5MB 1YY8B 3H9HA 5JDSB 5C9JA 4MS8C 4XMPL 5HGAB 5HGDA 5CZVL 2H8PA 3C60A 2J12B 2FJHA 4QHLA 4GAGL 2R0ZL 2DQHL 3SDAD 3QXAB 1OTUC 1YEDA 5K9KB 5AUMA 15C8H 5GIRB 5J6GA 5HYQB 1CICB 1A6UL 4HEME 3VWJD 4L1DA 4DN4L 1VESA 1G7JB 4F58H 1U8KA 1BEYL 2EDHA 5D7SH 1RD6A 4ZUVA 2IPTL 3MV01 4YXHH 1IRAY 2QQQA 1HKLL 4CMMB 2R8SL 1DVFC 4IOIB 4QY8B 3MR9A 4HWEH 4OGXL 2OYPA 1X6LA 3KXFE 4P0DA 5CILH 1J8KA 2AXFA 5LCVH 1EHNA 2N7BA 3IKCA 2B20A 2DQDL 1DQDH 2FO1A 2NY4D 5E7FA 3ARQA 3ARGB 3OKMB 5C0AB 4PIRF 2GJ6A 1RZ7L 3P40A 3C5ZD 1FL3A 3IFLL 1AQDA 5I19L 2KZWA 4U1JA 1WIPA 4TVPD 3BPCB 2DD8H 4ALAL 4DUXA 1NC4A 4XC3H 3Q6FB 4M48L 3PWJA 4F33B 3IJSB 1UWGH 1JWMB 4LSDA 4JDVA 3W0WD 5D1ZA 3QHTC 5I1AB 4YGVB 3SO3B 2CLZB 5T3XE 1F00I 2OTWA 1IQWH 4P5TB 3H2WA 1YEFL 4ZFFA 5DTFA 5FA4A 3PG2A 4PJFB 5FO9A 3VWKD 4YXLL 1A7QH 2D7TL 1F97A 3MRFB 5J11B 1KELH 3GBMH 4ZS6D 1EEYA 3D9AL 4RISH 3NZ8A 1DQQA 4LVOB 1MHHB 4OBSA 5EG6C 2WBWB 2A6DB 3SN6N 1LE5A 3SQOL 1MI5E 1PSKL 2X4OA 2NR6C 2GJ6E 2OL3B 4J6RH 3UPRB 4WCYL 1CIDA 1INDL 5D7LA 5IW1A 2VXQL 4KROB 3NIDE 1WC7A 2ZCHH 4CVWA 5F6IB 1PX3A 4Y5XC 4HK3N 3RKDC 3CXDL 1D5ZB 4R97C 1AR1C 1G7IB 1Q38A 4MA7L 1ZLUK 1JZ4A 3RAJH 1EBAA 1LEGB 1UA6L 4NRZA 2YPLA 5DVMA 1HCVA 3JV6B 2A0LC 5DUPL 5DYOA 1TENA 5L8LB 3T1WA 1CXHA 2LVEA 4O2EA 2CXGA 4K2UH 4G3YH 1BX2A 5T3XL 4APQB 3RP1A 2AK1L 1ZWIA 3VFVB 5DS8B 6CGTA 5ESQA 4ODHL 5KVGH 3MLXH 2I60L 4HWEL 3ILQC 4PBWD 4M7ZB 5D72L 1NJ9B 1N5AB 1VEMA 3WFBL 2A9NL 1MI5D 4XCEA 1BJ1J 3K8MA 4FZ8H 3T4YA 1U91A 1X7QB 1W0VA 5F7FA 5MI0B 5DJ6A 1NGXB 4FQCH 3I75B 4LPCA 3TBYA 1CBVH 3TV3L 1ZGLB 1AE6L 5E8DL 5DMYA 5ADOH 3OX8A 3TZVB 5FUZH 4Z8FH 4LASH 3ZT5A 1CL7H 4KY1H 3DROA 4K07A 1S9VA 5KOVC 5HGBA 5CEXB 5D1QD 1KJMB 4UT7H 3NMEA 5HI4D 3VFRB 4NKOB 1BFSA 4PJCA 3V52L 4GXUN 1H9VA 1ZT7B 1QO3B 1TJHH 3KLDA 5JHLL 3JWDL 1EFXA 5D2LB 4LHUD 2NY6D 5FAAA 1KSRA 4Z7OF 1DUZB 4HMDA 1F3DH 2PCPA 3EFFA 4U1NA 2XIDA 2NX5E 1FE8L 3AU1B 2ZCKH 1NFIA 3J7HA 3FN0H 3T2PA 1YJDL 3VMPA 5A2FA 3H8NA 2J8UB 4NO3B 5IROC 1KC5H 1WEJH 1Z9OA 2P5ED 3OXRB 4IJ3C 5EU6A 2OJZH 1QYGH 