5E99L

Bovine fab fragment f08_b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
molecule keywords Fab F08_B11 light chain
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L01
1IC5H 4Z7OF 2YPLA 3CVHB 3FT2B 3M17A 3EFDH 3GSQA 3E8UH 1IEHA 1MAJA 3VD3A 5LAXB 4NQXB 3UJTH 3FB6B 3ULVC 3CFJB 3O6KL 5IIEB 43C9A 3TBSB 3NOIA 5KZCB 1WFOA 5IF0A 4ODHH 2O93L 5IMLA 2EZ0D 2B0SH 5D7JD 5EU7C 4RA0C 5EUKA 1F4XL 1XGTA 2C1PA 7FABL 4LRNL 3BP7A 2VABA 4O2EB 3O4OC 4Z8FL 1EXUB 4ALAH 5IW3A 3D85A 1JRHL 3RX8A 2XWBB 4X6FB 1AXSB 1K6QH 1OP3K 1RU9H 2QSTA 4ZTOH 4Y4KC 3ZDXE 1BFSA 5JORB 3UTTB 4KZEH 4KQ4L 3SDXA 1A6AB 3ARED 3ARYA 3DGGA 3REVB 1QLEL 4OB5L 1AR2A 3J8F7 4Z0XA 3W9EA 4E5XB 2DQFA 2BDNL 3MRKB 3KNBB 5C0AB 2AJSL 4S10A 1MHCB 3AUVA 2HJKB 4XWGH 5D5MB 4Y5XC 2M2DA 4ZUTB 3L3HB 4GSDL 4WNQA 1F3JA 3CSBA 4NNYA 3UTSB 4ONGL 1IAIM 4OZHB 1KJ3L 4Y4HB 3VGHA 2P43B 5DUMH 1CDUA 2EICA 1YDPA 2R56H 2X1WL 4ZO9A 4Y19B 1A1MB 2VLLB 4OSUL 4D9LH 3JXAA 4JG0L 4PJIF 4IJ3C 1MLBA 4Z76B 3RP1A 1P6FA 4YX2L 1D7FA 5E00B 5JZ7D 4NN6B 4ZOBA 3IU4L 1A1NA 5FB8B 4NCDA 2X09A 3BP4A 4X80H 3CVIH 4P4KA 3N1GC 5BJTA 2APWA 5J1AB 1YJDL 1AHWB 4K3DL 5CINH 1JGVH 4EXKA 3NACL 4P2RB 1BD2D 3MQIA 2BVPA 1NJ9A 3ARBC 3KXFB 1YEKH 1KCLA 4YK4B 1OP9A 3NFSL 1UWGL 3P4NA 2VDKL 4I5BB 2ED8A 4M8QA 1OLZA 3OJVC 5B8CB 3MRCB 4LSPH 2BFVL 5E2VL 4PGZA 4OLXL 5LCVH 3O41B 1WF5A 2BC4A 3MLWL 3P9LB 2F5AH 5C09A 2XG4A 5ANMA 4O02L 3GSVB 3CGTA 3L7FA 3OKNA 1O0VA 2X40A 3QH3A 5EC1A 3T4YA 2FRGP 2QKIB 1YECL 2YD4A 3ARDC 4J4PD 4F9PA 2DQHH 4X98A 1HDMB 4XCFL 4PJ9A 3VFNB 2E7MA 3OTTA 3SGDI 3S35H 2OQJA 5I1IL 5CS7A 1D5ZB 3ARGD 1N6QL 4ONOA 2GJ6B 1HHKB 3G9AB 3QG7H 3FO9A 4JR9H 1LVEA 3I6KB 3EYUL 1HH6A 4YBQD 5ELIA 1VPOL 2YC1A 2NTFA 3AC0A 3IU3B 2VN7A 4HW6A 2G5RA 5DJXB 4PFEA 5DK0B 3MBEC 2CRIA 3CMGA 1NFIA 1PG7W 4RGNC 3WFHB 3FCTA 3HC3L 4G42A 5EBMA 1JPFB 2OZ4A 4F33B 4AIOA 4M7KH 1EFXD 2FECL 3MV01 4FQLH 2LAAA 5EUKB 4RMWA 4ODBD 3V6OC 4BELD 5I1HL 4K9EC 2D4FA 4LPUA 1E6OH 3RU8H 3SO5A 5E2WH 4V2CB 3VXRB 2B1HH 2X1OA 2IPKA 4L4VD 4LVOB 1TTGA 3LMJH 4LCCB 4J3SA 2ZUTA 4R0LB 5C07A 1FVCB 1R3LB 1QYGL 5J4MA 2AJ3B 2FBJL 4I48A 4ELKA 4H20H 4XVSL 4JDVB 5JW5B 3DO3A 4JPWH 4AENB 2I25N 4V2BA 4WW1B 3TNNA 2JB6B 4WNQB 1DBML 3K7UA 5DXWA 5MEQB 5ICYB 5F9JA 4GSDH 3VD5A 2NXYC 5ESQA 3PWLA 1PG7L 4KRMB 5FO7B 4AL8H 5GS0L 5J1TC 4LHUA 3MROB 5D7KD 2DYPB 3D6GA 5INCA 4X99B 5GQBA 4NNYB 3UTSA 4PJDA 3QEQA 1V05A 4FFYL 2F19L 3RDTD 4H1LH 1FJ1A 3AY4A 3GMNA 5A2FA 3VH8G 2J4WL 5IMMA 1I9JL 2UZYB 3RZCB 1KJ2H 1MCWW 5IG7B 5HVHB 3WHXA 2ICCA 3VWJD 4LRNH 2FEEL 4DUVA 4JY4A 5DRNB 1FIEA 2PYED 5TE4L 2PTTB 1AD9B 2OP4H 3IF1B 5A16A 3UTPD 1IGMH 4OAWA 4YO0A 3RAJL 1WC7B 2OXHA 3TYGH 4OFVA 4OGXH 2AJVL 1DBKH 1ERNA 2A73B 2NXZD 2QQNL 4ORGB 3SKJH 2MKWA 1BOGB 1DFBH 2DIJA 5JXEC 1R3JA 5E94A 1KTDA 1P1ZA 4KI5F 3OKEA 4PRIB 5HYFA 4JVWA 5ENWA 2GY7B 4CW1B 3EJYC 1H3VA 4MAUL 1NCDL 4I0KA 2E6PA 5FGSA 5EO9A 3G5VA 2FYYB 12E8L 4UU9B 1A4JB 1IGJA 2H41A 2QJDA 4ODSH 1N3NA 4DJMA 4GW1A 4HGKC 1Y18B 5FK9A 1DBBL 1MCPH 3U2SA 1CFTB 3JWDH 5FYLE 2NZIA 4UQ2B 4XBEH 3FQXA 2FO4A 3F5WB 1KF9B 1HE7A 4LLAA 1CICA 3L1OH 2KUTA 1DANU 2DTML 4HFUL 1INQA 3MYJB 3QO1B 3X13A 2DIBA 5ITFA 2G60L 5DHYA 5DHXB 1JPSH 1PLGL 3W9DB 5KSBE 4KK5C 1P7KA 3VA2C 1FO0L 1QKZH 4GAGH 4PGDA 1QR4A 1VEPA 2CIKB 4M6NH 4Z7WA 1XH3B 4DFIA 4LEOB 4QRUA 2GJJA 4JY5L 2XRAH 3P4LA 5T1KB 2HMID 5D1XA 3IJYB 3CDCA 3MLYH 3L5WA 4OZIA 5KS9F 2A73A 1KUMA 4Y1AA 4APQD 4I2XB 3S34H 4LASL 5B39A 3UDWC 2A9NL 4Y2OA 5DD1H 3SKOB 2XA8H 1HILA 2Q1EA 5AG8A 2QADB 4QTHA 2ICEB 2W65A 2ZUQC 3ZMRA 2YUZA 3ZDZF 4K7PX 3DIFA 2VXTL 3GFUA 1ZHBB 3CU1A 3KG5A 3RJQB 1LO4H 3QNXB 5DQDH 1MIEH 1D3CA 3X3FL 4XNUH 1JUFA 1F90H 1XZ0A 2IQ9L 3BYYA 1BEYH 4KUCF 3KLHC 4ZFOL 3VXNA 4F7MB 2EYTA 1CLYL 4N1EA 5TE6L 4JRXD 3BWAB 1OT2A 2HT4C 3HNSL 5IK3B 2BVEA 4Y5XA 3VWJA 4PLNC 1CLCA 4OGAC 1LK2A 4NZRH 1TQBC 4Q9RH 4XPGH 1Y6KR 4M1CC 5LGHH 2VZ3A 3LH2L 1F6AB 4U1HB 4NRZA 3IRPX 3KYNA 4GKOA 1T04B 3MRQA 1FVDA 1TZIA 5JW4M 3S98A 4HFUH 2X89A 6FABH 2OTUA 5E2TH 4DVBA 3TESA 2CKBH 3QEGH 1T7VA 5JPMB 3DO7A 2R69L 5GS2D 4QO1A 5D9SB 4K8RC 3IGAB 2P5EE 3HC0B 4I1NB 5H94B 1KV3A 3MBEA 3D0VB 1YPZF 4PRPA 4K7PH 3PWVB 2APVA 1ZGLB 5F9OH 4TUJB 3S4SB 1KEML 1MH5B 1YNTA 5K9OA 2J2ZA 2X9XA 1JHLH 3DRQA 3VDCA 5HYJA 4YR6B 1NCDH 1FFOB 1H3PL 4ZO8A 5IBUG 3ZYOA 2BHUA 1MRDH 1G1YA 2Z92B 5E0QA 5E5RB 1U3HA 5CBAA 2A77H 4Q0XH 4HFWA 4LKCB 2UWEE 4IIQC 1HZHL 4KVCH 1YY8B 3FT3B 3BZFB 3DV6B 1U8KB 2WZPD 1S5IL 2AP2A 1D6EB 1BHGA 4YK4C 5EA0L 5IB5A 4TUOA 1CICD 1EO7A 5C6PB 4KJYB 5L8LB 4ETQB 3GSUA 3GIVA 3U7AA 5I1CL 1TZHB 5DJCA 5E5MB 1IL1B 1E27B 4G7YL 4JAMA 4AJ0A 4CRPA 2OP4L 1GPOL 1C5CH 5DTFA 3VFNA 4LHJB 2W9EH 3C5SB 4OM1H 4BH7B 5IOPB 1FAIL 3HLAB 2ESVA 3AXLA 1AR1C 4KQ3H 3HAEH 1OW0C 4GRLA 3VFRB 1FNSH 2NQCA 4POZC 2HJKA 5KOMC 2FATL 4OM0H 3MPCA 4PJIB 3QFDB 5E8DL 2UWEB 3B2VL 5C3TA 3LKQA 3EYQC 1INDH 4L8SB 3RWHA 1MREH 4TYUA 1Z9OA 4QTIH 4PJEB 5DJ0B 3M1BB 3N9GH 4NQCA 5A2JH 5D1ZB 3KR3L 3MCKA 1KTRL 4KKLC 3RWCB 4MZ3A 1BQHA 3LRGA 5DYOA 1DQJB 4KUZH 4LQ1A 2QHRL 1JPFA 4LF3A 3T0AA 3G08B 1ZANH 5BJTB 3Q5YA 3FT4A 1NAKH 