5E9DA

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
275
structure length
266
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 69
structure length 266
sequence length 275
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5e9dA01
1V7MH 3QPXH 4ZUSA 4U6XB 3LMJH 4UT7H 3ZE1F 3X11A 4GSDH 4G3YH 4OIIL 1W8NA 4TVPD 1IGJB 5CEZD 4H26B 2ZSVA 1OAXL 8FABA 4NQDA 1OPGH 1NUGA 1UZ6E 2FH8A 3P9WB 2XFXA 2A1WH 3G08B 5D96C 3L3OA 3HI6L 5HVHB 4X7TB 5IJKC 2VLKD 4MJ5A 3QDME 1HEZA 3ORJA 3L3IB 4E42B 2ZP0T 3WFBL 2YUZA 4NFDA 4F3FA 3S3SA 4E0RA 2LQRA 1BQSA 4GRWB 2DQEL 1MWAB 3STLB 5C0AA 4R7DB 4KJYA 4KQ3H 2FCBA 4TUOB 3UTSA 5DFTA 1NEUA 4GQ9L 2VDQL 5CSGA 3TO4D 1WCBB 1IAMA 4U1HB 5CSBA 3S96B 5JQ6H 3MFFB 5IB3B 4MAUL 1TVBA 1WFNA 4L8SC 4P0DA 1U93A 1DBJL 2EDBA 3SJVA 4ZSOA 3VDCA 2BHUA 2E5EA 1I8IB 4MXVE 5DA0B 4GW5B 1MFBH 1QTYT 2OI9B 3MRKA 3AXLA 4XPGL 2OX5A 2ESVB 5C0EA 1DQJB 4OCRH 3EYQC 1YY8A 3QB7C 2A6IA 4UOJA 4ZFOL 5HPMA 4PY8I 4X9HA 4FFVC 1T7YA 1BAFL 4P23C 1AIFB 4K94H 2YK1L 1JZ5A 4V1DE 5JMOC 3RWEB 1UH3A 1CDIA 5MEQB 2QADB 5ISZA 1J0KA 3RWGA 1IKFH 2OL3H 1PX3A 2GI7A 3BISA 1J05B 4ZUTB 4EI5B 3QEQB 1JVKA 4ELKA 1HEZB 2HWZL 3ZTNL 3EDFA 2N1KA 1NEZA 4YPGA 4PTTB 3MV8B 1BQHB 2JIXA 4MDIB 3QIUD 3V5HB 1VDGA 3FB7B 4OCWL 1SBSL 2EYTA 4Y5YB 2PYEA 4ONHB 4GG6B 4KJYB 1ZEAH 4OZ4B 1AGBA 3O3EA 4P2RD 1VFBB 3KWWA 5BOZG 1YPZA 2E9IA 1M71A 4TN9A 5TE4L 4MWFB 5IVZB 1RJLA 1FVEB 5DHYA 3SJVB 4AH2A 3JV4A 3L3JB 1MCRA 3OKDB 5TGBB 3V6ZB 2IBGA 5IG7A 1OAKL 3QDAA 3ZE2E 2CRIA 1JHTA 1QA9A 3BH9A 3KG5A 1HQRA 1KCSL 3QIWC 1SMAA 3AXLB 4JRYD 3RVUD 4YLQT 1FFOB 4M93B 2APBA 5DQ9A 5I17B 2R0LH 2YD6A 4P4RB 4MXQA 4WW2C 3P4OA 5E6IC 2YUWA 4M5YL 2FL5A 4HK0B 1CK0H 4MX7B 4NPYA 4KDWA 5I1JH 3BIAX 1FYHB 5ICXB 4HBCH 2Y1VA 4HC1L 4N0YH 5I1LA 4OFVA 1II4E 