3SE3C 1XZ0B 1XF3A 5EU3B 4U1MB 3T3ME 3DECA 3IXTB 2CIIA 4LRNH 4N0UA 5F7DB 1QA9B 5SWSE 3ARFC 4ZG1A 3MLYL 5GISH 1WFUA 1L4IA 3AREA 3MGTA 4UV4H 2AK1H 4LCCA 5HJ3A 5DJAA 4DZ8A 3WFCH 3GNMH 2W0LA 2B4CC 3K81A 2OI9C 4MXQD 3W5MA 2CLVB 2NZ9D 4JLRB 1A7NH 2QQKL 3ZTJG 5DRZA 4WEBH 2BOBB 4J3OC 4NC2B 4ZXBC 5DF0A 4U1KA 1HSAB 3T77B 1UKSA 1R6VA 1M71A 5E8OB 5B38G 3OGCB 2MSPA 3KYOB 2AP2A 1G7QA 5IOPA 1SM3L 3WLBB 1UXSB 2ORBH 3PWUB 2QSVA 4NQDE 1Z9MA 1I3RB 2E3VA 3U9PH 5L2JA 4RNRA 2FWOA 3F7RA 2E9IA 5ESVA 1TITA 3MBEC 4LEOB 1JYNA 5GS3A 4Q6IB 2BRRH 2FGZA 2CMRL 3SDXA 4NN6C 3QHZH 3GMPA 3IJHB 1MF2L 4LLUA 3HNTL 5J3HC 3MLTB 1X5AA 4FQJH 2P42B 3WHXA 4WW1B 5IUSA 4X7CC 1Q94B 5HTSA 5F89A 4L9LC 4LHUB 3JWDH 2MCPL 4CMHB 1NANI 1ZVSB 4LCIL 2ENYA 1E28B 1CLYH 1I1AA 2XKSA 3RWEB 2YWYA 3L5WA 4NQVB 5C3TA 2XN9A 1CGTA 2HT3C 2VL5A 4UIKH 1QBLH 3TH4T 3BQUA 2LE9A 1MPAH 5E7BA 2XQYG 3KJ4C 3KPSA 4O02H 3GIZH 3VWJB 1MVUB 1G7HB 4UILL 4ZAKA 2WUBH 1WTGT 1J10A 4M62L 4JN2B 2O61B 5EWIL 2AERT 3WO3B 1NCUA 3LKOA 4YDJA 3O2DA 3FZUC 1UB5A 1SQ2N 3SCMC 3WNOA 1J0JA 3MFFB 2O5YL 1RUPH 3B2VL 5T1MA 1I8KA 2PXYC 3U79A 3F7VB 1F3JA 2Z8RA 3PWNA 2VMFA 1BPVA 5GGVL 2HT2D 5E4IA 1RK0A 1TTFA 3LKNA 3DPBA 1QFWM 1TNMA 2BRQA 4MJ5A 1XGQA 2EXWD 4TSCH 5CGYD 3TN0A 4OCLC 4MJ6A 3NFSL 2I9LA 2X89D 3W39B 3KJ4B 3SO3C 1D3CA 4RZCB 4HH9A 3ARPA 2EEAA 1I1YB 1PD6A 3DNKA 3TO4B 3AC0A 1NUGA 1J11A 2HN7B 4GUPA 3PWPD 2FLRT 4JKPL 4HIEB 1N6QH 1ED3A 2L7JA 4DEPB 5D9SB 5T33H 3TA3A 5C0DB 3I3BA 5ESAA 2GTWA 2F53E 3LN9A 4ODXA 3BN9C 3H9HB 1FVDB 1HHGB 5TF1H 1RPQA 4I0CC 4XMLH 4Y2OA 5EIIB 1JZ7A 5C9KA 2FJHB 4NN6B 5IV2A 2AV7A 2DJUA 1JNHA 1KLUB 4W68A 3U0TA 1U8KB 4G7YH 1RUQH 1NUFA 1TVHB 5I1DB 3ZDXF 1CTOA 4GG6B 4LPUA 1HKFA 5CSGA 3SDAA 4J1UA 5EUOB 1NCDL 4S1SL 5DMKA 3DHJA 4W81A 3MCLH 4K7FB 1W2KT 2Q8BL 2NW2B 2XWJB 4PUBL 1ETZB 4W6XB 4MJIA 3CZJA 1CZ8L 3IKCB 5ID1B 4ZOCA 1CE6A 4K3JL 4UOW1 2HYMA 2X9WA 3FRUA 3Q6GH 4Y4FC 3MXWH 4L3EE 1JI2A 4B41A 4PLOB 4XMPH 4RIRA 5C09D 3MACH 5I66A 5D70H 4UIKL 4JFYA 1GSMA 1LQSR 1QLEL 5CJQL 1SMAA 2FHFA 3S4SA 