1ZSDB 4ZQKB 4P5TB 4FP8L 5ADPL 1ZGLM 1A7OL 3O3AB 5E00A 5BV7H 5FYJE 2NY3C 1Z9MA 3A6CL 4E9LA 1A6UL 2X4TB 2IBZY 4QHNB 4U1IB 1CS6A 2J8OA 2VLRD 5SX5H 2EXYD 4AEIL 1ZEAL 2G75A 3Q1SL 5CILL 4DVRH 5L9DH 1EJOH 3L7FB 4Y16A 1QFHA 5C09E 2YZ8A 4YGAB 4M5YH 5ILTL 1J8KA 4XXDB 4RNRA 5T3XL 4GW5B 3BZEA 1TTFA 3RNKA 5MEPA 4NC0B 5KJRL 1TVHB 2BSSA 3T09A 3JV6B 3TEUA 3HUJF 1H9VA 4LFHG 2JE8A 1BBJA 2KL6A 1C7TA 1U8JB 2X4UA 4FQJH 5MEND 1SEBB 3QCVL 4U7KA 4YDKL 1FFRA 4M43H 1N6VA 3EO0A 3HNTL 1CG9A 5DQ9A 4R90H 1NC4D 2CDGB 3WCYA 1NUGA 1YMME 1ULVA 3O8XC 3PABA 4PJ8A 3Q2CA 2Q7YA 4LVEA 4F3FB 3H0TB 3MRDA 1BVLB 1DQTA 3QFJB 4CN1A 1MCBA 2AJUL 2Z35B 1N0LA 3ARPA 5I8OL 3QJHA 2X7LB 3LD8B 3KJ6H 4P5TD 5AZ2L 4GAJL 3QBTB 4K9EL 4OFKA 1IC4L 4XCCH 2YUXA 5I71B 3C8KB 4XMPH 1ZLWK 4JHAL 3VRLF 4CAGA 2IH1B 3PXJA 1NMCC 1IJ9A 3OAYK 2WAHA 3AS0A 1J8HB 4OUUB 5DUPL 1K5NB 3KPTA 1P2CA 1ZLUK 3PV6A 5D72H 3MACL 5SX5K 2E27L 2AXJA 1UXSA 3K4AA 5E8PB 1BFOA 3CFKB 3EOTL 1G7IA 4LIQE 1YNLL 3JWOH 1A9BA 3QA3B 2HFTA 5F1NA 5CKGA 1G6RA 4XC3H 2PYFA 1WCBB 2XKUA 2GT9B 1JPTL 4LCIL 3CX2A 2QQQA 4Y16B 1F11B 1LP9B 1X5HA 2EDEA 5MI0B 4YHZH 3P4OB 1I8MA 3GSXA 3GMMB 5CZXC 4W68A 5IEHA 2QEJA 1GYAA 1QUNA 4PGEA 3GJFH 1J1XL 3DYMA 5HHNB 3E2HC 1B0RB 3FT4B 1O5DT 2W9DL 3C8KA 2QQLL 3FONB 4R4BB 2RR3A 3A67L 5CGTA 1RHFA 1FNGB 1CU4L 3LKNB 1VADA 5D6DC 1ACYH 3QP3A 4I13B 4K55A 4O51A 4U1SB 4LDEB 4JY4B 5KSAA 4WUUD 4BSJA 4KJWD 3SOBH 3QQ4B 4DFHA 1PW3A 2P24B 3S88L 1VFAA 5IG7A 4UB0L 1G7IB 4GJTB 5JIIA 2APTA 2E7HA 3H9SB 4JFPB 4WCYL 1OAXH 2UYLA 1HI6B 1QFOA 4O9HL 3UC0H 3W11C 4W6WB 5IHUL 2EE9A 3CIQA 3MODL 1INEH 2V9QA 3VXQB 1JHKL 1YQVH 4F58H 1AKJD 1K4DA 3BDYL 3FQWA 2X4NB 1GJIA 4JFED 4ZFFB 2QADC 4JE4B 1T89A 5B22A 3UDWA 3BYTA 4ENEC 4OIBA 3FKUS 3VH8B 4BKLB 4N0RA 4MD4A 4M03A 3LSOA 3S7GA 4GBXD 3BEVB 4OV5A 3FFCE 3PABB 4LLVA 4PJ8B 3T1FA 1NANH 1WICA 1T2XA 3MRBA 1V7NL 4JQXA 4I9WD 5E1HB 3O9WA 5DJ6A 2WWMC 3E3QE 1D9KB 3CXDH 4TVPE 1PGRB 4P2OC 5TH2A 1BVKA 4YQXH 2APFA 2DQUH 4DKAA 5AWNH 3NIFE 2KQNA 2QSCH 3FO0L 1UH2A 1E4WH 5SV4A 1FBIH 4RAUB 2ZUSA 5ICXA 3IFNL 1OGTB 1AE6H 4XPAL 3C6LB 1HQ4B 3BHBA 5IEKB 3C08H 4A6YL 5E9DE 4U6YA 3MRJA 3RL2A 3QAZB 4TVPH 4WFFD 5H94A 1YEEL 3K81A 3U0WL 5F7FA 1DLFH 4DGYL 5F3BB 3RA7H 3QA3A 3I3BA 3SEPA 4DUWA 3IU3A 1IEBB 3ES6B 4LARL 4OGYH 2PKDA 2VMFA 3O3BA 3VXUE 1PBYA 3BXNB 1DFBL 1UXSB 2DL2A 1WBXA 3KDMA 5KVDH 3TVMA 2EDDA 3STZB 5ACZA 5K93A 3RKDC 1IFHL 1N5YH 2GHWB 4TSCL 4PJ9B 5HI3D 4G7VH 5I75B 4L3CA 3CAFA 5E2JA 5CAYB 1DN2A 3QWOB 1WAAF 3E1F1 3L6FA 5IFHL 3AGVA 4GXUM 4TUOB 3JWNC 2O5YL 4P9HH 3P0GB 5DMKA 5DJAB 1JRHI 1MFAL 1E6JL 2D9CA 5EIIB 3X12B 1Z5LA 5IGXL 4FNLH 5D7JA 1F58H 2FHBA 1U3HB 2E9WA 1T0MB 3SDYL 5CBAB 5DEGA 1U2HA 3I6GB 2JELL 4LSUH 1H3UA 2P45B 1BIIB 1YY8A 3C2AH 3FT3A 1QFUL 4WV1C 5HHOA 1FIGL 2YA1A 4M9PA 3NIDE 4LSTH 3B3IB 4J8RB 1C7SA 5D70L 1T22B 4L8BB 4DGIH 1M05A 1IZJA 3EYOA 2ZG3A 3PGDB 3HI5H 4M6OL 4JFYB 5F9AC 4FZ8L 3C09B 3X3FH 5GRUL 4J3WA 4KROC 1SBSL 3UYRL 1KBGL 4L8SC 3WXVH 3AU1B 4HJJL 1FG2A 3ARFD 5HYQA 4WW2B 2HN7A 4K7FA 3HPLB 4LDLB 1IT9L 1PKQE 4Z95L 3DO7B 5TQ0H 3VFGH 4M3JA 3ZLQC 4I3RL 3MOQA 5DD1L 4N8VA 2FSEA 2H9GB 2MQ0A 3QUYB 1LHZA 3H9HB 3D69B 1P84K 3VXTA 1FNHA 2VDLH 2AGJH 3BOVA 4X6CE 3G6JB 1FYTE 2Y4SA 3BZFA 4G43B 5FGBA 2G2RA 4HIXH 1PG7X 4OTXH 3WKNA 4TPRL 5IB4B 4NPYB 2H32A 4U1NB 5D96C 2HLFD 4XVUD 4YNYB 3LRSA 3EBAA 4GRWB 5TGBB 4GRWE 4EDWL 4YHZL 2VXSH 3K1DA 3KS0H 1NCBH 1OD7A 1KIPA 1DDHB 4MGXA 3BHBB 2ZCHL 3TV3L 3VXRD 4XMKH 1R24A 1JV5B 3UYOD 4D0DB 5A1AA 4HIIA 3ULSB 4PJBF 2J8HA 1J87A 3BI9X 3ZKMD 3T65B 2DQHL 5JZ7C 4QCIA 2AQ2A 4KTYA 1UFUA 3IDNA 5F21B 2HAZA 5LQBL 1BOGA 4PJXB 2A74A 3KHQA 4JO3L 5IVXA 2R29H 1D5XA 2NW2B 3H3BC 5D7IE 3V79C 3QUKA 3CCHB 2AEQH 4XWOD 3B2UD 5T1KA 1P7KB 3FQRB 4YBHA 5J6GA 5BRZD 3WN5C 1BF2A 3HZVB 5BS0E 3I6LD 3MYJA 4Z0BL 3MRMA 4P9HC 5AYUH 1MEXH 3BQUC 1AHWC 4HWEH 3SE8L 2HTKD 5D93B 5JR1L 1FAKT 2CO6B 4PRNA 3O8XA 4AH2B 3OX8A 2DLGA 1G9NH 3EFFB 3LD8C 4EI5A 1MJJB 4WIQA 1I7ZB 3FQUB 3ILPA 3LHPL 4PRAA 4MVBC 5GS2H 1KB5L 4S11A 1BECA 1DE4A 1KNOB 1YC7A 3FB5B 5IFAL 1E4JA 2A9ML 5BZDA 4BFIB 1A7PH 3TWCL 3BKYH 3BN9D 4QHKJ 4ZDHB 1A3RL 3I9GH 5TPWL 4PGCB 5FYJL 1P4IH 3PF2A 2OI9B 3DHMA 1U8HA 1D6VL 2IBBA 2FDBP 3O6ML 1NCCH 3E6HB 4CVWA 1OAKL 5KSBF 3DX6B 2DJ4A 1NC4B 1MCSA 2YPVL 5EULV 3TJHC 5DHYB 1YMMB 4W4OA 2DBJA 2FCBA 2VOTA 4NRXB 4RX4A 1FCCA 5AWNL 1W72H 4YHML 5DD3H 1QFWL 3KYAA 4JKMA 4PGEB 3T2NH 4ERSL 2VL5A 5I15H 4JKWA 3FOMB 3MNWB 2FBOJ 1MCEA 1WZ1L 1CFQA 2IANE 5SWQA 1K6QL 5F7EH 4HUMB 5B3NA 5HGDA 1NGZA 3GI8L 4RGNB 3RUGB 1CICB 2GCYB 1NEZA 1RUQH 4L3EA 1MRCH 3BKCH 4WU5A 1RK1A 5I2IA 5IQ9B 1WAAE 3PIQA 5I76A 5E8NB 4TN9A 3ZDZE 1CLOL 5F70A 3DMMD 1C5DA 1IAIH 3MV9B 4LSVH 2XKSA 5FGRA 1RZGB 2X4SB 4K23H 4CUCA 1LK3H 1HSAB 5KAQF 5HSFA 2EIBA 2HKFH 2HTKC 4G6FB 3VW3H 3L5XL 1YEJH 3RDTA 1JGEB 3LS5L 4RIRB 4Y16D 4WEBH 1K5NA 2QL1A 2ZPKH 5E03A 1BM3L 4RFNC 4HWEL 4JFDE 5EB9A 2YD1A 4RMTA 3ZT5A 4X7TB 1RZIA 1P2CB 1XF5B 1R3LA 1EZVX 1FL6A 2ZSVA 4KHTH 3SOBL 5ERWA 2VXVH 3V5DA 1NGPL 2R4RH 4K3JH 5HYSG 3RRQA 2VLME 4M4RA 3BIKA 2R29L 3UX9B 2F5BL 2N56A 1IC7H 