3JBG7 1A2YB 1MHEB 4IJ3C 5EBWB 4CN4A 3UYPA 3QCUL 2DLEA 2X1WL 3CFDB 4OV6F 1T7ZA 1T2XA 4ZMAT 1X5HA 1DQLH 6CGTA 1Y6KR 3QXTA 1A6WH 3TYFA 1N64H 1JF1A 4TUJA 1T1YA 4PG9B 4M00A 5J6HA 3QXDA 4LPXA 1JWMA 5T5NF 3O6KH 1OW0A 4NM4H 1OM3L 1DBAL 3LY6A 4M4RA 3CZFB 4JGJA 3F7RA 4LVNB 2NR6D 4PP8C 2PO6D 3B9VA 4KUCD 2Y72A 1SQ2N 3HMWH 1MELA 4WI2A 1CD9B 4HIIB 1Q1JL 1Y0LA 4KZDH 1JGVL 4YXKL 3D69B 4FP8H 3H9ZA 1H3PL 2VDPL 5INCB 3DV6A 3QAZB 3BZEB 3JWDL 3L7FA 4RNRB 4BK4A 3QO0A 4JFED 3SKJH 5CP7A 3WKMH 2J3SA 4FABH 4U0RC 3ULVL 2OZ4A 3FB6B 2DQJH 5EC1A 3EDEA 3VXPB 1ADQA 1CVSC 1AO7A 3CDCA 4P3DA 5JW4M 3N85L 5JMRA 3MOQA 2H45A 1R5IA 2UWEF 4F57L 4ZXBC 2EXWC 4CVXB 1UWGH 5D7SH 2YUVA 4LASH 4O4YL 1Q9LB 2W9DL 3RWIA 3QBTB 4FQXB 3MJ7A 5K9OA 2Z93B 2RCSL 3V52L 3QH3B 3S8WA 4TTDC 3M1BA 4HGWB 3BW9B 3VRLF 2NLJA 5I9QB 3RU8H 4YGVA 2ITDA 5F9JA 2D2OA 1P84K 4YDVA 1RUQH 1OAQL 3HC4H 3OAZK 2EC8A 1FLRL 3GSXA 4PJHB 3Q5OA 4PUBH 3KPRB 1K9TA 2X09A 4Y19D 4U3XA 2BHYA 2AJYH 1J0HA 5KZCB 3IDJB 3U1SL 1YQ2A 5CUSH 1D5IH 3R8QA 1NSNL 4ZQKB 2NYYC 2BVPB 2WINA 3MV01 4QXUH 1F4XL 2P5WB 3M8OL 4Y16D 1IC1A 3MR9B 1D9KA 4JPIA 5C86A 4WU5B 2AKRB 1V3KA 3OR7A 5EZOH 5E2JA 2LU3A 2WWMD 2YD5A 3MCG1 3T0XA 1JZ4A 5K9JL 3HR5A 4AJ0A 5EBMB 4XNYL 3V5KA 2D9CA 3FFDA 5J12B 1I1AD 4XAKE 2C1PB 3W11D 5BVJA 3WNOA 3HE7B 5SV4A 5CIPA 4ZUWB 1UCBL 4NC1E 5FAAA 3GMNA 3MRNA 3JVGC 4JQVC 4F7CA 1YN6A 3WUZA 1KIQA 4NZUL 1JP5A 1JNLH 3IETB 3WXWL 4K8RH 3TM6A 3M1BB 3P11L 4QRRB 4EDXA 4GUPB 4K7PX 5DJXB 3VMNA 3IU3A 4PGDA 1BFOA 1N5YH 4IDLA 4PJDB 5CILL 1A8JH 3G5ZA 4N68A 4DKEH 3BEVA 3RA7H 1ZGLA 3DV4A 1W0YT 1UB5A 4U1JB 1KELH 5DURD 2PYFA 3E2HB 3MCLH 1VGEL 1FSKB 25C8H 2Z91B 4NKOA 3VRIA 4BSVA 5EU4B 3RBGA 5EOTA 2WWKO 1LDPH 3BJLA 2COQA 3MLRL 1CBVL 5CJOL 2ZOKA 3LN9A 2AERT 4M6NH 3VXME 2XTJC 5EORH 