3GSQA 4U3XA 4F33A 5CHNB 1IC7L 3LRSA 4WI6A 4JFDE 1W72H 4JE4B 4UB0H 2NLJA 3ARDB 2Q20A 1J1OL 2CKBL 4XP1H 2OZ4A 4JQXC 3TGXA 5IBLC 2FIKB 4K8RL 5DR5L 3GB7B 3OKEA 1BLNB 1ES0B 5DTFB 3EOAA 4UU9B 3WUWA 2CSPA 5IR1B 2FJGA 5F1IB 3P73A 4TTDC 1OPGL 4EDXB 5HVFB 4PLKD 2R56L 5FDWB 3HAEB 4PJHB 1P7QD 4NUGL 2BX5A 4CU8A 3P4MA 4ZD3L 3B8SA 4ONFH 2IJ0C 3RY5A 4HSQA 3UTSB 2P8PB 2G2RB 1H5BA 2JK5B 9CGTA 1HINH 4UIMB 1LE5B 1FV1A 2C1PB 1IGCH 4JFFA 4Y16C 4YDVB 1IMHC 1NUNB 2YBRA 2OL3A 1S7WA 1WAAF 2H2SD 1MREL 3LEYL 1N6QL 1A6ZB 1RIVH 4LHUG 1UZ6F 2VZUA 3LN4A 4TULH 3LPFA 5I16B 4EQ2A 3QCUH 1AXSB 3RIFF 3FO9B 3SQBA 2HG5A 5E8NA 1QR4A 4KVNH 4F2MA 4S1QH 5I1EL 3C5SB 4I3RH 2NY7H 1A5FH 2CK0L 5IK3B 1T04A 4OCXH 4C4KO 1IAMA 5C0IA 1FG9C 4CVZB 4D8PB 1YEJL 5EO1B 2VXVH 3D39E 2BY3A 3MUJA 3MLWH 1KNOA 5FO8B 4UQ2B 5C0BA 4RISL 2NY6C 3OF6D 4ZNEE 2P5EE 2E8ZA 4APQA 4KQ4H 1N6VA 1ZSDA 4JR9H 1IGFH 5ICYB 3P0VH 4QRPD 3FQRB 5BV7B 4LNRA 5FGRA 1D5BB 3HCVA 5DJ8A 1KB9J 1S9WA 4GSDH 3WLWC 3O4OB 4MB4A 3CFBB 4XCEB 2BSTB 1KG0B 4KDVA 4YXKH 3ARWA 1ZVYA 4LPVA 4XI5C 4KI1A 4IDJH 5T3ZH 3I75A 3DO3A 3L9RB 3VFUA 4D9QE 3FFCE 4JKWA 3RAJL 3RWFA 3VXOB 2OXHA 2VQ1A 3OX8B 3F7QA 4CN4A 3MLRL 1IL1A 5GZND 2H2PC 2E7LC 5HYSA 3CLFL 4PBXA 1R3IL 4UI2A 4X6FB 4G9FB 2PXYA 5GGUB 4HFUH 4OM0H 1UFUA 4AQ1B 2V2WA 5BRZA 1A3LH 1PKOA 1QLFA 4YHZH 4C4KT 4X6DB 2RB8A 3EFFB 3LZFH 4G42B 3WHE1 2VERN 5GS0L 1YQ2A 3U2SB 5E2TH 2V2XA 1FO0H 3V0AC 2YXFA 2ZP0T 5D71H 1T0NB 4OZIE 4P4KC 3BVNB 2FR4B 5FECB 2UZXB 4MZ2A 4MA1C 4HPYL 3VXME 1QFHA 5EU6B 2V9RA 2F5AL 2NTSP 1XZ0A 1KN4H 1FVCA 5EU3A 1EO7A 2BHYA 3IXTA 4FQ1L 3O6LH 2XY1A 1P6FA 1MWAH 1C5BH 1UWXK 2I9TB 3E2HC 1Z5LB 3C5JA 1DBMH 1DQTA 3IFPA 2QQNL 4J23A 2YPVL 3VXMD 4YHNB 4PJAE 4XP1L 3AS2A 1I7RB 1S3KL 3GBNH 5TH2A 3FAXA 4DZ8B 5EC1B 1N64L 2Y72A 5ICZA 1LD9A 1SBBA 2D0GA 1VFAB 4LLYA 4WEBL 5KSUB 4OCYL 2AJSH 4NQEA 3QNYB 1IZJA 4JFEB 1RZGA 4ZFGH 4NCC1 1IFHH 4JM4H 3QUXA 4X4YB 1HSAA 2NNAB 4OT1L 5C2BH 2JF1A 3T77A 5IMLB 3BPNB 1N8ZB 4EUPG 3BN9D 1B3JA 5D6DC 1F2XK 2QSQA 3W11C 2D03H 1EAPB 4JFZL 2ADIB 