5E99L

Bovine fab fragment f08_b11
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'VLNQPSSVSGSLGQRVSITCSGSSSNVGNGYVSWYQLIPGSAPRTLIYGDTSRASGVPDRFSGSRSGNTATLTISSLQAEDEADYFCASAEDSSSNAVFGSGTTLTVLGQPKSPPSVTLFPPSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLSLTSSDWKSKGSYSCEVTHEGSTVTKTVKPSEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F08_B11 light chain
publication title Conservation and diversity in the ultralong third heavy-chain complementarity-determining region of bovine antibodies.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e99L01
4LSQL 2JELL 1YEFH 3O8XA 5LQBL 3ZE1E 1HINH 3L1OL 5I19H 5KSBB 3MV8E 5EFIA 1KJVB 1ZHNB 3H7BA 4K7PL 1V7ML 5HHXH 3B9VA 3CH8A 3GBML 1RZJH 3QWRA 4N90D 1KIPA 3C2SA 3MCKA 4WV1A 1FG9C 4PJGA 3EYVA 2Q8AL 3SCMC 3O3AB 4XH2A 2BXYA 1JK8A 1BEYL 3CFDA 1IBGL 3I85A 4PJ5E 4OD3H 3DMMB 1QYGH 1F4XL 1G6RB 3UXFA 3P4LA 3PL6A 3EDFA 3NIGE 5ENWB 2R2EB 2Z31A 5T5FL 1YY9C 3O4LD 1RK1B 3MUHL 5KVFL 1P69B 5FCSH 2NCMA 3EYQD 4Y1AD 2VZVA 4XC3H 3O6KL 3DYMA 5FYLH 3HCVA 3MOQA 3OL2A 4OUOA 3NH7H 1OT1A 1BVKA 3QWQB 4ACPA 5D1QC 3FB5B 3U4BH 1D5BB 3GK8L 4WFGE 4YC2C 2GHWB 1FYTD 3B43A 3O3BB 1KN4H 5EULV 3IU3B 4KV5F 1P4BH 3D48R 3MBEC 2KZWA 4MX7A 2IANE 1QFWL 2WK2A 4XNZC 4DVBB 4PGEA 3OKKA 1DZBA 3NIFE 2BSRB 3HZYB 1S9VA 3NN8A 1KJ2B 1B3JA 5F97E 5EOTA 3ARGB 5H94A 5AZ2L 3SDYH 2OSLA 4PS4L 1H8OA 3DLQR 5CEXA 1OF2B 5AD0B 5FM8A 3MXWL 2CD0A 4QHUB 1W0VA 3BVNB 1BFOA 2CKBL 3VFUA 3MMEB 3MYJB 4EXPX 1T89A 2R23A 3ARFD 1Z3GL 4XNQB 4OZ4B 4E9LA 5FM5M 1YYLL 1T6WA 3WL9A 4YGVB 3QEUB 2DDQH 4YO0A 3FOMA 1UKQA 4FQPA 3ZTJH 2EDWA 3WEXB 2FYYA 2OL3L 4PJXA 2Z35B 2DD8L 1JRHH 1YEDA 1KJ2H 2BNRB 3UPRB 2E9IA 3UJJH 4NM8H 2VH5L 4HIHB 1P7QD 2VDPL 4FQLH 1I7TB 4PFEA 4GFTB 4ZQKA 1FPTL 4LKXA 3GNMH 5CKAA 4JY5H 5EORH 3DXAE 3MOAL 4KK6C 3STLA 5D5MB 2FJGB 3BT2L 4KRPB 4LIQH 3ULSB 3RWDB 1J86A 3RHWK 2DB8A 5GS2H 1JPGA 2FBJL 4IRSA 2MFNA 3LRGA 5GGVY 2XNAA 1X6LA 1BZ9B 3IJYB 1YPZE 4ZUUA 4X8JA 1BP3B 2A83B 4RFNB 2ADJA 4M6ML 5E9DE 1Q0XL 5KJRL 3G08B 4G7YH 4R4FL 3VFMA 2FGZA 3GIZL 1L4IA 2XRAL 3CK0L 1HYRC 4MNGA 4MJ6A 4YR6B 1BQHA 4M1DH 2FB4H 1O7SA 1D6VL 2RBLA 4YHML 3L5IA 2YN5A 1EUUA 5DRWB 1B2WL 5L9DL 5E2JA 2Q7NA 2OR9H 4LCWE 3RIAK 3H9YA 5CEZE 3LH2L 3S6CA 1FAIH 2BVUA 4HUWA 4V2BA 5DQJB 5LVEA 1CE6B 2QKIB 4LCCC 4JZOB 2A77H 4FQ2L 3IDGB 3D9AH 4XMKH 4U2ZA 4LDEB 4OCWH 4F7CB 3FTGA 3NZHH 3MFFB 4HX1B 1CICC 3DHMA 4HF5L 1SY6H 1X5AA 4G6KL 1OQOA 3GMMB 5I1IH 2VJXA 5LXGH 2NY0C 4HG4J 1RY7B 3QIUD 4DQOL 4R2GB 3CFJB 5DC0A 4Y5YA 1X4XA 2R9HD 1F4YL 3VGHA 1EBAA 3VG9C 2YPLB 3PABB 4WHDA 1VFOA 1GXEA 4HQQH 3IDYC 5IROC 1LE9B 1LO4H 1J8HB 3MCG1 1BM3L 1DQLL 3CSBA 5CUSH 4HD9A 1NCUA 3AC0A 4JVWA 3RTQD 1WK0A 4PJCA 1KJMA 1HH9B 2BVYA 2EEDA 5T1LB 3BP6B 4NDMB 2XA3A 4G9DB 2DQFA 4AM0A 4D3CL 3EOBA 4WNQB 5BS0E 3JUYA 4OFIA 4GQ9H 4XHJC 2CSPA 2FX8L 4R0LA 2V2WB 4HGWB 3X3FL 3VXNA 1MQ8A 5HI4C 4RQQA 1KTRL 1MHPH 1MREL 1UKSA 4IIQC 5JNYB 3WLBB 5FO7B 2VDKL 2X4NB 3BQUC 1MCPH 2Q7YB 1X9QA 4KROC 4O58L 4TSBL 3MRHB 5BCAA 1U2CA 1M7IA 5F7EH 3KPOA 4JY6A 3O6FD 1T0PB 5EU3A 1PJ9A 3K4DA 4NZDA 5C0JB 4X7DC 2VDML 1JCKA 2VAAA 3TO4D 4TUJA 4PJFB 3L7EB 3TN0C 3IJSA 5I71B 1ED3B 3OKLB 4JO3L 2APTA 1L0QA 4C56B 3BN9C 1CR9H 3GI8L 2ARJB 4NWTH 1PSKL 4X5WB 4IRZH 2I07A 3QH3A 1NUNB 4OLWL 1IM9B 2DQEL 3G5VB 5KOVC 3V0WH 1F6AB 2P8PA 2D9QB 1FG2B 2J5LB 4G80B 2E7LA 4QLRA 3MOBL 3GO1L 2IBGA 3MGTA 1H3GA 4NKQB 4U7MA 4YAQB 4CVWA 5IUSA 1GH7A 3TVMD 2P5EB 4U1HB 5IK3A 3AS3A 4RGNB 1YN7A 2VC2H 5GRZA 4QXGH 4M7LH 5EOQL 1H5BA 3LN4A 4QKXB 4HJJH 1Q0YH 5C0FB 4IHOA 1DVFB 4CJ1A 3O9WC 4CU7A 1OCWH 1EFXB 4KJWD 4P46A 3RNQA 5C6TL 4ZOBA 1RUPH 3WKNA 4Z78A 4XPAH 5C0ND 5EOCJ 1SQ2N 4OI9A 4OF7A 3SDCB 1CGYA 2F54D 3FO2B 2BMKB 2YPKB 2X4RA 3Q3GA 3PGDA 5H8DA 1LD9A 4XTRC 5CZXD 1BD2B 3PDOA 4UILH 1G7QA 4S1DD 1A14H 3SDXB 1A47A 3LAFA 1A2YA 2XQBH 1Z2KA 3SY0A 1JRHI 3LDBC 1RMFL 3SE9L 3DUSB 1UCTA 3VXSB 5C3TA 3P9LA 4ODTH 5HXMA 2VDLH 1A4JA 1BQLH 4LP5A 5K59E 1YMMD 5E24E 4PG9B 4WDIA 1NBZB 2XV6B 3MACH 1NC2D 4EQ3A 4DK3A 4HS8H 4UV4H 1VEOA 5DZOA 5MEOB 3MRMB 1AD0B 3OKDB 3A6OA 5CJ5A 1BBDL 1CQKA 3HPLA 3GSNB 3NCYP 3BDXA 4OFYD 2BY1A 1F6FB 4AJ0A 5DMKB 1MFCH 2B0SL 1UJ3A 4ORZC 4YNYB 4ODHH 5B3JF 1WISA 4N5UA 4V1DD 1A1OB 2V5RA 1CFNB 3HG1B 3K1DA 4ZPVA 3IDMB 4PJAF 3GMLB 1OAKH 4M5YL 4M43L 3JBG7 3T0EE 2Y5TB 1KTLB 2Y5EA 4G9FA 2P24B 4H20H 3IJHB 4F7PB 2IPTH 3D1MC 3FCTA 2ZUUA 4Z7UA 5B8CA 4LPYA 1LK2A 1S9YA 1II4E 1ZHBB 3QZWA 4Q6IC 1FNFA 3VRLE 1XR9B 1AXSB 3FQWA 3GSNH 4NHUA 2UY6A 1T21A 4Z7VF 3KWWB 1IAMA 3HC4H 1FNGA 5JOFA 1HYSC 4MCYB 1R3LA 4PRPB 3BD4A 5CILH 3FB8B 2B5IC 4ZAKD 1OGAA 3VFGL 1CGSH 1NLDL 2W9LA 5H35B 1NGXA 3ZDYE 4Q9RL 4OCRL 4R7NA 2Y06L 3KPSA 1YZZA 1A7BA 2YD2A 1NC4D 3IGAB 1MHHA 4JREC 4M02A 1X5LA 4FMFA 5EU6E 2YPLE 2D4DA 4POZC 3DUUB 5FYJH 1ITCA 4XAKD 3VGAC 2WBJC 3NFNA 3QEQE 3AY4A 5GGVL 3GSQA 5HYJE 4YHPB 4LLWB 2I25N 3CDFA 5EIIB 4X9IA 2VLKB 5HGAB 4OZFH 2QJDA 5IBLD 1IAKB 2CDEB 3KR3H 4ZNCD 1A7PH 1HSBA 1BQUA 2QR0A 2XPGB 1FZKA 4HG4K 3DWTA 1DLHA 1P4LB 2QTEA 5HHOD 1ZA6B 4O5LH 1KXTB 5ICXA 5T1KA 3SJVB 3VFTB 4MHHI 1JHTB 1IAIH 1K6QH 2DWDA 1MAML 2MPAL 4FTVA 4KY1L 3QNYA 