3H7BA 5F1SA 4MQTB 5CEZH 3EO1A 2E7BA 1MVUA 3OXSA 5L9DL 3VRLE 4KVNL 4UTAH 4OZFG 2W9LA 5BVJB 5BXFB 3WLWC 2XZQL 1QLFA 3WHXA 4U7SA 5T1MB 1ZHLA 5E94A 3MBEA 5HHOE 5IVXA 1YC8A 4JQIL 1NBVL 2ZPKH 1HOCA 3RJDA 2GSIB 1AY1L 1FNSL 4TVSa 5FCUL 1WIPA 5SWZE 3PWNB 4D2NA 4LHUG 3MROB 3CFJB 4QHNB 1P7QB 1PQZA 4NHCL 3N1GC 3P40A 4ODXB 4M62H 5HVGB 1G7LB 2AW2A 1C1EH 2AV7A 4U05A 5D2LA 4PRAB 43CAA 5IBTL 1SVZA 1J87A 5F3BB 5LCVL 2XA3A 1IBGL 4OM0L 4NNPH 3UJIL 3IFNH 1CFNA 4NKIH 5CJQL 3R06A 2V5MA 1T1ZA 2WV3A 3HZMA 3B5GA 5GHWH 3QFDB 2DIJA 5KS9A 5H35A 4JO1H 3KPNB 5JHDB 5GS1C 4PRIB 1JMZA 1UM4H 3D25B 3KDMB 3U0TB 2EIBA 1FNEA 5EA0H 4ERSL 3L5WA 4OQTH 3SGJC 3MNZA 1HHIA 3TO4C 5TPWL 1OAYL 1MFCH 4WFEE 1X5FA 2NMSA 5JDSB 2NY4C 1DLHB 2X1PA 5CLTA 5I8CB 4WHTA 3TJHA 2VLJE 2QSCH 2DLIA 3O3DA 4P2YA 5IMOA 4M7LH 3TIEA 2X70B 1N3NA 2J8UB 1EVUA 3U36A 3C60B 3MRPA 4DN4L 2GJZB 2WUBL 1NGPH 3E6FB 5C0BD 3FN0L 4AQOA 4YWGH 3P9LB 5DZLA 3GBNH 3WFCL 5C9JB 2YRLA 3DMMD 3EFFB 5DJAB 4NQUA 5IF0B 2H2SC 5FGCE 1VHPA 4MJIB 4QRTB 5E2TH 5F8QC 2OK0L 1G7PA 4NKMA 3L3HB 1UEYA 4TRPL 3DHMA 2ZUTA 3FO1B 2ZG3A 4Y5VB 3H42H 2GJJA 2EYRB 3WFHA 2R29H 5SWQB 1KTDA 3ZKND 2LE9A 5CEYA 1OGTA 3QEHB 1OOAA 4X6EA 1I9IH 5ETUB 5HDQL 1A5FL 3S36X 5CZXD 3G5XA 4UOW1 3HFMH 2Z92B 4J4PC 2YPLB 1ITCA 5HYSG 3FQTB 1FVCB 3BIKB 4NP4L 3PABA 5KN5B 1EA9C 5GSVB 4CVZB 2IPUK 3AUVA 1I1CA 3UC0H 2X4PB 3QISA 2UY6A 1KJ2L 4J23A 2CKBL 4XCEB 5DHVA 1ETZB 4PDCE 1HHHB 3CD4A 3UPAA 2GCYA 4O2FA 1QPPA 1IC4H 1U8LA 4H88L 4EOWH 2YZ8A 4D0DB 3IDYB 3SQOH 4GOSA 3G6JF 5BS0D 5HYJA 3P0VH 4HK3J 1EUTA 2ADJA 4Z7UA 2XA8H 4BQ6A 4N90D 4MS8C 5TDOA 2V7HB 3WFDH 4GH7B 1EAPB 3NPZB 3MODH 1GOHA 4F7TB 3HZVA 1L0XA 3BN3B 4S2SB 4HQQL 3E1F1 5CEYB 3UZVB 1A7QH 3SOBH 1LVEA 3FT4A 3EIFA 3GJFH 1YMME 4FRWA 4OLWH 2W9EL 4HS3A 3RTQB 