2JJSA 1HIMH 1MELA 4G6JH 3GSOB 4I5BA 3S35L 4DKEL 2HG5B 3BPCA 2MMXA 4LEXL 4M93C 2AV7A 2HKHH 15C8H 1GGIL 2ZCLH 4LLDA 2A6KB 3OGCB 4X9FA 1NFIB 3C8HA 4BQCA 3RGVD 3WIFA 3GMNB 4YGVA 2D0GA 3LKRB 4NNXA 5FUCE 4FOMA 4XPAH 5BV7B 3CH1A 1WIOA 2XZCL 3WFHA 1F4AA 1JPTH 2HRLA 1CGSL 4KI5E 4I0PB 5KG9A 3TO4B 4Y88A 1DANT 5F1IB 4H0HB 5I8EA 3C6LC 3VXOA 1QNZH 5LJYH 4FQQB 4Y2DA 4MQ7A 5C86A 2RB8A 4JO2H 3WFBH 3KLAB 1NEZG 5JW5A 3PHQB 1KPUA 3QAZC 1GXEA 1S9WB 2V7HB 2YC1B 4P57A 4PG2A 3SDAD 4C4KO 2AXFA 5CWSB 1NFDB 1RULH 5D72L 3OJDA 2IPKB 5FA4A 1B3JA 1GZPB 4NC1E 1GIGL 4KFZC 4Z7UE 5ISZE 2AKRB 2R39A 1M7XA 1JNLH 3TA3B 3ULUF 4GBXB 5EUOF 3QULB 4LF3B 5GRJL 3ULVL 2IH3A 3MRFA 4OCYL 3U7YH 5KSAD 1CD1B 1XF4A 4ODWA 5C0EA 4FZ8H 5I18H 4ONFH 1ZGLP 1NSNL 4P23A 4M1DH 2XTLA 2HFGH 5TE6H 4R7NB 4OF0A 1TCRB 3RVWD 4JFOB 3LKQB 5HDBF 2VE6B 1OWWA 1HNGA 4RSVA 3OGCA 2JJSC 4Y4KB 4IMLB 2R8SL 1KC5H 1G9NC 1CLZH 1L4IA 4NZTH 3GMPA 3CNKA 3KHOA 1ZS8A 1DQLL 2CGRH 2OR7A 4PJCA 4DN4L 5I1GH 4F7CA 1MWAA 4L8SA 2ESVB 3AXLB 5IB3B 1IAIL 5A3ID 4BZ1H 3MRRB 1JP5A 3NFPB 4I0PD 3IDXH 5L88L 5EOTA 4BQBA 2NY1B 4UOW1 2VKXA 4MQ7B 2JLLA 4I0PA 5KG9B 2H32H 4MHHG 5TDNB 5FUZL 2K1MA 1YDPB 3C60A 3I75B 1X6LA 3PHQA 3O6MH 3O6FB 4MNGB 5D7LB 5D7LE 1MCWM 1M05B 1MRFL 2AERT 4Y19E 3MBXH 2CLVA 2VDML 4N9GB 3O6KH 3TFKC 3RKDD 5GJSL 2ARJQ 2GTWB 3H3PL 3CH1B 5T5NF 3HNVL 5JW3L 4HMDA 5BZWA 4AK1A 3V4VL 4CDGC 2P5WE 1OWRM 4ZNEA 4CKVX 1T0MA 1EXUA 3HE6C 4HZLB 3ARBB 3BKJL 4LLMA 1XGTB 2C1PB 2V7NA 5D2NB 2MCPH 1ZTXL 4DKEH 4YFEA 2HG5A 1F00I 3KAAA 2NNAB 1PQZA 3UYPA 1I1AA 5J11C 3WIIH 3ILQD 1OCWH 3MXWH 1RJYA 4NDMA 5F96L 3IDYC 1TTUA 5MHSD 1RZJC 3IAPA 5D6CA 3V7MA 4JHAH 2XZZA 4HCRH 4R97B 4UI2A 4MVBD 4NRZB 3MRKA 1BJ1J 5BVPH 1RUAL 4MX7A 3GK8L 3KPPB 1NCNA 4NM4H 2ATPB 4WDIB 3FTGA 1A6AA 3NFNB 4ISVA 3KLAA 2QQNH 3QIWC 1VB9A 4FMKA 2ENYA 4WWKB 4XVTH 5FIEA 3QI9B 1OTSD 2HRPL 4B7IA 1VA9A 4B53A 2FJGA 2BVOB 4S0SD 1FYTB 4M7ZC 2FGWL 1W0YT 4JQIL 4RGOL 2H45A 5GGUB 4OI9A 3NTCH 1GGBL 5DI8A 4GKSB 1EPFA 2YKLH 3DETD 3KPMB 5H35B 3BKCL 1T1ZB 4YDIH 3JTTA 5TQ2H 1XGYH 3FRUA 2HT2C 4F37K 4GG6F 1T1WB 5F89A 1GHFH 4ZUWB 4OLZL 4TNVF 4IS6A 3E3QC 3V0WL 3MBXL 2F74B 4LVOC 3V0VA 3F7VA 1ZEAH 5CILH 3C5ZB 4L4TD 4PTUB 4LNVA 2A0LC 4NM8L 2L4OA 1I1FB 5ITBH 4PJ9D 4H8WC 1BQUA 2BMKA 3BGMA 5MENB 3WXVL 5JQ6H 1BM3H 3KPSA 2ZCKL 5E6ZA 5ITFB 1NGQH 1IGTB 3MCLL 3VXQA 2KKQA 4I18C 1OARH 2NXYB 4H5SA 3M8OL 4AIZA 5KOVC 2D4DA 1ND0B 3AMKA 3QXWA 1ZAGA 4MJ6A 1WBZA 4J7RA 3WLBB 1CQKA 4G9DB 3FFCD 4LPVA 4AYFA 2NY5C 3O6LL 3VWKB 4NYLB 3L3DA 3LKPB 4I9WE 1KBGH 3BAEL 4U1SA 4LRIC 1QFUH 1SHMA 3GO1L 1KB9J 3C2AL 4OT1H 4WY7L 5I76B 3QCTH 1QBLL 3Q6GH 3U4EB 3CH8A 1FE8L 1AH1A 2NY0D 3VI3E 1UA6H 4BFEA 1G9EA 5T1LA 3UPRB 4RZCB 2VDPL 1LO2H 3WNKA 3RWIA 3C60D 5HHNA 2O5ZH 1FYTA 1IMHC 2ITCA 1KLUB 5KVMC 1FAIH 1QO3B 5IBLC 3L95A 4GRWH 4XNXL 3N1QC 5HHVL 4P5TA 1FQ9C 3ZL4H 1IEAA 3JSSA 3QG7L 3ROOA 4AT6B 3D25A 1FDLH 1F45A 4WFGE 1Q9WA 4PIRF 4Z77B 2P44B 2QR0B 2F9BT 5KSBA 3ZE1F 2FL5A 3AROA 1ZT7B 1M7IA 3KPOB 1OTUD 2F53E 1A02N 4M7LL 3SE9L 3ALWA 3KPRE 4LARH 4LKXB 4HBQA 4KVCL 3NAAH 2DM3A 1BGXL 4M48L 2H2SD 4K2UH 5C2BH 4AIXA 1YEEH 2X5PA 3MA7A 4PJ7F 3B9AA 1LDSA 1I9EA 2D7QA 3BESR 3TZVD 3BP5B 3WHE0 2R2EA 4K2UL 2BY2A 3GBNH 1WAAA 2EE3A 1PJ9A 1MUJA 1YY9D 4P2OA 1FJ1B 4XX1G 3DVIA 2FX9L 1Q94A 2FX7L 5IT2L 1QR1A 1NMAL 4YE4H 4M93B 5DTFB 2NY6B 4HWNA 5FDWA 1M6OA 1MEXL 1BZ9A 5AD0A 1XGQA 3MRDB 3L3GB 2K3TA 5I71C 4HEPG 2Y9RT 5EU6E 3X12A 4UNVA 2Z31B 1TETH 3N85L 4YIQB 5HVFB 3IFPB 2JB5L 4KKBC 1IQWL 4G6FD 4WFHE 2OX5A 3U30C 2XIDA 4FQ2L 4P23D 3GSRA 4BJLA 1G84A 4LCYB 2R2HA 2Z93B 4LSQH 4DAGL 3CFBB 3HHRB 1E4XL 5T5FH 1WZLA 1J88A 1OD9A 1MVUA 1QBLH 3QCTL 4L29A 1NGYA 1JHKH 3KPSD 3RBGA 3TVMB 3U0PB 1FE8H 2ED7A 3UTQA 3OG6B 3RI5F 4LFHD 5T1MA 1KIPB 2P1YA 4WEUD 2C3GA 3B9DA 1XF2B 1MHEA 2GJZB 5JW3H 4NN5C 4JLRA 5D7JB 2X4RA 2N7AA 3REWB 4KPHH 2GTZB 3EYFB 4POZD 5FECB 1WFNA 3H9YA 3KPQA 4X4YA 5GGVL 3N85H 4GO6B 2NTSP 5E8DH 2XN9B 2B8OT 2ICWA 1J1PH 4Z77A 2F54E 3GB7B 3MRGB 5ESAA 2IH3B 4GQPH 5IGXH 5DJ2A 3IFLH 3DVFA 4LSSH 4HPYL 3TN0A 1FZJA 4P23C 3MCG1 5HD8D 5F7EL 4GKNB 4P48A 4FMFA 5L9DL 4FFYH 1WZ1H 4M1CD 1NMAH 3Q3GB 3LEVL 3R4DA 4FA8A 1PKQA 3FFCA 3WUWG 3RUGE 3CSPA 5T1LB 3RVVC 1FVEB 2H8PA 4HLZH 4IRJD 4HUVB 1FG2B 3HE7C 4D3CH 4Y2DB 5JMOC 3GMOB 4JHWL 1FNFA 3TF7C 2O5XL 3ARGB 3VFVA 4P57B 5T1MB 4YGVB 2FX7H 1I75A 1NC2A 5GRVK 2CLZB 3TT3H 1T22A 2DI8A 3FN0L 2ZG2A 2W65B 1DQLH 2CGRL 3TCLB 1G7PA 1BD2A 1GVIA 2R2HB 5T1KD 1P7HL 1FIGH 5TDOB 3PP3K 4YHPA 1KEMH 12E8H 3P4NB 5IBUB 4B5EA 1LP9E 4G6AD 1G7LA 3R0MA 5BZWB 3GSNH 4Q9QL 4HCRA 4XMPL 1FNLA 3BKMH 4K9EH 1FNAA 3EO9L 1A9EB 5EU6B 1A4KA 1UKSA 5J1AA 1M6OB 3MLSH 4LVHB 4UV7H 2V2TB 1WJ3A 4UT9L 3T1FB 1Y6MR 1HHIB 3PL6D 3BKML 1T5XA 3PDDA 1U6AH 2SEBB 3LSOB 4FQXC 3MXWL 3WFBL 4LSDA 4PUBL 2X4OB 4PV8A 1MCLA 3L3HA 3H9SD 2WV3A 5INDB 1BQHG 1IKNA 3W81A 3NFPA 8CGTA 3QDHA 4LPXA 1Q94B 2J5LB 4MA1C 4NHCH 4R97C 3H9SA 4PY7B 3P4OA 4F7PB 2B2XL 4YPGA 1FSKB 4LLWA 3VMOA 1JBJA 2R2EB 1QBAA 4YXLL 4Q0XL 1F90L 1KACB 2DM4A 1MCRA 3QUMA 4KVNL 4LOUC 4RBPH 4XTRD 2V9RA 3SO3C 2HKHL 