5E9DA

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
275
structure length
266
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 69
structure length 266
sequence length 275
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e9dA01
3NZ8A 4ZUSA 3LHPL 2H8PB 2KQMA 5EU6D 4N0YH 3DHJA 4O2FB 3NACH 3HAEH 3LPGA 5E4EB 5CEYB 3CK0L 3ARUA 5DJCB 2H3NB 4YBLC 4BSWA 5C92A 5SWZD 2UYLB 4W4OC 4NGHL 5FUZH 4ELMB 4AG4L 1OD9A 4AM0A 2MKLC 4KRPC 1GC1L 4OGAC 3IDGB 5IHZB 3UTSB 2VAJA 5DQDH 1LD9B 5ECJE 2IWGA 2AV1B 4UIMB 2X4SA 4PJFA 3C2AH 1LK3L 4JRYE 5C0CD 3OF6A 2R9HC 3NCJH 5A2FA 4J3SA 3GM0A 5FM8A 5GS1A 3QDMB 1CGSH 2DF3A 1I3GL 2FR4B 2D7TH 1FSKB 3BSZL 4UNUA 2R2BB 2QEJA 5SV4A 1BZ9A 2I5YL 3TN0B 4OI8A 3BD3A 3GJEB 2G75B 1OGAE 4R7DA 3WFEH 3GGWB 4AJ0A 4OT1H 3A67L 2F8VA 5HGBB 2VITB 1S7WB 1DQML 1OAZL 4ZUWB 5T3ZD 3DV6B 3PIQB 5I18L 1OSZA 4N0CA 2HWZH 5TQ2H 5EU5A 4GRWF 3MODL 3U9PL 3DXAA 2PKDA 4MCYB 2OQJA 3C6LC 1MNUL 5GGRY 4Y2OA 4N1EA 5IMLA 4FQLL 5TF1H 3BYYA 3K74B 3KNBB 4MNQE 1CG9A 1DBML 1Z9OA 4P46B 3BJLA 2AABH 5ADPL 1MRCH 3Q0HA 4YZFE 5IFAH 3QO0A 1TFHA 5GRJL 2V9QA 4FQJL 2VLKD 3VFPA 2Q8BL 4I1NB 3STZA 4KK5C 3MJ9L 3H9SD 4FQXC 4ONGL 1RZKL 4Z7WA 1S3KH 32C2A 2BVEA 3GSUA 4EI6B 1N5AB 4MD0A 2F8OA 3BPNB 2VLJB 3KYKL 35C8L 1IGYB 4Z7NE 1NUDA 2EIBA 1QQDB 3ARFC 2BY2A 4U1KB 5HYEA 4JE4B 3V0AC 1JPGB 5ESQA 4ODUB 2YD8A 4L4VB 1L9MA 5DT1H 3LEYH 4HUWB 1KPUB 1AIFB 3OAUH 4K3HA 2X4PA 1HYSD 5AYUL 3HG1A 3U2SA 1FH5L 3SJVD 4XVUC 3IF1A 5GS2H 3TJHC 3FTGA 4H0IA 3OAZK 3TVMD 1IEBA 5IFHH 4QTIH 1EH9A 5HHMB 3DETC 4YFLI 1MF2L 5EA0H 1HHKB 2ARJQ 3DNKA 5ABDE 5C0CB 4PR5A 5HVHB 4OLWH 1SJVA 5B8CB 1NGYA 1NMCB 4GKSA 1MCWM 1JWMA 3JSSA 4JPWH 4Y1AA 3QIWD 5ISZE 1X6NA 1QA9B 1G7QB 5L0QB 3J8F7 1FNAA 4YNYB 1JNJA 3BP7A 4W68A 1NUFA 4NO3A 3S35L 4WTWA 1NMBH 5C2UB 1L7TL 4M7ZC 1JHKH 2VZTA 5FCSH 1F4AA 1MCEA 2EDWA 4G9FE 1SYVB 4Y8AA 4AQOA 1YMMD 3FFDA 1R5VA 4HFUL 4P0DA 3EJZC 3KLSA 3V52H 4HG4J 3CIQA 1XCTB 1TVBA 3H3PL 4R26L 5DJXB 2HFFA 1EHNA 4PJCE 5JHDB 4WV1B 1OTSD 2OJEB 1B2WL 1DFBH 2YA1A 1DDHB 4HIEA 2CDFA 2OMNA 4DVRH 4U3CA 4P3CL 3HZVB 1R3KA 1FGNL 3QNYB 1IGJB 1F4YH 1I8MB 5HI3C 1WT5A 3TT1L 1EUUA 1MI5E 8FABB 3FQXA 2BY1A 4NO0A 3LV3B 4NHUA 4H26A 3PWUA 4XH2B 4QXTB 2IMMA 5CGYC 3O11B 2OL3L 4K3JH 3T08A 1T89C 4JO4L 4F58H 1KG0A 3BRGC 2YKLH 4KQ3L 4GKNA 3M45A 4ZO6A 4YAQA 4CMMA 1UJ3A 3RVTD 3H9SB 4NDMA 5GGSY 4ENED 3DMMD 5FKAB 2R4SL 4KHXL 3FQUA 3L7FA 1K2DB 3KPRE 3QPQC 5I17A 3LN5B 3QDJD 3U4EA 2P48B 2PNDA 4WI3A 4RWYL 4NM8L 1V5JA 3MXVH 4N8VB 3BP4A 4JFDB 4C54A 1X5YA 4YXKH 1KLUA 4K3DH 5HGGS 4KWUA 4KZEL 5DD3L 3AFLA 1F00I 3C09C 3U36A 5DR5H 1JZ8A 3RHWF 4PRDB 3TFKD 1IM3A 2LVEA 3TVMB 4JO3H 4GW1A 2B1HL 3EO1B 1QLEL 2G60H 4K23L 1XGYL 2DIAA 4HK3N 3KVQA 2HJLA 3E3QA 4O2EA 4F37F 2YC1A 4G80A 4LCCB 5H35A 4Y0GA 3Q3GA 1MLCB 4HKZA 3SDDA 4G8EB 1ZHLB 3VFSB 2HTLD 3T8XB 4JG1H 3MV8D 5EZLA 1HSAB 5INCB 4NBYB 1TPXC 1VGEL 3LRGA 1MCNA 1AQDA 3U30C 3BJ91 4XP9H 5C0FB 1NCCL 3BPLC 3QUYC 1AJ7L 5IBUB 2R1WB 3W0WE 4RZCB 1KJVB 3G04A 4XHQA 5DFTA 4U1GB 5DUMH 1TENA 4NC1C 1SBSL 5IHUL 3JV5A 3U7WH 1T83C 3HHRB 5M95B 4APQA 1J1XH 4J3VA 3ARGA 4JHWH 1L0XA 5JUEL 4LSQH 1PSKL 2YD3A 4OI7A 1BVLB 3EGSA 3ARQA 3IS0X 3RKDD 4U1HB 3SO3C 5K9KB 2DBLH 3EUUA 4P48A 2QSQA 3STLB 4MYWB 4DW2H 1HQRB 4OLZL 3HI6H 1RUAL 3BKYH 5FUCE 3GSVA 2O5ZH 4CADA 4NQDA 4LNVA 1WAAE 2YRLA 4JM2B 1I1RA 2WQRA 2XKNA 5I9QB 5J13B 4OB5L 4F9LC 4HX1A 4KQ4H 2MPAL 3MRMB 4HXBL 4PD4K 3AY4C 1VEMA 4KKAC 2UV3A 5BS0A 2XWBB 5C9KA 2B2XH 4NWTH 5EG6C 5JLZA 2DQJL 3JWDC 1U2CA 3CFEA 1ZV5A 3G5ZA 3O6FB 4LPYA 3FT4A 3CXDL 4ZFZA 3I3EA 4C4KT 4Z0XB 3QI9D 1IQDB 3GSQA 3KYAA 1BJ8A 3CCHB 2ZSVA 1T5XA 3VFVA 3CK0H 3WLBB 2RGSA 2QV2A 1WWCA 1VACB 3VXTB 3BW9A 2LAGB 4XCFL 1JNHA 3CDYA 1NC4B 7FABL 1CXIA 1D5IL 1VCAA 4X6EA 1RJCA 3DX9B 2C1OB 3BWAA 3HZYA 3HC0B 1H9VA 3PNWA 3RWGB 3CLEH 3GRWL 2Y9RT 4PTUB 1LO2L 5DC4B 1MAML 1YUHB 5GRWA 3SPVA 5DJ0A 3IAGC 5FYJD 1YEJL 3MV8B 4MA8L 1MCFA 3KXFD 2R56H 1GOGA 2I5YH 1ZTXL 1BWWA 2D0FA 4QHLB 5DRWB 1C5BL 5ERWA 2Z8SA 3ESUF 4D9LH 3A67H 4BM7A 4Q6IB 3PWPA 3GK8H 4LLVA 1OF2B 3C08L 4ODVL 3KR3L 4PY7B 4LQ1A 5LGHH 3VXME 3NH7H 2ADFL 4TSAL 2GK0B 4RSVA 2G2RB 4OBSA 2WBJA 1OSPH 2W0FA 3F6IA 2EKSB 2LU4A 1HZHH 1M05B 4LCWA 2GITB 1MVUA 1U8PB 2C3VA 4Q6YA 2CLVB 2OTWB 4Q7DA 2QKIA 3UBXG 5I1AA 4EUPB 5I1CL 1G9NC 2VDLH 1MFCH 1I7ZA 1N8ZA 5E6IB 1X7QA 5GS0D 3FQWB 3TP4A 5ADPH 3VXOA 5D7JC 3CSBA 4CBPA 4NQED 4HCRA 3TPUE 4ZAKB 2VABB 3MNWB 4YHPB 2Q8BH 2HKHH 4WNQB 2FO1A 2VDPL 5GZNC 4QOKA 3WEXB 4UDUA 2NX5E 3HNTL 4ERSL 5I73B 3DVIA 1KB5L 2KQNA 3AMKA 4BQ8A 5ICZB 3GI8L 4LPTA 3L6FB 3KYKH 4ELMF 3KPQA 3QHTC 4PJGF 4MAYD 5HD8D 3REWA 2ITDA 3OKMB 4OCYH 5C2BH 3ELAT 4JREB 1U36A 2AJVH 4XCEA 4JFXA 3QPXL 1KJ3H 3W82A 1T0PB 3SDCB 1EVUA 3VXSB 3DO7B 2NY5L 2BVUA 3FQRB 1D5ZA 3MCKB 5C0IA 5TE4L 4OZHA 1ZOXA 2BCKA 2WK2A 1BQUA 4Z7UE 1H3PH 4S0TD 4UOW0 1F6LL 1MF2H 1KTRL 4Z5RB 2WLZA 4R0LA 1JBJA 1OWRM 1KCRL 1MH5A 1JK8B 2OZ4L 4KU1A 4LLWB 2J12B 1VKXA 4WO4A 3WE6A 5JHLH 3MNZB 1Q38A 3GJFH 4L3EB 5C0GA 4JDVA 5J3HD 2ZOKB 2RJMA 5KSBB 4WGVB 1LE9A 5ITBL 1VSCA 1JZ4A 1XF2A 5CBAA 