1TZIB 1UZ8B 3T0EE 2QQQA 4BM7A 2R4RH 5TJWK 3P0YH 4ZDHB 5D5ME 5JA9A 4NC2B 2ZCLL 1S3KH 1BZQK 1QSVA 2YD8A 1Z9LA 5IW6A 3FQXB 2HFFA 4LSPH 3KXFD 4TUKH 4WY7H 4JFZL 1UB6A 4CN1A 1NLDH 3L1OL 2UZYB 3IXTA 1YNLL 4GXVH 2EDLA 1AGFB 1KNOB 3MRHA 3VU2A 4LPYA 4LVOC 1N4XH 1HHJA 1UM5L 1TPXB 2PW2A 4IS6B 1MREH 4YHNB 1CICC 1VPOH 1QLRB 3GIZH 5HYQA 2WUCH 4JJ5B 3CSPA 1Z0NA 4QXGH 3U0WH 2P8LB 3GMPB 4EEEA 5DRWA 2CIKA 4LK4A 3SGEH 5HGDB 3QDJB 3U0PA 5IESL 4LHUD 1ZSDB 2MHAB 1DBKL 3RUGB 2F53B 4NUGH 2WWKT 2DKMA 4Z7VA 3QWRD 1H5BC 4XP5H 5L2JA 3SE4A 3PP4L 2MTPA 1XGPA 4D3CH 4MVBA 1S7SA 5KW9H 3O6FA 3QI9D 4YHKL 3CIQA 3RIAF 5TDNA 2V5YA 1RURL 5MERA 4FXGB 3IDXL 4MQ7A 1J8HB 3NCMA 2P45B 2FRGP 3VWJD 4D0CB 4XCYB 4JFDD 2Z8RA 3KPOB 2YXMA 1HXYB 3KYOA 3QCVL 5HGBB 5HHMB 4WHYH 4IRSD 4MA8L 4JKKA 1FNGB 1EBAA 3PNWA 4GRWE 4PGZA 3MRQB 3EJYD 4TNWF 2VZ1A 4H20L 4OLXL 4HLZG 2C7UA 2O61B 4FQCL 4KMTH 3QQNA 3BMWA 1TIUA 1FZKA 3VA2C 2CUMA 1HHJB 1JV5B 3NAAH 2GAZA 4WI5A 3IFPB 4PJAF 4PJ8A 3OAYH 1G7MA 1JGDA 1NC4A 1QUNA 5HYQB 4IRZL 2DICA 5CD5C 1KJVB 5DD6B 3FCTB 2HP4A 5DR5L 1RY7B 2J6EL 5DFVD 3ARZA 3QDMD 1H3WM 3MJ9A 2ESVE 3U4EB 5D7JD 3NPSC 4UAOC 1G7IA 2I24N 3ILQD 1BGXL 4U6VL 5EO0B 1TQCC 4OIIH 3OF6D 5DO2D 1XGPB 3REWA 3V7MA 1R5WB 4X83A 1OAXH 4L4VB 2VZTA 3TPUA 5IMMA 4UDUA 5E8NB 5F6IB 5JIHA 3HI6H 4JFPA 3B9KB 4UMGA 3K7UA 3FL7A 1TJIH 4XNMB 3SE9H 1KENL 4PGCA 3LEXB 1DVFB 3QEQE 1A1NA 3TBSB 4Y5XA 1R24B 2Y5EA 2CRYA 5DUPL 3MV8E 3RKDD 3ZKXB 4XGZB 3CVIH 1M6OA 4UBDC 2G5BA 5CKAA 2ICWI 5DXWA 1MJ7L 4GQ9H 2VDQH 2C7UB 1G7QA 4GG6E 3WEXA 4HJGB 1DQML 4MAUH 4MA1B 1T21B 2FBJL 5T5NG 1DBJH 2BXZA 3PP3K 4JGUA 3L6FA 4V1DD 5LBSL 4PV8A 4X8JA 1EEZA 1NGWA 3SJVE 4WWKD 1A6TA 2O5YL 5E8DL 3ZSTA 5HDBE 4BFGA 4ZNEA 4J3UA 4XPGH 4HJ0D 3NN8A 1U3HA 3X3FL 2D31A 4IMLB 1U8NB 