4Y19E 5DYOB 4GO6B 4JZNA 1QSFB 4I2XB 3ARBD 3RI5F 2OBGA 1CFVH 5ANMA 2R0KL 2FSEB 3JV4B 3VI4F 1UWXK 5ESAA 1MRDH 2F19L 3R1GL 4LRIA 1KB9J 1C5CL 2AXGB 1JHKL 4AMKL 4C56E 4GRLC 3IRPX 1H3PH 3F7YA 3ES6A 1RJZA 3SE4C 3B9KB 4TNWF 4Q9CA 5ICZB 2A9NH 1QEWA 5HYQA 4GAJL 4NM4H 3SHSA 4OM1L 1PKQE 2BHYA 3TWCL 3L6FB 5DD0L 3MRRB 4L9LA 1N4XH 4MD5A 4K8RL 5D7IA 5GGRB 4NP4L 4OAWB 4R90L 1SVZA 3FT4A 4MJ2A 3ISWA 3WYRA 3CH1B 1U8HA 4XP4L 5F3BB 4MDJB 3QDMD 2LTQC 5DD3H 1OL0A 4FZ8H 1X5YA 4FXLA 5LAXB 3ZE1F 4WFEE 3QFJD 5F72S 4ETQB 4ZS7H 4DGIH 4RGOH 4JKKA 4PTTA 2R9HC 3WIFB 3EO9L 3GB7B 3CPLA 3K2UL 1CFTB 5GZND 5LCVH 2VZSA 3MPCA 3UZQA 1SJEB 5IB2B 2Y9RT 4F37K 1UH4A 1T7YA 4HMEA 3RTQC 1UACL 2IEPA 1JNNL 1ORQB 2P43B 3BDBA 1NEZA 4XZUA 5T33H 1F11B 2V9RA 4MXWH 4XNMB 3B8YA 3BEWB 4L3ED 1FLRH 4NQVA 4OIBA 3E6FA 2JJSA 3RU8L 5D7KD 3V95A 4OF6A 4GRWE 3T77A 1S7XB 4PRID 4R3SB 1OSZA 2DQUH 5EZOL 3VXSE 4TSAH 3ULUL 5HYSB 5FUZL 3CFCL 3B3IB 5FKAB 1MSPA 4OZHB 5DJCA 3BKYL 5FXCH 2FL5A 4JFQA 4M1GH 4P59L 2AJXH 3F5WA 3V4VL 4MJIA 3LD8C 1ZVYA 5KVGL 3DO7A 4ONOA 4OJFL 3O6FC 3QHFL 2VL5A 1CFSB 1VEMA 3ZTJG 1BFTA 5JW4Q 5FM5O 1CK0H 1IC4L 3CFEB 1A8JH 2DJ4A 3VFPA 4HEME 4PJEB 5BRZE 4P5MB 5J8OA 1LO3H 1NDGA 3U9PH 5DJZA 4R9HA 5KS9F 3RJDA 4P4KA 1MVUB 2OI9B 3RZCB 4MWFA 4O2CB 1ZGLA 4J3TA 4L4VD 2EDOA 3CJJA 4ALAL 3MRGB 2D7MA 4JFZH 3KPMB 2X89A 1HZHL 1T3FB 2KPNA 1J1XH 1GGBL 4Z95L 4XMLL 3JWOL 5D7LE 3TVMC 1DBAH 5IHUL 1J1PH 3QI9A 1EGJH 5ICYA 2FLBT 1H0DB 3WDHA 3SKNB 2UV3A 3QR2A 1FGVH 3BGMA 1U8QA 3HZKB 2J88H 4O51B 2H3NA 1EEYB 1N0LA 5IVXE 1WICA 4KJWC 1AD9A 1EEUA 2J6EH 3LZFH 1KELH 5FOBA 3X3GH 1LQSR 5C0NC 4MLSA 4YDLC 4NKDB 1KLGA 1VADB 3NAAH 2PN5A 1H3WM 4YFDB 1IC5L 3WJJC 4Y4KC 5F9WC 2O93L 5H37H 2APBA 3VMNA 3QCTL 2LU7A 3RAJH 4O02L 5D2LB 2L7UA 3O2DL 3I75A 4MAYB 5EO0A 2MWCA 1WCBA 3Q48A 4KH2A 1C7TA 3ALXA 4W70A 4S1DC 4PLJD 1WFOA 2K7QA 2W65A 5HHMD 2HH0H 1MCOH 1UJTA 4HWZB 1FO0B 1G7JB 1HHJB 1VGKB 3QQ4B 3V79C 3S97C 2VSDA 2IFFH 1E4WL 4U1LA 5IB3A 5T3XE 1WBXB 3K3QA 1DBKL 4QO1A 5DRZB 2AJSH 3L95A 2OR8A 3JTSA 1WEJH 15C8L 1FVEA 2E9JA 5GSRA 1EAJA 2BZDA 3G5XA 2XKSA 5HDQH 2W0LA 5J56B 4LEXL 3BDYH 1E0OB 4XP5L 4AL8H 3SJVE 2NY4C 1JPFB 3I6KA 4Q2ZB 2AK4D 4LBEA 5I66B 2UWEE 3O4OB 1X5HA 3H9HB 1TETL 4IRJD 3T65A 1A6ZB 1W0WB 3OR7B 5DHXB 1S7TB 1TDQA 4Y5XA 5F1SA 1QSFE 1CG9A 5DJAB 2L0DA 3V8OA 2HFFB 1QR1A 3CFKB 1YC7A 3EYFB 1FO0H 3E1F1 5IP4A 3PWUB 4PJ9A 2E9WA 3A67H 3MV9A 3DGCR 1E6JL 3GMPB 1PZ5A 3BO8A 2EDFA 1MAJA 4DGYL 5I73C 3FQNA 2GUOB 4AEHH 2CPCA 4XP9L 3TBVA 1JZ5A 4BKLB 3HNVL 5JXAH 3D0LA 3OSKA 2LV4A 5DHYA 3KYMB 1NFIA 3ZHDA 3NGBB 2GSGB 3THMH 4NBXB 5HI3D 2AXFB 2R4SL 2R69L 3RWGB 3V4UL 4W6YB 4ZAKC 2ZCKL 4YXHL 4PB9L 4S11A 4RIRB 3X13B 1WC7B 5CSGA 4HSQA 2R2BA 3ET9F 2ERJC 3C2AL 4ERSL 4I18B 3QUKB 2EDYA 2F9BT 5GGSA 4NQCE 3NIDE 4M7JH 5CJOL 2A1WL 1P7KA 1I3VA 2EDJA 5AYUL 3OXRB 2CMRH 1ZT7A 3QT2A 3O8XB 1TNNA 3C6SA 5IBLC 5EFIB 5IFHH 3H7BB 2EEAA 1G0DA 2B7DT 4XBPA 1C7SA 2BFVH 4KKAD 2E27H 4RFOL 5FOJA 1KIPB 3ILPA 1JNLL 5TE4H 1HEZA 3MCKB 4N68A 4WV1B 3VGDA 3DX7A 4KVNH 1QFPA 4PJGB 4U6XA 3EYVB 2UUDK 5E6YA 3TF7C 4XH2B 4XVTH 1JK8B 3MLZH 3C5ZA 3RDTD 4UIMA 4YFLI 3CFDB 1WGOA 2ORBL 2KQNA 5IVZA 3PL6B 2ED7A 2NY1D 3GRWH 1K2DA 4HPOL 3UTSD 2Z31B 1IAIM 3SDDA 4WU7A 1ADQH 3ARBC 4RMSA 1RUML 1YEFL 2F53D 3HCVB 5A2JH 1HINL 3KHQA 5I19L 2RCSH 5IJKC 3T3MF 1BVKB 2X2YA 1OGTA 3HS0A 4PYHA 5HHXL 1RZJL 3GSXA 5BZWA 2V5YA 5F7UA 3I9GH 4S0SD 5KVMC 2BHZA 1F3RB 1KCRH 5L0QC 4B0MM 2GYSA 4DJMA 1OAYH 4QRUA 4FQXD 3UEZA 4MX7B 2VLRA 1SM3H 4PGEB 2JJTC 4OD3L 3A6CH 3OKKB 1QYGL 1S9VB 1I8IA 3NN8B 4U1SA 1YC8A 2FH6A 1E28A 5EOTB 4HEPG 4XB7A 3VMPA 4M62H 2VN7A 4G8GD 2OSLB 4XC3L 5E6IA 5CEXB 5FYLL 4I0CC 4MQXD 3NH7L 1FORH 1W0VB 1BFOB 3VFUB 3R4DA 1IGIH 5GZNC 4EEEA 3U4BL 2R23B 3RPKA 4EI5D 3V2AR 3LPGA 3VH8A 4RFEA 4AEIH 1KN4L 3WL9B 5L2KD 4YO0B 1P4BL 3KLAA 1J05A 2HYMA 3FOMB 3U46A 3RGHA 3BH8A 4M4RA 1IGTA 5D5MF 3CFIC 5K59F 5GZOD 3FMGH 1G6RL 3RWCA 2FYYB 4I0PD 4PJXB 3U9UA 1YEDB 3ULVH 1ETZA 1CL7H 1YA5A 3UTTD 4ZQKB 3PNWA 5D7JA 4LKXB 1GC1H 3SDYL 2HLFC 4X4MA 1CXLA 4L29A 3STLB 1MOEA 4LF3A 1DQJA 2M8XA 5JR1H 2D7OA 1JPGB 3ZYIA 4IRSB 1A1MA 2Z91A 5SWSA 4NFBA 4NSKA 2XNAB 5A43C 1JYXA 3VXRA 4EN3C 4HUUA 4Z7NE 5FDWA 4CU6A 1XAUA 2DDQL 4ZUUB 4X8JB 3K7UA 2ADJB 1YEHH 1J9CT 4UNTA 5E94A 3C8KA 1JRHL 1K3ZA 1KJ2L 3QO1A 3VFMB 2X10A 3UJJL 4NM8L 3VRLF 3G6DH 4MNGB 1MCWM 4FQLL 4MJ6B 1BQHB 3BZ4A 4KHTH 4J3XA 1QHOA 1IGFH 2R0ZH 3GNML 5E5UB 4TPRH 2EDKA 2ITDA 4JY5L 5EORL 3T0DA 4LIQL 3H9ZA 3ZDYF 4QRSA 4HUWB 1R5VA 2BVEA 2QLVB 4P2RD 2GFBA 2HG5A 4Z0XA 4PJ7A 4NZJA 3N1GC 4KKCD 1B9ZA 2QV2A 3FTGB 1G9NC 1NLBH 4X6EA 4ZFFA 4G7YL 2V7HA 2PKDA 1HE7A 1MFNA 2MCPH 4M1DL 2FB4L 1FL5A 3OB0K 1KYOJ 3S3PA 5FV1L 4Y5YB 2G2RA 5D93B 1NUDA 2FR4B 3QUMA 2EXYD 3IAQA 3SO5A 5JW4R 2OR9L 4Q58C 3EYOA 1FAIL 4ZXBA 5I75C 3EW3B 2A77L 3QYCA 1IEBA 3S37X 2P42B 4PJCB 3D9AL 1KJMB 4XMKL 2XN9E 4PJDA 2DQFB 3PWPA 4AM0B 4OCWL 3EOBB 1A22B 3NZHL 1I1AD 1MFEH 4R0LB 4PJGE 1NFKA 3VXNB 2NY6B 4RQQB 3LKPA 1XIWA 3GBNH 1SY6L 3QB7C 5LXGL 5I1IL 4PJFF 3AFLA 4IRJC 3BI9X 4YPGA 1OVZA 5F7YC 3PV7A 1M7IB 4RBPH 3SE3A 1G0XA 1UWGH 1NL0H 3KPOB 4JY6B 4HQQL 