4QCIB 4N90E 4WUUD 2O5YL 3S35H 1QPPA 5DF0A 3NZ8B 4NSKB 3D85B 5IW3A 4GRLA 4IJ3B 4ZS6C 4NBZB 3T1FA 1QLRA 2QTEA 2BZDA 1KEML 4PJBF 2B0SL 2N4IA 3AS3A 5D72H 3S37X 4BSWB 1P5UA 1KB9J 1CDBA 1B2WH 1EFXA 3SDAD 3AM8C 3O4LA 5B38B 3CAFA 5F1OB 4PJAF 4XC1L 4IOIB 2P7TA 4Y4KC 3IJSA 3QQNA 2DQEH 4RBPK 3TT1H 4IRJA 1FCGA 1P4LA 3WO4C 4TSCH 3T2QA 1H3GA 4XP6L 1S9KC 2A6JB 5D2NB 3TWCL 4JGUA 3G5VA 1F90L 3KYMA 4K8RL 5GS1B 3MCLH 5I1IH 1F3DJ 1QSEA 3QZWA 1CL7H 2ATPB 3TBVA 1BOYA 1BZ9B 2HFGH 4PIRF 2F8XC 4TOYL 3FONA 4POYA 5MHSE 4R7DB 2MJWA 2FJFA 1F02I 4HDIA 2FEDD 3RGHA 5DD6B 1QSFA 1KT2A 3D87B 3D25B 1JYWA 5T1LB 5J11B 3KLHC 1JGEA 2J6EH 1OSZB 3FHAA 3FQTA 4P4KD 4QRPA 5E8NB 1Q0YL 5EU5B 3SE3A 3DXAB 3ARED 3T0DA 5IJVA 4NN5B 1QRNE 4P5TD 1K8IA 4P23C 2NXZD 5D93B 2OQJB 2VTFA 4DK3A 4P5KA 3CLFH 2NY2C 5F9JB 2FSEA 5JW4M 1BQHG 1M71A 1QBLL 5IMLB 2B1HH 5GSRA 5F7LB 4JY6A 1A6AA 1QLEH 4I4WA 1CG9B 4K23H 5HI5D 5CEXA 4UQ2B 3QO0B 4FQ1H 5HGHB 4ZDHA 1S7QA 4JFPA 3ULUC 3GNML 5J6HA 1JUFA 4XVSH 3KS0H 1T7XA 3IDJA 4OUUA 5F9WB 3STZB 1W8OA 3H6JA 2RR3A 1TMCA 5AWNL 4U3HA 1G7LA 1IKNC 3HE7C 4R7NA 3DYOA 3R0MA 5EUOB 4WHDA 3ZKQD 1MWAL 4G8GD 5I8OH 3A6CL 5F89A 1VGEH 2AQ3A 1NCCH 1YPZF 3DO3A 3CFDA 4O9HH 1J0JA 4L9LA 3IJYA 1UWGL 3A6BH 3QJFA 5IHUH 4CVXA 1KPRA 3GKWL 4XHJC 4YDLC 5DJ6B 3GZKA 4PP2A 4I2XE 4KK9C 4DGVL 3HG1B 2VMFA 3RI5K 3U2SB 2WY3A 1TJIL 4PJFE 1RUPH 3FTGB 5TFSH 4C4KO 1IEBB 4PJ5D 3OZ9H 4XBPB 5EZJB 2E7LA 1PLGH 2HTKC 5GGQL 2B5IB 4HAGA 1OL0A 4HK0B 1LO4H 4YO0A 1EERB 3DRQA 2ICCA 4LNRA 4P2YA 5MENE 1I4FA 4ONHA 4KMLB 4JFFA 1NGYB 5IMOB 2DD8L 2LVCA 3K2UH 4HWBA 4IIQC 1JWMB 3U0TA 4Y1AB 3MLYH 2ICWI 4OB5H 4OCXL 1MFEH 1L6ZA 4H1LA 1RHHA 3F62A 4Y5YA 3LPWA 4JANA 5FHBH 3HA0A 4NO3B 3VXPA 5EU6A 3OX8A 3W11C 2WWMC 4UINL 3OAZH 1JE6A 1BQLH 2YWZA 1M7DB 4S1RH 5D1XC 2VSCA 1JFQL 4LAJH 3FFDB 5EOQL 4TN9A 2R2CA 2P8PA 4YR6B 4Z7QE 1TVBB 5SWZA 2HFFB 3VH8A 2A77L 4HIEB 3TPKA 3V2AR 5A43C 2CDFB 1RULL 3FMGL 1MIEH 1R3KB 3N9GH 2DKSA 5D71L 2X41A 3G6JA 5C6PB 4MXQD 3GIZL 3K46A 4PJIE 4O5LH 5C0BA 3LRSA 2CKBL 2BDNH 3D2UD 2AJSL 1XMWA 4OKDA 5TE7H 4PJEA 5DHVA 3EAKA 1U8KB 3CMOL 2YD1A 5DMIH 4GKNB 4FQ2H 1LO2H 4YAQB 3TF7C 1UJ3B 4TVPE 4M5YL 2H2SD 5DA0B 1YEJH 4MA8H 3AAZA 1B90A 3FQUB 3KS0J 5IROA 4N9OB 3GBML 3L7FB 1TNMA 1DBKL 4NZRL 4TVSa 5I17B 3U4EB 2BVQA 2ZPKL 1C5BH 1EZVY 4KI5C 3L3HA 4XMPH 15C8L 3O9WC 3BP4B 1KLUB 4P2QD 4HGMA 3K81A 2NTFA 1S5IL 2YA2A 4ODWA 2AJXH 2NXYC 3NFSL 3U0PA 1P4BH 1T2XA 3UJTH 4NJ9L 4IMKC 3U36B 4ODVH 4ZODA 2PO6A 3KR3H 5GGTA 1IM3B 2ADFH 1V3JA 4WHCA 5K9OB 1ZVHA 5CP3A 5BZDB 1Q9LA 2Y72A 5SWSA 2A9ML 1G9NH 3QIUC 4WEBH 3MYZA 2DLHA 4EI5C 4MJID 1RU9L 1JPSL 1G7PA 4QNPF 4O2EB 3GFUA 5I1CH 2YC1B 3CDCA 2XV6B 2E6JA 1FLTX 2Z92A 2WQ8A 3FO9A 5FDYA 5H35B 3Q3GB 4HKZB 2DQIL 5D1ZA 1A22B 3FAXA 1G6RB 3SDDB 5E2WH 2AXJA 2NW2A 4XBEL 1ZVYA 3QQ9D 1SEBB 5GS2D 4HS3A 4XAKD 5EZLB 3JTSA 4V3EB 4X4YA 1P53A 3DTXA 2E8ZA 5DS8A 3S35X 2DDQH 1LP9B 2H2PD 3G04B 3ARDA 3HNTH 4JEGB 1KB5H 5IB2A 3VGHA 1RIVH 2YK1H 5FF6A 4BFBD 1XF4A 2LU3A 4APQB 1MUJA 4GRWE 4M7LH 4FZEH 3C8KA 3WDIA 1BM3L 3B4NA 2B1AL 3HI1A 1N6QL 2Y1VA 4NHUE 1Y18A 4QT5B 4QXWA 5C7XL 3O2DH 4I0PA 5IBTL 4M7JL 3CMGA 1F13A 3EYUH 3VW3L 2NY5H 4RMVA 5HYJA 5TQ0L 1FIGL 3MV9A 5CD5D 1BVZA 2VR5A 3GSVB 3S88H 4CADB 3NTCH 4N5EC 5J0BA 4NQDB 2CLZB 2XKNB 4WI8A 3FB5A 4JDZB 2OZ4H 2ZUXA 1LDPL 2V9TA 3HC3L 3MPCA 4PBXA 5BS0B 4QKXB 1A7NH 2DMKA 1UZ8A 1UFUA 3WXWH 5E2VH 5JLZB 2CJUH 1RZ7H 2QQNL 3BH8A 3UTZA 5D96C 5HYSA 3PWJA 2DIBA 3CFEB 3VG9B 4MJ6A 3G5ZB 1IQWH 2YBRB 3UPCA 3FT4B 2DB8A 2Z35A 1WTLA 2OM5A 3LEVH 4NKOA 4NWUH 4HPOH 4G6KL 3GSQB 1KEGL 4G6FD 1A7RH 3I6KB 1ZT4A 4LLYA 2ZSVB 1T5XB 2X4QB 2B0SH 1JNLL 1IBGH 3VFVB 3TYFA 1NDMA 2RIKA 4ZXBD 3RRQA 3IFOA 4N8CH 2Q1EA 5TGBA 4M93B 3BW9B 4HSQA 3WNOA 1JNHB 1N0XH 2EXYD 3F7QA 4MNGA 1A7QH 4G43A 4KGLA 1OTTD 4I3RL 1T83A 2R69L 1MHHA 1I1FA 4U3XA 4X6EB 1JNNH 3BWAB 3HZYB 5GJSL 5IVOA 3PNWB 4OLVL 1RZFH 5D7SL 1FJ1B 1NCBH 2IBBA 2NYYC 4KVCL 4U49A 5DGQA 4K8RH 3MRNA 1MAKA 5GRXG 5FK9B 2QQLH 4Y4HD 3S5LA 4OLUL 1FP5A 4JO1L 1QHOA 1G0YR 4X6CF 4E42A 3ERYA 4TOYH 1DTUA 1EEYA 5DI8B 1U8OB 5I71B 4LBEA 4J6RH 3QAZB 2IQ9H 1S9VA 1X9QA 4J3OC 1AHWA 2UWEF 3FN0H 3PWPB 5E1HB 5H37G 4LLVB 1AO7A 3K80A 2GAZA 4U2ZA 2I27N 5HYFA 4E41A 4OGXH 3PV6A 3C9NA 1ORSA 1N59A 2ESVE 2WBJB 2W0FB 5T1KD 2XG4A 3N50A 4LCWB 1G1CA 2C3VB 1A3LL 2E7MA 2PN5A 2QKIB 5I1AB 1QBLH 4L8SC 1QRKA 1JVKA 1I7ZB 1N8ZB 4P59H 1X7QB 1RZJL 2DQHH 3AS2A 4BH8A 3ULUH 1RFDL 2AI0L 3AS1A 4KFZC 3VXOB 2EE3A 4X98A 4JY4A 5D7IF 3ZDXF 3EYOA 3B2UD 1WVZA 1DP0A 5IBLC 4QOKB 1D5MB 5L7XL 4LP4A 4UDUB 2DM2A 1V8HA 2R23A 2EDRA 4U31A 1MWAH 2F5AL 2GCYA 3D48R 3EYQD 1CDHA 4D9QE 1CTOA 1U91A 1E27B 4PJ9C 3SDXA 4O58H 3MLSH 4EDWL 1ZLWK 4RRPG 4XCEB 5E6YA 3STBA 1ES0A 4JFXB 1A3QA 4KGJA 4M1GH 4JZJA 4ZS7L 5C0DA 1MCOH 2XTLA 3JTTB 3RVXC 5CP7A 2M2DA 1D5ZB 2PF6A 2V7HA 4OZHB 2IFFH 1UWEL 2BCKB 1KCSL 2E9BA 4GAJH 2NY6C 1MH5B 3CVIL 1JYXA 4ODSH 1TCRB 2HT2D 5D4QA 1C5CL 1ULVA 1VKXB 4QXGL 4WO4B 43C9A 3V6OA 1YEDA 1MJ8L 5EOCJ 3P77B 4MWFA 4OGAD 4PB9H 5C0GB 4JDVB 4G8FB 1GIGH 2FGWH 5JW3H 4HWEL 4PLOB 1MJUL 4YUEH 