2X41A 5E7FA 5B3JF 5E9DA 5D9SA 4NFDA 2JJVA 3D85D 4Q6YA 1PY9A 4WWKA 1CBVL 5C9KA 4KZDH 3RWFB 3P11L 2OTUB 2FGZA 4QRPD 2P24A 3MA9H 4WDIA 4EDWH 4R2GB 4KY1H 1BFOB 1KXQE 3MRPB 2KPNA 3G5ZA 5D1ZC 4P3WA 2V2XA 2ERJB 3TBWA 1VADB 4Z7OE 3IETB 4OLYL 4PJ7E 1ZA6A 3MCLH 1U3ZA 3FFDB 1TZGH 4JDZB 5JXEA 3ET9F 1R0AL 1OTTD 2EIDA 4MS8C 4G6JL 3EGSA 5GSRA 5DJZA 1DBJL 1I1AB 3IFLL 4PJ7A 3OHXB 4XCEA 5DRWB 4MD4B 4RMUA 5EU5B 2VLJE 3IDXL 4I3RH 1G0XA 3P30H 3S9DB 3T4AA 4HZLA 4LLMB 3QPQD 3A6CH 1YMMA 4LCWA 1U8HB 1T5WA 4GRLD 4JQVA 1JGLH 5HHQA 1CYGA 4JFDD 1QSEB 4ODXA 4Y4KD 3MLTA 3IYLW 2M26A 4IDJL 3QNYB 3D9AH 2BNQE 1JZ8A 3KYMB 3QZWG 1Q9KB 2HKFL 4Y4FA 3VW3L 4NBZB 4YC2C 4G9DA 5JR1H 3JV6A 1TIUA 4NHCL 4YHNA 1CI5A 1T2JA 1OY3B 1W8NA 4G8GD 2ADGA 5LGJB 4GW5A 3BZEB 4JREC 5ESQB 5FO7A 4QRRD 5ETUA 3IKCA 3T0EC 1B2WL 4DUXA 5I8CB 1NAMA 4JJ5A 2C3WA 1FLTX 1IQWH 5FHAH 5IB1A 2AV1A 3EKCA 4YXHH 2Q76A 4HK3J 3UJIL 3MRLA 1DUYA 1A3LH 1DQDH 1UYWL 2NZ9D 2LVCA 4EN3A 3DI2B 4RAVB 1DEEB 4X7SL 2J6EH 2AJUH 4PLKD 1A4KB 2VERN 4TSAL 4YHPB 1RUKL 4OZGF 2Z8WC 1GZQA 5FA3A 3UZVB 3KYKH 4OLYH 1IAKB 2Q7YB 2WSKA 2HVJB 3L5HA 1SVCP 2RAMA 4HKXB 2I5YL 4O58L 3DUHA 1TVHA 2BSSB 4ZXBA 1GGYA 1N3NB 2F8VA 1I1AD 3BKYL 3D2UD 5A2IH 1R3HB 4P2OD 4RIRA 1MCIA 4NQCE 1U8JA 5GJSH 1G7PB 3G5VB 1N0XH 4EOWL 5HHQB 1QLFB 5DLML 5F1NB 4LLWB 3ZE2E 3WS6A 2WM0A 3DROB 1VFOA 2Z8VC 4X4ZA 5HDQH 2HA1A 3I50L 3LKOA 1CXIA 4RNRB 3S3PA 4J2XA 5E94B 1H3PH 2EKSA 3OHXA 4LLYB 1VACB 1YY9C 6CGTA 5INDA 1OAQL 2ESVE 1DEDA 4Q97A 1ED3A 1UWEH 3BP6A 5CWSA 2F5BH 4FN0A 2BZDA 1AGFA 4YX2H 4N8VB 5AG9A 4Z7QE 4S1DD 5B3JE 5FYKL 4OUUA 1JK8B 5EC2B 1EAJA 3LV3A 3TBVB 4Z7UF 3VXOB 2R1YB 5IVXF 3TO4A 5J13C 3P0VH 4WW2A 1DQQA 2ZUYA 1DLHB 2BNUB 2V5RA 4HCRL 5F1SA 2IALA 2RHEA 5CFHA 2CH8A 4U05A 3MJ9A 1DVFB 1T0PB 4FQ1L 3PG2A 3RWFA 3PNWB 2IGFH 1U8MA 1F02I 4HWBA 1LK3L 4NGHH 2CLRB 4XMKL 2AK4B 2BDNH 3T77B 3OKLA 1EUTA 3KXFA 32C2A 3OQ3B 3H0TA 4L29B 3OG4B 2ID5A 2BNQD 1F6LL 1QQDA 2ATKA 5C0NC 5IP4A 2ZSWA 3DUSB 1MI5A 4X9IA 5HYSB 3KWWA 2XQYG 3M8OH 5BCAA 2OTWA 2A6JB 3MV7A 2X4PB 4EVNB 4G5ZL 2DQEH 5JOFA 5DSCA 2I27N 3CDYA 1DE4B 1MVUB 5T3XH 3VXRE 5TDNA 1IL1A 1E27A 3UC0L 2D2OA 1KJMA 3PGCB 2EYSB 4MAYD 5EO0A 5J06A 4DQOH 5HI4D 2W60A 1ONQA 1SMAA 3MV11 2ADFH 3G6JF 4OZFH 3ULVH 4IHOB 3DOSA 2PYEA 2XFXA 4TPRH 2Z91B 3LEXB 1IAMA 5C7XL 5E8OB 4OLZH 3MO1A 5E5UB 3BWUC 3LPWA 3VJ6B 1SBSH 3UYRH 3KYNB 3QUKB 1PKQB 2P5WB 4KTDH 3O0RH 1GOFA 5FDWB 1Q1JL 4JPWL 4G5ZH 5DLMH 5CJXA 1VKXB 1WGOA 1MCFA 4FFVD 2VLRB 4JM4L 5TQ0L 4TUKH 5GJTH 1EO8H 4P2OB 3MCKB 3FCTB 5GISH 1FC2D 3MLWH 4OZIF 1JGUH 3T65A 1DQMH 4KPHL 3FJTA 2Q86A 2ZP0T 4NJ9L 4AZ8A 1LILA 5BRZA 1MJUH 4L3EB 2IAMC 5I17B 5K9OB 1YNTB 1YUHB 1LE5A 1DN0B 1QLFA 1Q72L 3FB7B 4PJEA 4QKXB 5F7YC 2DYPD 2G5BB 2BOBA 5DUBA 4DK3A 2P49B 4CVXA 2OR9H 3CVIL 1C16B 4D0CA 4ZUVA 1FDLL 4J3UA 1XR9A 1GPOH 3KYOB 2IBGA 2J3SA 3DX6A 3VJ6A 3ARRA 4HLZG 1IAKA 3KVQA 3HLAA 5JOPD 1N64H 1KYOJ 4NZRL 3U36A 2RQ8A 3LEXA 4CVUA 1D6EA 5LQBH 1MFAH 2MKLC 4XNZB 3FN0H 4JFXA 3OB0K 3WD5H 4IEFB 3T2QA 4HFWB 4HKJB 4JLRB 3U0WH 4XNUL 3SDDA 3JV0A 4JN2B 1A6ZA 1ND0A 2OK0L 1J0ZA 3AREC 4WO4C 3FQXB 1JGLL 4D3CL 9CGTA 4WV1B 5DD0L 4JKLA 5KVDL 4LKCA 5AAMA 1CWVA 4JM4H 4MD5A 5C2BL 2HTLC 1MCKA 1AD0B 1OAUL 3MBEB 4PRPE 2E6QA 1Q0YH 2X1QA 5MERA 1KXTB 2ZCKH 1OQXA 4I3GA 1NLBL 1VEMA 5T3ZE 2VB5A 5I9QC 3L9RB 4HS6A 5ENWB 1IM3B 5DRZB 5J89A 3ROOB 3TYFB 4ZNCD 1YEFH 4LP4A 3TPUB 1PDKA 3ARXA 4X8JA 2NZ9C 3UJIH 4GBXC 3CX5J 2DQFB 3L95B 3RJDA 5DMKB 5ADPH 5IW1B 4GKSA 2VH5H 3QYCA 1KCRH 5IQ7L 3QUYC 2VLMD 5BO1H 1A6TB 2OYPA 4G8IB 1K85A 2E8ZA 2YD2A 5GGVH 1QTYT 4GLRI 2EXWD 3RWIB 1E4XH 3JBG7 4HKBB 1I8MB 2FH8A 2K7QA 3VXSE 4F7EB 4KKBD 3V0AC 1A6VL 4GKZB 4UDUA 1CDGA 1WISA 2G2RB 1UJ3B 4ZOEA 4LSUL 3DJ9A 4JRXB 1RU9L 3KPRA 1ADQA 1NEZB 1WCBA 1GSMA 3KJ4C 1CLOH 2ZJSL 4H88L 1EEZA 3P0YL 4QXWA 4P2CG 1A7QH 1BAFH 1UVQA 4JFQB 3CFDB 3JVGA 4CN4A 1KJVA 1IM3A 4OZIE 1DUZA 3C5JA 4NUJB 5L2JB 3EHBD 1AP2B 2B0SL 3EO1A 4IRJB 5TF0A 1NC2D 5MERB 4LGSB 1KN2L 3ZHDA 4HHAA 1S9VB 3IKKA 3RGVA 1ZHKB 4U6HA 4QYOA 5CUSH 4OGZA 2AJVH 5CZXD 4ZFOA 2DLFL 3UJTL 1PZ5A 4K94H 1XH3A 3ZE0F 1DUYB 2QQLH 3CLFL 1VERA 3SDAB 3MMEB 4PGDB 4YHKL 5M94B 4QHMB 1X6NA 3E6FA 4WVRA 4YE4L 3AMLA 1OTUC 3G5XA 3BE1H 3O2DL 4JG1H 2VISA 1TJHL 3HE6B 4OF7A 4AH2A 1MQKH 3U0TA 2P8MB 5FCUH 4ZFGH 4RFOL 1L6ZA 2WBJA 1AFVH 4KUCD 4RFEA 1JGVL 3QB7C 4OF5A 5F88A 1OB1A 5EOCJ 2ZOKA 3B6SA 2VDNH 5E4EC 4F33A 5ALBL 1J1OH 3A6BH 4POUB 4XXDA 1CFTA 1QBMH 2X1XR 1JYXA 4R8WH 1IT9H 3EDKA 3KPSE 2LTQC 3FTGB 3SDCB 3K4DA 3PUCA 4HH8A 1A0QH 1U8PA 1NL0H 4JQXC 5FKAB 5I6XC 2GJ6A 4X4XB 1IKFH 3ME0A 4JJHA 2ZUVA 4QCIB 1QFWM 1UB6A 3VFUB 3GSNA 4H88H 5DUPH 3RNQB 2R23A 3PWPA 3QI9D 5C0IB 3EJJX 3MJ6A 5MP6H 5LWYH 3MRRA 4PJBB 3OAUL 3A6OA 2BJMH 3IDNB 4OJFH 4DN3H 1LE9B 2F54D 3T4YB 3AS2A 5IESL 3O6LH 1QRNA 1J05B 4KROD 3PDGA 5H35A 4GH7B 4BSWA 1RIHH 2FWOB 1YQVL 1G0YR 3QIUA 4F58L 1FP5A 5HY9A 1ZTXH 1U93A 1G1CA 4WUUA 3SE3A 3Q6GL 1WC7A 1EIBA 1MRCL 3BMVA 3RWCA 5EBMB 3VGFA 3I6KA 3QULA 4O2FB 5E2UL 3EZ8A 3DUUA 5CSZA 2L0DA 1X4XA 3KXFE 4AQ1B 3ZE2F 2XQBH 1P4BH 1CD1A 3PWNA 