2VE6A 4F8QA 1LO4L 2X4UA 5EU3B 1Y6NR 3PWJA 5CUSL 2VAAB 1WZKA 4TUJB 4WHYH 4YK4C 3NCEB 3IJSB 2A74A 4I3SH 3VRIA 1MI5D 1C5BH 1NGYA 4OGYH 1BLNA 2FDBP 1P9MC 5DO2D 4GQ9L 1GJIA 1WFUA 4XAWH 5IBTH 1OB1A 2I07B 2R56H 2R1WA 3QH3B 4LVHB 1MHPL 2P8PB 5T1DH 1OQXA 1U8JA 3FFCE 4K3HA 1MCPL 1R3KA 3MGTB 4L1HA 5HI3C 3BIKA 1IGCH 2GEEA 4NN7B 3EFFA 5GGRY 5IK3B 1YN7B 3PGFH 5F7EL 4BSWA 3HE6A 3LN4B 1H5BB 1F3DJ 4JRYA 5LGKA 1EERB 3MRFA 1NGZA 4IHOB 4UMGA 5FEBA 2AEPH 2DQJH 4LSRH 5TDNA 2OZ4A 1FE8H 4P46B 3RNQB 5I0DA 1KUMA 4NO2A 3UP1A 3SDXF 1J0KA 1CR9L 2DQIH 4Z78B 3QDAA 4JRXE 4U05A 5HYSG 4NWTL 4X6CA 3TO2A 4IRZL 3V0WL 2VABA 5EZJA 1J87A 2X4RB 3Q3GB 3PGDB 1LD9B 4KKAC 3WNMA 3N1MC 2I24N 3PDOB 5IFJA 1LE5A 3WBDA 2XZQH 4NQED 1G7QB 2M2DA 1A2YB 4OGAD 2VC2L 3SY0B 4AG4H 4QXGL 4UOW0 4M7LL 1DLFH 3OG4B 3QDJA 1K3IA 3P9LB 4HJJL 4HWBA 1Q0YL 1A4JB 1EAPA 3OJMB 3T0WA 1XCTA 3HKFA 4WDIB 1OCWL 1YEGH 2NY3B 5H37G 4NZUL 3PHSA 1RUPL 5ESQA 4XPAL 3PQYD 1OPGH 4JFYA 1C12A 2FECL 3HPLB 3T2OA 2HJKA 2A6KA 5MI0C 3CXDH 2PW1A 1JF1A 2ESVD 1UJ3B 4X6FA 3MRIA 1KCLA 4UILL 4MNHA 4LGPB 4L4TA 1A14L 1M1SA 2XQBL 2BX5A 2Y72A 2EYTA 3F6LA 3SCMA 5K33A 4ODTL 4G9FB 2XWJA 1QHPA 2VDLL 2XA8H 1BQLL 4N1CA 4PGDA 3FCTB 4Y5VC 5I1DA 1HOCA 2GAZA 4MA3A 4Z7UB 5SWZA 5CP7A 5B8CB 3D39D 4QWWD 2X4QA 1LK2B 3MACL 1S9YB 1T6VN 3QZWB 4HS8L 4UV4L 4U3CA 4Z6AT 3FQWB 3PV6A 2ZCHH 5DS8A 4NHUB 1E4XH 2A6DA 3KPRE 1T21B 5TDOA 5TE7H 5JOFB 1R3LB 1MFCL 5I9QC 1UZ6F 4ONFH 3ARWA 2EKJA 4ODHL 4X4XA 1OGAB 3BGFB 5D1QA 3SKMA 1NGXB 5FYKD 5C0AA 4R7NB 1ZANH 4YHYC 1AHWC 1OAKL 3KPSB 2PO6A 5DDHA 1YECH 2CUHA 5C9KA 1GZQA 1MHHB 1RU9H 4H20L 4I0PC 3MBEA 4BZYA 1XMWA 5IEKA 2C4XA 5IHLB 2IPTL 4GOSA 3AGVA 4JGUA 2B39A 1B88A 3EOAA 3NFNB 5DUBA 3LOWA 3GSQB 4IOFC 4PJ8D 5FCUH 4PJCE 3AS1A 3DVNA 3GSNL 2D3VA 2FGWL 3QISA 4FXKA 1U8PA 2OTWA 5DMGD 3HC4L 1UT9A 2DIBA 1HSBB 2QR0B 4WI4A 1FZKB 5CILL 4HUMB 2NXZD 1CGSL 4PY8I 2YRZA 4Z7WE 4H8WH 5DVLA 3KJ4C 4R97C 2BVQA 5ICXB 5C09E 5T1KB 1T1WA 3DROA 3FQXA 3FO9A 2DWDB 4K2UH 4WTXA 12E8H 4FTVB 4QRQA 2R2CA 3QNYB 1TQCB 5FYJL 1U8KA 4JZNB 2WSKA 4KUZH 5ANMB 4J4PC 5ESAB 1JF5A 2YUZA 2WM0A 2C1PA 4Y4HD 3F7YB 1LMKA 3ES6B 1QOKA 1RJZB 3KR3L 4EOWH 1A7PL 1AY1H 3MNZA 5TDPA 4YFLF 5D6DC 1QEWB 5HYQB 3OMZA 4DW2H 4FQCH 5HGGS 4ZNEA 3TM6A 2QADD 4O5LL 1Q1JH 5B3NA 4L9LB 4MD5B 5D7IB 2EDRA 3MV7A 1IAIL 1K6QL 5E7FA 3BZFA 3FT4B 1LP9E 4OLVH 1U8HB 2DQDH 2FCBA 5GRUH 1TCRA 5SX5K 1HXMA 1KIRA 4YDJA 3QULA 1CFVL 1JNJA 1IVLA 5ISZA 1FZJA 3FT3A 3MRNA 1MRDL 4PTTB 4YDVA 5CINH 1W8NA 3LEYH 3WFDH 2RR3A 1L0YA 1H3PL 2P8LA 2Y07H 3CPLB 3WN5C 2CIIA 3WFZA 4HGMA 2EXYC 4FFYH 2V2XA 4LKCA 5FUCC 1GYAA 2A9NL 3AB0C 5C07D 4GSDH 1JWMA 4NM4L 4HKJA 2DAVA 2DI8A 4GW5A 4LCCA 4OZHF 1NEZB 4XZUB 1CGVA 2Y6SD 3TPKA 1N6QH 4D9QD 1N4XL 2O5ZH 1UFUA 3U7AA 4NQVB 4XBEH 5F21B 3E6FB 4JKLA 1VGEH 2ZG3A 5D72H 4PRNA 1FV1A 3RPIA 3T77B 3BYTA 3T1FA 1CICA 3U30C 3FQUA 1OSZB 5FKPA 3IDUA 5DD3L 5KANI 1I8MA 4FZ8L 1EJ6A 4GW1A 3ZKMD 5DFTA 4PJEF 3DX6A 4TYUA 4ZS7L 4OZIA 4DGIL 4RGOL 5DJCB 4TVPD 2FL5B 4JFQB 4N90E 3F5WB 1X4YA 4MJIB 1BHGA 3DO7B 4DKDC 4KWUA 5LCVL 2VL5B 1QVOA 2E8YA 5IROA 3ZE0E 2XI9A 2I5YH 4S0TD 3VFPB 3WLWC 5T33L 5FB8A 4MXWL 1JGDA 4I5BA 5CJBA 4XX1G 4EDXA 1EVUA 3QEHA 3O4LE 4P57A 2BDNH 1NDGB 4NQDE 5DJZB 1FC1A 1FLRL 5J1AA 3PP3K 1XF3A 4P4KB 4GXUM 3QSKB 4Y1AE 3M1BA 4MWFB 1BQSA 2MSPA 1ZGLB 1KPUA 2DQUL 4TSAL 1OLZA 4IIQA 1D3CA 4F3FA 3D85D 1QA9A 3BQUA 2E7MA 4M1GL 1C1EH 4HJGA 1UXWA 2AJXL 4RAUA 3QI9B 5ICYB 5C0CB 4WI9A 1J1OH 3TT3H 3TFKC 5MEND 5KVDH 5JUEH 5D2LF 3BGMB 1U8QB 1CK0L 3ARZA 4NO5A 2H3NB 4EZMA 1J0YA 5FFLA 4KAQH 1AD9B 3TN0A 5FOBB 1LO3L 4BFBD 3DNKA 3E3QE 3U9PL 1KLGB 2G60H 3G5ZA 2YA0A 1QUNA 1I3RA 3LKOA 1AIFA 2BSTA 3H3PH 3VD9A 4L8BA 1OAZH 1YNKH 3E6HA 4EKXA 2P48B 3W2DH 4JFZL 3I75B 3KYOA 5EO0B 1WCBB 1J1XL 2H26A 3VXMA 5J9PA 1RZ8A 1DBAL 4OGAC 1FNSH 1J1PL 1EGJL 3DI2B 1IEHA 5FO8A 2DTMH 2W65B 2ZOLA 4OTXH 1JZ7A 4JFDA 2Z8RA 1LO5A 1FGVL 3WNKA 5IB3B 4U1LB 4PLNC 2H1PH 3CMOH 4PRHA 2J88L 1TITA 4RGMB 3L95B 5ILTH 4QXUH 1BQHG 3JTSB 2J6EL 3O9WA 3LZFL 1KELL 1FVEB 5BMFH 3X3GL 2ICES 3BHBA 4N0UA 5GSRB 3G5XB 3NAAL 1Z9SA 1LO0H 3I6KB 1JPST 3NPSB 4LBEB 3RAJL 6CGTA 3T65B 4Y5XB 3OKEA 4OLZH 1CVSC 1CG9B 1UM5H 4OT1H 4XPGH 4KHXH 4TTGA 5IBUG 3FO1A 2YUXA 2HH0L 1QR1B 1MCOL 2CUMA 4KJYA 4Y16D 2IFFL 1ZLUK 3MV9B 1DE4A 5EUKA 4CMHC 1PZ5B 3BO8B 2AJSL 1FDLH 4XBGA 5E56A 3ME0A 1L6XA 4HMDA 4QWWC 1WEJL 1OSPH 3FQNB 4N0FA 5DVMA 3TBVB 5KAQG 1FH5H 1U42A 5HDQL 3MV8D 2X09A 3D0LB 1KEGL 3QHTC 2W9DH 2NR6D 5DHYB 3BDYL 4AL8L 1NFIB 3CNKA 3RVXD 2NZ9D 1P2CA 4JQIH 5D7IE 3SGJC 1SYSA 1HQ4A 1QG3A 2ICCA 4ELKA 3QXUA 2MMXA 4WHYG 1FYTA 4PREA 1MCSA 5DJDA 2R2BB 3O0RH 2H41A 4PJ5D 5BW7C 3T3PE 1FO0L 1H3VA 3V5HA 4LVOC 5GGSB 3A67L 3I3EA 2XTJB 4Q6YA 5EN2A 1P7KB 1CI5A 4PJGF 5DJ8A 4AEHL 4IM8A 2HA1A 1ZT7B 1JGLH 1RULH 4Q6IA 1GGYA 1TQBB 3C6SB 4WFGD 5DMGC 4XBPB 1NCAH 1HDMA 2DYPD 3THML 3P11H 3ILPB 2AK1H 3D5OF 4JAMA 1HEZB 2NXZC 3DX7B 4U6XB 4E41E 5GS0H 3IB4A 4J3WA 2YC1A 1N6VA 2IAND 3C5ZB 2ZP0T 4UIMB 2WIMA 2O26U 4X7EC 5IVZB 5E7BA 1K2DB 3ECBA 4M7JL 3SDDB 4UI2A 4WU7B 4EIGB 3QA3A 1MRFH 1Q8MA 2EICA 2NY2C 3MJ8A 4ZODA 3NACH 2WBJA 3P4OA 