2XN9D 4M8QA 4XP4H 4JCLA 4DQOL 1XF2B 4ZSOE 5JZ7C 5CBAB 3EBAA 3NZHL 1KXVC 1E6JL 3QI9A 3F5WA 1A6VH 4GRLB 4X6CA 3T1FB 1QLRB 1I7UA 1OPGL 2R15A 3H3KA 5AUMA 5EOQH 5IESH 2X9XA 1K5NA 3THML 2CDEB 1W0YT 4QRTA 1A2YA 4FXGA 4UV7H 1AD9A 1IAOA 1KCLA 2P7TB 3IJSB 1GHFH 3GIZH 4IRJB 2D7PA 2IAMA 4NQCB 4RFOL 1P4LB 1UVQA 5BZWB 1IC7L 4IDJH 4E0RA 1SQ2N 3G5VB 3WD5H 3C6LD 1MCPL 3CMOH 4PYGA 4NT6A 1QSEB 3QEQA 4NFDA 2G9HB 1R24A 5EU3A 4A6YA 3FONB 1MJJA 3BPOB 4KXZI 4WHTA 2F53D 2XTJC 4X4ZA 4HDIB 3IDMA 3NOIA 3DHMA 1KT2B 4RBPH 5JORA 2D4FA 3MV7A 4S1QH 4KKLD 4NZRH 4QHKI 1U41A 4YEFA 1KJ2L 1CYGA 1JGEB 15C8H 1HINH 4FQXD 5D7LA 1UQSA 3FQTB 4QRPB 5ALCH 3QUXB 5IJVB 3NFSH 5IVZA 5IOPA 4JGMA 1X5FA 4P5KB 2VL5A 1A4KB 4GOSA 1DQQB 1H8OA 1GC1C 1NEUA 2FSEB 4PG2A 1M71B 4YHZL 3ARFD 5GSRB 5FV2A 4JY6B 1J87A 4I4WB 4JRXA 4PY8I 4ZFGH 5CEXB 1JPSH 1WTGT 4NQXA 4YBLB 5E99L 3VRIB 4ZDHB 1S7QB 3BH9A 2VDRL 2VZOA 3QDGD 4JFPB 3PL6C 5J6HB 1UC6A 1JUFB 4OUUB 3IDJB 3TJHD 4JQXA 1GPOL 4KRPB 2DQIH 3BAEH 1EEZA 1TMCB 1QFWL 3P30L 5E8PA 5ICYA 3DETD 3MX0A 3HRZA 1A6WL 1I3UA 4MJ5B 4R7NB 3OMZA 5CIPH 5EN2A 3QNZA 4LP5A 1GJIA 5F89B 4FG6D 4KJWC 3NCMA 5KS9B 4XWOC 2AXGA 4ZQKA 4R2GD 5IVNA 4L9LB 4RWHA 5E24E 3IJYB 5C0AA 1FORL 3QISA 3QJFB 1K6QL 3O4LE 4PRBA 3ROOA 5DEZA 2VLME 3WCYA 1U8LA 4PP2B 3ZTJG 5F6HJ 2P4AB 4JDTH 4PV8B 4XI5D 4YK4C 5I30L 4POZC 3V9FA 2ADIB 3LAFA 3G9VA 3EJZD 3MOQA 2E9WA 4TVPL 1FIGH 6CGTA 3BEVA 2W65A 1PYWA 4YHIA 1U92A 3GMMA 4ONHB 3V4UL 5LXGL 1H3TA 1JRHL 1JGUL 3GSNA 4P23A 3MLUH 5JW4N 3U0TB 4KKCC 5BV7L 4D8PA 4HS6B 3BKMH 2I26N 4H1LB 1QSFE 1RHHB 1RZKC 3WBDA 3HC3H 3I9GL 2D2OA 2ZCHL 4JANB 3D0LB 5GPRA 5CGYD 3VXPB 3TYGH 1PVHA 2XA8H 3OX8B 5C08A 4RGND 5H8DA 1T20B 4ELME 5IT2L 5E5RB 2QQNH 4PJGE 2X4NA 4QEGA 2Q86A 4OLXH 5FO7B 3M17A 3C60A 5F7YC 4NQUA 4U7MA 2YPLE 2LQRA 4YHML 1PKQE 1AGEA 3SDAA 3TO4D 3VH8B 4EN3C 5C09E 1AC6A 2YZ1A 3D18A 5SV3A 1CGVA 1JWUB 2PTVA 4Y2DC 3QPQD 2RAMA 4ETQA 4JQVA 3G6JB 1FL3A 4P2RA 5F3BA 5CKAA 5I1KH 1G7HA 3ARFB 2ZOLB 1CZ8L 3LRSB 4OFPA 4MQXD 4K71C 3IXAA 2BSRB 5E5MB 1D6VL 4Z76B 2MCG1 4LSUH 3B9VA 2NLJA 4PJEB 5DHVB 4WVRA 4RAUA 3KPOA 1LP9F 4JFQA 5BO1H 1OCWH 4K94C 4GW4B 4KTDH 1RVFL 2EICA 1KN4L 1KCKA 5D8JL 2BERA 3D39D 5EU7C 4JO1H 1XR8A 3O6KL 4BZYA 3PWNA 5DXWA 2QQKL 3LKPA 4AEHL 4IDLA 1NBYA 2BVQB 3Q6GL 3L3HB 1RY7B 5JDJA 3AREA 1EO8L 3UTQA 4PJBE 4GXVH 3SO5A 4ZTOL 2NTFB 4ODWB 3U0PB 3RWFA 2B7DT 3QUYD 4J2XA 5L9DH 2PO6B 4LCYA 3U4BL 4PJAE 2MNUA 2PW1A 5IK3A 1KYOK 4OZFG 3RA7H 3DRTB 1Q9LB 5GIRB 4JFFE 5HHNA 5SWSB 2A38A 4B0MM 1MIMH 1AD0B 2J8UF 3TA3A 4N8VG 5F72S 4M8VA 4Y19D 3MLXH 5CINL 4LIQE 4KDTC 1WZKA 1TZHA 4KRLB 1TQBB 1CXEA 5D1ZB 4J3XA 4NYLA 5EU6E 4XPBL 2B4CC 2VIRB 3JTSB 2WUCL 1DQDL 3B9KC 1BAFL 3DTXB 5DS8B 4V1DD 5BRZD 3OXRA 5SWZE 4WWKD 5EFIB 5T1DL 2Z9TA 2GJZB 3WIHH 1K85A 2DQTH 5D1QD 1NCUA 3VGAC 5IB2B 5EBGA 3UYRL 1CDUA 5FF6B 1XF4B 4HT1L 1CXLA 4X8JB 1MUJB 4KKAD 1MFNA 2IH1A 5C0CE 4LSVL 4EDWH 5BJTA 3C6SA 1UH3A 3W5MA 5C0BE 4MS8C 1X44A 3FO0L 1Y18B 5IBUG 5AZ2L 4JR9L 2BJMH 4PRPD 4I0PB 1OAYH 3MBEA 4QGTA 3P73B 5F7KC 3HAEA 5TF0A 5HYJB 3MUJA 5LBSH 3MV9B 5F8RC 2FX8L 4X4MA 3C09B 4Y89A 4Q9QL 3PP4H 4GAFB 1U93A 4Q9CA 4M7LT 4TSBL 1C5CH 2V5TA 5T3ZE 2PXYC 3SCMA 1Y6MR 4Q97A 1GOHA 4XNUH 3Q6FA 1UZ8B 4AEIL 2XYCA 3D39B 1QD0A 3HN3A 1I9RH 3BH8B 3UTZB 1YPZE 3R4DA 3X3FL 5HYSB 2NY0B 3PWJB 1G7JB 4G42A 4DQOH 4MJ6B 4DGIH 4MX7B 4OCLC 5KANI 2C5DC 3QA3B 3WHE0 2Z35B 4M6OL 4OF3A 4OZGA 4XP1L 3WSQH 4HUMB 3UPAA 1T0NB 3FCTA 5AZEL 4R4NC 2MCPH 5HDQL 1T1XB 1DCLA 4XPAH 3U30B 1BEYL 1ZT4B 2I60L 4J3TA 1R5IB 4LLYB 3BPLB 4PLKC 3MLVL 4JHAL 2HH0L 2VLKE 3TYFB 2ZUTA 1WZLA 1NDMB 4MLIA 3IFOB 5TGBB 1XZ0A 4QYOA 1CFTA 3K3QA 3H9SE 4G43B 2C4FU 2X5PA 4ORZC 4WW1A 1MHHB 2YRPA 3OR7A 1A8JH 2NPLX 1H3VA 4LAQH 3O8XA 5I75C 3MBXH 1IC7H 3RVUC 3SO3B 4AMKH 4UU9B 2DTMH 1YNLL 1CE1H 1MCPH 4Q9RL 3BT2L 3VRJA 4G3YH 3RX8A 4DEPC 5TE6L 2IPKA 3M8OL 2V6HA 2LABA 4E42B 3TT3H 4GXUM 4V1DB 2X89D 1EEYB 3SJVE 4LBEB 1UGNA 5GRYA 1LO5A 3D3VD 3HPJA 1S9VB 2L0DA 4HH8A 5D7JD 2IG2H 3LKNA 3DUUA 1AHWB 2GT9B 3QSKB 1UEYA 1EZVX 1AO7B 5GZND 2AJ3A 5CJOL 2IPTL 2N7AA 1KJ2H 2R4RH 3N1GC 1P6AB 1DBAH 3U7AA 1AXSA 4U6HA 4E41B 3PV6B 2OK0L 4MJIA 4BZ2L 3C9NB 1ORSB 1N59B 1KCGC 4PRPB 3B8SA 1FYHB 4WFFD 4UDTA 3EFDL 3VGEA 2VXSL 1S7RA 5DJ2B 2FIRT 1T6WA 3CU1A 2FECL 2PUQT 1DQJA 4DN3H 5MERA 2VJXA 4B53A 1KTLA 1YMME 1I9JL 3C5SA 5F1SA 4JY4B 3GHEL 2FLRT 4LKCA 3EYOB 3C5JA 1DQTA 5JOFA 2DM7A 3V0WL 1GPOH 1X5XA 3P30H 3MACL 1E28A 3GBNL 3GHBL 1QFUL 5ESVA 1JFMA 2WIMA 3OKDB 5TDOA 5H94A 1J0HA 4HGWA 5KW9H 1ZLVK 5DHYA 1U91B 3JWNC 3SDXB 3UPRA 2F5BL 2ZCLL 4R90L 2DL9A 2EDDA 1RZ8A 1K6QH 4MNGE 1A7BA 3UTTB 5HPMB 1J8HD 1EO7A 5IHLB 1CFSA 5CP7B 1FQ9C 2VL4A 5I30H 5KN5A 1IILE 1O0VA 1R3LA 4O51B 4QNPE 6FABL 3T0EC 1ZHNB 4DTGH 1TCMA 1UB6A 1U3JA 1XGQA 3DSNA 4XNQB 4N0UA 3QDJE 1HWHB 3V4UH 3ECBA 1KTDA 43C9B 3SGKA 4HBCH 3QG6A 4MWFB 1ZLWH 4XXDB 4PJXA 1FO0L 3CVHA 2J4WH 2L7UA 3O41A 4Y4KD 2XZCH 3HE6C 3BRFA 3D9AH 3RBSA 3BKCH 4OLYL 1FZOA 2F15A 3P4NA 5F21B 3S3SA 3F5WB 3HZKB 4PRHA 5IR1A 1M7IA 1WFOA 3BIAX 3DPBA 1I7UB 2Y06L 5AUMB 3IDIA 4EQ2A 