4QRPE 2VAAB 3EOTL 1A7RH 2FSEA 4FQJL 3V5DA 2VABA 3WNNA 3MNVB 1OGTB 1CDGA 1ZA6B 4Z77B 2X4NB 5LBSL 4IMLB 4P3WA 3S34H 3IU4L 4KQ3L 3VH8G 3TH2T 3O9WB 3GSNH 4LEOA 1XIWA 4P59L 4PP1C 2W65A 4Q6IA 1OWRM 3T0DA 3SDXB 3S88H 2I5YL 1PQZA 4LCYB 3RU8H 2WZPD 1A6VH 3E6HA 3FCTA 4M5YL 3E0GA 4G8IA 4PRPD 1IAIM 4Y16A 1KXQE 2X5PA 4LCIH 3LB6C 4B53A 1Q94A 5DRNB 4OM0L 2I26N 4K9EH 1A7BA 1VGKA 4XGZA 4KI5C 4JGMA 4QXUL 1BREA 3O2VL 3PL6C 2YD3A 3V6FA 2XN9B 3U30B 3GMLA 1T5XA 3B8YA 3UEZA 1ADQA 2FJFA 3VFGH 1S7XB 3CFKA 3ZYIA 5IMMA 5IB1A 2FBJH 3VWJA 4ZAKB 5AG9A 2BFVH 1T7XA 2AABH 2BNRE 2YRLA 1SEBB 3BMVA 4ISVA 1OTSD 4HIXH 1Q72L 2R29H 1OB1A 2DTML 3HPLA 4GW5B 2J2ZA 2VE6B 3F7VA 3LIZL 1KFAH 1IT9L 4XP6L 2RJMA 3PGFL 3UO1H 4R26H 1Q9KB 4M00A 4ODWB 4C58B 2NY2C 1G7PB 4NO2B 3EZJB 4OLUL 4MJ6B 1JHKH 4JY4A 2ZOKB 3MRMA 4DKEH 4P9HC 5D72H 5JORA 1D6EA 3V95A 1F4HA 4HKJA 1BQHA 4L5FH 4QWWD 4CMHC 3FB5A 5E9DE 1G7LB 3NBNA 5D96B 5C0DA 4OI9A 4DTGH 3LEXA 4HDIB 5F8RC 3S37L 3LHPH 1IZKA 3RZWA 3QO0B 1BBJA 5KG9A 3VXUA 5JIHA 5C08E 4LASL 2IFFL 1P7HL 1N5YH 3FQNB 3RWJB 1C08B 1X5YA 2AV7B 5F9DC 4I4WA 1JNHB 5C07D 3HNSL 3QUKA 3ZTJH 3V6OE 3BDBA 4PUBH 3HG1E 4N1HB 4MD0A 2AK4E 4J2XA 3EYFB 4P59H 3Q6GL 2P5WE 2EYSB 3PGCA 2XN9E 1C1EL 3CGTA 4JM2A 1DLFL 4OIIH 4UAOC 1TZGH 4AEHH 4M8VA 5I8OH 4O2CB 2AJYL 3T0ED 2BC4B 3TPKA 4MJIB 4WEUD 5ILTH 3HZKA 4WFGE 1GPOL 4P3CH 4TVPE 4YGAB 5C0JA 2O5ZL 3RTQA 1CE6B 1IQDB 1YYLH 4UDUA 5DJDB 2EDJA 1JWUB 2WINB 4OZ4B 4L29A 1B6DA 2D0HA 5CJQH 4RIRB 1E4XH 4WGWB 1ZT4A 2XRAH 1FIEA 1NBVL 4OCMC 4HUUB 3HPJB 3VXMA 1T4KA 4PS4L 3ELAT 1FN4A 3LQZB 4OZIA 2B1HH 3BZDA 3OTTA 4IS6B 4ONHA 4WFGD 2NLJB 3P11H 4ESKA 1E4XI 2D7OA 1P1ZB 1DUYB 1ZA3B 4FTVD 2YD4A 1QSVA 3CFJB 4V1DE 1N3NA 3MRRA 1IM9D 2BY2A 3O3BA 1HH9B 1T80A 3EOAB 4F3FB 3C8DA 5CIPB 3ARBA 4P57B 2NMSA 2OL3H 4LQ1A 2FJGB 2OP4H 5AZ2L 3ZE2F 4NUGH 3GUTA 4P4KA 1YMMB 4RMUA 4U1GC 3O41B 4H0HB 3WN5B 3NAAL 4M3KB 4DKFL 3PQYA 5D5MA 4XBEL 5C07E 3F58H 4FTVE 4YDLC 4XVUC 5T3ZD 1A22B 3IYLW 3PHOB 4KDWA 4JCLA 2JIXA 3TJHC 5D93C 3F5WB 4R90L 3WJLA 2DQTH 