5CEYA 4WI5A 4UINH 3OR6A 3U1SL 1HHJA 3MJ8A 4KU1A 4ELME 2JB5H 4S1QH 5HGBA 3U46B 5IOPA 1HXYB 5SWSE 4YHMH 3U7WH 4HJ0D 1D5ZA 2OJEA 1ONQB 1S78D 1HHHA 3PGCA 2YUVA 2PW1A 4PJHF 1G6RL 4WI2A 3GSWB 1G6VK 3O41A 4FQCH 1Q0YL 2XNAB 2YRZA 4HBCH 2XTJC 5AEAA 1OF2A 4PBVC 2W60B 3HS0B 5F9JB 5GSVB 5IVZB 1TQBB 2CPCA 2GSIA 3GBNL 2V5MA 3OB8A 3HB3C 5I1LB 2NX5D 4MA8H 5EOTB 3VWKC 1TJIH 3CUPA 3OV6A 3I3DA 3MJ7B 2EECA 2PTUA 2X10A 1KLGB 3L3OB 2WUCH 1WEJH 5DD6A 3O3EB 4ZODA 4Q6IC 1XGUA 1GGIH 2PXYC 1S8DB 4KDTA 4HUUB 1OP5H 1NKRA 1YNLH 3JWOL 4QRQA 1ZT1A 2UZIL 2C4XA 3EOAB 4L9DA 4X7SH 1KIQB 1ORQB 5F71A 3NVQA 1CGWA 1JIBA 5BV7C 4XB7A 3ZT7A 2VUYA 1T1YA 4JR9L 4QEGA 1EFXB 2IAMB 2WWMD 3VGEA 3R8QA 4QYOB 3GGWB 3H7LA 8FABA 1FVEA 2H8PB 2AJXH 2FB4L 4FNLL 5E99H 1I3VA 2DMCA 2GEEA 4Y2DD 1VGKA 4NFCA 4P46D 3MFGB 3MBED 4FABL 5BVJA 3MJ8B 1HHHB 2YPLE 3PGFH 5F96H 3PXHA 1ZLVH 2OJEB 3NBNA 4U1LB 1F4YH 2F58H 5FOBA 2DMKA 1X9QA 5IEKA 4E5XA 4X6FA 1EEUA 4PYHA 3W9EB 5DJYB 2YBRA 1T83A 5I1KH 1TCRA 1VHPA 2CQVA 2MCPL 4L4TA 4QRSA 5F3BA 5JW4R 3WDJA 5IK3A 5CP3A 4O2EA 5TE4H 3GZKA 2DKMA 4OGYL 1LO0L 2E8YA 4LQFH 2BNQA 1P9MA 4KV5E 3U4EA 3PQYD 4M4PA 3NPSC 5CD5D 1U8QB 4D9QE 5C0RL 4JHWH 4I0CC 4L3ED 1I9JH 4JRYA 3MUHL 2BVQA 2Y6SC 3L3DB 1CFNA 4FQIL 3IS0X 2A6KA 2H6PB 3F7YA 2BNRD 5SWSD 5I15L 1CFVL 1RIVH 25C8H 5J9PA 2BNRB 1UB6B 3D0LA 1C5BL 2VLJB 4YQXL 1B90A 3CFBA 1T3FB 5D1XD 5I8CA 4RMQA 4UINL 3WIHA 4YAQA 1YN6B 1D5BA 1YEDA 4F9LA 1JPSL 1PLGH 2IAMD 5E7BA 3DLQR 1UZ6F 1IE5A 4HPYH 5GGQH 3GRWH 1MAKA 3CMOH 3BO8A 4FQQA 1RJLB 1WLHA 5DA4A 2C1OA 3HTLX 2OZ4H 3TBYA 1BLNA 3O4OB 4PJGB 4JJ5B 4NQDA 4OZGB 3KR3H 4L1DA 1A1OA 3N9GL 4MAYA 2A83A 3MUGB 1EJ6A 5JDSA 1CL7L 4NN5B 3KPRD 3CC5B 1HQRB 2DB8A 4G3YH 1Q9KA 2KZ1B 2JIXD 5D5MA 1WBYA 5L8KB 4NGHL 4EN3D 1W0WB 4MAUH 3TZVC 4PD4K 5C0DB 3SY0B 4HKJA 2D0FA 4MQXD 1L9NA 2ED9A 2AVGA 5GS1A 1ZGLA 3GMQA 3LQAC 5TE7H 5JW4N 4NN7C 4JDZA 2NW2A 2FD6L 4JGJA 2YXFA 2PXYD 4OCXH 4HG4J 3DARA 5F1OB 1TNNA 1UB5A 4R8WL 4DKFH 3DX9B 3DMMB 1P53A 5L2JA 2XZCH 1Z3GH 2BY3A 3BFOA 4O4YL 4YLQT 5ESVA 3BH8A 1KJVB 3WIIL 1D5XB 1H3WM 3L9RA 1ETZA 3MUY1 1T04A 3LKSB 4UBDD 3HZMB 2A6DB 2MPAL 4WFHD 4OLEA 4QY8B 3ULUD 2ESVD 3R8BB 2VDRL 1ZHNA 2I9TA 3HNTH 2OM5A 2Z0BA 4PG2C 3PWUA 3TT1L 3HUJA 5BRZE 3PL6A 5KSUA 1H15B 4EBQL 1XF1A 1RK1B 1FRGH 3G6JA 4JVUA 5IHBA 4U6XA 5IB2A 1C1EH 2HRPH 3NAAL 3KGRA 2LU4A 4L3EE 4QGYA 1OHQA 1V8HA 1CTOA 2BXZA 1M7DB 2P8MA 4XC3L 5EH1A 1SJXA 1YEKL 1ZHLB 3L3KB 1NBVL 5IW1A 1KYOK 2VISB 1OTSC 4Z5RA 3GHBL 1F8TL 1L7IL 4RA3A 5TFSL 2BNRE 1F42A 3MGOB 5EZIL 3MROA 4LHUB 1KN4L 6FABL 2X4OA 1ITBB 4PV8B 1T1XA 2P8PA 2R69H 3QEGL 5JXED 3QG6A 1YEJL 4HD9A 3QEQB 1IVLA 5IB5B 1ES0B 3LMJL 4IOFD 3CSYB 1AO7B 1I1FA 1CXKA 4PJCF 2J5LC 3QEHB 2XI9A 5EO0B 5IHLB 3S6CA 3HCVB 1BBJB 1NAML 4Y8AA 3QEQD 2F74A 2Q6WA 4XP1L 1QEWB 3WNMA 5TDPA 4WHDA 1CG9B 4G6KL 1NC2B 5EU3B 5HYJB 3KPLB 5T3ZH 3C5ZD 2HJLA 3VXUA 1CGXA 4PJEF 3ECBA 3NA9H 4PB0H 1RQ5A 1LDPH 2VRAA 3L3JB 1KCRL 4HWBH 3MRNB 3VGAB 1AQDB 1HXMB 4WWID 2CLZA 2NY5L 5CEZD 2ZOLB 3Q48A 1EMTL 2CLRA 1U8MB 1JRHH 3V6BR 4ZO7A 5HGHA 5DRXA 5GRYA 2BVOA 1I85C 5I1CH 2IFFL 5CHNA 3EOBB 1QSZA 4RCAA 4HUVA 3SCMB 4GRWF 1Z5LB 1JPGB 3WS3B 1X3DA 4ODHL 4WUKH 2HTLD 4U1IA 3MO1B 2VLRA 1YJDC 1D6VH 5FO9B 2BRRH 2WLZA 4PLJD 4UOJA 5DEZA 1SJHA 2VLRE 5IVXE 4BZ1L 4OKVA 4NCC1 5IR1B 3F12A 2L7UA 3C8DA 5EN2B 1U95A 1UJTA 4M9OA 4QRRA 4WGVB 2YEZA 1IC5L 4N90E 3ULUE 1LE5B 4ONHA 5K9KA 5M7QA 4JFYA 5DVKA 3RZCC 3SN6N 3RA7L 1S7SB 1GGBH 3E0GA 4XP9H 1T03H 2FNBA 3OZ9L 4XCYA 1QBBA 4JREB 1VKXA 3O11B 5FO8A 3KPLA 3D18B 3WIFB 3WO4C 1QEWA 3LOWA 1INDL 3OR7A 3ALXA 4P49A 2D0HA 4OD3L 2CK0H 5JPNB 2X4QA 3SQBA 5GGRY 2VWEC 5C0CE 3CXDL 4RFOH 4NM4L 3QEHA 1F58L 5D2LA 5J56B 1RZ7H 2LVEA 3V8CA 1L0QA 4Z0BH 5EIQA 4YWGL 1Z6JT 4UNUA 2VAAB 4WENB 1KELL 4YXKH 4W70A 1UA6L 2QHLA 5IROC 1B0WA 5C9JB 5GGSA 5DR5H 1HK6A 2EC9T 3LS4H 4U6XB 4MMZC 2FR4A 3BPNB 5CUSL 4ZUVB 4OIIL 3HZYB 1UQSB 4GMSH 1CVRA 4JFFD 1Q0XL 2EO1A 4JFHD 4Z7VF 4L4JA 3QUZB 3Q5TA 4IRSB 1VFAB 1Q1JH 3S34L 3RY4A 1CTNA 2WP3O 2F5AL 3FZUD 3DBXB 2UYLB 3P0YH 5BOZG 4I8DA 3ABZA 3K80A 5JPMA 4Q9CA 2R2BB 1D5IH 1NGWA 2QBWA 3S88H 1MCQA 4I77H 5C7XH 1EEYB 5FKPA 3O2WH 4OQTL 4ZSOE 3NFSH 4ODWB 5C0EB 3O3DA 3WBDA 4UT6H 5I1DB 5DJXA 4YHOL 4CBPA 2B1AH 3QXUA 1RIUH 1MHPL 4X5LA 4LL9A 3NPSB 5GRUH 4Y5XB 4Y7MA 3Q0HA 5I1JL 3WS3A 5KVFH 4RQQB 1ED3B 1CGTA 2D7NA 5D1XC 1RK0A 3ZSTA 5GRVL 1HEZB 2DM7A 2P8LA 2AV1B 2UWEF 4WHYH 3GMMA 3NCCB 4LLQA 1CDCA 1MCPL 1N59B 3LH2H 5EZJA 3PQYB 2C9AA 4WI9A 5B39G 1UEYA 1M71A 5IM7A 2OMBA 4JRYE 3PP4H 4M3KB 3ZKQD 4OQTH 3GJEB 2DBLL 4XH2A 3TIEB 4I77L 4H8WH 3WFZA 4HC1L 4OLUH 3OAZH 1JZ3A 3LEYL 1IC1A 2EO9A 4FQXD 4PJIE 1TQCB 3MUJA 1FNSL 4Z7QF 1HI6A 3EOTH 4KJQC 4ZXBB 4LAQL 2XKNB 2EXWC 4PJGF 4W6YB 5FXCH 3WV0A 1WITA 4N0CC 4MJ2A 2EZ0C 1ROWA 2G9HA 4L5FL 4HIEA 4NQDE 3U4AA 4N8CH 2VQ1B 3MX0A 3KPSB 3TVMD 1GIGH 4LSRL 5D7IB 3MRBB 2P5WD 4LHQB 4HKXA 3FHQA 4GOSA 1HHIA 4WI6A 1CFNB 4CU8A 4JRYB 1EAPA 1HH9A 3VD9A 3F7VB 4NQED 1H3XA 2Z4QB 4NN7B 2R1WA 2VQTA 1N0XL 3ZDYF 5TPWH 3QUZD 4IRSD 3VG9B 4IBLT 5MHSE 4KGJA 3TP4A 1EBPA 5E8EA 4OLXH 