2W9LA 2JE8A 4LOUD 1INDH 4YHMH 4OIIL 3OHXB 1KENL 4FXGB 1OY3B 5AG9A 4NNPL 1YEGH 3MV8E 4PJ9A 1CICC 5GGUA 1RK0A 3O2VH 3KLHD 1YNKL 1UM4H 3V6ZB 5I6XC 3FQNA 1UVQB 2ADJA 3ZSTA 4E0RB 3K8KA 4Y4HA 5BOZG 3NPSC 4K94H 3V5KA 4JCMA 2NY2D 3TH3T 5B38G 4HLJA 3F7VA 4W81A 4NT6B 2UVEA 3BP6B 3GSRA 3QEQB 2WP3T 4A6YB 2DQDL 1CR9L 1RVFH 2YPKA 4HF5L 5HSFA 1RAMA 1MJJB 1P5VA 3F7RA 5HGAB 1YZZA 3IDMB 4ZFOA 1NGPL 1UEMA 3CFCH 4JPKL 3ULUD 4WW2F 5JORB 5BQ7A 3MJ7A 3MV7B 2FDBP 4AEHH 4EBQL 1U0QA 4Z7VB 2R8SL 1M4KA 2X6MA 3Q6GH 4LVNB 4XP5L 4FQQA 1FFOB 25C8H 4GBXA 5D7LB 1UQSB 3HE7D 1YEHH 1WBXB 5IOPB 1JL8A 2CQVA 2XZQH 5DMGC 3SKUD 3TZVC 1DQLL 2HKFH 3U4BH 1FIEA 5KVMC 3SKOA 1I8LA 4LLDB 4U0RC 1T2QL 4P9HC 5DJAA 3GSWA 3QEGL 5IB5B 4JRXB 4RNRA 1GRWA 4KK9D 2ZJSH 3BH9B 3OB8A 5CINH 3VG0L 3JV0A 3QIBC 2B4CH 3OXSB 5E4EC 1EEZB 5E8PB 4LFHD 2VDQL 4OV6F 4XPBH 5DFVC 5ICYB 2Q6WA 2V5SA 3HRZB 4X6CE 5EN2B 4X8XA 3QNZB 1FRGH 4B7IA 2WUCH 4KVNH 1TZGL 3MMEA 1JHLL 3S3PA 2AXGB 4ZQKB 4P4RB 4JO2L 3PQYA 5L88H 1BD2D 4M1CC 3V8OA 1RZGA 5T1DH 3U7YL 1TJHL 2UWEE 3VD4A 4XNMB 1CE6B 1FYTD 1F3JA 3QUZC 4PRBB 1JPST 3ROOB 3IXTA 1U8LB 2JJUA 4D9RD 4G5ZL 3W11D 2WWMD 1FSKC 3HUJA 5I16A 2Z8VC 1H3UA 12E8H 2PR4L 5EIQA 4JR9H 5FYJE 1BFOA 3QCVH 5D1XD 5JW4Q 4OBRA 1I9IL 3V6BR 2IMNA 3KXFE 2FB4L 3GMQA 4QTHA 5DMKA 3PGDA 4FTVD 2AK4A 3RIAK 3BEVB 1PYWB 4YHIB 1U92B 3GMMB 3MRBA 2QHLA 2VDNH 1P2CA 4P23B 3GSNB 4CVZA 1MCCA 5HDBF 5D7IE 3QFJD 5F7NC 3ZDXE 2A6KB 5I8KH 4D8PB 5T33L 4BYHA 2BNRD 2D31A 2NY7H 4H5SB 3DYMA 4NRZA 5BW7A 1HK6A 5L8JB 4PJDF 3O45B 3MRPA 4OD1L 2QR0A 4YLQT 4FFZL 2DQUH 5C08B 5HHPA 1P69B 4KZDL 1IGCL 2F9BT 3PL6A 2VE6A 4PJ8A 2X4NB 1NJ9A 4LPCA 1G9ML 2Q86B 4DOHE 3AMLA 3C60B 1X5HA 2D7QA 4LMQE 1G84A 3HB3D 1SY6L 4MAUH 1CI5A 4HWBL 1SEQL 1WCBA 1BEYH 3D18B 2PYED 3UYPA 2EDLA 4NQEE 4LIQL 3OGOE 2K3TA 1FL3B 4P2RB 5F3BB 1K4CB 1OAXL 4OM1H 2CH8A 4KI5D 4UB0L 4UIKL 3O9WD 4NZTL 3CPLA 1OAUL 3UZEA 1MY7A 5FB8A 3EYVA 1ZLSL 2NXYD 4RISH 3WYRA 4UTAL 4NPYA 1NKOA 3K1DA 4GT7A 3BWUC 2JLLA 3BX7C 2B8OT 4AL8H 5DJYA 2F53A 1CFBA 1RSFA 4FXKB 4DZBA 5C0AE 2W9EL 3VFOA 4Q9RH 1ORQA 2DOCA 4UOJA 2EH7L 4U1MA 3LQAL 3PWNB 3WNLA 4C58B 2VXTH 1BD2B 1BVKA 1NBYB 2A1WH 5JA9A 5E9DD 2A9NL 3S96A 1NANH 1NGZA 5GZOD 2F74A 3ARXA 3MJ9A 5HVHC 2X4RB 2QLVB 4WUKH 1DUZA 1U95A 2DMCA 4ALAL 3EOAA 5HHVH 2IPTH 4C57C 1VDGA 1QYGH 1DE4A 5F3HB 3UO1H 5HHNB 3TA3B 4DVBA 5JO5B 4RX4D 3TV3H 5ILTL 3K1KC 1V05A 5T3ZL 2AP2A 2H41A 4HW6A 4WUUE 4XVTL 5CSGA 1TZHB 3PDGA 2COQA 4XNXH 1BREA 2C1PA 2X09A 3PXHA 4NYLB 4NJAL 4D0CA 4HPYL 4OM0L 1NBVH 4WV1C 4U4BA 5GGRA 2VLRD 1TJGL 3GHEH 3VDBA 5C8JA 1KV3A 1AGCA 3DLQR 3FJTA 2E9JA 3R8QA 3MACH 3KYNA 3OXRB 1CDYA 2JB5L 4UILL 4ZPVA 4PJDA 2CO7B 5ACLA 2NY4D 3W9DA 5FUOH 1EFQA 5IIEA 1XIWA 4HV8A 2VXVH 2IH1B 4XMLL 3C6SB 5BJTB 2V2WB 4J8RA 5FUCC 2DQCL 3RX5A 2Z4QA 4LSRH 4G59A 1D6EA 4LGSB 5JNYA 1U6AL 4OCRL 4NZDA 1WWBX 1AC0A 3MBEB 1BWMA 3O9WB 1A21A 3CSYA 1RMFL 4AK1A 2NXYB 3L5XL 1AGBB 2YPVL 1GZPA 1T1WA 1F58H 4MLSA 6FABH 1NCAH 3IGAA 4KROD 3G6DH 5B39A 1E4JA 3T2NL 1U93B 3F8UB 4YBQC 4CRPA 2ICWJ 1IEAB 4U1NB 1IZKA 5IW6A 4H25A 3SCMB 3QIUB 2XWTB 3DI3B 4EI5B 2JB6A 4DKFL 3P4MA 1FGVH 2VDML 5HBBA 1B4JH 1I1AA 2OL3A 1Q9WA 1W0WB 3LH2H 4X5WA 2Q7YA 3RBGA 5E9DB 1BFVL 2WP3O 1JPTL 1ROWA 2UZIH 4OZGB 1UM5H 3N1MC 4KJQC 3QP3A 3FCTB 3SY0A 4LCCC 3QCTL 4JJ5A 4KDVA 5I8CA 2G5RA 4PG9A 3WN5C 4MVBC 2V5RA 1ZEAH 4F8TA 5BXFA 1YQ2A 1XZ0B 4L4TD 4NNPH 4WW1B 5HVGB 1P7QA 3L95A 5ENWA 4G8GE 1RUQL 4JFED 2PW2A 3BD5A 3OR7B 4U1GC 5JDSA 4U1IA 3WXVL 3TJEL 1MQKL 1U8JA 3O8XB 2VRAA 2OR7A 4F80A 5F88A 3PWVA 4HHAA 4UUJB 3MA9L 4Q2ZB 1S9WA 3Q5YA 1QKZH 4X99A 4B7LA 4OCSL 4YHNA 3VRJB 4WU5A 1E6OH 2UUDK 4K7FA 2IPKB 3MLRL 1HQ4A 4XCNA 2DQDH 4HF5H 1X5GA 2WSKA 3DECA 3HPJB 4MMZC 4PJ5E 5ADOH 2Y6SD 3BYTA 1NGPH 3DUUB 4WCYH 3MLWL 3ROLB 3ISWA 3OB0K 2FX7H 1KYOJ 2P5ED 2AJ3B 3QBTB 5GGSA 3HS0B 4KRMB 1EV2E 4K9EH 4CN1A 4EKXA 4U6HB 5D96B 2DQGH 4F57L 4R96A 5EDXA 3TC9A 1A3RL 4HJGA 2JJVA 1Q1JH 2BVPA 4NUGH 4UDTB 1DQLH 5F1IA 1YEIL 4XC3H 1CGXA 5CMAA 1S7RB 2MMXA 1A14L 1X5KA 4K2UH 3QEGH 1LP9E 5MERB 3MR9A 4RMQA 3ARBA 4NCDA 3C5SB 1QLFA 2HJKA 1HWGB 1QNZH 1F8TL 4LKCB 4MD5A 5F7MC 5BRZA 5JOFB 4WWKA 5I15L 4M00A 1NFDF 1E28B 1V7NH 4GUPA 2NW3A 5D1QA 5ESVB 1CWVA 5LWYL 4X7CC 1YMHA 3S9DB 1NAML 1REIA 3I3DA 1NEZB 2I25N 1PG7L 2Q3ZA 4QRSA 5H94B 1CBVL 1J05A 2ID5A 3MRLA 1A6UL 3UPRB 4JO2H 3QG7L 2FNBA 1JGLL 3U46A 5HHOD 4G7YH 1G0DA 1RZ8B 4GXUN 5IM7A 3S36L 1WBYA 2M1KA 1N6UA 1XAUA 5CZVL 4PJ7A 1CFSB 2DLFL 5AYQA 1RK1A 2J8UE 1NC2D 5KN5B 3ARPA 2CUHA 3BE1L 2JJSA 3TLRA 4LEXH 5CJBA 4KMTL 5HJ3A 4S0SD 1MHEA 1UB6B 1XGQB 3HNVH 1S7TA 4OCWL 2FJGA 1ZLVH 5HYQB 5LCVH 4YH6A 4XTRD 4Q6IC 5JXEC 4MNHA 3ECBB 1KTDB 2XZAL 1NAKL 1U42A 3QG6B 2R0WL 3MRDB 4P2QE 3T0WA 4PJXB 3CVHB 5LQBL 5T33H 3VFNB 4S10A 4JLRA 1FZOB 4MHHI 3P4NB 1NSNL 4ZYKA 2EDEA 3GRWA 4C59B 5T5FH 2CRMA 5E8DH 4U1SA 4BK4A 1WITA 4UBDC 4PRHB 2MQ3A 5IR1B 1M7IB 2H32H 1L8JA 3IDXH 1J1PL 4MJIE 1NMAL 5E6IC 2P5EB 3IU4H 5EOTA 3IDIB 3VDAA 4TNWK 4U1LA 3GB7B 2VC2L 4MA7L 5KSUB 1SY6H 3B5GA 2XTJD 4ZAKC 1IAII 1A7PH 2AGJL 1FNSL 3UTOA 1U8NB 