4X4MA 4ELKA 5EUKB 4IRJC 4WO4C 3RPKA 1IEAB 4ZXBA 2IBZY 3P9LA 2GITA 4AEEA 1DFBL 4HWZB 4QRRE 4Y19A 2XNAA 4LGPB 5J1SC 3S7GA 1AJ7H 2CK0H 5E8NB 4OF6A 1YEGH 4JFXA 4L3CB 1QQDA 1WTLA 3QEUA 4F7TA 2DJ4A 5GRXG 2W1NA 2J8HA 4JZJB 3MYJB 3HB3C 5FXCH 3QDHA 5E6IC 2H2PD 2AXFB 4M93C 5EN2A 5C0BE 3NCMA 1RHHA 2IPKB 2W60A 3ILQD 3NCJL 1KN2H 3S3JA 2VWEE 2GJ6B 4PJDB 1ZSDB 4FQXD 1HINL 2VLKA 2AK4D 3ARDD 5CS7A 4RA3A 1AQDB 3ET9F 4HS3B 1FNAA 2XA3A 1EGJL 4R96A 4DFIA 2BNRD 1MHPL 1J05B 4PJCE 4APQC 4JRWA 5DJ0A 2DIJA 5INCB 2WUBL 3GSOB 3LKSA 1WZ1L 4LL9A 2ICEA 2UY6A 4YGVA 4DN3L 2DLIA 3BYTA 3UAJD 4P5TA 3GI9H 3S37H 3K46A 1IBGH 4JB9H 3TP4A 3EGSB 4PJ8A 5ALBL 2XKNB 4TUOB 5F21B 3UJTH 2BMKA 2O5YH 4OCWL 1LNUB 3PL6B 3RZCA 2RFXA 1U36A 1R3IH 3O3DB 5IFHL 1QSFD 3QZWG 25C8L 5HYSB 2HT4C 4EXKA 4ZUTB 5BZDB 1DQQB 2I27N 1JYVA 5DD1L 4PY7A 4MNQA 2A6DA 3OJVC 5F1SA 1QLFB 4MDIA 4X6DA 1WWAX 4OFIA 4O2FB 5F1OB 2VLRD 4C83A 5H94A 3LMJH 1CR9L 3JWOC 3A6CL 5FYJD 1ZLSL 4L8DB 4FMKA 5FECA 4F37K 3S5LA 3CDCA 4IMKA 1P84J 2X4TA 1RZKL 5FV1L 2YPLE 5HGHB 1IJ9A 1BHGA 4AZ8A 1A6TB 4WNQB 3JV6A 5IIEB 4K3DH 5CGTA 1A7QL 3TVMA 3MC0A 1T2XA 3FT4A 1N4XH 1VSCA 4P2CG 3O2DH 4OLEA 4D0BA 3GMNA 3T65B 1BX2B 3PP3H 5IG7B 3SKUD 3M8OL 3P4NA 3DGGA 3IDXL 5L8KB 3FO0H 5DVNA 1I7RA 5IWLC 4GO6B 5IEHB 4XCYB 2EXYD 4KK9C 1RIUH 3DLQR 2ICES 2GI7A 1JI1A 5EC1A 2GY5A 1NJ9A 5SX4H 4LSVH 5KVFH 3QG7H 1FDLL 5KAQF 5LQBH 5E99L 5CUSH 1MQ8A 5DK2A 4NNXB 4R6UA 4ZNCD 5IMLA 2M8XA 4I0PC 2E27H 4O9HL 2VXTL 1H5BC 3PWVB 2ED8A 4HUWA 2IAMB 3IT8D 1IBGL 3MLUL 4JB9L 4W4OC 4FQ1H 1KCVL 3MRPB 1MJ7L 2VAAA 3GIVA 2UWEA 1MH5A 3TESA 4QGTA 2I07A 3TCLA 1ZAGA 1KXVC 4DUWA 1ZT7A 4LP5A 2VZVA 5IHZA 1KEGL 1N2RA 1XIWB 4YX2H 1LEKB 5D2LA 1LP9B 4JDTL 4U4BA 5DD1H 3PQYD 1LVEA 3AGVA 4GAFB 4NQDD 5B3JF 2PCPB 3OZ9H 4YDIL 1O0VA 3OR7A 5TPWL 3VG0H 3TVMC 4XPHL 1A7PL 3SY0A 4QXUH 4JHZA 2XFXA 2J88H 2W0KA 3BD4A 5EBWB 3MCKA 4S1RH 5GS0C 1QBAA 5DC0A 5EOCH 5EU4A 1JE6A 5ADOL 3GO1L 1NLDL 3FT3A 5H2BA 3GMLB 2AJXH 4OTXL 3TBTA 2CIIB 4ZUWA 2VXUH 2QL1A 3CXHJ 4M43L 4BQ8A 4OFPA 