5LCVL 2IQAB 4XRCB 2MJWA 1I8LA 4HK0B 2DQUL 3GHEH 4CMMB 2I9TB 3BSZL 1PFCA 3O2VH 4L4TE 2VN4A 4JRWA 5C0AD 2DM2A 1K2DB 4H8WL 4POYA 2XA3A 2VZSA 5F8QC 5C08D 2AXHA 5IKCB 4WU7B 1U58A 4DTGH 2HFFB 5FM5M 4FFWD 5C0FB 4MX7B 1K9TA 4G8EB 3LIZH 1HSBB 1NDGA 1FYHB 1A3QA 1NAKL 3IAQA 3DHJA 1ZANL 4XWGL 3MGTA 5B21A 3SKJL 5IHZA 5GHWL 3DTXA 5I16B 2XT1B 4GRLC 3QXAA 1NGWB 1U3JA 5F7HA 4JRYD 3BAEH 4CNIA 1K8DA 4KKCD 5DQ9B 3EO0B 2B1HL 3LPGA 4PV9A 4Y89A 3THML 3RU8L 3Q6FA 4KI1A 2R1XA 2VXUH 4TNVK 4UUJB 1WVZA 2NY0B 2X70B 1EDQA 3OKOB 4X99A 4YDJB 1IARB 1MOEA 1N8ZA 4KMLB 4XAKE 1NMBL 1G7QB 2W0KA 2XA8L 4S1RL 1BZQK 1BJMA 1VFBA 3BP4B 4N5ED 2Y07H 4U1JB 3K1KC 5JHDB 1TZGL 3TIEA 3JV5A 2LV4A 1E6JH 3GJEA 2P5EA 4G8FA 5HDOA 3HS0A 2F53D 2V2WA 3T2NL 4OLVH 2ORBH 4P3DA 3BQUD 3VGAC 2DWEB 4QHNA 3ZKND 4GG8A 1HEZA 3WFCL 2BFVH 2GJ6E 4QXTB 5GRWA 3PWNB 4XI5C 1KIRA 1XGQB 2LU3A 4HIJB 1T20A 4LGPB 4N9OB 3UTOA 5C0JA 3CU7A 1HCVA 1H5BC 5I74B 4ELMA 2YKLL 2VLKE 1IGIL 2ZWLT 4E0RB 4LBEA 2CUIA 3VXMA 1EA9C 5F44A 4LGRB 3OXRA 5FUCC 5SWZB 3LAFA 2G5BA 4X9BA 2VZTA 5JHDE 4DW2L 5K59F 1VFUA 3BP5A 3MRGA 5ESAB 1S7SA 2CDFA 2YD7A 2YBRB 5C2UB 4TRPL 3W82A 1J0YA 4MQSB 2WK2A 3UZEA 5J12B 4ONHB 5K9KB 3CDFA 5C8JB 4UIKH 4KHTL 3T0ED 4LKXA 1RZ8A 4ZFGL 1WWCA 4C59B 5C0GA 1OF2B 1K4CA 4CVZA 5BVJB 4U1HA 4EOWH 1CDIA 2Z9TA 1XGRA 3KPOA 2CKBL 4A6YA 2FZ3B 3T0EA 4ODTL 5JW4Q 2DTSA 1JFQL 4WGWB 4AT6A 1KB5B 4WWKD 4YIQA 1FH5L 1HINH 2CRMA 3T8XA 2DD8L 4NNPH 4J3VA 4HIJA 3U9UA 3X14B 4O58H 4LCYA 2PO6D 3EOBA 2BSRB 4RWYL 3DV4A 1JFQH 3C9NB 2VXQH 4DKFL 4OLVL 4X6BA 4ONGH 4WUKL 3BDBA 5D1QA 1NGXA 4BFGA 1FCGA 3MNZA 3DECA 5FECA 3SCMA 3X17A 4P5MB 4CMHC 1AQDA 3MV8E 3OSKA 2XN9A 5DRXB 5EU6D 1G7LB 2ZJSH 3RVWC 3VRJA 1V7ML 4R9HA 2QLVB 1P84J 1PSKL 3MV7B 3UTQB 4EVNA 1B4RA 2R4SL 3EIFA 3NCJH 4GS7C 3TA3C 4HC1H 2DBLH 3MOAL 4E41A 1I3RB 1NFDF 2QSCL 4DW2H 1XF2A 4JKPL 2GAZA 3MC0A 5CEXB 4Y1AD 5DS8A 4APQA 5E5MA 3QXAB 5BMFL 4X8XA 5LBSL 3GMOA 2ZKHL 4X80L 1F4WL 3CFDA 4MA8L 4C55A 2C4FU 2A6DA 1I7RA 1JF5A 4LIQL 4NRYB 1KJ2B 4X6DA 1F4WH 5D2LF 1LK2B 1RUMH 4UTBL 5EORL 3V5HA 5AUMB 5I1EL 1HCFX 1UVQB 4JFQA 1YEFL 2BXYA 5IFAH 4FQCL 2JIXB 3DVNA 4XBGB 1TVBB 3V6FB 5KVFL 2AK1H 3ZHKA 2WANA 4JRXA 4DWHA 5JOEA 4HK3N 4J3TA 4LLYA 3PWJA 4PJAF 3KPMA 1JZ5A 3KDMB 3TH2T 2GCYA 3BXNA 3CZFB 4FXLA 5JQHC 1BBDH 4R3SA 5D2NE 1XFPA 1J5OH 4U1GB 1CFQB 3MJ9L 4R26H 1ODAA 3IDMB 4BQ8A 3BUYA 3PL6B 4HWBL 5I73C 4P0DA 1R3JB 1T4KA 1KCKA 2HJFB 2NY2D 1ZHNB 2BOCA 5KTEH 4GUPB 4KHXL 4TULH 3T0BA 4QXUL 4X6DE 2DLHA 4QHUB 43C9B 4X4XA 1QRKA 2D03L 4FABH 4PP2A 1KEGH 3O4LE 3TA3D 4XP4H 1I3GH 4H26B 4M61A 4LSRH 4MYWB 1IFHH 1N5YL 5DEFA 1S7WB 4X83A 4Z7NF 4PYGA 5JIKA 5DS8B 4LEOA 4APQB 5CZVL 4FQJL 1QFWI 4YBLB 2W0LA 4YXKL 3BMWA 4UT7H 3IJSA 2XPGA 1HZHH 5IW6B 4BUHA 3M07A 5FCSH 1QSFB 2B4CH 2H26A 4MB4A 5DJ8A 3LKPA 4UBDC 5LGJA 4IOIB 4PLJC 5E4IA 3TO4D 3X13B 1P9MC 4HIXL 4NUGL 1T66D 4HPOL 5FHBL 5I1AA 2ICEA 1WBZB 1ZK9A 1JZ2A 1EK3A 1NBYA 3W11D 3VFWB 2MSPA 3MV8A 2H2PD 1F5WA 1A22B 2D31A 4NZJA 2Z31C 5C0CB 2X4UB 4NYLA 3UJJL 4E42B 4KDVA 4P5MA 3QEQE 1C08B 3HPJA 5GGTL 4XPBL 5A3IC 3WE6A 4DEPC 3KXFD 3VGBA 5LGHL 4Y1AE 3IJYA 1EX0A 1KJ2A 4OFDA 1BFTA 5E1AB 1H3TA 3HR5B 1I3GL 2Q8BH 1CE6A 1MCHA 1M71B 4KXZH 4X6CA 5IM7B 3V5KA 4QRPA 2CIKA 2Z31D 3N0PB 4MB5A 4HDIA 1PYWB 5H2BA 1M7IB 2LFGA 3BH9B 4PRIE 4KGLA 2R15A 4PJ7B 4K3HA 5I9QB 2OCFD 3MLXH 3FB7A 3LS5H 1U3HC 3HFML 4HIIB 5F9WB 5TF1L 3SGDH 2IANB 5FEBA 1RURH 2R0ZL 1KTLB 3U79A 4HGWB 4JFFB 1ZA6B 3QUMH 4MAYC 4QHUA 4PJEE 3BUYB 3HG1A 1EMTH 4QGTA 4L8CA 2JCCA 2XTJE 5I66A 3ULSA 3WIHL 3X3GH 1S7RA 4GKZA 1R24B 4D0DA 1FZOA 2XQBL 1GC1L 1UADC 2CKBA 4NQTA 3QHZL 1JWMA 4ALAL 1DCLA 1F11A 4P23B 2RIKA 4FQHB 3LRSB 3ZKNC 2BP3A 5SV3A 3MLPA 2B5IC 5CMAB 3UTTD 5ACLA 3N1PC 3LB6C 1MLCB 4N90D 3QDGB 4GAGL 3SPVA 3BGFB 4F7PA 4X6DB 3PWJB 4X98B 5F7WC 2OS7A 1HH6B 3WEXA 2CLVB 3LQMA 5L2KA 4OZHF 3TBTA 3KJ4B 3GUTA 1EERB 2YD5A 1RURL 3WNPA 1GZPA 3HI6L 3QXVA 4NO0D 3BPOC 3L1OL 3NPZB 3V52H 4ODTH 2YRLA 1I7UA 2Q20A 1YECH 3BEWB 3ZZ1A 3WN5A 2C3VB 2X44D 3MRCA 1KN4H 5CP7B 4PJFF 2NNAA 8FABB 2VAAA 1EHNA 1YN6A 1QYGH 1E4KA 2V2WB 2N1KA 4HKZA 1XEDA 5IB3A 5JA9A 2WWKT 4OF6A 3TH3T 1G9ML 5FGBC 1MWAL 1A7PL 4OIAA 4WW1A 3VXRA 1I1YB 2BVPB 3LN5A 3MOAH 4QNPF 2ILLA 1I8KA 4JEGB 3DV6A 3GRWA 1MWAH 3BN3B 4ZTPH 2E7CA 4JN1H 1QHOA 1U8QA 1A5FL 3ARDB 5M95B 4I4WA 5E24E 4JDTL 2XY2A 3BSZH 2A1WL 4U0RB 1V7NH 3QR2A 1CFSB 5HHXH 1RY7B 1X5KA 2XACC 5DJYA 2GKIA 4RWYH 1DLHA 2BNUA 5K9QG 4JFHE 1A14L 2Y36L 1OPGL 1BF8A 4KJPD 5CJ8A 2A6IB 1URLA 5ICZB 1JK8A 5EC2A 4MNHB 3TM6A 1VACA 3ZDXF 5J12C 2IJ0C 3RVTD 3NCFB 4M6ML 3PGFL 4MNGA 3WD5L 2NTFB 5CP7A 3DGCR 3RY6A 1MJ7H 2P5EB 4G8FB 1MWAB 3OKMA 3RVXC 4U7MA 1XGPA 4S2SB 4R7DA 4GKNA 1DTUA 3F7QA 3RUGF 2MFNA 3GSNB 1DR9A 2EEAA 5EFIA 2ZCHH 2OMNA 4XVJL 2DI9A 2OTWB 5DQDL 3CD4A 3QUYD 4R2GC 5HYSA 1DQJA 1CD8A 3SDXE 4KKLD 4JM2F 1YEGH 4XPHH 1JE6A 3T0XA 5A2LH 2NXYD 2OL3L 2UZIH 4MJ4A 1TITA 4MNQD 1T7ZA 3QDME 4XX1E 5MEOB 1IQDA 4RDQF 3UTTE 4OCMC 1J05A 4N0FB 2PNDA 3OJ2C 2IMMA 5DF0A 5F88B 3D5OF 4ZTPL 3CFJA 1MHHA 1I8KB 1JNNL 1RZFH 3QFDA 3MV7D 4KTEL 