3BMVA 5FYKU 4UT6H 5F70A 4XAKE 4PJ9B 1RK0B 4K7PY 3ZLQC 4UB0H 4YZFF 1Q0XH 3QRFM 3JBG7 1Z9MA 3FQNB 2M26A 5HYIA 1B6UA 2ADJB 5KTEH 4PBVC 5I1HH 3T3MF 1FVCA 4RAHA 3QH3A 2GW5A 4OFVA 3GSOA 2HFEB 5F7DA 4KHTH 2GJ6D 5GQBA 4OIAA 2YPKB 4P2OC 4WI5A 1JGVH 4F7EA 3SDCC 1TDQA 4YC2C 1MRDH 1ERNA 2NY6B 4OZIA 1LO3L 4ZFOB 4G8IA 5BQ7B 3G5YB 4HUNB 4FQQB 5FYJL 1WC7A 5SX5K 1VFUA 2N1KA 1S7VA 2WBKA 3ILPA 1F4WH 1LE5A 3ZKSD 1KB5A 4XCCH 1MCWW 5E00A 3ZT5A 3FFCD 4KJWD 2R1XA 4XWOD 4XT1C 4D2NA 1YDPB 2XWJA 1MELA 3SKOB 5HHQA 2BVOA 1RIUL 2F54B 1HXYB 1UZ6F 5DJAB 3GSWB 3LKRA 3SKMA 3T1WA 1FDLH 1CU4H 1EXUB 4LLQA 4K7PL 4LGRB 4RNRB 5HVWA 2J88L 4OF6A 5KAQF 5J9PA 3RTQD 2ARWA 2E7BA 2ZUSA 4XVTH 5FYJU 4KXZH 4JRYA 3ZZ1A 4POZD 2P44B 3ULUF 4DGYH 4YBHA 1CICA 4F33B 5E7BA 2Q6WB 1VGKA 5BVJA 3PGCA 4ZPTA 1H8SA 2DWEA 1T4KA 4XWGL 1U8QB 3BUTA 2V5MA 3MMEB 2VZ1A 5C0RH 4NHCL 2OZ4A 2IPUG 3IU3A 1OGAA 5GS0L 3PQYB 1U8MA 5ALBL 3WUWG 3VXUD 4PGJA 4KKCD 4UILH 1J8HA 1F3JB 5EWIH 3WFBL 1QR1B 5KJRL 5GS1C 2AEWA 5ACMA 1JF1B 3MROA 3HUJB 5I16B 4LVEA 2X1OA 5BMFL 1KCUH 1BFOB 3W39B 3VGBA 4R4FH 4GQ9L 2R29H 3GMQB 1CXHA 5DMKB 3PGDB 4XAWL 4EN3D 2YD2A 3NFPB 4PFEA 2JIXD 2BOCB 3MRGA 4MNQA 3KDMA 5J11C 2Z93A 1P2CB 5CS7A 1DVFA 4Y2DD 3BZFA 2ATKA 1AFVH 4N0CC 4TULH 3RNKB 3NAAH 1A9EB 1H3XA 3FO1B 4NKQB 4LCUA 4M9PA 2A73A 4EVNA 2D31B 4NRZB 1A7OL 1FNGA 3MRPB 4YXHL 2QR0B 4DKFH 4TQEL 5HHPB 4I77L 1SM3L 5E56A 3LN4A 4UT9L 3BDXA 3QIBA 1YC8A 3PL6B 4PJ8B 4DZ8A 1NJ9B 3OJMB 5D6DA 4K3GA 4XCYA 3CDGA 4KKBD 1IC5L 1JPTH 4NO5A 4FXLA 1ZANH 4O2CA 3TBWB 4PLNC 4AY0A 4K07A 1ED3A 3AC0A 1Q9KA 43CAA 5F9WC 4HG4K 1L4IA 4XPHL 2VLLA 1U8HA 1DL7H 1YN7A 1N5YL 3DIFB 2OYPA 2ILLA 5DVMA 1RHFA 1C7SA 3QUML 3SKJH 4C83B 2EIDA 1FV1A 2GTWA 5FB8B 2VXUL 1CDGA 4G6AC 1H5BA 2ED7A 4NPYB 2BNQD 4YK4B 1HHHB 3O4OC 4OI9A 3PJSA 3U83A 5F1KC 5BV7C 1GXEA 4RDQF 5DJYB 3GO1H 3KPPA 3QXDA 4Y88A 2BHYA 4L29A 4DZBB 3LQZA 3VFOB 3PHOA 1ORQB 2XXMB 2F58L 2P8MA 3LIZL 4U1MB 4PGEB 1BF8A 2YD5A 2EYTA 3S96B 1NGZB 4X9FA 4KI5F 2F74B 3U0WH 2VDOL 3RWJA 3IFLH 2HN7A 1MWAA 5C6TL 1DUZB 5E8OB 5DQ9A 3LS5H 3EOAB 4PJCA 3MV11 2FWOA 1IM9A 3CH1A 1DE4B 4PS4L 5DRNA 3MXWL 2D03L 4F57H 5DRXA 2UZXB 4XPFH 4OLEA 3RVWC 4C56D 4DVBB 3I84A 2XN9E 4I18A 5KVGH 1MI5A 2CXGA 4PY8J 4S1SL 2WLYA 2VUOA 5IQ7H 1A14H 5CSBA 4MS8D 5KS9E 4FFYH 1HIML 3ZHLA 3NIGF 1IGTA 4D0CB 4OKVA 2E7HA 5GGRB 3CC5A 3BQUA 4NZUL 3FT2A 4HIJA 4JY5L 3AUVA 1R3IL 2YXMA 1WT5C 4AEFA 4KK6D 5IEKB 1QBAA 1DEDA 3BN9C 3EOBA 5DRZB 4AIXA 2OR8A 3KPRA 3ULVH 4KAQL 5ITFA 1PG7H 1YQVH 5IIEB 3X13B 1XIWB 5DURD 1A6UH 2PXYD 4HV8B 3FAWA 1ZLUK 2APTA 2Z31A 3EO0A 4FNLL 5F44A 5IUSA 3RPIB 4J8RB 1HOCA 1UJ3C 2EC9T 1YECH 4M1DL 2Z4QB 4MQSB 1D6EB 1S7UA 4OF5A 1FE8H 3R8BB 1R3HB 1E4XI 2VN4A 5ANME 3VXRD 1CQKA 2HJFA 2BFVL 1UADC 4DFHA 3CSYB 2AK1L 4R4ND 3RDTA 3MUGA 1K3ZA 3IDUA 2F53E 4HMDA 2KH2B 1KC5L 1GZPB 4H0HB 1A4JB 3X11A 5DJ8B 3BD4A 3I6GA 1HKFA 4WU7A 4GG8A 1LK2B 4NKDA 3VFTB 3FO2B 2QADD 4H25B 4LLMA 1T2JA 1A9BB 1MEXL 1RUML 1KCVH 2CKBA 1E0OB 2JB6B 1VHPA 3UJJH 4X7SH 1I1AB 1MRFL 2OL3B 4N0YL 4ELKB 4ACPA 4X5WB 3RI5F 2APVA 3NACL 4D0DA 1PY9A 3RVUD 2RFXA 4I3GA 4O02L 3KAAA 2DICA 3LRHA 4LLUA 3E3QC 1AGFA 2FRGP 3SY0B 4G7VH 5FUZL 1X5AA 4JJ5B 1NMAH 5I8CB 2D7OA 3B9KB 2IAND 2ARJA 3SDDC 3RWIA 3QDGE 1N7MH 5CSZB 5DQDL 4EXPX 4YFLF 5C70A 3C2AL 2AGJH 4XXCA 3VGAB 3NCJL 3E6FA 4JG0H 2I9LA 1P7QB 3L95B 4WI6A 2FD6H 5ENWB 5IMMA 2PW2B 1LWRA 5JDSB 4U1IB 1URLA 2NZ9C 5HDBE 1U8JB 5SX4I 1T7YA 1WK0A 3GIVA 3PWVB 4HHAB 4APQC 1UB5A 3ARGC 4YHKH 1S9WB 3WFEL 1EJOH 3NVQA 4PJDE 3V7AG 4X99B 3D6GA 4OT1L 3CUPA 5L6YH 1HQ4B 1B6DA 4LRNH 4XCNB 5JR1H 1FAIH 3CU7A 3H0TA 5IW1A 5TQ2L 1UYWH 5F93C 2FH8A 1AQKL 3T0AA 5CIPA 3OKNA 3QJHA 4X6DB 1LQVA 4LASH 5JPMB 5GGSB 5TF1L 2X1XR 5E6ZA 3IDYC 2LTQC 4HJGB 2AABL 4F7TA 1MRCL 1NLBL 3B3IB 5IFAL 3N85H 2BVPB 4S1DD 5F1IB 5DVNA 5LGJA 1OP3K 5GJTH 3K8LA 3VWJA 4RGNE 5EO0A 4QY8B 4UT7H 1BBJA 4RFNC 4TUKH 3MZTA 3FOLA 3ARBB 2XXCB 1S3KL 5I66A 4GSDH 1QLFB 3OB0H 2HJKB 3Q48A 4MD5B 2FZ3B 1S8DA 1QZ1A 5KZCD 1DANT 3T0ED 4GUPB 2NW3B 2KDGA 4G9DA 3K8MA 3WFHA 5IMKA 3BDYH 2EC8A 5DT1L 5I75B 4OFKA 4PRIA 1OM3H 4QRSB 4X9BA 3LEYL 5A3IC 1F5WA 3OAUL 3MRLB 1UCBH 4LSSH 4J3UA 2FH6A 3FHQA 5ALBH 3U46B 1JHTA 3HE6D 4M43H 4AENA 4DEPB 4X9IA 5IM7B 5IFHL 4QTIL 2GUOA 2ZG2A 5EA0L 1ZHBA 3VXMA 3GMRA 4PJ7B 4KUCD 1PEZA 1J1OH 1RK1B 1FFQA 4OLWL 4LDEB 3MLTA 5D2LF 4W6WB 1CQYA 5IGXH 5KVFH 1KIQA 1JN6A 3D39E 2IPUK 4JPWL 5HJ3B 1ZT1A 3MRHA 1S7TB 4L3CA 1FFRA 4XAWH 3RUGB 2HRPL 3WIIH 5I76A 4CL7A 1TTUA 1JHKL 1Z5LA 4L8DA 1XR9A 1U3HA 3TPUA 1U8IB 4JLRB 4GAYB 1KLGA 3LKQA 3V52L 4IS6B 4ZYKB 3U79A 5E2JA 4U1SB 3OJVC 2NX5A 1DFBL 3MJ6A 4DVRL 1L9NA 1MPAH 5EU4A 1F4YL 4Y19E 2AJYH 3OWEA 5EOTB 4TTDC 2PTUA 3RZCA 1AXTH 5E03A 4U1LB 4QRRD 2GHWB 5C0JA 2K9UA 1HH6B 1EHAA 3EOTL 4HZLA 4XPHH 4BK5A 4HUXA 1KB9K 4K3JL 3K4AA 3RWDA 3MUZ1 1FZJA 2ORBH 1GZQA 2NR6C 3KPSD 4XRCB 2BSSA 2YKLL 3SOBL 5C07D 5IG7A 5BRZE 3OBAA 5HY9A 1CVSC 1FL5A 3V0VA 3ME0A 2R0KH 3NGBC 4Z7UA 1TQCB 1FVCB 4LPVA 3QH3B 4PRAA 5DMGD 3RWEB 3TZVD 5KVDH 3BI9X 2VH5H 3GSOB 5F7DB 1HSBA 3P2TA 3VFUA 4F7EB 4ODXA 