2CMRL 3D2UD 4MDIA 4NFDA 5BXFA 5GGQH 3MRJA 3MRLA 1OGTB 2Q20A 3HS0B 2BVOA 5IFHL 5KANG 1B4JH 4P9HC 2R15A 2BFVL 3ULVF 3GSXB 2E27L 5BZWB 1WAAA 5TE4L 4KVNL 4N8PA 2QADC 4XVTL 4BQ9A 3DTXA 3MLZL 4QRUB 1ORSA 1VACA 2VLRB 3VU2A 3L3OA 3VMOA 5LBSH 1I8IB 3GRWL 4OCMC 5C0CE 4U1SB 4YZFE 1E28B 1SMOA 5AYQA 4KRNA 1ADQL 2E6QA 1CD8A 4UBDD 4DUWA 3DXAD 5E6IB 5HPMA 1W2KT 2RCSL 1ZV5A 1QRNA 4PJXF 4GRLA 1JF6A 2IBZY 3N1PC 3SE4A 3VH8B 4RFEB 4GBXD 3I9GL 4JN2A 4FN0A 3HZMA 3OGCA 2BOBA 5DEFA 4OZGA 1KCRL 3KLAB 1J05B 3U46B 1OAYL 1F2XK 2YPVH 3BH8B 1IGTB 5E9DD 1SM3L 3A6CL 3RWCB 5KZCD 2BNQA 3U9UB 1ETZB 4JFPA 3VXUE 2WANA 5A3ID 3PNWB 5D7JB 4M62L 1RHHA 3ZKMC 3K4ZA 3W0WD 4QRRE 4L29B 4Q74A 5IOPA 5I8KH 4LCWD 1FORL 3L3HA 1TJHH 3KPLA 4LF3B 5CEZD 1DQJB 1KV3A 1KENH 4RMWA 5JHDE 1IGIL 1DSFH 3NTCH 1A1MB 2Z91B 5SWSB 3FL7A 3JZ7A 4JM4H 4HV8A 2V2TA 4NSKB 3VXRB 4AEIL 4HUUB 5FDWB 5I30H 2Q1EA 3LQAC 2D03H 2P7TA 4KFZC 3RTQA 3K81A 4DKEH 5CKGA 3FMGL 1R3IH 5E94B 3C8KB 3VWKD 2J8UA 3L7FA 3QO1B 3ULVL 3NA4A 1CL7L 1UWXH 3BZ4B 1OTSC 1XGQA 1GC1L 5GJSH 4IDJH 5E08H 1AR1D 2ITDB 3S5LA 3EAKA 4D9LH 1S8DA 4U7KA 3VFOA 3ZT6A 4DVRH 2PW2A 4QOKE 3SBWC 3BYYA 5JR1L 4JCMA 4QRSB 2QQLH 5IJVB 2OLDA 3O6FA 2GFBB 3F6IA 3V6FA 2HG5B 2IWGA 5KAQF 3P9MA 4PJ7B 4Z0XB 3CX5K 4KKLC 4LCUA 5BS0D 1RK0B 4X6EB 2PF6A 4P2OC 1DQTA 1YEHL 3HHRB 4OBSA 5C7XH 5ADPH 5DLMH 3U48A 4ZFFB 5C0BA 2V7HB 5ABDE 3DMMD 1T7WA 4W6WB 3G6DL 1FCGA 4P2CG 4PJCF 1ZGLM 1EJOH 1FL5B 4KHTL 2R0ZL 1IGFL 4TPRL 3N1FC 4A2MA 4QTHA 4UDUA 2G2RB 3REVA 4OCSH 5A16A 4H1LA 4WTZA 2Z8SA 3QUMB 2B2XH 1RUKH 3TVMA 4OLYH 3EYOB 1TJGH 1D5ZA 5JZ7D 4ZXBB 5EIQA 3BW9A 5D4QA 1L9NA 3S35H 1IEBB 4PJDB 4GMSH 4HLJA 1S5IH 2W1NA 1I3UA 3PWPB 1NLBL 1B6DA 4CUCA 4X7CC 3F7VA 4QHLA 5EU7E 5JHLH 4MCZA 3LKPB 1XIWB 5L88H 1UH3A 1X5FA 3QUZD 3F7PC 4ZOAA 3WJJA 4Y4KA 4BSJA 2MCPL 5SX4H 2F54A 4GT7A 4YPGB 3ARGD 3FZUC 5FM4A 3QUMH 4YBLC 2VE6B 4DZ8A 1WCQA 2N1KA 4ELME 2X4UB 1NMCB 4LNRA 1P6FA 2UZXB 3TH3T 3PWJB 5BOZG 3VRIB 1A02N 2A74B 2OJZH 1YJDH 1A4KA 1NGYB 1LP9F 1BLNB 1MFEL 4KK5D 1OB1B 1NC2A 2R1WB 3GBNL 2NW2A 4HIXH 1LILA 1U8JB 1KBGH 2FJHA 2NZ9C 5EH1A 1R3KB 4OFYA 3BIKB 4HPYH 5HVHB 3EFFB 1EUTA 5CS7A 4JCLA 3WFCH 3L3DA 1UWGL 4JDTH 3QXAA 3X14A 4BSWB 1NL0L 4V1DA 4XXDA 5DZLA 3HE6B 4JRYB 1HH6A 2N56A 3EO0A 4PJBE 4DOHE 3MRFB 4GUPA 1NGZB 1MFBH 2PYEA 3EYUH 1CDBA 4I3SL 3WDIA 4BK4A 1HN1A 3MLVH 5TDNB 4NO2B 1C5BL 4U0RC 2ID5A 4OGYL 5C71A 4M6AA 4XRCA 4XAWL 4X6CB 3MZGB 5IBTL 3TO2B 5I6XC 1QD0A 1NSNH 2R56L 1U8NA 4ONHA 3ROOA 2NXYB 3QFJE 5T1DL 2VABB 3IU4H 4QHNA 5EZJB 1OAQH 1UG9A 1K85A 3FB7B 5IFJB 1IGCL 1LE5B 1HILA 3V52H 4MQ7A 4TN9A 3PGFL 2YD8A 4ZAKA 4PLOB 3T0ED 1V3LA 3DURA 3QDJB 2CH8A 3JUZA 3BESR 4OLEA 4YPJA 4NKMA 2RHEA 5FGCB 2VERN 1EAPB 1XCTB 4LFHD 2OZ4H 4P3DA 5C0DA 4MQTB 2AEPL 2DQJL 4LSRL 5MEQA 3ZTNH 1FE8L 3WJLC 3O45A 2DQIL 4BELD 5ESQB 2DLFH 2IFGA 4NZTH 4JFYB 1C12B 3KPTA 1Z0NA 5T3ZH 2HJKB 4KKBD 2A6KB 1FL6A 2PW1B 3LV3A 1JF1B 4WW1A 1BBJA 4X6FB 3MRIB 2PTUA 4Z7UF 1QO3A 2IBZX 4MNHB 2XZQL 4QEGA 3S88H 4L4TB 3IFOA 4KDWA 4KQ4H 3G04A 2YZ8A 4PGCA 1UWEH 2AVGA 4AG4L 4JY4A 2YSSA 2EYTB 3CU1A 3DSFH 5E2VH 5HHOA 1DLFL 3SCMB 4JPIA 4HWBH 2YPLD 3MZTA 2XWJB 2AEIT 2HJLA 3OQ3B 3MREA 4PGDB 5I1DB 3PWVA 1HOCB 2GAZB 4MA3B 5SWZB 1YEGL 5CP7B 3OF6A 5HYJD 2X4QB 1CF8H 5FHBH 4DAGH 2VR5A 5KTEH 4NFCA 4OFVA 4UTAH 4LLDA 1OPGL 4P2QA 3ARBA 4UBDC 3PV6B 5DS8B 1NQBA 4K55A 2A6DB 3PF2A 4RRPG 4NGHH 1XH3A 5TDOB 2PR4H 5KVEH 3CXDL 5GRXG 5IJKA 2FEDD 2FD6H 3PIQA 4X4XB 4LEOA 5D1QB 3SKMB 3TZVD 2GJJA 4QRPA 4YC2B 5C0AB 1ERNA 1LNUA 5C8JA 5TH2A 2PO6B 3MLRH 3INUH 4OI8A 5DDHB 3HAEG 3NCFB 1GZQB 5DI8A 4Y19D 3MBEB 5IEKB 1CT8A 2XA8L 5TQ2H 3L3KA 4XNZB 1JGEA 1U92A 2JJTA 4NZRH 3VI3E 2OCFD 5GGUA 3SKJH 4F2MA 2Z8WC 3EOAB 4M6OH 2XACC 5HHVH 5DUBB 5A3IC 3CDGA 3DX9A 3QDMA 4X4ZA 4I3GA 3RUGE 4C56D 5KN5A 3DVNB 2ZCHL 4PJDE 4GAYA 3QDGE 1E4XL 4NRYA 4FXKB 5TE7L 4NQXA 1U8PB 2OTWB 3G9AB 4AY0A 2V6HA 4ONFL 2UUDH 1T1ZA 4PGJA 4KI5F 1RAMA 1A7NH 5HHME 4CBPA 5C2BH 1ZANL 2BVQB 2ICWA 1T1WB 5HPOA 3DROB 3WXVH 3FQXB 2D31A 1YECL 3FO9B 4F58H 1CU4H 4YX2H 1RU9L 5F3HA 3HNSH 2VXSH 3VWKC 1FNLA 4UNVA 1U8KB 4WFED 4MJ5A 1PFCA 1DVFD 3H3KA 5FCUL 3F65A 3WUZA 4MNQE 1IEAA 5EUOA 2AK4E 3ZZ1A 1TVBA 3IDXH 2C1PB 5D7IF 1FFRA 4ZSOE 1A6AA 2W0FA 2X1OA 3MNZB 5TDPB 3SDCD 4D94A 4LRNH 3X17A 1IQWH 2NW3A 4ONGH 1F58H 1JI1A 4EN3A 4K3JH 3UCRA 3MV7B 3BZFB 4K2UL 1SJHA 12E8L 4J3SA 4KRLB 3VXSD 3RVVD 1TCRB 3VFVB 1IKNC 1HXMB 1KIRB 4KUZL 1EH9A 4YDJB 3QULB 3QQNA 5ISZB 4LVNC 1FZJB 4L3CA 4Z9KB 3FT3B 2BVTA 3MRNB 4L4VA 1RUQH 2X1PA 1ZHKA 3MUZ1 4YDVB 3D3VE 5LWYH 2EDBA 5GGSY 2P8LB 2CIIB 5KOMC 1WZMA 4EOWL 4K9EC 1XGUA 2V2XB 1AY1L 4LKCB 4X6CE 4G6AD 5JZ7C 2DMKA 1JWMB 4DW2L 1DQQB 4HKJB 4G6ML 3E2HC 4GW5B 4FQCL 5BRZD 4LCCB 4JDVA 4KZEH 2XKUA 5CGMA 1Q1JL 1MCHA 2ZUQC 4P0DA 3RIAF 1I8KA 3ZDXE 5FECA 1CCZA 5L8LB 1NAKH 3EFDH 3W5NA 3B6SA 4OLVL 5AEAA 4PRNB 2YD9A 2DQDL 3RPIB 3T1FB 3RWEA 3IVKA 1CICB 3FQUB 3QUZC 5GRUL 5FKPB 1JVKA 1KN2H 1I8MB 1NKOA 4GW1B 1OW0C 3DX6B 4U6HA 2NY0B 5D7LD 5FYJD 6FABH 4OZIB 2NX5E 1MFAH 4G3YH 5CINL 1T03H 3WFDL 3LEYL 4H8WC 2AJVH 2Y07L 3VG9B 4FFYL 1DANT 2DQHH 2VQ1A 1QVOB 3IDYB 