2YD9A 5DDHA 4CAGA 3S35X 1G9MC 2EIEA 5GGVY 3QDMB 1SEBA 4ISVB 4F15B 5BO1H 1RZJH 2H1PL 3S36H 5CBAA 3AREB 3R0MA 4HHAA 5BV7C 4LCCB 1UM4H 3CK0L 1Q1JL 4WJ5B 5A43C 3LIZH 2X4SA 1CLOH 2IQAA 3QQNA 4RFOH 5CILL 3KLAB 2VYRE 4PRHE 5HHPB 4LKXA 3RY6A 3O2DL 5EOQH 1OPGH 3BIKA 4XTRD 4XPBH 4A6YA 4ELMB 1YJDH 4Y7MA 1G7MB 4KQ4L 3KXFD 2IGFH 4MAYB 4GG6F 1G7PA 1RZFH 3PWLA 3KYOA 2BNQA 1WV7T 4TTGA 1K5NA 3GKZA 4PRIA 4MA3A 5FF6A 3VGDA 4QKXB 1I8LA 1TETL 3WLBA 5CMAA 1ZHKB 3DUHA 1KJ2L 5LQBL 5FOJA 4I8DA 4QHNA 5HHQA 5GHWH 4NQDA 2DL2A 3LOWA 4EJ1C 1I3RA 4NM4H 1KT2B 4HKZA 2VLRE 4XT1C 2BRRL 5DJCB 1MHCB 3RNKA 4UOJA 2V2TB 2FGWL 5T3XD 2XOTA 1QRNB 4P23A 3FQNA 4LKCB 2N7AA 4XCNB 1N0XH 3SKMA 1JZ8A 4ZPTA 5SWQA 1J5OH 5F96L 3VG0L 5F89B 2O5ZH 3CAFA 3D2UA 1ZLVK 4XH2B 1I1AB 5E94A 2VLRB 4JDTH 3RWEA 3LDBB 1ZXQA 1GGBL 4O2CA 1FFOA 5J13B 2V9QA 3JV4A 4J3UA 2F5BL 3KPTA 1GOHA 1CD1B 1X5LA 4HW6A 5GJTL 4GKZA 3BIAX 1U0QA 4XMKH 3P0GB 4HPYH 4N0UE 4Z7UA 4WY7H 4OZ4A 4ENEC 1NBVH 5JTWA 4XHQA 4NDMA 3C2AL 4P46D 4ALAH 5TDOA 1F4YL 1UB5B 1NGPH 3RA7H 3MFFA 2VZ1A 4J4PC 5T1MB 3KPRB 4Q6YA 1AY1H 1F3JB 1A3RL 1CF8H 4BZ1L 3LQZA 4TSBL 2Q86A 4ERSL 1NBQA 3UTZB 1RVFL 5FHAL 1P1ZA 4XPBL 5IJKA 1C1EH 1K4DB 1N3NB 3MRRB 1ORSA 4XP5L 3ZKNC 1KCLA 1QSFA 1OQOA 1DL7H 4Z0BH 3ARBB 4RZCA 4P57A 3WD5L 5E8PA 2Q8AL 5E2VH 2R0WL 1X5ZA 3GHEL 5DHVH 3O41A 3BZFB 1GPOH 1FO0L 4HGWB 5D9SA 3TA3B 5KZCB 2GTWB 3GM0A 3MRQA 1KPRA 1NCAH 2YD6A 4YQXH 5KVMC 4L4VE 3P9MB 3GEWB 1F90H 1CDJA 4AK1A 3HLAA 2HT4D 4ODVH 4HWBH 4KUCF 4M61A 3NACH 2XTJB 2KQMA 3ZMRA 2D31A 1BWWA 4HCRL 1IEAA 1FP5A 3P9LB 3E6FA 3HR6A 3CX5J 2VLJE 2YK1L 2DKUA 2VRAA 4G6KH 2CDGB 3WNKA 3VD4A 2ATPB 4JREC 5HDQL 4WU5B 3B5GA 1U8MA 4YHIA 4QEGA 5FUCE 3DUSA 1E4WH 4HIJA 1N64H 4PGEA 2DYPA 4JZJA 4L8SB 3ZZ1A 5GSVA 3O0RH 5EN2B 3MXWL 1XGUB 4KHTL 3DYOA 2HKHH 1GGIL 2FATL 4X6EA 4PJDA 2QSTA 1JGDB 3QYCA 4PLKC 3OJDA 3FT2A 2NY4B 4EUPA 1V05A 1L7IH 2DICA 1EJOL 3GMMB 4R96B 2WBJC 3VFSA 4N8PA 4N8CH 3O3EB 4PJHE 4PLJC 5GJSH 2FDBP 3ARDA 2AABL 2RCSL 4YHOL 4DK3A 1RFDH 3LN5B 3QP3A 1IAOB 1WCBA 