1JI2A 4YXKL 1D5XA 3VI3F 4G8IB 1PG7X 4HKJA 5INDA 2DKUA 1YEFL 4JM4L 4R0LC 1KIPB 1VPOH 2PTTA 5GS3A 1MLBA 4JO3L 2W1NA 2VDOH 3P9MA 3QO1B 2G60L 4WO4C 3PP3K 1W2KT 1S7VB 3ILPB 3S36X 1LE5B 1KB5B 1ITCA 5C3TA 4DUXA 5DYOA 3UTSD 2XWJB 1JGDA 2EYSA 2D03H 4NP4H 2EEAA 3B83A 1ACYL 5ACZB 3LKRB 3SKMB 3CX2A 4FOMA 3CNKA 4OF0A 4GRLC 3QDMD 4JG1L 1J0IA 5DK2A 4S1SH 5J9PB 4H20H 4XP9L 4JRYB 1CD1A 2GY7B 3TN0D 5J1AA 1CICB 5SX5H 3UCRA 3MC0A 4ZUVA 1WF5A 5DUML 3UBXA 5BVJB 3PABA 3QRGH 3PGCB 5ISZD 1DZBA 4F15B 4NZUH 2DWEB 1T4KB 1IC4H 1XF3A 4J4PA 1R3IH 1J1XL 2X4TA 5HHOA 3WHE1 4JHWL 3NPSB 3IU3B 1OGAB 4LSQL 1U8MB 4IRJC 2UVFA 4G9FD 5I19L 3HC4H 4LHJB 3UYOD 5F6HI 3OGCB 4QRRB 3X12A 2BOBA 1NC2A 5IFJA 4DW2L 2FEEI 3HI6L 5D70H 3MROB 3BKYL 4NKMA 2O5ZL 3QEUA 1QRNA 3L3JA 3R0NA 5IKCA 4GW5A 4P46D 3BPOC 4JN1H 4XNZC 4HIHA 3Q2CA 2BVTA 4MNQB 3KDMB 1BFTA 2Z93B 4BQBA 3D3VE 1KC5H 1DVFB 3BZFB 2ATKB 2B2XL 4NWTL 2VO5A 1DBBL 5DMYA 3WLWC 2NQCA 4BELD 3SE3C 1NFDE 1TZIA 1QVOB 1WIOA 1JZ7A 2A73B 4EVNB 2VLJD 4FFVD 1T22A 1C16A 1FNGB 5KSVA 2GSIA 4X80L 4NCC1 4XNYL 1T03L 1MRFH 1J0KA 1CF8H 1JYNA 3QIBB 5SWQB 4DZ8B 4WFFE 3EYSH 2XPGB 4L4VD 1KFAH 4I3SH 4R8WL 4XCYB 4AQ1B 3CDGB 4O02H 4NO5B 5CEZH 4UI2A 4O2CB 1MCHA 1G6RH 2NZIA 1ED3B 3RGVA 1Q9KB 2APBA 43CAB 4R97C 2VLLB 1U8HB 1B0RA 5JQ6H 5KAQG 5L2JA 5HHMD 4K3EH 4LLAA 4I2XA 5DD0L 3CLEL 5MP6L 5JOEA 1KJ2A 3L3IA 3QUZB 2IJ0C 4HWZA 1FV1B 2GTWB 4WGWB 3PDDA 4HJ0D 2OTUB 4K7PX 4L9LC 2CGRH 5MENA 2R56L 3PJSB 4P9MH 4M62H 1UT9A 2P8LA 4L29B 5ISZB 2HVKA 4D9LL 3PHOB 3ETBF 4OIBA 2P8MB 1J8HE 4C55A 4LSTH 1BGXL 3GK8L 3EDFA 4P99A 2E7LC 3SHSA 2JCCB 2FX9H 1G9MC 5LGHL 3NH7L 2EYTB 5JHDD 4G9FB 5JW5A 4LFHG 3RWJB 1AQKH 1OSPL 3LQMA 1HZHL 3KYOB 3ALXA 2CUIA 3RQ3A 1ZWIA 5ID0B 3B43A 4PJCB 1HHIB 1IM9B 2VDLL 3CZFA 1MFCL 5JA8B 4Y5YC 5DRNB 5IV2A 5DRXB 1NLBH 2NNAA 2CK0H 3RTQA 1LO0H 4OFYD 4P49A 1MI5B 4PJIA 5E2TH 3T3ME 1A47A 1A1NA 1LHZA 5A2LH 1CS6A 2HKHL 3ORJA 1CDCA 4FZ8H 4OUOA 3UZVB 3F65A 1PAMA 4YDKH 3U1SH 3MLPA 4M61A 3SGJA 5IVXF 4OKVB 1J0ZA 3ZO0A 4U0QB 5CCKL 5EORH 4YE4H 1BQHA 4HS8H 4JN2A 1WQVT 3CC5B 3BQUB 3DSFH 4HIJB 5DTFA 4NUJA 4HUVA 2WMPA 3VXUA 4CJ1A 3HI5H 4JFHE 3LQAC 1XGUA 5JPNA 4OCYL 5C2BL 3EOBB 1UJTA 4JFDD 2W0PA 2KL6A 4Z95H 2AJVL 3KPRB 2NY3B 1KJ3L 1EAJA 1AR1C 2V7NB 3V5HA 5DZOA 5B22A 3EO0B 5HXMA 5F96H 3ZKNC 4PJHF 4DN4L 1S7UB 1H3PL 3MO1A 4S2SA 1UZ6E 3L7EA 4M3JA 2HJFB 1OTUD 4RDQG 5IROC 1UKTA 4KJQD 4L4JA 5TDPA 1UXSB 3RDTB 3QUKA 1A0QH 5JHLL 2OI9C 3RNQA 1FLRL 2EIZB 3P0VH 4D0BA 1KIRB 1FC2D 1AKJB 3H9YA 1MFBH 3ULUE 1VFAB 1XCQA 3X11B 4GMSH 5MEPA 3I6GB 5IWLA 4WU7B 2HRPH 2KUTA 4GG8B 4YHLH 1BZQK 1ZLUH 4NKDB 2GYSA 1O5DT 1P1ZA 4LLMB 4Q74A 3W2DH 2CKBB 2PO6C 1I8KA 5FECA 1M6OA 5EC1A 4HUUA 4NBXB 5DC9B 3RU8H 3MZGB 4D0DB 5GRVK 5D72L 1YEEH 3W0WB 3VE0B 2Y25A 4LLUB 4LHUA 2Y36H 3UC0L 4CUCA 1A5FH 3K0WA 5CJQH 1TQBC 1Z9LA 4HCRH 5D1ZC 2ARJB 3O3DA 1OAKH 5GHWL 2DQEL 1EHLL 4UV4H 4L3AA 1X5ZA 3ZT6A 4TSCL 3L5IA 3EOTH 3E6FB 3QNXB 2I9LB 2BNQA 5IMMB 3MCLL 4JM2D 4LRIA 3ARDC 3QWQB 5I1IL 2QSCH 1FG2A 3SOBH 1CL7L 1VEPA 2DI7A 4XMKH 1XF1A 3CSGA 1E4KA 4H8WH 1SMOA 1HYSC 2HFGL 1BIIB 3GIVB 1DN0A 4ORGA 5E1AA 1UXWA 1FYTE 2O26U 1RJZA 2YN5A 2BRQA 2W60A 4QO1A 3CUPB 2G5BA 4D9RE 2EDXA 4MMXC 3O6FD 4I0PC 1WISA 4GG6F 1MJ7H 2J6EL 5IW1B 1I3VA 1P7KA 2D0HA 3S34H 2ZNWA 5CIPB 5GSVA 3OKNB 1OQXA 3ESVF 1BX2A 4FTVE 3CLFL 4YDVA 3VD7A 3IKKA 5BCAA 1YEFH 4JM4H 1ZMYA 1YJDC 1WZMA 5IP4A 1Q9OA 2VQTA 1ONQA 1NC4D 3QFJE 4ZD3L 4M02A 4AH2A 4F7TB 3MRJA 5JIHA 3RZWA 3L3KA 2BNRE 4FQ1L 4QHMA 3VA2C 3X17A 4ZFFA 4F7CA 1KNOB 1NGWA 3ULVD 1VFBA 1HH9B 4XVSL 2KKQA 2NY0C 5EZOH 3VWJB 1ACYH 3WN5B 5EO0B 1BBJB 1OTSC 4ODHH 3FOLB 4JVUA 1WFTA 5I66B 1BMGA 5I8OL 1S7XB 1RD6A 1CT8B 2H45A 1TXKA 2CDGA 1HDMB 1S8DB 3OKOA 4O9HL 1FBIH 3PV7A 4G9DB 4BFIA 4HKXA 3A6BL 3WFHB 2PYEE 5IMKB 5JW4R 1CFVH 3GMPA 1LEIA 3MLZH 4GS7C 4KI5E 2DYPA 5JXED 1J12A 4NQVA 2OCFD 1OP3H 3OJ2C 1RUPL 5TFSL 5D5MF 1JHTB 4TPRL 3OZ9L 5I2IB 5I19H 1PLGL 1ADQH 3VXRA 5FA3A 2GUOB 3OKYA 4JQIH 4NCC2 5DEGB 1ZHBB 3VXMB 1LO4L 3UMTA 3GMRB 1CLOH 4WJ5A 1NEZG 3P4OA 1ZA6A 3MLTB 4LCIH 2ESVA 5E6ID 4HBQA 3K2UL 3MLYL 2P24A 1MFEL 1ZT1B 3MRHB 1U3YA 2O5XH 4L3CB 3NIGE 4GLRH 3T0BA 1AHWC 3JWOH 5E9DE 4ZAKD 3H3BC 3ZL4H 4F2MA 5FHBL 1T1ZB 3MJ8A 1WBZA 1BQLL 4L8DB 2FO4B 5KSAA 1DBBH 4QHUA 5TPWL 4S1RL 4H88H 2R2EA 1U3HB 3JUZA 3OKLB 4YDJA 3TPUB 4X9HA 3L9RA 1KLGB 2ZUQC 3LZFH 4IBLT 4OQTL 3QQ3A 4X80H 5L2KA 3QQ4A 2NX5B 4HKBA 4XNYH 4KUZL 3BPCA 4KUCF 1T03H 3LVEA 1BECA 3KLAA 3IDNA 3LD8C 3EHBC 1MIEL 3N9GL 2HTLC 3RWCA 4R8WH 4Y16A 3KPMA 3RZCB 3SDCD 2YEZA 3VXSD 5C0JB 4O5LL 3HFMH 3M1BA 4CN4A 5DC0A 4NRXA 3QT2A 4DJMA 2BDNL 1FL6A 1NLDH 4HZLB 4YQXL 2FATL 3I75A 4XPGH 4HUXB 4IHOB 5TE7L 2VLRE 3TBSA 2XNAA 3MQIA 3RWDB 4XGZA 3INUL 1K4DA 5DD0H 1FZJB 2D0GA 2BSSB 3MRQA 5MP6H 5DMIL 4FQ2L 5IG7B 1OOAA 1HKLH 1Z0NA 3B2VH 3V0VB 5D6CA 4N9GA 4L3ED 1F97A 4Z7UB 3QULB 4LPXA 4PRAB 5KVEH 4AIOA 4HMCA 4PRIE 2X4UA 1HSBB 1S7SA 5DZLA 4U6VL 4JZJC 3VFUB 4ODXB 4U6XB 4M5ZH 4XMPL 5DGRA 1FC1A 3D85D 1SJHA 2HP4A 3V5DA 2MFNA 2AJXL 4X6FB 5DJZA 5TDNA 5FGSA 1P4BL 1BGXH 3DV4A 1JJUA 