4GSDL 4LU5H 1DJSA 2A2QT 1KTKE 2AJZA 3MCLH 2AEQH 5FB8B 4RWYH 3ZDZE 4NO3A 1JGDB 4I5BB 1N6QL 4EDXB 3QEHB 4P57B 3SGEI 2A0LD 2O5ZL 4L4TE 4YZFF 2YKLH 4XBEL 5J1AB 4KK5C 1XF3B 1VGEL 5D72L 2L7JA 3RKDC 3M1BB 3WS3A 5A2KH 4R26L 2YD7A 1KPUB 3M17A 2F53E 4IIQB 4F3FB 2BP3A 1QA9B 4KXZH 4OGXH 1GGCH 3BQUB 3LHPH 4HUXA 2P47B 3VH8G 4IRJA 1OP9A 4KROB 4HJGB 1UXWB 2J8OA 4N5ED 4RAUB 1T7ZA 5GHWH 2VLKD 1HHKA 3HZVA 3C6LC 5CZVH 3RP1A 1RJYA 2FIRT 5T3XD 1T22A 4ZFZA 1BJMA 1E6OH 1V5JA 4XCEA 5E5MA 1YEEH 4NO5B 2AERT 1WVZA 2I5YL 4OM0H 4DZBA 3KYNA 5JQHC 2FX7H 3TN0B 4M1CD 2PCPA 5JW3H 2BDNL 4CVUA 5C0AE 1KNOA 3G5ZB 1WUNT 3SJVD 1FHGA 1X6NA 1I3RB 5D2NE 3LKOB 1P9MA 3OB0H 4JG1H 1AIFB 1BX2A 2BSTB 2VKWA 1VFAA 5D96C 3PDDA 1MCFA 4BH7A 4L8BB 3E6HB 1RI8A 3KYOB 1QSFD 2H26B 3VXMB 5ITFA 1RZ8B 5J9PB 1C1EL 5DVNA 4K71C 5FO8B 5I76A 2ZOLB 3T0EC 1J1OL 1QFUH 1AGEA 4R96A 3TT3L 4JFDB 3OJDA 1A21A 1LO5B 1MPAH 3P30H 1NPUA 5KVDL 5JUEL 1TTFA 4PRHB 3B9KD 4PUBH 4KAQL 3O9WB 2PUQT 1ZE3C 1CXFA 2I60H 3BHBB 3S3SA 4NCDA 2G60L 3ALWA 4OD2A 5KG9A 4KKBC 3H3PL 3WNLA 2DQTH 2XXCB 4BSVA 2GK2A 1OAZL 1YNKL 4WVRA 4MD4A 3W2DL 5MERA 4TNVK 3OKEB 4WGVB 2RGSA 3HPJA 3WHXA 5DEGA 2GK0A 5C86A 1FNSL 1TTUA 5JDSA 3FO1B 4EUPA 2DTML 4OTXL 3LDBB 4NQCD 4NUGH 3UBXI 4KJYB 1IKFH 2V17H 2H1PL 3CMOL 1DE4B 5EUKB 4XBGB 2DLHA 1AO7A 1J0ZA 5ILTL 4QXUL 3GUTA 3UTSA 1NCWH 5BMFL 4N0FB 1JUFA 3ARDD 3GSVA 4YLQT 1LDPH 2EYSA 2C1OA 2CO7B 1B0RA 1K5NA 3HUJA 2Z93A 4WIQA 5I1AA 2CXGA 3BPCA 1LO0L 1CIUA 4PJHA 1P2CB 2FEDC 1SYSB 5AAMA 1HQ4B 4ELKB 4WWKC 5AAWA 3TZVC 4OLZL 1BZQK 1UM5L 2YD3A 4OT1L 4QNPF 4XPGL 1FYTB 4KHXL 4PREB 3JWDC 2KKQA 5DJDB 1M7DA 1KOAA 1U95A 2EDEA 3HFMH 4YGAB 5CP3A 3V5HB 3ETBF 5IQ7H 1NFDA 5EN2B 1FDLL 3CZFA 4Y5VA 1MLBB 3UO1H 3MLWH 1DN2A 5DJ8B 2YD4A 1FH5L 1JL8A 4LSTH 4Q6IB 4G8GA 2W9DL 1QFWI 3MLSH 4JQIL 5E5RB 4ZG1A 1HDMB 4XGZA 5C2UB 2PTVA 4JAMB 3QCVH 1VDGA 43C9A 1Z6JT 4M5ZH 2B5IB 2YC1B 4ELMF 3I2CH 3O0RL 4O2EA 4U3HA 5E2TH 5L2KA 1MCRA 1AHWA 4ODXA 4Q7DA 1A1NA 3ECBB 3KLHD 2MOVA 4LMQE 3GHEH 4JREB 3QA3B 4I0PA 2KUTA 3MJ8B 1IC7H 4OFPA 3G6JA 3S36X 1DVFC 3VGAB 2WBJB 3P4OB 2V9TA 3BMWA 4MDIB 1JGLL 3UTTA 1J5OH 4MB5A 1RULL 5LGJA 5BXFB 3MRJB 3BGAA 4PRAA 3MRLB 3P0YH 2BVOB 2VXQH 3TBSA 1NCAL 1INEH 3P11L 4CN4A 5JOPE 2AK1L 4HS3A 1B0WA 1LK3H 4GXVH 2IG2H 3W5MA 5GS0L 1X5KA 4MAYD 3PGCA 3EYSH 3DTXB 3IDIA 3BP4A 1ORSB 1VACB 1J10A 2FX9H 2RIKA 2GY7B 3D25A 3L3OB 3QNXA 4G8EA 2R0LH 5F93C 4ODWA 1MRFL 4KQ3H 4LMQI 5EIVA 4F8TA 1NBQA 1UB5A 3WIHA 3NACL 2DLGA 2E8ZA 4KRMB 2OS7A 5HPMB 3C9NA 4J4PA 3L5JA 5GGQL 1MCQA 1QRNB 3P9WB 1VESA 1B4JL 2W38A 4GRLB 4WO4C 5D1XD 1GHFH 4G6AC 1A7OH 3LRSA 5KSUA 5HVFB 4NC1E 3QIWD 4JN2B 3HZMB 5D6DA 3OGCB 4Y89A 2BOBB 5DEFB 4OZGB 4ZFGH 4P2RA 2Y25A 4WY7H 4GG8A 4AT6A 1EIBA 1OWRM 1JPSH 4IBLT 5LBSL 2BNQB 5JTWA 1VA9A 3IAPA 4RNRA 4L4JA 4JFPB 4Q9QH 1C16A 2F15A 1G0YR 2EDXA 1OM3H 2ADIA 1RHHB 2ITCA 2LTQB 3HI1A 2OM5A 4CVZA 5IOPB 3L3HB 4JHBA 3KPLB 3MV01 5F70A 1EA9C 4H5SA 2PXYC 3WN5A 1PDKA 2DWEA 4QXWA 1QLFA 1U8LA 1Z9MA 4HV8B 2V2TB 1TZGH 4Q9BA 4ZTOH 1QLRA 3BOVA 1YYMH 4JGJA 3LB6D 3RTQB 2VZ1A 2YPVL 1CYGA 1VB9A 2A0LC 2J8UB 3L7FB 4F37F 5BVPH 5I1KH 4JFEA 1J88A 4OZFA 3FJTA 1URLA 1XGQB 2HT2D 1NUFA 4O00A 3S5LB 1XF2A 4N8CH 4KTDH 1I7ZA 1S8DB 3EIFA 3VFOB 1FVDA 2AABH 5I8KL 2PW2B 1HNGA 1TJHL 3BPOC 1Q9WA 3O8XD 1KENL 1DSFL 2EO1A 3LD8B 3NTCL 3QBTB 4JM4L 3O6FB 2Z92A 2H2PD 2XN9D 2EH7H 3V6FB 1MJ7H 3P9MB 5DJ6A 1S7VA 5I30L 3MX0A 4LCUB 2HFEA 2D03L 1FZMA 4DKEL 4M1CC 2ZCLH 3UBXG 1MI5A 5SX5H 5I17A 1R3IL 5C0BB 1BWMA 2DM3A 5F6IC 3PL6D 1OP3H 3RUGF 3QJFA 2Z31D 4PJDF 5GJSL 4IDJL 4QTHB 5E08L 4UDUB 3REVB 4D9LL 4C59B 5A16B 4H1LB 4DVRL 3MQIA 3TVMB 2H8PA 1JPTH 5IR1A 1D5ZB 2QQLL 3CDCA 4LPWA 5HSFA 3BW9B 3T2PA 3D18A 4O4YH 2BC4A 1KG0A 5DJYA 2R0WH 4CL7A 1JZ8A 3F7VB 4MCZB 3UYPA 5C7XL 5ADPL 3AS0A 3FFCD 5DLML 4YDLB 3TYFA 3O81A 1CLYH 2ICEA 5FA3A 4Y4KB 5F9WB 1G9MC 1EJOL 2F54B 4OKVA 3LQMA 4H1LH 4OCSL 2B2XL 5HYFA 1RUKL 4OLYL 1AR2A 4DZ8B 5HI5D 1TJGL 4LNRB 3SO3C 2H2SD 3GKZA 3S35L 1A3RH 1X44A 1A4KB 1J0JA 4BUGA 4GMSL 1S5IL 4JRXD 5KSAC 3PP3H 3VXOA 3RFZC 2Y1VA 2COQA 2XG4A 1T5WA 3ARDC 5JHLL 1NC2B 5CSBA 2NW2B 5L88L 1M71A 3PQYA 5B39A 3VDCA 2FJHB 3MBXH 5M95B 1NEUA 1A7RH 1EHNA 2NY4B 4NOFA 4LLQA 4RZCB 5DD6A 3W81A 3K8LA 2WWKO 3QO0A 3MLTA 2ESVA 4JFFE 4X8XA 1A5FH 3L3DB 3QXAB 3QUML 3X14B 1I8LC 4X6CF 4V1DB 4XXDB 2CIKA 1F4AA 1HH6B 3EO0B 5CIPA 4WI2A 5LGHH 4GUPB 1QPXA 2PYEB 4HIEA 2OJZL 1YJDL 1V8HA 5HYIA 2HTLD 4N9GA 5INCA 2B1AH 4XRCB 1KLFA 4HFWA 5DK3A 4BQBA 3D39A 2EDLA 4F80A 3MNWA 5I73B 1U8NB 4ONHB 3ROOB 3U0PA 3MYZA 4H25A 4HIXL 3SE8H 4QHNB 3LS4H 1KBGL 4G43A 3TPUA 1I85C 3CSGA 2BNQE 4HPYL 4RBPK 1HILB 3SGJA 4MQ7B 3WFCL 1LEGA 4XNYH 1S3KH 2VWEE 4JDTL 5ID0A 2ZUXA 4ZAKB 3QG7H 3DURB 1IZKA 2ERJB 4NKMB 5BW7A 5B4MD 4OIAA 1MFBL 4UUJA 4P9MH 3EYUL 4P3DB 2YN3A 3ZDZF 5C0DB 3KLHC 4D9QE 5EB9A 5MEQB 3MLVL 1CLZH 3O45B 5FIEA 3FFDA 4ESKA 4MGXA 4FFZH 4TVSa 3WXWH 1EZVY 3FQTA 1QBBA 1NSNL 3Q5TA 3DETC 3V5KA 3IU4L 1FL6B 1OAQL 3FRPA 3LV3B 3HE7D 3Q6GH 2CK0H 4WW1B 1BBJB 4YBQC 4FG6D 1PZUB 1QO3B 1FRGH 4PRBA 2WAHA 3V52L 3IFOB 1U0QA 2Y36H 3G04B 1TVDA 4PGCB 3SGDH 1NGWA 3WIIH 