3QWRD 4HIXL 3TBVB 3BN3B 3H3PH 1DP0A 3G5YA 1FVEB 3FQTA 4LSSL 4TUOA 2DN7A 2BMKB 1OCWH 1MLCB 4NJAH 1LNUA 4GLRH 1FNFA 3X13A 2X1PA 2ESVE 3RKPA 1A1MB 4Z95H 4ERSH 5IVXF 2ZCKL 2D0FA 2ZWLT 4JQXA 2VITB 5C0NC 4JFEE 3ZKMC 3ES6A 3AM8C 4XVSH 3I9GH 4OJFH 4PREA 5FIEA 5TGBB 2EDFA 1IAII 1CXFA 4JDZB 3UJIH 4G6AC 7CGTA 1LO4L 2DI9A 3TLRA 4O2FA 3N0PB 3FJTA 3RKDD 3SDCD 2CDEB 4GW4A 4C83B 5D7JB 2FZ3B 2NXYB 1HXYB 3MV9D 2P5WD 4BFIB 2F5BH 1FNHA 2ICCA 1EMTL 3MV11 1NCAL 4L8DA 5I16A 2YSSA 3MJ8A 4U2YA 1CXEA 5EUOF 2ATKA 4JZNA 1QYGL 3UXFA 3IDXH 3QNXB 3GKWH 5F9OH 4F2MB 3OKNB 3JTTB 3C5SA 3U46B 4JGJA 1UACH 1Q72H 1RJCA 4XNZC 3KYKH 5IQ7L 1JYXA 1F11B 1JHTB 3SGKC 3T08A 4WWID 4UAOB 4YLQT 4D0DA 5HHME 1AQKL 1AO7D 2HVKA 5CEYB 4Y0GA 4IRZL 3MO1B 4LCWA 4Y16D 1IT9H 2QADD 4D9RD 3SE4A 1LDSA 1F6AB 3LS4H 4WFHE 4TQEL 3SDYL 1EEQA 5HYJB 1NANH 3O81A 1T0PB 4I0PA 1X9QA 4WUUA 1TQBC 2BP3A 3I50H 3UTTA 4Y5VA 5IP4A 1F02I 4LNRB 4PJ5B 3I3EA 1D5BA 4Y4KB 4PJ9D 3U83A 5ALCH 4G8FA 1KTLB 1IGMH 5FUCC 2V7NA 2R9HC 3L5XL 2ITCB 1CGSH 5KAQG 3KPRE 3EO0B 4TULL 1JRHI 2VOTA 3N85H 4K23H 1FSKC 1V5JA 5DD5L 1LK3H 5J06A 5LWYL 4MX7B 3RWFB 2GJZB 4ZUUA 2IAMA 1OSPL 2FECL 4BSVB 2VNCA 3STLA 3G9VA 2CMRH 4FQLL 5BJTA 4MAYC 3MRPA 3QNZB 3HNTH 5FKAB 2UWEB 4D9LL 1KJVA 3NPSC 3CMOH 1MCKA 4XHJD 1A21A 1N2RB 4XB8A 2Y07H 2F54A 4NQSA 3WS3A 4KDTA 1LP9A 2Y9RT 3KLHC 4FNLL 4Z95L 1LO4H 4WFEE 3RVWD 1KJ2B 4R4BB 3SY0B 3WNPA 2DWEA 3HE6B 1UB6B 2EKJA 4DAGL 4YHYB 1DLHB 4E5XB 4UT9H 5FYKU 4I3SL 1P4LB 4UNVA 43CAA 1J8HE 2CKBB 4B7IA 2DQTL 3VFTB 4PP2B 4PJAB 3QEQA 1MQKL 5I1IH 1X5FA 2K7QA 4Q0XH 4H0IA 1MWAA 1UEMA 3CLFH 3QDGB 4JQIL 4OV6F 4PJ9A 3TIDB 1XGYH 3M17B 5DDHB 5JW3L 4WWKD 1Q1JH 5CEZE 3SGEH 1DE4B 4JM2D 4PV9B 4EN3D 1F6LL 5ICZB 3C9NA 4BSWB 5DGQA 4ELMF 4WUKH 1Z3GL 3RDTC 3WCYA 1VERA 4YUEH 5TQ2H 3FQXB 1FO0A 5AYUL 5JIIA 3QUXB 5D71L 5GPRA 1NDGB 1I3UA 2NNAA 1DEDA 5BOPA 5HPMB 4XVSL 3F65A 4XBEH 4OZFH 4J7RA 1QLEH 2ADGB 1FSKB 3FOLB 1LK3L 2P8MA 4QXGL 4CDGC 1JN6B 4KPHL 4YNYB 3LY6A 5GHWL 3FN9A 3VD7A 2DQCL 5D7IB 5IW6B 2VR4A 4NQDB 