3FB8A 4ZSOA 3UJTL 4HKJB 5INDB 1X4XA 1MHCA 2APFA 3MOBH 1D5BA 2R2HB 3DARA 1EPFA 4N68A 1MLBB 2MHAA 1G9NL 4WEBL 3V6OC 4PB0L 4H1LH 5EH1A 5EULV 3F58H 4QRQA 5F97E 4YWGH 1IJ9A 5DYOB 3WMSA 2CRIA 2P5WA 1QFOA 1JGDB 1F3DH 2EYSB 3V95A 3VWKA 5E2WL 1F6AB 3QI9C 3TM6A 5DK2B 5DQJB 2KZWA 1CD1B 2A74A 5LG1A 3P0YH 4JPVH 2DDQL 3D1MC 1FPTH 4ZUVB 5CCKH 3PP3H 3UBXB 1O7VA 1RIVL 5CHNB 2YK1L 1XF3B 4FP8H 3V79C 1G7IA 2X4TB 4M7LL 4FZEL 5ESAA 5T1LD 2ZSWB 3QFDA 3C5ZA 4XBGB 4L4TE 1UWXK 2IAMC 4N0CD 2BNUA 5DHVH 1FO0A 4JFEE 3ALPA 4IRSA 3DXAD 3O2DL 4P2OB 4RA0C 2BOBB 4YC2B 3EYUL 4Y4FA 2OJZH 1S9XB 2BXZA 3TNNA 3L3OA 3HPLB 1ZHKA 1NQBA 3S88L 4NKMB 1RPQA 3QEUB 1QRNB 3NTCL 5FXCH 5ID1B 3HZMA 4DN4H 3ULSA 3L3JB 4WENB 4GW5B 3JV4A 3CSPA 3LKSA 3O3EB 4ZOAA 3P0GB 2Q7NA 1EGJH 1IGIH 3CFJA 4RMRA 4HIHB 5K9JH 1NUGA 2H9GB 2ICES 5KG9B 4L8CA 3T4AB 1A7NL 4RMWA 1FLRH 1WLHA 2Q8AL 3HNSH 5HDLA 4LVNC 3SE8H 3WXWL 5E2VL 3TCXA 2CJUL 1RZ7L 2P5EE 2WW8A 1D9KA 1MREH 1V7MH 3CXHJ 1IQWL 1C16B 2QSVA 4ZNCD 4LDOB 2GSIB 3LEVL 4ZUSB 3RKPA 4PG2C 4NWUL 4G6AD 4BA8A 1QBMH 4HPOL 1A7RL 1IBGL 4NQTA 2F19H 2GY5A 4N8CL 4PUBL 3UC0H 3HG1D 1N0XL 1A7QL 4KTEH 4WTZG 4AM0B 4JQXC 3RL2A 5L2JB 4F3FA 3KPSA 1JYVA 2XQBH 4CMHB 1OHQA 1JNNL 5GHWH 1EHLH 4I2XB 5EOCL 3RIFK 5D2LE 5C07A 5E08H 4L9DA 1RZFL 2X4SB 4PJFB 4RGMB 1KJ2B 1TETH 3L3IB 1NCBL 4KKNA 4HWZB 4Y5XA 2DLTA 1LNUA 5F1NA 3T77A 2GJJA 3EKCA 2QQLL 2XY2A 4Y1AD 2EO9A 3MGAA 3ZSSA 4J1UA 5MENB 3LMJL 5HHOE 2ZUYA 4IOSD 5DUPH 3RVWD 5L8KB 4J6RL 2IQ9L 2ZKHH 4O2FA 5BVPH 4XZUA 3FN0L 3JUYA 4HGKC 5J89A 2HA1A 4ZOBA 5J12B 2UYLA 4ELMA 2WAHA 4OGXL 4PJGA 5HHXH 5JW5B 5J3HC 3IDGA 3EJYC 2WWKT 1OAQH 4ZG1A 1ZWIB 2YPLA 3QWRA 1PKQA 2C3XA 5C09A 5J4MA 3BN9D 2C9AA 3MUHL 4P59L 5E7FA 3KWWA 5IV2B 3VMOA 3BZDA 1P9MA 2DQHL 4ZD3H 1IRAY 3ZKXC 4GQPH 3VGDA 3ULUL 3O2WH 2AAVA 1HNGA 2NNAB 3ZKMD 3SE9H 4JKKA 4PJIB 3VFPB 5F6IB 4BQ6A 3TN0A 3C60C 3BGMA 2MSPA 2JK5A 4IOFC 5DVOA 2Q3AA 3GGWA 3SDAC 4Z7WB 32C2B 4QF1A 1DUYA 3GSUB 1BQHB 4MD0B 4KC3B 5DTFB 2EYRA 3T3PF 4D3CH 1AE6H 3FOMA 2XTJE 3ARTA 4JQVC 4O58L 1A02N 4YX2L 3MLSL 3VI3E 1XGUB 5JPNB 1WWWX 2XY1A 3O4OB 4YGVA 2Z8RA 5ESQB 5BV7B 4M1GL 3VFGH 2X4PB 1MCOL 1RUKH 4PJBA 2GKIA 2H26A 3IF1B 3CH8A 3KG5A 2IFFL 1GVIA 2X70A 4NKIL 4P46A 4TPRH 2JF1A 5IB1A 2H32A 1ZGLP 3MO1B 4GAJL 2J8HA 2VXQH 2GJ6E 4PJAA 4TYUA 3PG2A 4ODSL 4PR5B 1SY6A 3RNQB 4D94A 4GKSB 4P4KC 4PB9L 5CEZD 4D0BB 3SDDD 3J7HA 1N5AA 5GGVY 1GIGL 2FGWL 5JW3L 3AREC 4YDIL 1XCQB 4YUEL 2NXZC 5MEPB 4XP4L 1FCCA 4UAOB 3BP7B 4EIGB 3JWDH 1GGCH 4AYFA 1A6VL 1I8KB 3TEUA 4V2CB 3WNNA 4ODUA 5TPWH 5FECB 5HI5C 1M6OB 5EC1B 4HIXH 3FFCE 2NZ9D 5EBWA 2GFBA 1R5VB 4HUWA 5IESL 3TA3C 2DAVA 4OQTH 4APQD 3ARGD 1B3JA 4KUZH 4LHUB 8CGTA 1VB9A 4UV7L 1E4XH 1PBYA 2OMBA 3RIAF 3O3DB 2A0LC 3QXAA 4GRWB 4KMQA 5C3LD 1GHFL 3O0RH 5C0CA 1IE5A 3FQXB 2JKXA 1RIHL 3GBLA 4NO0B 1DBJH 4NHUB 5FM5M 4H26B 3PWUB 5I8EA 5B8CA 3BP5A 4YQXH 3HTLX 4IDJL 2FATH 5M94B 3TH2T 3WD5L 4NQDD 4HUKB 3INUH 2JJWA 1KG0B 2EH8H 4YNYA 1FG2B 1D3CA 2BSTA 4CMMB 1ITBB 4X5XA 3UZQA 3VXUE 5J57B 4NDMB 5GGVL 1DN0B 5BS0D 4ORGB 5E1AB 1UXWB 1ZGLM 1RJZB 5FYKH 4I48A 3GI9L 2GK2A 5FEBA 2G5BB 2OI9A 4S1QL 1VESA 1XCTA 2IGFH 1EEQA 5DJXA 3SQOL 4U6VH 3MBEC 1HINL 4U6YA 1P7KB 5ALCL 1A1OA 3HZVA 1YPZA 1IGJA 3EW3B 4U05A 2JELH 3G6AA 4YDVB 1BX2B 8FABA 2H1PH 2ZG1A 3QXVA 3FN3A 4JM2F 1ZA3A 3N06B 3Q1SH 4GW1B 5JIIA 3SCMC 4OFYA 4OQ1A 4DAGH 3WKMH 3MRJB 4PB0H 4ZFGL 5A3ID 2VLKA 1EDQA 5SX4H 3L3KB 2HJLB 4QHMB 1T04A 4A2MA 1VERA 1PEWA 2D7MA 1NGWB 1VFBB 4G80B 3H9SA 3BAEL 3JZ7A 1UH4A 5FKAA 1Y0LA 4KV5F 3P3YA 1K2DA 4KY1H 5FHAH 4OZFA 1AQDB 3MRCA 3WV0A 3VDCA 3O6LH 2CDGB 4N8VA 4NRYA 1BPVA 2NCMA 5EU7E 4HKXB 3GMPB 1LEIB 4BJLA 5K9QI 1PX4A 4Z0BL 3SJVA 3ARGB 3PWPD 4JDTL 3TVMA 4LDLB 2HAZA 4EDXA 3ULVF 3O8XC 3EO1A 3EGSB 3T2PA 4OV5A 3ZHKA 2WNGA 1IFHH 2WBJD 5FA3B 2UY6A 2BNQE 4LCWD 4A6YH 3G08A 4WJ5B 3P4OB 1OLLA 1ZA6B 4WDIA 3QIWA 2ESVB 1ZHLA 3MLUL 3TESA 3IVKA 2CIKA 1JF5A 3BKML 4HX1B 2ERJC 4YPJA 5IVXE 2R1WA 1FN4A 3IDYB 3DI2B 2LTQB 3OKEA 2VN7A 4RZCA 1KJVA 2Q8AH 5CBEA 3TYGL 2QL1A 2XA8L 3MJ8B 1WBZB 4QOKD 1YMMA 5KSAB 4WFED 5FGBA 4QHUB 3HMXL 2R2EB 2NR6D 4YDJB 1BLNA 1W72L 4OLXL 3L9RB 1IZJA 4RFNB 3V4VH 3QQ3B 5CJXA 1E4WH 3FKUS 3H8NA 4UTBH 5IQ9A 2WINA 4ZFZB 3QQ4B 4HKBB 2OSLA 5C6WH 3KLAB 3IDNB 2RCSL 3DGCR 4OF7A 4C56E 1QTYT 1EMTL 1SJEA 4FQIH 3FB6A 3RWCB 3KPNA 3KPMB 4Y16B 4I13B 4P57A 4I8DA 1BBDL 1HQRA 5I1KL 3BRDA 5D7KD 4PUBH 4PJHE 5I1JL 4H0GA 4CNIA 3M1BB 1IGMH 1G9EA 1FL6B 5FGCE 4LSUL 4JM2A 2H2PC 4X83A 3E8UH 4U6TA 3TBSB 1GAFL 5EOCH 4XGZB 1Q72L 2WWKO 2CUMA 3MRQB 5BO1L 1OCWL 4M6NH 1X5JA 5IB3A 4XX1G 3DMMA 4KTDL 1C12A 3U6RA 3SPVB 4WO4D 4N9GB 5DJ0B 4CN6A 4FA8A 2CLRA 1II4E 2BHZA 5F9DC 2HFTA 2OP4L 3EIFA 3QDJA 3O6FA 2X4UB 3LMJH 1S7SB 4JKWA 4E9LA 5ERWB 5KOMC 2AJZA 4U7SA 5J1SC 4Z0XA 1F3RB 1IQDA 4GXVL 1SJHB 4GRLD 1LILA 4JKLA 1OP5H 3FB8B 3DV4B 3TFKA 4ZSOB 3VXRE 3WLBA 5I74B 5L9DL 2AW2A 3VXTA 1MHCB 3GSNH 1IT9L 1NC4A 3K7UA 5J6GA 4JVWA 3MUY1 3RA7L 3WJLA 1MIML 4G6MH 1WSST 3SGKC 1NAMA 2C1OA 1MVUB 1Z0MA 2WUBH 3RWGA 4QRQB 3MLXL 4IRJD 4PTUA 5KSBF 4NQCD 3DVGA 1YUHA 