4JY4B 2YSSB 1ZLUH 5E0QA 5HHOB 4JPIB 5JIIA 2DTSA 1MCBA 1TCMA 2HJLB 3O3DA 3MREB 4F33A 2OZ4L 3PWVB 3TA3C 1VPOH 3BUTA 3ZTNL 5DVOA 2HAZA 5F89A 1YNLH 4I1NB 5EU4A 3X11A 2DLFL 3WO3B 1TZHA 2W91A 3HB3D 4LLDB 4P2QB 3ARBB 4NZTL 3QCUH 1U8IA 3FAWA 4X99A 3DHJA 1XH3B 1VEPA 5T3ZL 3SPVA 2NY6D 5D1XC 3FRUA 3PIQB 4LEOB 3S88L 3ESVF 4QRPB 3NCJH 5C09D 3QIWC 4U1GC 2QQKH 4KQ4L 1UWEL 1LNUB 5HDOA 4ZPTA 1FC2D 5TH2B 4X6DA 5C8JB 2W0PA 3DSFL 5E2VL 3O2VH 1IARB 4DGVH 5L0QB 1JI2A 4HWBL 4KTYA 3V6BR 1KF9B 5DI8B 1CT8B 3L3KB 1YMHA 1JGEB 1PX4A 1U92B 4D2NA 5GGUB 1P53A 3SQOH 4F2MB 4ZMAT 3DYPA 3LKNA 1CF8L 5FHBL 5KTEL 1PX3A 2D2OA 3CDGB 3QDMB 4UTAL 5KN5B 1QSEA 2IH1A 2R2HA 4GAYB 3BP7A 4NRYB 3PXHA 4NGHL 4NQXB 2PR4L 5KVEL 5BVJA 2AW2A 2FD6L 2MQCA 3ULUE 1T1ZB 2NQCA 5B22A 5SV3A 1KPVA 3R06A 5EC1A 3TCLA 3ZO0A 2ICWB 5C07A 3LEVH 4KC3B 1G6VK 2OXHA 5IW1A 3MRCA 3MLRL 3INUL 2D31B 3TNNA 5F3HB 4M9OA 3VXQA 5TQ2L 5DJ2A 4NZRL 5DD1H 4DWHA 1BFVH 3SKJL 5EO9A 1MCWW 4M6OL 4MJ5B 2KQMA 5HHVL 4NNYA 5E2UH 2HT2C 4WUUA 5EBWA 1VKXA 3RIFK 4LDOB 1IEAB 5EUOB 2HVJA 1DTUA 1TVBB 1G9EA 3EUUA 5ERWA 1A6AB 3OJVC 2W0FB 1AC0A 2YUWA 4LGRB 3EJZD 3RWIA 3E8UH 2JLLA 3RL1A 4Z8FH 3KXFA 2QL1A 4K7PX 1A7NL 3HMXA 2NW3B 5C2BL 1XF1A 3BEVA 2WZPD 5I16A 2RJMA 4WGWB 4EN3B 2VISA 2HRLA 3WXVL 3GIVA 4F58L 1CU4L 4YX2L 2KDGA 4H0HB 1SJHB 3HNSL 2VXSL 2P5WE 5F7WC 3R8BB 1F2QA 5DRNA 4WHCA 2BSSA 4L3CB 4Z7VA 2PYEE 4L4VB 5J6HB 3LKQA 1OTUD 1ZHKB 5DJ0A 4UQ2A 5ITBH 4LLMA 3IDXL 1RZFH 1K8DA 3PWLA 3D85A 1H3XA 1XGUB 1NMAH 4U4BA 4G8FA 2V5TA 4JO4H 3SBWA 4L8DA 3L3IA 4LRNL 1NDMA 1IQWL 2GJ6E 3AAZA 1U93A 3H9SA 4JDVB 4OZIF 4PG2C 2ZUYA 1AH1A 3TJEH 4NQDD 4ONGL 1XGRA 1F58L 3TT1H 1I8KB 5TFSH 5FECB 1S5HA 4K3JL 1K8IA 5DQ9A 3UTPE 4DEPC 1DFBH 3B6SB 1IC1A 3CVIH 4P2OA 1XT5A 4BJLA 1FVCA 4WWID 3RWEB 3IVKB 2OTUA 5JIKA 3KJ6H 4U6HB 3LVEA 1RUQL 3JV5A 5HJ3A 1DR9A 5LWYL 1F97A 1UEYA 5K9OA 5HI5C 3P0GB 1HKLH 2LQRA 2VQ1B 3LKSA 2H2SC 5I75B 3GI9H 4KZEL 4H26A 2AJZB 2ZPKH 2P44B 5KS9E 4NO3B 1N5YH 1NANH 5EC2A 1G9NH 4AEFA 1NAKL 3EFDL 3BRFA 1QPPA 5F7MC 3KPSD 1W8OA 5ACZA 3WS3B 3EHBD 4S1QH 3M17B 1KN2L 4O9HH 3UTZA 4F7EA 6FABL 2EDQA 3NABH 5F7DA 4HUXB 1EBPA 4IRJB 1MFAL 4G3YL 1T03L 2DM2A 5HHQB 1Z9OA 2AJVL 3HZVB 1HHKB 3C5JA 5DA4A 1RJYB 1WBZA 1DUYA 1AQKH 2VZTA 1T22B 4ZFZB 4NRZA 4XCEB 5E5MB 4LU5L 2CO6B 5F7LB 4DZBB 3KYNB 2UVEA 4YK4B 3MCLL 2AEQL 4RWYL 3BWUC 2PCPB 2VLJA 3F58H 4O2FA 1KNOB 2YKLL 5T1KD 4CU8A 1BX2B 1I4FA 1VFAB 3IS0X 4WW2C 3MV8A 4BH7B 4CAGA 3H42H 2DLTA 3OXSA 4OGXL 1GGCL 2UZIH 3VWJD 3LHPL 5FGBC 5F9OH 5ITFB 2VTFA 5GHWL 3SEPA 2A9MH 3RY5A 3GGWA 2YXMA 5I76B 5IMLA 5CZVL 1AGEB 4R96B 3OJDB 2EC9U 4PJ5A 4NQSA 1E6OL 3HC0A 5B4MC 1AKJA 1YEEL 3CXHJ 4OM0L 3VCLA 4C83A 3B9EA 2FX7L 1RZKC 5E03A 4LOUD 3IAGC 4AQOA 5JW3L 5HDBF 1T1XA 3T4AA 3S5LG 2QSQA 3DX8A 4OD2B 2QHLA 3DPBA 4JG1L 4HUVA 4DFIA 5KG9B 1DDHA 3W0WE 4BSVB 3HE7C 2X9XA 4MD4B 5MERB 1PG7H 4FG6C 2AJ3A 1W0YT 2DYPA 3HPJB 4ZDHA 5DEGB 1LDSA 3WHXB 2GK0B 4Z7QF 5IFAH 5JDSB 4EUPB 1NJ9A 1QFUL 4F7MA 3P30L 1MPAL 1GIGH 2IANA 5J12C 4MQSB 4QF1A 3V0AC 3P2TA 3ZYJA 4MVBD 1AO7B 4PUBL 4XNUH 2V9QA 2Q87A 2C4FU 3GUTB 3UTSB 3DARA 2GJZA 2I60L 3WJLA 1JUFB 3HB3C 4PB0H 3GSVB 4E0RA 2EYSB 2C1OB 1B0RB 1K5NB 3HUJB 4P5TC 2Z93B 4OIIH 4MAUH 3D2UA 4H1LG 5I1AB 4WTZG 3BPCB 4PJHB 2DQTL 2ICWI 3TJHD 5MI0B 1A6WH 4E41D 3NVQA 4NCC1 2GITA 4IJ3C 4UV7H 1HWGB 5FYLE 5KSBE 4EUPH 1M7DB 4X83A 1U95B 3LRHA 2NYYD 4EDWH 5C1MB 3RL2A 4U1MA 1A0QH 4NUGL 1GPOH 1IKFL 2V17L 1JGVH 5AZEH 4LHUG 1NFDB 3BKJH 4ODBD 4GS7C 1D5IH 3CZFB 4Y5VB 1NCWL 4QHKJ 2N4IA 1LDPL 4G8GB 3CVHH 1K4DA 4MB4A 4MXVE 3DXAA 4PYGA 2MHAA 4P4KD 5D6CA 4XGZB 5EG6C 2W59A 5I9QB 3JVGC 3T04D 43C9B 1MVFA 4O2EB 1GVIA 4PY7A 3T2NH 1YPZA 4YHYB 4Y4FD 5L2KB 3QI9D 5CP3H 1YQ2A 1AHWB 2X4OA 3HFML 4ODXB 5C0CD 1A1NB 5E8EA 1QFOA 5E9DA 2L4OA 4QCIA 2DI7A 5IQ7L 1WAAF 4I0PB 2R1XA 3QUXC 4LSVH 2EZ0D 3G6JB 3UO1L 4JHWH 3MLWL 1QNZH 3T3ME 4GH7B 3UTTB 3RWJA 4LSTL 4B50A 1W72A 3UTQA 5LGJB 1YUHA 4PRAB 2AQ1A 3M8OH 3TBSB 3MLSL 4GKZA 5JLZA 4JM2C 1GAFH 3MO1A 4LCWA 3EJZC 3QCVL 4HS3B 4N8VG 4KK8D 3BUYA 5ACMA 4M93C 1CDCA 2ZSWA 1SJXA 4M5ZL 2E6PA 3GBLA 3PGCB 3CLEH 3IDIB 4LIQE 3BP4B 3I2CL 4KKNA 3KJ4B 5E2TL 2J2ZA 4R97B 4M48H 1KEMH 3D25B 2FEEI 3QNXB 4G8EB 3DV6A 3QDHA 3OKNA 3VXUD 1FFOA 2XKNA 2O5YH 4X0KA 3GHEL 4QGTA 5IB1A 4ODWB 1YN6A 2IALA 3K1KC 4JFHD 3VWKA 1DUZA 4QRRD 1UB5B 1IC7L 1P7HL 4OZGF 3VG0H 1FSKC 2P49B 1J5OL 3C9NB 1GZPA 2BNRE 5JHDD 3P0YL 2VXQL 4XP6H 4RA0C 5J57B 1INEL 1QKZH 3LRSB 5KSUB 1Z9LA 3CIQA 4NJ9H 2Q86A 4E5XA 1LK3L 5KW9H 4GXVL 2LAAA 2IG2L 3MJ6A 4D0DA 5D5ME 3FHAA 4P2RB 3EYSL 4GG8B 4AT6B 2FX9L 1AGFA 3PHQA 1MUJA 2VL4A 5BS0A 2VXVH 3EYQC 7FABH 4RNRB 2R0LL 1C16B 1MIEH 4G6JH 1YEJH 5DR5H 1A6TA 4PV8A 1VERA 4KQ3L 3WIHH 1T80A 2ADIB 2ITCB 3HI1B 1IKNA 2GKIA 3O6MH 4CVZB 4QOKD 4ODSH 1KLUA 2J8UF 1BIIA 3DRQA 4H5SB 3WN5B 1CGUA 1GHFL 2DWEB 1QLFB 1A7OL 1U8LB 2FATH 4K94C 4Y8DC 1TIUA 5J13C 3I02A 5J1TC 1F45A 2YR3A 3AB0B 1QLRB 4ZFGL 2BY2A 5D7SH 3VFSA 1Y6KR 4WY7L 3ABZA 4IEFB 3E3QC 2DBLH 5JPNA 2I26N 1JPSL 5FGSA 2CRZA 4M3JA 2QSTA 5DEZA 9CGTA 1K4CA 4Q9QL 4JFEB 3C08H 4OZFB 3BWAA 3QQ9D 3CXHK 4P5KA 1OM3L 3U30B 3QUZA 