2VABB 2BSSB 4KKNA 4P5TC 5H35A 1OGTA 1TCMA 1ZA6A 4PGCA 4Z77A 3GMOB 1XGPB 3BT2H 1QBMH 3DTXA 4GBXC 4NZUL 5DJCA 3WV0A 3BP6B 4U0RC 1MHCA 1DCLA 4A2LA 2CGRL 3TNMA 1QRNA 3B9KC 2HFEA 4OCRL 1UACL 2JJSC 12E8H 2OS7A 3ZKSD 3ZHKA 4XNZB 5EBMB 1BVKB 1NCNA 5JMOC 2FX7H 2OJZL 1Z9SA 4AMKH 2NYYC 4WV1A 4Z76B 5E94B 1U8IB 4JY6B 1YQVL 3DV6B 4BFBD 5EFIA 3L3KB 4MCZB 5C09B 1S7XA 5D7IE 4MCYB 3WO4C 5IB1B 1CR9H 3IDNB 1T21A 3QDGE 4U1GB 5FCUH 4IDLA 3CU7A 2DQFA 3E3QE 1KCKA 4ZTPL 3H3KA 7FABL 1QNZH 2VZOA 3MLZL 3QXVA 2H32B 1J9CT 4OCXL 4HIIB 1A7NL 4A2MA 4UZGA 1NFDF 4JY5L 3HZYA 4UT6L 4O4YL 3A6BL 2C9AA 5GGRA 4XWOD 4D9QD 2WWKO 1A3QA 3D85B 1UH3A 2RAMA 2OQJB 5IFHH 5D8JH 3KS0H 3SO5A 2A2QT 4Y5XB 3UMTA 4NO2A 5IESL 4KRLB 1ZLVH 5DQ9B 4ZD3H 5I76A 1A7OL 2GUOA 1MFBL 3KS0J 3QFJE 4DOHB 1D6EB 1M7DA 5JHDD 1OW0A 1JVKA 1T20B 3QIUC 2NZ9C 3JXAA 5MENB 4L1HA 3LMJL 3DRQB 1EHLL 3UC0H 1OHQA 4YBQC 4U49A 3QO0A 5JDSA 3P9MA 3RIAK 4UTBL 4HJGB 4UNUA 1A6UH 3HNSH 1G84A 1C08A 1E4WL 5K9KA 2XZCH 3EYQC 2MNUA 1FORL 4G80B 4EXPX 1UWEH 4N8VG 5J12B 4ZS7L 1J1PH 1R3LA 4PJGF 4CGTA 3U0PB 5EZIH 5D6CB 1GGIH 2FATH 3BMWA 3ULVH 4X4ZA 2V7HA 4EI6A 4TOYH 2Y1VA 3UP1A 2C1OB 1BD2B 4JFFD 4PGEB 5LJYH 4CU7A 4FZEH 1MCLA 1U8JA 1A7PH 5I18H 3QCTL 3MQIA 1C16A 4KDTC 4JVPA 4NWTH 3B9DA 2ICWI 1XGUA 5TQ2L 5I71B 1VB9A 1AH1A 4LOUC 3U1SH 4OAWB 1IQDA 4UDUB 4N0CC 5DJDA 5GRVL 4L29B 4PGDA 1EGJA 5T3ZL 4KH2A 3MRHB 5K9OB 1A0QL 1FL3B 1VPOL 2DI8A 2QR0B 1WF5A 1OAYH 4EUPB 3BPCA 3TA3C 1UZ8A 2R15A 3Q6FA 5F70A 4JDVB 3AB0C 3EAKA 4TRPH 5D1ZB 3NVQA 1INEH 1SJXA 2ZUWA 3LN5A 1MAML 1C5DA 5DHYB 1ZA3A 4APQD 3BEWB 5FYJH 5D1QA 5JIPA 3RWGB 4U6HB 5HYJE 3DXAA 5HD8D 4HC1A 5E2WL 2H3NA 3NCFB 4WENB 4NFCA 4LPXA 4TPRL 1F8TL 3THML 3B2UD 3OKOA 3VFOB 3I9GL 4UBDD 4U1IB 3WN5A 1R24B 1CFSA 3B9KB 4JO4H 2VXQH 1EEYB 3MTRA 1DQDL 5AD0A 1GAFH 3MRBA 3MJ6A 1HE7A 1D5MB 3HB3D 5IKCA 3IS1X 4LLVA 4PREB 2BVOB 5JPNB 4HULB 3OKKA 1C7SA 5GZOC 3ULUC 4QRRB 3F5WA 3MV8E 4MXVE 4X4XB 5IFJA 1IC1A 2MHAA 1MLBB 4WI7A 1W0YT 4AIOA 1NKRA 4BFIA 2GITB 4IRZH 1VA9A 1Q0YH 4HWZA 5EA0L