5E00B 1A4KB 4WJ5B 3DSNA 5GZOD 1BAFH 1IQDA 4MXQC 1T0MA 3OKKB 4XPAL 3EYOA 2YK1H 4HJJL 3QUML 1K4DB 1MQKL 1UC6A 5DC0A 3TPUB 3QEGL 2PR4L 4LCCA 3VG9B 1NCWL 3QQ4B 3O4OB 1X6LA 2IADB 2DBJA 4ZNCD 4U33A 2HWZH 3ZTNH 4PJXA 4JVPA 3AFLA 5HY9B 1IM9A 3P30L 2DRUA 2O5ZL 1D5BB 3O2WL 4L29A 4OCWH 1SBSH 1W72A 2PN5A 3O4LB 2AQ2A 1OW0C 5IB5A 2GTZA 4EUPA 1JWSB 1N59B 2G2RB 2VXUL 3WEXB 5DD5L 4EUPG 5TE4H 4O5LL 1JGEA 3SGEI 5TE7L 1NCCL 3NCYS 3LAFA 1FZMA 2FSEA 1CDCA 2AXGA 4CRPA 5E6YA 5KVMC 3PE9A 3CVHB 1OAKH 1DBBL 1D5XA 5IB4A 4Z5RB 1KCSH 3LDBC 4JFFA 3VXRB 3C08L 1CFSB 3BPLB 4RZCA 5AZ2L 3TBVB 4J7RA 4I48A 2C3XA 3QJHB 4ZD3L 3EO0A 3QP3A 1EH9A 5MP6L 5IEKB 2R2EA 5HHNA 3DMMC 4M7KH 1RUML 2NXYD 4Z6AT 5HYFA 4HC1H 5EUKB 1HYSD 4RAVB 3OXRA 4W70A 1GZQA 5J0BA 5IP4A 2UYLA 1U8KB 2R0KL 3VH8A 1E4KC 1MCHA 4M7ZC 4L9LA 4DK3A 3FB8B 1CU4L 1VACA 3KVQA 2X4RA 3JTCA 1HHGB 4OF8A 1OM3H 1DBAH 3DVGB 4PJHE 1YNTA 3FO2B 1YMHB 3KPRE 5IIEA 2HN7A 3I6KB 2EIDA 5EULV 2Q86A 5D1QA 1Q1JH 2LABA 1JGVH 1CG9A 4F58L 2AXGB 1H3PH 2VDPH 4WW1B 3MYJB 4NHUA 2E8ZA 3JWDH 3RGVD 1HQ4B 3MZGB 4K7PY 3W9DB 2P5WE 3ARDB 2IANB 1D9KC 5GRJL 3HZKA 5DS8A 3ULVH 1R6VA 4JKWA 4I48B 2A9MH 5T33L 1BFVL 5E4EB 1N26A 3N85H 1FL6A 4F7MB 4F57H 3F58L 4XP9L 2W9DH 4RAUA 2W0LA 1XCQB 1T7WA 1KPVA 1XFPA 3OXRB 2RCSH 3V52H 1C08A 4RWHA 3BP5B 1U91A 3TZVA 1LMKA 4ZTPH 4PGEA 1Q9WB 2ZWLT 1OAQH 1S7VA 5HVWA 4QRRE 1FLRH 3HMXA 2OMNA 1RZJL 3BESR 1T1XA 4GRLD 4OZFH 2C4FT 2ENSA 3TVMB 4PJDE 5FUZL 2VZOA 1YEJH 3HC3L 3VCLA 2GT9B 2IAMD 3F5WA 3U1SH 4KKAD 1MFNA 3GMOB 4XAKD 2ID5A 1NSNH 3NCYP 4OV5B 3FQUA 1CXLA 4GAYA 1F4XH 3M8OH 3CAFA 4HUNB 3HC0A 3S4SG 4A6YA 3OKEA 1ONQA 3EZ8A 3VFMA 1U58A 3KPPB 3DUSA 4I2XA 2R2HA 3GGWB 1IZKA 3GFUA 4JFXB 4XAWL 4U7KA 2YD4A 5K9JH 1KULA 3EOBA 4YDJB 4XNYH 2FD6L 2NNAA 4XPFL 2HTKD 