2XTJD 1XF2B 3ARYA 2IJ0C 3IKKA 1OW0A 2CGRH 3AU1A 1FVDB 3ARFC 1ZSDA 2E9BA 1Q9WB 4RMUA 4H0IA 3RX7A 2VR4A 4UT7H 3TCXA 2Z92B 1MJUH 5E95B 4J3OC 3WHE0 1TZGL 2J8HA 4DK6A 4ZTOL 2Q76A 1S7VB 2ZUSA 3MTRA 5DJ6B 1YYML 2HFEB 1MH5A 1FZMB 1VHPA 3WV0A 4P2YA 5M7QA 1J8HE 1MI5B 1HIMH 5I17B 3ZKXC 4LSPH 3C5ZD 1JWSA 3A0OA 5BVPL 3KG5A 4FP8H 5I1KL 2Q8BH 5F6HJ 3QJFB 2CRMA 5KBNC 5IESH 3SDDD 4N8CL 4KTDL 3VWJC 3KPQA 1X5ZA 3MRDA 5JW4M 5F1NA 2AABL 3BKCH 3FAXA 3EOTH 3ULUF 4QHMA 2H8PB 1L9MA 5IR1B 3S7GA 1S7SA 1GOFA 3C6LA 3D18B 2BC4B 2EH7L 4HLZH 5T5NG 1MJ7L 3ALPA 5CLWA 1KG0B 2X4SA 5DJYB 5J11C 4WI3A 2ZCLL 1AI1H 4MA7H 4PJFE 1UM6H 5CWSA 3TYFB 3LY6A 3M07A 4KJQD 1UXSA 2ICEB 5FA3B 2VUOA 4OKVB 2GTZA 3BAEH 3ELAT 3BH9A 4ZO8A 4GMTH 3QJHA 1JPTL 4YH6A 1BF2A 5HD8D 3T0EA 4LCIH 1QTYT 4O4YL 2P5EE 4LPTA 1P1ZA 4RGNE 5IHBA 4MVBC 4YHOH 3OAUH 2R0WL 2ZG2A 3VDBA 2W9EH 3VXOB 4EIZC 1T5WB 2FHFA 5GSVA 3QIUC 3WNPA 3L3GA 1BFSA 1J7VR 1M71B 3PQYB 5B39B 4YIQA 1CLYL 3RGVD 5CD5D 1C8PA 4QT5A 4LLQB 5DD6B 3QO0B 3MLTB 4JEGB 2ESVB 2YD5A 5E1AA 2IPUK 2CIKB 4UOW1 4XWGH 2FECI 5CIPB 1RJLA 1BD2E 4LSUH 4HMCA 4HIEB 1A3RL 3SDXE 5EU6A 5DURD 5I1HH 1HWHB 1MCJA 4N9GB 1CIDA 5INCB 5HVGB 4CMHB 2ENSA 1VENA 3QEQA 3MC0A 4HFWB 3D39B 5HYJA 1R24A 3MNWB 3OV6A 3U0PB 5C0EA 1N8ZA 4H25B 3TPUB 4G43B 3GSUA 3MBXL 3GI8H 1A7RL 2GT9A 5HYEA 4BFGA 1LEGB 3RZWA 1A5FL 4KUCF 5CBEA 4Z0BH 5E00A 5ID0B 5FO7A 3TO4C 4WWKA 3TZVA 1I1RA 5CIPH 4Y4FC 2MCG1 3RA7H 4OQTA 5LGHL 3B2VH 3VGEA 3V7AE 1IILE 4UUJB 3CZJA 3HG1E 4LVOB 4Y19A 3FFDB 4HW6A 1U3HD 3CC5A 2B1AL 4NQTA 2JB6A 4LL9A 3GZKA 5IW6A 1DQMH 2X41A 3FQTB 3IYLW 4GKSA 3V5KB 3SE8L 5FYJE 3LS4L 4ETYA 4FFVD 1NUGA 1MHCA 3O6LH 3MJ7A 1KXQE 4PRBB 4UOJA 2C26A 4C55A 4TUOA 4XNYL 1UH2A 1R3HA 1S3KL 4HKZA 2NXZB 2R4RH 1PKQA 3QG7L 1NGWB 5FYKH 5AG9A 1JYVA 3I3DA 4W6XB 1KGCE 4PRPE 3O3DB 1JJUA 4CDHA 4F33B 1F4WH 4P9ML 1JWUA 4G7VH 1NCBH 1CLZL 4LK4A 1D5MA 2CKNA 5F89B 1KJ3H 3LS5H 5EU4B 3X11B 4FFZL 3IDJA 1TZHB 3MFGB 3WXWL 2OTPA 3QDGD 2EDDA 2NY2B 3PWPD 1DVFA 1U8IB 4X99B 5CZXC 4JKWA 1UZ6E 4MA1C 3SPVB 4FQ1H 3Q6GL 4FA8A 1U3ZA 1XIWD 2CK0L 3BIAX 3FRUB 4H0GA 1FRGL 2VLKE 1QRKA 2BJMH 1DBMH 2Y36L 2HKHH 4YUEH 1S78D 4KI1A 4ZPTB 3WIIL 4X6DB 2QADB 4U0QB 2AEWA 1UVQA 3C8DA 2RQ8A 1YMHB 2Y23A 1VPOL 3LKNB 2X4PA 4NT6A 1YNLL 5E8DH 4MNQD 3KPNA 3VD5A 3WMSA 1L6ZA 1MJ8H 2HT3D 3QCUL 1QSEB 4NJAH 2IH1B 2R2HB 1WT5C 3KYKH 3BP7B 5DD5H 4KJPD 4I2XE 5BVJB 1IAII 5T5NF 4EUPG 1C5DA 4P9HH 5IV2A 3SGKC 4P4RA 2FIKA 4WO4A 5C70A 3R06B 5EC1B 3U83A 3NCJL 3TCLB 5JMOC 2A6JA 2QQKL 5C07B 5EUOF 5CAYB 1T66D 4Z5RA 1P84J 5IW1B 1BJ1H 3MRCB 5BRZA 3O2VL 2GCYA 4DGVL 1GCFA 4W4NA 3TNNB 3P0VH 3VXQB 3HE6D 5DJ2B 4LVEA 5D9SA 3BSZH 4JZJC 4X80H 3SQOL 5EO9B 4NNYB 2FO1A 3OZ9H 4WUUB 3D3VD 5EBWB 1JZ3A 1VKXB 3ARVA 2HVJB 1MY5A 5ERWB 3K8KA 5D7LA 4XXCC 4IOSD 1BZ7A 4PP2A 2HT4D 3KS0H 3RWIB 3RL1B 1D9KD 5KSBF 4RISH 3KXFB 2PXYA 1FFQA 3BEVB 5I16B 3LEVL 3RKPA 1MLCA 1EFQA 3UC0H 1LEIA 5IVXA 2VISB 3BPNC 5EU7C 3C60D 3GIVB 1GSMA 5HGBA 1T4KA 1X5JA 3QDJD 4PP1D 1U58A 3PUCA 4NO0D 5DD1L 1MEXH 1BFVL 5IT2H 4PR5A 5DRNB 5E2WH 5EPMA 2X4TA 2BSSB 5E2UL 2NX5D 1SBSH 3MRBA 4MXVF 4Z7VB 3LKQB 3DYOA 4GKOA 5DJ0B 4UQ2B 4LLMB 1K8DB 3CFBA 3PWLB 3D85B 4TVPH 1N64H 5D1ZD 1SYVA 4G8FB 5C08A 2OXGA 1EEZA 2G5RA 3E8UL 2EE9A 1H3TA 4L8DB 3PP4H 4OZHE 3BXNA 4Z8FL 3HMXH 3L3IB 1IE5A 5I74C 1NDMB 3AAZB 1U93B 3H9SB 4LAJH 4HK3J 2EE6A 4POUB 2AXJA 3LQAH 1XGRB 4L4TD 4NNXA 5L6YH 4RMVA 1S5HB 1K8IB 5DQ9B 1MCIA 3EDJA 4P2OB 1FVCB 3SCMD 4FFWD 2MTPA 4G5ZH 2D7PA 4PJEE 2XT1B 4KJQC 3SJVA 4YHLH 2OTUB 1HSAA 2UWEA 4HT1H 4ZYKA 5HJ3B 4BM7A 5ITBL 2NY5C 2R1YA 1RZFL 5K9OB 4I4WA 2VZUA 3WO4C 1NMAL 3LN9A 2HFGH 3I3BA 1SEBA 5GISH 5HD8C 1WIPA 4JO4L 3LKSB 4DFHA 3MA9H 4XVSH 4HFUH 3GM0A 4MB3A 3VFNA 5LJYH 4H26B 5D1QD 1KCSH 2BRQA 2P8MA 4QXTA 3VGFA 3TJEL 4X7FC 1ES0A 3TT1L 4WUKH 5C0AD 5TFSL 5H94B 5EC2B 3OBAA 4KMLB 1DFBL 3CVIL 3ESUF 2PO6D 5ACZB 2J4WH 3QPXH 3RGVC 5CD5C 3UTZB 1ROWA 3LQZA 3KJ6L 4K7FA 4F7EB 5F7DB 3ZKQD 4D8PA 4LQFH 4M7ZC 2JB5H 3C5JB 5D2LE 1KCVH 5CSZA 4YBLB 1WBZB 1HKLL 1DUYB 1BOGA 3AVEA 4NRZB 3BPLC 3GI9L 4NQCA 4C57C 5CMAA 5FV2A 2ZPKL 2EH8H 1MIMH 2VLJB 1N5YL 1INDH 3R0NA 4OF3A 4WI5A 4JFXA 4O2FB 5KSAA 1G9NL 1RURH 1XGYH 5FYJU 1R3JA 1I4FB 3ARDA 2I27N 3V7AG 3MV8B 2FEEL 1LO2H 2VO5A 4S1QL 4O9HL 4WI8A 3TBYA 1AJ7H 1HQRA 3NABL 2XQYK 3OXSB 3U2SA 2WQRA 4Y2DD 2P4AB 3GGWB 1U6AH 3FN0H 5JIHA 5IMLB 4UT9H 1I8LA 1CDGA 5CCKH 4PJ5B 1AQKL 2XG5A 4NQSB 3HC0B 1AKJB 1EO5A 3VCLB 2K9UA 4C83B 4PBXA 3I6LE 4OZFG 3QWOA 1U3HC 1I9EA 3FQRA 3F58L 1FBIH 5F96H 4U0RB 1T1XB 3QUYA 3T4AB 3DX8B 5DRXA 4R8WH 4HUVB 4HS6A 3RVTD 2F8XC 5I6XB 3IT8D 1DDHB 4WFFE 3H42L 3MRPA 1G7HA 3Q2CA 4WCYH 3VRJA 2AJ3B 5I2IA 2UZIL 1I85A 2DYPB 5F9OL 4ZDHB 2A9ML 4HLZG 2UVFA 1ULVA 3MXVH 4OCYH 1XZ0A 1NJ9B 4JPKH 4WUUE 1A7QH 3HUJF 1OP5K 4XMPH 4F7MB 3OPZH 2IANB 4PJHF 4QF1B 2VXUH 2VITA 5BV7C 32C2A 5GPRA 1Q9OA 3HMWH 3V6OE 2N7AA 2GJZB 1P84K 2KL6A 2Q3AA 4E0RB 3NA9H 5I8CA 3NPZB 3UX9B 3D2UB 3D69A 4X98A 4PLJC 3WE6A 1NFDF 3QQ3A 5HVWA 1CICD 1PG7L 2GITB 5K9KA 2IMMA 1V7NH 3LSOA 5FDYA 4Y7MA 5IFAL 1S78C 2NNAA 4M6NH 4CADA 1N3NA 1VCAA 1JIBA 1E4KC 3RL2B 4U1MB 2YD6A 