5E2UL 1QFHA 3VWKB 2Y4SA 3MV8A 2D7NA 3S4SG 4DUWA 3FRUA 3EFFA 4IM8A 2N56A 2W0LA 5K9QG 1QSED 1DSFH 2A74B 5L2KE 2DLGA 2EXYC 3JV6A 1BJ1H 3WIHL 3LPFA 2DQTL 2IANE 4ZTPH 5GRZA 4GG6E 3KPQB 1G7IB 2VAAA 5ESAB 4LL9A 3NGBB 4M4PA 3REWB 4YX2H 1OVZA 3O6MH 3QFDB 2ITDB 3C5ZB 3QYCA 3HMWL 3QHZH 1TTGA 4QRPD 3WLWD 1M05A 1FO0B 3QUXD 2BJML 4MJ4A 4Y4HC 4MXWL 5CZXC 1OAYL 4KTYA 2VYRE 1NGQH 4Y4FB 5LBSL 1ODAA 3TNNB 5C0IB 1IEHA 2SEBA 4NKIH 1CLYH 3JV4B 3PP4L 4R0LB 1ZS8A 2XIDA 2P42B 3H7BA 3MNWA 4PREA 4WNQA 5CJ5A 3RFZC 2YA0A 2B39A 1G1YA 3GKZA 4L8CB 3WE6B 4KRPD 4XNUL 1UWXH 4Q9BA 4GBXC 2VKXA 4YDIH 1LE9B 1I9RL 4P2CG 1D9KB 4XX1E 1MCRA 4DGIL 1R6VA 2R9HD 3WDHA 1EBAA 3WSQL 1I8LC 2IQAA 2MCPL 4XPAL 2WV3A 4TNVK 5D5ME 3FQRA 5F7EL 3MCKA 1SHMA 2UWEA 1LEKA 2P5WE 1EFXB 5DWUH 2MTPA 3O4LB 4NN6B 3RL2B 4Z5RA 4F3FB 3EYQC 1B4RA 1I7TA 4LAQL 1RIHH 4Z7WF 4N5UA 5DD5H 5EUOF 1GGBH 4L3EA 3T0EE 3VXNA 3MBXL 2YUXA 3KYMB 2ZOKA 5F1NB 4AMKL 3T77B 2DTML 3KXFA 1CE1L 4G3YL 4J1UB 4S0UC 3QZWB 3TBVB 4QCIA 3TT3L 5GGVH 4NSKA 3D85A 5D7IA 3NABH 4X6BA 4XNZB 2FJFB 1AY1H 4TNWF 2IG2L 3GI9H 1NCNA 1QSFB 4XZUB 2WIIA 3DVFA 3RY6A 3SQOH 1BJ1J 4KK5D 2R4RL 1NKRA 2HT2C 2VWEC 1DBAL 4ZMAT 1AR2A 5B38A 4PJGB 4HXAH 1PZ5A 5J8OA 4IOIA 1K8IB 3UTPD 1MVFA 2JJTA 4GKOA 2YPLB 1PKQB 2X1WL 1W8NA 5C09B 1VENA 2A6JA 2AQ1A 5D2NA 5C0BD 1A6AB 3KWWB 1T80A 5BW7C 4DN3L 4NQEA 1AR1D 3H9HA 1IAIM 2XKSA 4RGOH 1ZVSA 2ATPA 4PJ8C 1YYMH 4R97B 4XVUD 4CAGA 4YHYB 3BGMB 3ZKND 2JK5B 1P6FA 1NBQA 2W07A 1G7LB 3MOAH 4QF1B 1DUYB 4WW2C 5DD6A 3S8WA 3D25A 2NY1B 4MAYA 5T1LA 2H6PA 2EYRB 4QRRE 5KW9L 3FOMB 3CFDB 1PDKA 5E8NA 1EAPA 2FBJH 2X42A 5KBNC 4NZJA 4ZOEA 4WEMB 4YGVB 4M7KH 4CVXB 1OD7A 1U58A 1KPRB 1RQ5A 4OGYH 4WI4A 3KPSE 4Z0BH 4HQQH 5F9JA 5C07E 4M4RA 2PO6D 4F9PC 4PJBB 2H26B 2X70B 2W91A 1F4XH 2OXHA 4OJFH 3MGOA 4UQ2A 4YJZL 5SWSD 2H32B 4DTGL 4OSUL 5IB1B 2EEDA 5HGHA 3SDYH 4YO0B 4PJAB 3DRQB 4LNRB 1MHPL 3ZE1F 2MQ0A 4JKPL 4KKLC 1I4FB 1JZ3A 4JB9H 4JFFB 3BFOA 4HBCL 1F11A 5D1ZD 4LK4A 5JTWA 5EUOA 2J4WL 4X4XA 5HI3D 2XZCL 4OAWA 3D9AL 3BKCL 1MFAH 4WUUA 4Y5YB 4J23A 3QUMA 2XA3A 3FRPG 5EU6B 3I2CH 3ARDD 3HMXH 4HJJH 1W72H 5DJ6A 1CTNA 2WBWB 5JXAL 5EBWB 3BZEA 2GFBB 2EECA 3UTSE 4WEUD 2P8PB 4AEEA 1INDL 5SWZB 3NA9L 5LKNA 1B9ZA 4JZOA 2RCSH 4GAGH 2X44D 4XBPA 2DN7A 5EZJA 5IF0A 4R9HA 4CW1A 1YEGL 1EMTH 3QDME 3IT8D 4HK0A 3QXAB 3O2VL 4MB3A 1BBDH 1I7RA 4I0PD 1A64A 1O7SA 1UM4L 5I1JH 4FG6C 5C0BB 4QWWC 5HYJD 3MV9D 3R06A 5I8EB 5IMOA 4R2GC 3BP5B 3IFNH 3E2HC 3NCYS 4FQCH 4K94L 1GAFH 2K7PA 1Q72H 3SQBA 2BSTB 4ETYA 4X5XB 2JCCE 1XIWC 4XI5C 1NCWL 2X1PA 1M7DA 2XI9A 5T3XD 3AAZB 3QCUH 4JFYA 2P47B 2OP4H 4I48B 3CFCL 1FNEA 1JZ6A 2OI9B 2NY0D 1JTPA 4YR6A 4P4KA 5LVEA 5MEOA 2X2YA 2YHGA 1NFIA 4RQQA 25C8L 1KN2H 1KBGH 1I85A 4P5TA 4U6YB 2DRUA 1A1OB 1YPZB 4E5XA 2AKRA 1YEHL 3EO9H 4GMTH 2XZQL 3G6AB 3WNKA 2HKFL 3OPZH 4OZ4A 1IT9H 1ZA3B 3G9AB 1YNTA 1MQ8A 3CVHH 2A2QT 4QXUL 3GDBA 1A6TA 4RGNC 5HGDA 3FL7A 2LE9A 4MQ7A 2VLKB 5FOJA 5A40E 1G7PB 1U8KA 1WIPA 1T04B 1I1AC 1MCLA 1X5IA 2VLJE 2ZJSL 3WNMA 3MYJA 2B4CL 3U82B 2AERT 2Z92B 3FO9B 5DLMH 5E2UH 3H9ZA 4GJTB 1VFMA 3TO4C 1B0GA 4YFEA 2NW2B 1Y0LB 2ENYA 4G8GA 3MSPA 2EE6A 3Q5TA 1IKFL 4HS3B 3WS3A 4IMLA 1CK0H 1FRGL 4L4VE 4FN0A 1T6VN 4KVNL 4OZFB 4X4YB 3MRCB 4BQ9A 4EOWH 2N7BA 2Y07H 2Y23A 5L88L 4NRYB 2QQQA 2C7UA 3FB7A 1GCFA 3ARDB 4MQXC 4CGTA 2AV7A 5HHME 1A1MA 3S37H 3VI4F 5HI4C 3SJVB 5FCUH 4LU5H 3P40A 5CGTA 3C8KB 3IS1X 1AO7D 3R1GH 5K9OA 3HI1B 3QEHA 4PJ5A 4EDXB 3HMWH 5BZDA 4OV5B 12E8L 4E41D 3QCVL 2EIEA 1DLFH 4ODBD 3SE4A 4MXWH 3G08B 3NBNA 1KLFA 5I1LA 1G6RA 2VDNL 4WDIB 3H2WA 1PFCA 3QIWB 3S6CA 3EHBD 1SEBA 4J12A 5T1MA 2DJ4A 3CD4A 1J10A 5I8KL 3UBXI 3IVKB 2CIKB 2EDYA 3PGFH 3FB5B 1MCJA 4Q58C 1YY8A 3M07A 1ZGLA 2NY7L 1T3FA 1FN4B 3OKEB 1LP9A 1HYRC 4LARH 5JHDE 5CBEB 2DQUL 2BX5A 3T3PE 1YMMB 1P4IH 2APXA 1BLNB 3VD3A 4O00A 4MQTB 2Y5TA 2X4OA 5IQ9B 4MAUL 2WINB 4NKOB 4QT5A 4DKEH 5CKGA 4WI7A 5GXBB 2OSLB 3SBWA 4YXLH 4MXQA 1MFDH 1SJEB 3VFRA 3FB6B 2DWDA 3KPNB 3UTTD 4M48H 3ARBC 3EYFA 4P57B 4OM1L 4B5EA 5F7EH 5FYKD 3D2UA 4ODTH 1IGFH 4CNIB 1CGTA 4MNGB 4WWKC 1AI1H 2CLZA 4GS7B 1KF9B 4RISL 1I1FB 2X1QA 5GISH 3L1OL 5D1QC 4JDZA 1N64H 1Z6JT 2J8UA 3KHQA 2BHUA 2X40A 3WDJA 4AL8L 5IB3B 3DMMB 1C12B 3U6RB 1X3DA 4JFDE 3MRNB 2CLRB 5I1GH 3S5LB 5IJKA 4ISVA 1S78C 4FQPA 5DK0A 2XKUA 3QDJB 4ONFH 1AP2A 2YBRA 2AEPH 4RMSA 2VXTL 2A1WL 4FABL 3LHPH 2AJZB 4P2QA 3HCVA 1ZXQA 1S9YA 3P9LA 2R39A 5MI0B 3I6KA 2HRLA 2X4QA 4WUKL 4OZHF 2JJSC 1C7TA 5HHVL 2GAZB 5K59F 1QYGL 3DROA 4NGHH 5J6GB 4AG4H 3UO1L 2J2ZA 2CK2A 1GC1H 2OXGA 3TIEA 3EOYG 2ZUQB 1NAMB 3ZHDA 3TV3L 3AVEA 1TIUA 3JXAA 5EPMA 1LK3H 1FJ1A 2P49B 2IAMD 3LD8B 3DVGB 4XNXL 4BH8B 5FK9A 1I3GH 1NBVL 2C3GA 2EXWC 4X98B 3BSZH 4LKXA 4PBWD 5C0NC 3FRUB 3EFFB 1RJLA 5FO9A 3P11L 1T66C 5F9AC 1QSZA 3QEQD 5DI8A 1U8OA 4L8BA 3F7PC 4EUPG 3JV6B 1QFWI 3DUHA 2R23B 1HHJA 2GCYB 1DQMH 5FUOL 1OAZH 2AXHA 2VAAB 5CFHA 5I18H 2VXVL 3MV7D 2DLEA 5JOPD 1KSRA 2EC9U 3MODH 3MRKA 3U9PH 4CU8A 2C4XA 5D7LD 4LSRL 3SEPA 1ES0B 4BSVA 1MNUH 3FZUC 4JZJB 2X05A 1TQCC 3JVGA 1FVDA 3DUSA 3F12A 1EVTC 5AEAA 4HH9A