3PWVA 1MHHA 1UCBH 5IMKA 1ORSA 1UGNA 4ZS6C 4X5WA 1GCFA 2Z8SA 4MQSB 4YHZL 3MBEC 5JXED 4RX4D 2HMIC 1F11B 5E95B 4XTRD 4NZUH 4HMEA 5C0IB 3WXWH 1JYVA 3LKQA 3P11H 3PWUA 4M4PA 1B0RB 5C0RL 5B8CB 3GB7B 3RI5K 1EEUA 3IKCA 1I7RB 3DHJA 5CILH 4KGLA 4UV4L 5EFIB 2YRPA 3C87A 2XIDA 3VXMD 4DCQA 5EH1A 3L3KB 3FT2B 5AG9A 4ZFGL 3P73A 3F5WB 2OMBA 1MIEL 2F8XC 2YRZA 1I7UB 1VGEH 1KB5B 4E41A 4I1NB 2X9YA 3SCMA 2DQFA 2YD7A 2YPKB 5HHOD 4H8WC 1CL7L 4W6XB 4JFQA 5JHDE 2LAAA 4WTZA 4PRIE 5A1AA 3MLRH 2VSCA 4F2MA 3EOAB 5HPOA 1C5CL 1CBVH 3H9SA 1U58B 3C09C 1SJEB 2EDTA 5SWZD 4X99B 1CVRA 4LCWB 3O9WA 1RUAL 4X6DB 5DA4A 3NCCB 1AFVL 5L9DH 2HJLA 3HAEB 4KVNH 4X6FB 3PWVB 1QO3A 2XZQH 3TT1L 1F3JA 3UTOA 1MHCA 2NW2A 1EEYB 3LKPA 2WW8A 4IRJA 4QRUB 5A3ID 3RZCA 4JQIH 1NBVH 5IVNA 1IILE 5F97E 4F33A 1E0OB 2J8UE 1XIWD 1AY1H 1FNSH 2R15A 5FCUH 4LGSB 4ZAKD 3R0NA 2BOCA 4HXBH 3F7YA 3G6JA 3KNBA 1P2CA 4NHCH 5IHZA 4HKJB 3MXWL 5IR1B 4MJIE 15C8L 4N9GA 5KJRL 3V7AE 2DDQH 4Y89A 3UROR 3QFJB 5IBTH 5LCVH 1IBGH 4OM0H 3FJTA 3IF1A 5CJQH 2X89D 4N5UA 1IFHL 4LLAA 2RHEA 3C6LA 4FQJL 4LAJH 4M3KB 3SO3B 5DK0B 2VLJD 1ZWIB 3GKWL 4U1IB 5F7MC 5ITFA 3K4DA 4H1LA 5KG9B 5C0DA 1RJZA 4Y2DD 2YPLE 4ISVB 4G9DA 1CS6A 3RUGF 4ERSH 3O3UN 5TPWH 1ZS8B 3GHEL 1OAYH 3SN6N 5ESAA 5HI4C 2F58L 4NRXB 1LEGB 3EYSL 1QRNB 1YDPA 4B7IA 2EC9T 4Y1AA 2AAVA 3LHPL 2APFA 5EO9A 4F9LC 3GSVA 4P4KD 1IRAY 4HKXB 1A7PL 4DN4H 3VG0L 2GFBB 3KLHC 1F6FB 3FN0H 5INDA 4G8EA 3WJJA 4NDMA 3WFCH 2ZCHL 4UNTA 3BVNB 4Z0BL 5CJ5A 2ATPA 3F7YB 3U7AA 1EJ6A 5CSZA 3FB5A 2OK0H 1TETL 3WMSA 3OZ9L 4TRPH 1TCRB 4YX2L 3NFNA 3FTGB 5JORA 2FJHB 3MLTB 4OCMC 4U2ZA 1MNUL 1BQHG 2YR3A 1XGTB 4RMTA 2DTML 1PYWA 3N1QC 1FRGL 1U8IA 3TFKD 1HWHB 5HDQH 4XRCB 1A5FH 1BMGA 3FQNA 3QNZB 5HI5D 3CH8A 3NCBB 1FYTA 4ESKA 4MHHG 1XR8B 3ARBA 3IGAB 