1GIGL 3JWNC 1QP1A 5DGRA 5GRWA 4P3WA 4XNUL 1NGQH 3TA3A 4MS8D 3MJ9A 4PB0L 1IJ9A 1M6OA 2HT3C 3H9SE 1EMTH 1K4DB 3JSSA 4ZFOA 4OIIL 1U3JA 3DXAB 1ZEAH 1A6VH 4MAUL 1OARH 2MHAB 2BY0A 5JOPD 2CXKA 5D6CB 4FQQA 1A6WL 5HI4D 4UV7L 3G6JF 5D1XA 25C8H 4JQVC 3UJTH 1B4RA 4PY7B 5IMOA 2YWYA 1YPZB 3QIWA 4EDWL 2B4CC 4F15C 4FQJH 2X4OB 1A0QL 1B90A 5E8EB 1GPOL 5E9DB 4NBYB 2VYRE 3D87B 3EOYG 1JGVL 4QCIB 3NBNA 5AZEL 5B39G 3BKJL 4U7SA 5KZCB 4GJTB 2X44D 2R1XB 1D5IL 2QSCH 1JBJA 3RWJB 1W72B 1MCLA 3UTQB 1YUHB 1MWAA 3ULVE 4GKZB 3BMVA 1HHGA 5JLZB 3MO1B 3QXVA 4LCWB 4XX1E 5HHNA 2HT4C 4MSWA 1PEZA 2C5DC 1D9KC 2DLIA 3BUYB 2ZSWB 4U6VH 3G6AA 4RMRA 3SDAD 2D0FA 4BH8A 1DEDA 3T2NL 4WEBH 3C60C 3DV6B 3OKNB 3WFHA 1FFOB 2XKNB 4X0KB 5IB1B 1YNTA 1DBBH 1CGTA 4PP1C 1YN6B 2IALB 3VWKB 4LSVL 2H32A 1DUZB 1P5UA 1UENA 4PRHD 5I1EH 4JHWL 1QNZL 3TBTA 1W72H 4PJXE 1RVFH 3O9WD 5ALCH 4HH8A 1GZPB 5DJXA 2ZUVA 3KPPA 3M8OL 4NIKB 5D1ZC 4DTGH 1YDPA 4BQ6A 5CEZH 1ZVSA 4XHQA 1GAFL 3RDTC 1CL7I 1BOYA 3H6JA 3HRPA 3FOLA 2Q86B 4E5XB 3PG2A 3OKOA 4D0DB 4IDLA 3D6GA 1S9KC 2NY1C 2ZSVA 2XN9A 3CLEL 5BJTA 4XTRD 1OTTD 1AGFB 3PHQB 1MUJB 3TEUA 4ODVH 4M48L 1KEML 4YHZH 5BS0B 5DFWH 1PGRB 4YDIH 2O5YL 3IS1X 4FFWC 3H7LA 1A6TB 2D7QA 4PV8B 3B9AA 3FRPG 4PD4K 5J6GA 5I18H 4FNLH 3WFBH 1FZOA 4PV9A 3VG0L 1SBBA 3AXLA 4LVNB 3UTOA 3GHBH 1KLUB 4MNGE 2VQTA 1BIIB 4JDZA 3ARTA 3DRQB 1MJJA 4XP6L 2QSVA 2XZZA 1WJ3A 4ZPVB 1QKZL 3I02B 1U8MA 4FQXC 4NJ9L 5J06A 5KW9L 5AG8A 4PGBA 4CRPA 3VFSB 3E2HB 4EBQH 1EVTC 3BISA 2OQJA 4G42A 5JPNB 4PG2A 3G9VA 5D2NC 2VXVL 2ZUQB 1XCQA 7FABL 2OR7A 3IXAA 4LARH 1K4CB 2PO6C 1MIEL 4G6JL 1OHQA 1YEJL 5DR5L 3BWAB 4MQXC 3FFCA 3WIHL 1IMHC 1YEIH 4P5KB 3QUZB 1FNGB 1G6RH 5E99H 1N7MH 3TP4A 1DCLA 3O6ML 4EI5C 3AU1B 1ZSDB 3EBAA 4ODSL 1P4IH 1WF5A 4AEEA 2VQUA 4TOYH 3LKRA 4LPUA 5F7HA 4K9EH 4NYLA 2FATL 2YXFA 3S4SA 5GZOC 1EHLH 2DS4A 2Q76B 1HYSD 1MH5B 5D7SL 1Z5LA 1V05A 1S7UA 3N9GH 1RIHH 1AE6H 5TF0A 3VA2C 4MD0A 2DBLL 4JRXA 1O7VA 3WUWA 4HCRA 4B5EA 1JWSB 2F58H 3DVFA 3C08L 4Z18A 4BZ1H 4F9PC 3BZEA 4POZD 3KPQB 3MRDB 4L5FH 2CGRL 5F1NB 4Y2DC 2WBJD 1DLHB 3EKCA 4QHMB 1RD6A 1RFDH 1S7SB 4ZUVA 1ONQA 3C6LB 4UT7L 1MJUL 2ILLA 2X1XR 4X9GA 4GW4A 2X4SB 3FO0H 4I77H 1T0NA 3QHZH 4FQHA 1HIML 2DKSA 5JA9A 4LSPL 3UROR 4P48A 5CWSB 4RAVA 5DQDH 4FP8L 3NCMA 3RVTC 1UXSB 2Q8BL 4J6RH 2APVA 4HZAA 3BKMH 5D96B 4JFFD 5IESL 4WW2A 3BZDA 2GTZB 3BH9B 3BKCL 3O3UN 3EOTL 3QJHB 5FGBA 4ZOEA 5INDA 4K71B 1QRND 4KKCC 3CLFH 3T0EB 2JIXA 2X5PA 4GRLD 1FP5A 1INQA 3AMKA 1F4HA 1P1ZB 3HR6A 5HY9A 4HGKC 4WRLA 4WENB 4KMQA 3PDGA 3REWA 1AI1L 1RSFA 1UB6A 4HAFA 4I8DA 5GSVB 1TPXC 2APWA 3B9DA 3L3GB 1E27A 4MA7L 1OP3K 1UM6L 2X9WA 3KPRA 4YIQB 5CHNA 2BNQD 4QT5B 4FOMA 1PKOA 2ATPA 1MCKA 4S1SH 3HE7A 3BAEL 3GSWA 2KZ1B 4R7DA 5E1AB 4GMTL 4TRPH 4OCLC 5CGYD 3S37H 4OLXH 1RJLB 3HC3H 4TNVF 2MKLC 4LCIL 1I1AC 2XWBA 2VDOH 3TYGH 5EU6B 2FR4A 4NN5C 3K0WA 2ENYA 4YHOL 4Y8AA 3OAUL 4ZUWA 1MRCH 4PBVC 2W9EL 3QEQB 4MS8C 5HYJB 1HCFX 1NCCH 1R24B 2DQCH 5C0EB 1N8ZB 4HKBA 3GSUB 2HVKA 4P5TA 2ICWJ 2GT9B 4KDVA 3P4NA 4Z7OF 5JW4N 5B38A 3HI6H 2OP4H 5CBEB 5E00B 4I9WE 4UAOC 4Z7WA 4WWKB 3OTTA 3TZVB 4XWGL 5C09A 1XGTA 4N0RA 4PTUA 5DC9B 5EU5A 4ZO9A 5L2JA 4LSUL 2H6PA 4KMTH 3K74B 4M8VA 5DO2C 4P49A 4JE4B 5I1HL 1IGMH 4Y19B 5IMKA 3CC5B 4K8RD 2JB6B 3WS6C 4LLYA 3ARQA 5IW6B 4G9FE 2YRPA 3QXTA 5IMMA 4JN1H 5LG1A 4GKSB 1MCCA 2A38A 4RSVA 4U6YA 4Z7UE 2QBWA 1ZA3A 3RNKA 1FGNH 1MHCB 5C0BD 3MJ7B 2A6IA 1L7IH 4NC1C 1ZLVK 4TUOB 3RWFA 2CLVA 2AI0H 4Z0BL 1R3HB 4HKZB 3SDAC 1PKQB 3JVGA 3JWDH 3W11D 4OQTH 1E4XI 3R0MA 1F42A 3RA7L 3V5DA 1OGAE 3B2VL 1KCKA 3OKMA 1LP9A 3J7HA 1JWUB 4U3XA 1D5MB 4BFIA 1XF4A 3KPSE 3IDJB 5F7FA 1TLKA 3QUXA 2E3VA 4X6DF 1DQML 3CGTA 5L8KB 4NZUH 5IF0A 3ULUD 2GTWA 4LHUD 3O6LL 1UCBH 1HI6A 4J2XA 4JM2A 4DUXA 4Y4KD 3VXPA 4EI6A 3ZSSA 4HDIA 2R4RL 1PVHA 1WTGT 2PTTA 5FYKL 2YMXH 1OTTC 4YXKH 1UVQB 2HWZH 4PRDA 2X9YA 4KU1A 1F4WL 2VDQH 4G7VL 1NCBL 4UIKH 4GRWB 1TNMA 2X4PB 1SEQH 3ZT7A 4NT6B 2GQHA 1KJ3L 3KPNB 3LS5L 3GJFA 1ZLWH 3VFWA 1WZLA 2QEJA 3H8NA 3RY6C 3GMQA 2HMID 4FTVE 5GJTH 3CX5J 3ARED 3ZHLA 4FQ1L 4KI5E 4CW1A 1C5DB 5ANME 3U6RA 5H2BA 2C3WA 2EIEA 1MQKH 5IV2B 4P4RB 2FIKB 2D0GA 4WO4B 3SKOA 5JQ6H 3LPFA 2BJML 5AWNH 1DBML 2NY4D 4PJ9B 4YEEA 2A6JB 2DI9A 2WUCH 4N0YH 2HKHL 4KPHH 4YUEL 4Z5RB 2NLJA 5BRZB 2GCYB 2P5WD 5TE6H 3T0VA 3O4LA 4NQDA 2I9TA 3KHOA 5D9SB 4GRWH 4Y1AA 3SN6N 3RX8A 3BIBX 4NUJA 1T2JA 2PYED 2V5SA 4JVPA 5E8DL 4JO2H 2YA1A 5DT1H 4LHJB 1MJ8L 3U7WH 1MELA 4NJAL 4YQXH 3KYKL 5IB4A 1CD1A 5D7LB 2FRGP 5DD5L 1SJVA 4YWGH 3PWNA 2W60A 3JV0A 1BZ7B 4XP1H 4PP2B 4KDTC 4P9HL 2WMPA 3P3YA 2IAMD 2GJ6D 2FGWH 1NBVH 2PXYB 2XZAH 4P23D 4APQD 1MLCB 2O5XH 1LEIB 5IVXB 3UTPD 5A1AA 2VSCA 5DGQA 1I7UA 4JG0H 3D0VA 3P0VL 5I1CH 4PJ8C 1T4KB 5HGBB 4Z76A 2BSED 5JXAL 1U58B 3BSZL 4FRWA 4X80L 2IC2A 4OBRA 4PR5B 5EPMB 2X4TB 2EE2A 3MLYH 2NMSA 3OZ9L 2F8OA 3MRBB 5F71A 4XVJH 3EO1A 3VJ6A 4LSDA 3CFBB 4KUCD 2BOCA 5I1LA 5K9QI 1SYVB 3ARFA 5BZDA 1KB5A 4L9DA 5C08B 3BPOB 1EEZB 3FT2A 4RISL 3BXNB 4IOIA 5ADOH 4MJIE 1L7TH 2ED9A 4NNXB 5F1KC 3UC0L 3P73A 4M03A 1R0AH 1P7QA 4L1DA 2GIYA 3VW3H 3MROA 5IT2L 1MEXL 4HWUA 5E2WL 4UZGA 1HSAB