5IF0B 2DAVA 3BVNB 4LP5A 3VFUA 3K74B 5GGQL 2VH5L 5E8OA 1G9MH 4NKOB 1PG7H 3IJHB 1ZLSL 4BH7A 1FL5B 4KTEH 4MNGE 4YEEA 3S5LA 4LRIA 1CFVH 2PW1B 1QPPA 5FKAA 3D39D 1U0QA 1U3YA 2ZSVB 1S7TB 4G6MH 2PO6B 2F8OA 2X4PA 1AGBB 1IGCL 3K3QA 1W0VA 4AG4H 4B7LA 4LVNB 1EH9A 1XMWA 5CD3B 4Y4FB 4ZUTA 1XIWC 2X4SA 5DZNA 3RVTC 4W6XB 4ZPTB 2JELH 4P2RA 4XRCA 3LKRA 4XVJH 4YZFE 3RZCD 1SM3L 3JV4B 4IMKA 3IXAB 5EUOE 2YMXL 3PWUB 5KBNC 4F8QA 5JOPE 1NMBH 2PXYB 3ZKSD 1C12A 1MCDA 3MRIB 4PJDF 3MNVA 3NTCL 2EDFA 1Z9LA 4P9HL 4RGOH 1T7YA 4DKDC 5DRWA 4ZAKD 5DURB 1XCQA 3GSOA 4JKKA 4N5EC 2OTPA 2WW8A 4P5KA 1N64L 4GBXA 2FL5B 3PL6C 4HAFA 3OAUH 5F8RC 3RAJH 3IDGA 2R9HC 3FFDA 4EDXA 2BOCB 1KFAH 5L7XL 3IETA 3QUXB 1F6AA 1FFNB 2AJZB 5DFTA 2YXMA 2GT9A 3EUUA 4CJ1A 2JCCF 3RQ3A 4TOYH 5GGTA 1RJZB 4H0GA 1F2QA 3SDXB 1LP9A 1A9BB 3VD7A 2YMXH 5CEZL 3TJEH 4NO3B 5E2VH 2OSLA 3E6HA 1KSRA 2NCMA 1Q9LB 1HIML 4HEME 4OLWH 1NUNB 4NWTH 4GMTL 1J0KA 5EWIL 4U7SA 4Z78B 4P2QB 2R2CA 2WMPA 3QO0B 4LCWB 3P2TA 4I0PC 4FFZL 3TO4C 2CR3A 4EUPG 1TJIL 4AG4L 2KQMA 2O61B 4UAOB 1DQML 1UCTA 1YYLH 4MA1B 1KCVH 2R0WL 2VL5B 2CXKA 5IMOA 3BRGC 1VEOA 5IVOA 3RWDB 4XBGA 3V6FA 4JZOB 3K8KA 4X8JB 3OX8B 4F3FA 4PY8I 3KS0J 3HMWH 3ARUA 1D9KD 2I5YH 3SDCD 1S7QA 1C5BH 4WJ5A 4URTB 3TPUA 2B39A 3H9ZA 1UXWB 5C1MB 2MQ3A 5ICYA 5EPMB 3B4NA 1FORH 5ACMA 5C70A 4PGCA 2YD3A 3IXAA 3QUZC 4IRSC 3MODH 3WXWH 5CIPB 1XR9B 4DZBB 3QZWA 5HDLA 2W59A 1I9RL 4WTZG 5ACZB 2QV2A 3I02A 5E08H 4JKPH 3RTQA 4LCCA 1FFPB 3C6SA 2YSSB 1I7ZA 3FQUA 3ILPB 4MD5B 3HZKA 4S1QL 4LU5L 4GAYB 4L5FH 5DC9B 1B4JL 4XCNA 5D96B 4Z18A 3EJZD 1L0XA 4XNMB 4U33A 4BFIA 5LKNA 4JFXB 1PD6A 5F7UA 1BBDL 4NPYA 1V3KA 1LDPL 5T3ZL 3TZVB 1ZE3C 4MXVE 5E8NA 3NA9L 1RSFA 2COQA 4PB0L 1FH5H 1AC0A 1HINL 2W91A 2V5TA 2J8UB 3GBLA 3TFKD 5T1DL 3VI4F 3W0WA 4F9PC 3AB0B 5J6GB 5KVEH 3RUGA 3QEUB 1FL5A 4X9GA 4NKIL 5SWQB 3NMEA 5T5FL 2R0WH 3QT2A 4QOKA 3NFNA 4Z7WF 3MRMB 4JY6A 2BSRA 4UIMB 4X7FC 2DS4A 3EDFA 2W38A 2CJUL 3GNMH 4ODUB 3MLUL 4HUXB 1A14H 2Q8BL 1MAMH 1ZA3A 4ZFZA 3UTZB 4AEFA 4U1MA 2BSTA 3L7EB 4HS6B 2MTPA 5ECJE 3O3BB 3OZ9H 2Y5TB 4MCYA 4TNWK 5D1ZA 2X89D 1K4CB 1AFVL 4JFFE 1XCTB 4IOFC 1KJMB 5D2NA 2DQDL 2H1PL 2YK1H 3QRGH 1HQ4A 1UQSA 3KPNA 3GMRA 4UT7L 4E0RA 5J11B 1TMCB 4J8RA 2AEQL 3QUZA 4FQPA 4IRSA 5C0JB 3S36L 3OXRB 5SWZA 2W07A 3GIVB 5EG6C 1FN4A 4ZOCA 4RBPK 1YMHA 4Y5YC 2VR9A 2Z91A 3S3JA 5DJAA 4JAMB 4YFDB 1AIFB 5GZOC 2MPAH 1A9EA 5EU6A 3QDJE 5T1DH 3U83A 2HT3C 4XC1L 4BK5A 3AREB 3ALPA 3HRPA 5CJQL 4WWKC 2X4QB 5L6YH 1Z3GL 4OCXL 2PYEB 3MV9D 4PTTB 1S7XA 2AK4E 4XNXH 4HG4K 2J6EA 4UTAL 2ADIA 4HXBH 3QWOA 4L8DB 2FEEI 2GAZB 4NC2B 4ZTOL 1U41A 1HHJB 2ICWI 5DVMA 2P42B 5IB2B 2HH0H 3GJFB 2DQEL 2HT3D 5J13B 4Q9QH 4NO2A 3GMRB 4KDTC 4P5TC 3UO1H 2YA0A 1YQ2A 3VRJB 3B9KC 3BD5A 2ZSWB 3DUSA 2BSTB 3L7EA 3WIHH 1P5UA 5ALCH 1CL7H 1NCWL 5JO5B 4WHTB 1CZ8L 1U93B 3B83A 2F53A 5J3HC 4N0CD 1X7QB 4JZJC 3I85A 3MLUH 2XWBA 2XWTA 4Q58C 4MQXC 4P46C 1E0OB 5DEGB 5JMRA 2NX5E 4OD2B 4X9HA 2E3VA 2IBZX 4JHZA 5GS0D 1X5JA 3IFOB 5IWLA 1B88A 4L3CB 1U95B 1S78C 3VXTB 4RDQG 5DZLA 4TQEL 1L7IH 2ICWJ 1H5BA 3O81A 4I18B 3RVUD 5IJVB 5JHLL 4UT6L 1WCQA 1RIUL 4QOKD 2NR6D 4L4VB 3QNXA 5GZNC 2ZUXA 4LSTL 4MXVF 4C56B 3QEUA 4WTXA 3S37L 3BZ4A 4AM0A 2EYTB 3A6BL 2LU7A 5AYQA 4KZEL 1FGVL 3OKKA 3RVUC 2VDNL 4FQLL 3HZKB 3WNLA 4O5LH 5C09B 4CMMA 5SX4H 1NAMB 2R0KH 3O45B 4YJZL 2WUBL 1U8IB 1NCCL 1CCZA 4PGBA 5F7MC 3FAXA 3WXWL 3TPKA 4XNQB 2B2XH 1GRWA 1HILB 3NABH 5C0AE 2O5YH 2DF3A 4NWUH 3VXME 4JM2A 3AS1A 3VCLA 3ECBB 2IQAA 4XHJD 3MLTB 2VXQL 3WO4B 5CJQH 2DQIL 4HWUA 2UY7A 4ZUUA 4DZ8B 1U91A 2A1WH 2OXGA 1X5IA 4QRPB 2I07B 2YWZA 3B9KA 4OCRL 3CXHJ 3VH8A 1OSPH 4YUEH 1E4XI 4ACPA 4ZD3H 1DVFD 5EZIH 1BQLH 2KH2B 4K07A 2V5YA 4WI3A 4LLVB 4X5WB 2X9WA 2EYRA 3PQYE 1UM5H 3EDJA 4PR5B 5DI8B 5JUEL 3T04D 4D9QD 5C08A 5CKAA 3F58H 3MRLB 1SYSA 4Y16C 4BKLA 1NBZA 1MFEH 4YHYC 1QLRB 3GEWB 4KAQL 3B9EA 3T0WA 3ZTJH 3AVEA 4OUOA 3S96A 1M4KA 2MHAA 4PRID 3I84A 5EU4B 2OR9L 3SDCC 3INUL 3FAWA 2NW3B 3PHSA 4ISVB 1CR9H 4QRSB 1AGEA 4MA7H 2YPLD 1AGBA 2R1XB 1JTOA 4QXGL 3TT3L 5DZOA 3ARTA 4HX1B 4XAKD 1YPZA 3FMGL 3GHEL 1C1EL 1QSEA 2WUCL 3QUXA 3TV3H 1SEQL 1FRGL 1X4YA 1DBAL 1ZT4B 2WINA 4PJFB 1IZKA 2HMIC 1NLDH 1ADQH 3P30L 3T3MF 2FLBT 4RMVA 4GFTB 5J9PB 1X5GA 3B5GA 3IF1A 3O3AA 1I7TB 3ZSSA 2CK2A 2NY4B 3MNVB 2ADJB 1T1WA 4ZUWA 4M7JH 1PY4A 4ZUUB 5HPMB 1U58B 4QXUH 3TVMC 1E4KC 2NY2C 4TSBL 4PJCE 3O6FC 1OAUH 3R1GH 4PS4L 3RPIB 3IS1X 4YFLF 3ARBA 5F7DB 4LLUB 3OAZK 4ZNEE 4OIIH 4IDLA 4ZS6C 2P47B 5JHDD 3T3PF 1K4DB 1OTTC 4NO0A 3SGKC 4HX1A 1I9RH 3S96B 1IGCH 1TQCC 5BQ7A 3ARSA 4DK6A 3SJVE 1RVFH 1NBZB 2NW3A 4ZXBC 1JNHA 5C92A 4ZMAT 1EGJH 3MUGA 1RJLA 5CCKH 3CSGA 4Y5VC 4F15C 2DYPA 4AENA 1ZKAA 3NA4A 1AGCB 4OZGA 5LWYL 1ZLVK 1UWXK 4JB9H 3BX7C 4DTGL 4PRHB 4U6TA 4X5XA 5GGVY 3UJJH 5DJDB 4ODVL 2AEPH 3LY6A 4Z9KB 2GYSA 1XIWD 4PJ8D 1TXKA 2V2TA 3WFDH 4Q6IB 1Z9SA 5FHBH 2DQDH 1OQOA 1CT8A 3RWGA 5D6DA 3GDBA 4NUGH 1MHPH 3D0LB 1ZV5A 4D0CB 1DBBH 1BQHB 1A6PA 3VE0B 1CF8L 4D8PA 2X05A 3O3EA 3K0WA 2EDLA 3G08A 4NQEA 3VG9C 1FV1B 2VLKB 3N1MC 3ZTNH 4NQVB 2W0FA 3IU4H 3FZUC 3QWRA 