4NP4H 3SDAD 5KSBB 1NBYA 4YEEA 2BOBA 5E5RB 5KAQF 3MRJA 3IVKA 2ADGB 4MSWA 3QG7L 1KJ2H 2CKBH 3AS3A 4LQFL 4R0LA 5D2NA 4G42B 1HWGB 4KKBD 2OJEB 5DRXB 1EGJA 1WQVT 3RNQB 4H88H 2UUDK 3QUZB 1D5MA 3DX9A 1PGRB 1ND0A 1YMMD 5IW1A 2VH5L 4L8CA 2VN7A 4PJAA 2E6PA 2Y6SC 1T4KA 3FAWA 4YHPA 2JELL 3T0ED 4FTVA 1ODAA 4NNYA 4QRSA 1IE5A 4MXWL 4UQ3A 5T1DL 1PG7L 4PRNA 1D7FA 3QDJE 5E8OB 2OZ4L 4MNQB 4HQQH 1YEEL 3RUGE 2F53E 5ID1A 5D71L 1ADQL 3HB3D 1HK6A 3SE4C 1QZ1A 3D39A 5EU5A 1J0YA 2W9EH 3O6FC 3CPLB 4NYLB 1RHHA 5K59E 2BCKA 2VQUA 3AB0C 1U3JA 2D4FA 3ZDXF 2XV6B 1J8HE 2R1WA 3VXOA 2ZCLH 2OQJA 5IFJA 1OWRM 3AM8A 5B22A 4Z0XA 2BNRA 4R0LB 1CDUA 4JFZH 4AK1A 3CC5B 1B2WL 2VL5B 5HHME 4NT6A 2FX7L 1YNLH 4HEME 1OTSD 3MRCB 5FGBC 2QSTA 1IGYB 1UM5H 1ZHBB 3LPWA 1SJXA 3NFPA 1G9ML 2RFXB 1AKJB 4PJ8C 5GZNC 5DEFB 5FYKU 3A6BL 1B4JL 4TULL 3GBLA 2E7CA 3ZT7A 5C7XL 4OZIB 5CGYC 4XI5C 5IESH 3CDGA 1XF2B 1DBKH 3VFOA 1VB9A 3DX7B 3MLUH 1VFAA 5B38B 3UPRA 2ZSWA 1HE7A 1W0VA 3VA6A 5DVLA 1IZJA 4EI6A 3FOLA 4M5ZL 3KLAB 3PP4H 4KRPB 1SHMA 1T89A 3RPIB 2CK0L 4YHKH 4R2GC 2OLDA 1RURH 1MJ8L 1F13A 1S78C 1IEAA 3IDXH 1EHAA 5IBLD 5DMKB 3DXAA 4RIRA 1FGNL 4L4VE 3BSZL 3IAQA 4LCYB 2BNQA 3VMOA 5FO9B 1XF5B 3D0VB 3DJ9A 3EOYG 2H32A 5TF1H 3BRDA 4G80A 4PJ7F 3BWAB 1IGIL 2AJUL 2HT4D 5TH2A 4MA8H 2EDYA 5CBEA 4V3EB 1INEL 2ZUQB 1JRHL 3O45A 4H20H 1K6QL 4OLXH 4GKSA 2X7LB 2DYPB 4FQCH 1G7HB 2ESVD 4JCLA 2FHFA 1JBJA 4GG8B 1CR9H 3LKSB 4ETQA 4NIKB 3VGEA 2Y07L 5DQJB 5CMAA 2AS5M 4IRZH 2QADD 3N0PB 3REVA 2Z8WC 2FHCA 2J6EH 1JPTL 4DZ8B 2BSTA 5JPMA 5MEOB 3CDGB 1U3HC 1OT1A 5CBAA 4NZTL 1QSFA 5E5MB 5FCSH 5AWNL 2Z31B 4EI5D 4QTIL 3QEQD 2K1MA 2VXSL 3IDMB 4YH6A 5DD0L 5F89B 3SY0A 1BGXH 4U6VH 2ZUWA 4HV8B 2NY1C 2ZNWA 5EO1A 4QY8B 3RY5A 4QCIB 2C3VA 2YN3A 1X5GA 5I66A 4AENB 1KCVL 1YEFL 