4CU6A 5DFVD 3RWHB 1JHTB 4J4PA 1RZJH 5DT1L 4WHCA 5BXFB 1JI2A 4M1GL 4R7DB 3M45A 4ORZC 4KK8C 3PQYA 3VFTA 1KFAL 3STLA 3QNZB 5JTWA 3GSWA 2X4TA 4KRNA 4RISH 1EHXA 3BUTA 1JPGA 4MA3B 1T66C 4R96A 2FLRT 4MXQD 2ADFL 4N8CL 3VXPB 5EOQL 4GG6B 4XHJC 2HLAB 3HI1B 3MLSL 4X4ME 1AXIB 3RL1A 4PJ5B 1YMMD 5I0ZA 3SGJA 3CLEL 3MUZ1 1IM9A 4M5ZH 4HUWA 1XGUB 3JVGC 2HWZH 2E5EA 2ICWB 3GSNL 2EDXA 5F72S 2CIIA 1FFOA 2EKJA 3GI9H 4YZFF 1ZLWH 1FORL 3VXUB 3EYOB 1RIHL 1B2WH 3RY6C 4HUUA 4KRPD 3MJ7A 4BK4A 3VDBA 1QR1B 1A2YB 5A43C 2EIZB 3L3JA 1O7VA 2Q6WB 1GCFA 4PRPB 1JGUL 1AHWA 1MLBB 4Y4HD 3SKOA 5HXMA 1A1MA 1CDJA 1RAMA 3GSRB 4DGVL 1AO7A 3I75A 1A1NB 5FB8A 4BA8A 3WO3B 1MH5A 2CD0A 3GRWL 4Z76A 1SQ2N 4ETQA 4QRUB 3JTSB 4GXVL 4JZNA 5GXBB 1LEIB 2E7LC 1PX4A 3RIAF 5CEZE 3U7WL 1AP2A 1U8NB 1A7NH 3EO1B 4JFDA 4XBPA 5JIHA 1SY6L 2ORBL 4FFWC 5AZEH 4F2MA 3T1WA 3VWJB 2H3NB 4KJYA 4ZO6A 4Z7VA 5GS1C 1AIFA 3KPRB 3VXNB 4F7MA 2NYYC 4XAWL 1NBVH 4G80A 4W81A 5E6IC 1QSFE 5C0RH 5GRZA 2WNGA 4KQ3L 5C0ND 2ZOLA 3R0NA 4R4ND 4X7DC 4DN4H 5I1GL 3QIBC 3LN9A 1XR8B 3VG0L 3QCUL 3CLFH 1V7MH 5IQ9A 1W8OA 2VAJA 4G8IA 4HT1H 3MA7B 4Q74A 1WIPA 3MGTB 3I2CH 2VITB 3LZFH 1I7UB 3PWVA 1EZVY 4KRPB 5T1LD 2GSGA 3SDDC 1AXTH 2I60L 5T5NG 1I8IA 2ITDA 1V3LA 2OLDA 2FHFA 4QRRB 1MJ7L 2IADA 3RKPA 3RGVB 4K3EH 1S9VA 2ENSA 4P2YA 5H2BB 2PCPB 5IR1A 3BN9C 5D7IF 4LSQL 3ZT6A 3NIDF 1FHGA 4IMKC 3D2UA 4PB9L 4XXCC 1UM6H 5I8KL 1TZHA 5I30H 3NH7L 3QXTA 3LPFA 1FLRL 3L3GA 2OL3B 1XCQB 2PR4L 3BGAA 5SWZE 5F9DC 3FB5A 2H1PH 3QRGL 4XZUB 4N0YL 4UT9H 4PRBA 4HS3B 1V3MA 3V0VB 2AW2A 1P7QA 2OI9C 1RZGA 4TTDD 1A6VH 2FH6A 4UDUB 4Q7DA 4ZYKB 1WBYB 5C71A 5J6HA 4MNQA 3DX7B 3CC5A 1MSPA 4M62L 4PBWD 3V95A 4HGWA 4JFFA 4NO5A 3JTTB 5DVNA 2EDJA 4UU9A 1SYSB 4GS7B 1DZBA 4N0UA 3L3IA 4PJDE 1HQRA 4TVPD 4PJDB 5D7JC 4CW1A 2APBA 1RUPH 5IV2B 5D8JL 2PTVA 5ERWB 1BVZA 1ZHKA 2YOCA 4IOSD 4U6HB 3EYSL 2FYYA 3RX5A 2D3VA 2H2PC 3B8SA 3QI9A 3ROLA 5HYEA 3HZMA 2ARWA 1UH4A 5D7IA 2VDLL 4EZMA 4XNYH 1NUFA 4Z7WB 2VITA 3VCLB 3RWDA 4HMEA 5HHVH 3ZL4L 2BOBB 2VXVL 3W5MA 2JKXA 3FRPA 4F80A 1C8PA 1KN2H 1Q9OA 1UACL 2M8XA 3NCJL 3UTSD 5J6HB 4LPTA 5GGUA 5TE7L 4LASH 2NY4C 1AKJA 5CJOL 2FJGB 5EZLA 4XH2B 1MPAH 3HUJB 3LDBC 3L5XH 4XP1H 4UV4H 4XXCA 3STBA 2YD9A 2YWYA 3DVNB 4FHBD 3DXAE 5JNYA 4Z6AT 5DWUL 1A4JA 2XV6B 2ZUQB 2EC9U 1GGCH 2EE2A 1LNUA 1S5HA 2HT2D 5MP6L 5F93C 4P4KD 1AY1L 3ZYZA 3N1FC 3HE6D 1U6AL 3KYOA 1BWMA 4KK9C 2IGFL 1S7TA 3HN3A 2EXYC 2OQJB 1AQKL 1FGNH 4GT7A 2GQHA 3FMGH 1GAFH 1LEKA 4EUPB 2PN5A 2QKIA 2H2SC 3EO9H 4KDWA 3D3VB 2X7LA 5IUSA 1ZMYA 3AU1A 4MSWB 5J3HD 3VFPB 1I8IB 2ITDB 2AI0H 5IV2A 3G9VA 4QRQB 3QFJA 2IG2H 3JWDC 4Y5VA 1BOYA 3O9WD 4GMTH 2N7BA 4EBQH 3BPLC 5ALBH 3H8NA 4N0UB 5F6HI 4N0UE 4C56E 5JDJA 1ORQA 5BRZB 5DD6B 4JPKH 2BVQB 1BIIA 5H37G 1UWXH 2ZUWA 1AD0A 5CD5C 3QDJD 1TVBA 1UM5L 3GMPB 2B4CL 5DGQA 1NJ9B 2DQCH 5DURD 2DQTH 4MNQE 2GSIB 1S7XB 5CLWA 5A40E 2ZCLL 3QDMD 5JIPA 1S7VB 3HC4L 1MVFA 1P7QB 1G6RH 4HS3A 4R4FL 1K3ZA 4L9LB 1QSED 4WI4A 3QUYA 2FSEB 2H9GA 3KLHD 4G42B 2NY7L 1LWRA 5F3HA 4PJGA 4JPIB 2V5SA 3BPNC 5DK0A 3DURA 2CXGA 3X11A 2VZVA 5B4MD 4C57C 2D7OA 3P4MB 4IIQB 3TA3A 4XNZC 4KHXH 4TULL 4YEFA 4I3SH 3OKNB 1HHGA 5L88H 2VR4A 1I1AC 4Z7UB 5ISZB 2A6JA 1N7MH 2VE6A 4ENED 2CRZA 2LAGB 2PW2B 3BJ91 2HP4A 3NCBB 1RV6X 2DJUA 1YNKH 5KANI 3UBXI 1ZT1B 2GTZA 3EYFA 3LQAH 2XZAL 5EZOH 1WQVT 3ULUH 2HVKB 4XGZB 1FNEB 2MCG1 3PNWA 5TJWK 4G9FD 5CGMA 3K46A 4OCSL 3ZE1E 3EAKA 1DJSA 4D8PB 3SKNB 3TBVA 1G7MB 1R5IB 4JPVH 4RMSA 3WFCH 4GG8B 3RWGB 3CFCH 4H25B 4V1DD 5ID1A 1VGKB 1QZ1A 4Q6IA 3BT2L 1IGFL 1I3UA 1XGRB 4AEHH 2AQ3A 3D39B 1OAQH 4WFFE 4CU7A 2CKNA 3BDXA 5K33A 3QXDB 4OV5B 1D5MA 3U4BH 3CVHA 4PGJA 5BXFA 5IKCA 1PKOA 3BPOB 2EYSA 2VNCA 4JO1H 1T1YB 2CRYA 5FCUL 5JOFB 4JDVA 1HKFA 4KMTL 3X11B 4NQVA 5ITBL 4ZFFA 4M6NL 4RFEB 3RVXD 1FZMA 2X70A 2J8UF 3B3IA 5FYJH 2RFXA 5IWLC 4YHKH 4KZDL 3RIFF 2VIRA 2KDGA 5DSCB 4MHHI 4EIZC 4XWOC 4KMQA 4HXAL 1LGVA 4LPCA 1E28B 4EUPH 1CFBA 3C87A 5KS9E 3ILQC 2CO7B 3LN5B 3QQ3B 2B4CC 1BWWA 3O2DH 1KIRB 4JG1L 4YXLH 3UAJD 1I4FA 4PV9B 3LQAL 5DJ6B 5E6IB 4TSAH 4Y4HC 3RL1B 1XAUA 5L0QC 3GIZH 5KSVA 5CSGA 3RX7A 1RUAH 1IC7L 4EKXA 2IEPA 2YRPA 3MV8D 3QI9C 1DQQB 2EE6A 4ZFOB 2IPUG 4JZOA 2UVEA 3VFPA 1NCAL 5LGKA 2AQ1A 3F58L 4HHAB 3SDAC 4Z5RB 4LDOB 2C3VA 2VKWA 1YEIH 1NL0L 1GGTA 1AGFB 4OGAD 1CGVA 5GIRA 4KKAD 4JN1L 4JANB 3GSQB 1U8IA 1DVFC 5KSUB 5I8EB 4TRPH 5E9DB 1A64A 4PJHE 4JO4H 4NO0B 3BRDA 1DP0A 3V6ZB 4PRDA 1IGML 4YPGB 4NCC2 1BX2B 1LMKA 2PUQT 2V17L 4X0KA 3CFKA 4WFEE 3RBSA 1UKQA 1OVZA 3CZFA 2GY5A 1HYSD 5HI3C 1EV2E 4DGYH 1WK0A 2VC2H 15C8L 4P46A 1F6FB 4BZ2L 2JJTC 2Z8SA 2J8UE 3MREB 3MLRL 3HR6A 2FJFB 1EAPB 4MXWH 5FF6B 4V1DE 1CD9B 5C6TL 1T5XB 1S3KH 3RNQA 1PEZA 4XPFH 1EVTC 2Q76B 2CDGA 5ABDE 3BIBX 1BQSA 3BRFA 1FL6B 3QWQB 3C60C 3CFCL 1B4JH 1AJ7L 2BSED 1TPXC 5DD0H 3FQRA 4OZHA 4Y4HA 1RJCA 4GXVH 2OK0H 1F3JB 1RMFH 2CMRH 3SGEH 1P4LA 1UZ8B 4UOW0 5IVXB 1A7RL 3SJVA 3E2HB 4KKNA 4U2ZA 4WV1A 2PO6C 1YYML 4ZPTA 1EEZB 3V9FA 4WI7A 4OT1L 1HYSC 4DGVH 3AM8C 4K71C 2F15A 1FZMB 2W92A 4GRMA 3RWJB 4PRNB 4IOIA 5I1KL 5HD8C 3WKMH 1X5LA 1W72B