1I8MB 3STBA 3BPOC 4ZFZA 2YEZB 4NZJA 3V6FA 2I60L 3GRWH 4TNVK 3F7VA 3TPUE 4LCCC 3MX0A 1KENH 1KPRA 3GNML 2BFVL 1T7XA 1T03L 1CD1A 5F21B 3S5LA 3SJVD 5DUPH 1T83A 1K85A 3DETD 3P4MA 5DMGC 4PG2A 5BJTB 3RY4A 1MJ7H 5D70L 2YZ1A 5KSAA 3O4LE 2BSRA 1SYVB 5DJ0B 3EYUL 1ED3B 1DQMH 2VE6A 3EJJX 5SX4H 4PB0L 2FBJH 4C4KT 1I8KA 4G6KL 3B8SA 4QT5B 3OG4B 4NSKA 1XGRB 4GJTB 3NH7L 5LBSH 3CLFL 1QQDB 5E8DH 1T20B 2O5YH 4H8WL 4JREB 1JUFA 4R7NB 4APQB 2V2TB 3BQUA 4GAFB 3AU1A 3X3FH 2AK1L 3VXRE 4BKLB 1NFKA 3BGFC 5F6HJ 4X98B 3KYKL 4LKCB 4JKMA 4M6AA 4XPAH 1M05A 5DJCB 2RGSA 4G6ML 1YEDB 4QYOB 4UT9L 1G9NC 4HJJH 3PL6B 5JOEA 1G6VK 1NMAL 3QUMH 4Q2ZB 2DLHA 1MQKH 4P2OB 2X9WA 2NY5C 2F54A 3VXUA 3S3PA 5DTFA 3QEGH 1CE6A 4CNIB 1AQDB 1LGVA 4DGYL 1NCWH 5FECB 1RVFL 2NX5A 1DN0A 3EAKA 3MNVA 2DWDB 3P30H 3GSQB 4NZDA 1NUNB 2O5ZH 2AXJA 1NC2A 3O2WH 4RQQB 3QHTC 3QDGA 5D7LA 1CE1L 3FONA 1ZA3B 4F7EA 4L1HA 4HS6B 3TA3B 2HJKB 1Q9OA 4HZLB 2VXUH 5CP3A 5DD5H 1MJJB 4O5LH 3ERYA 4X0KB 5TE7H 2ARJQ 1NCCH 3DGGA 4LRIC 2ZCKL 1KIRB 5D1QC 4F7PA 4TSBL 2XKNB 5LGJB 5F93C 2W1NA 5IHUL 3QXAA 3DO3A 1DBBH 1IGML 1MI5B 1Q94A 3C08H 5AZ2H 2BY2A 2G9HA 4FQXD 3V7AG 2IANE 1IQWL 1BLNB 1K8DA 2X5PA 1A6ZB 2Y06L 5MP6H 3HE6A 2ATKA 4OIAA 4MD0A 4Z7OF 3HRZA 3BDBA 3U30B 1RUMH 1QFHA 1Z6JT 4KKNA 4KUZL 4ZPVB 2ZG1A 1MCWW 1TNMA 3KPRD 4HXAL 5DVNA 2DI8A 1RZIA 2EC9U 2HJFB 5BOPA 1S9YA 3AAZB 5B39B 3VGBA 2R0KH 5KOMC 4PV9A 5KZCD 4HWNA 1QSEA 3JWOL 4X6DF 1GOFA 3TZVC 1AP2A 2YSSA 1CU4H 4HCRL 3VI3E 2P5WD 3TIDB 1LK2A 3HZYA 4OBRA 1U8MB 4FQ2H 4LEOB 3C2SA 3VJ6B 4ZPTA 5F9WC 2CIIA 5I1AA 5ESVB 1Q9OB 3OKMB 2JJSA 3QUXA 3OWEA 3NOIA 5C0GA 4JAMA 4XXDA 1AE6L 4ZUUA 4PRHA 4BSJA 5JXAL 4UU9B 4F58H 5D1ZA 2PXYA 3WE6B 1QOKA 4U3CA 4XP1L 2BY0A 4KKBC 1DUZA 1VGKB 3VDBA 3FFCB 4Z78B 3CJJA 5GRJH 5LQBL 1JNJA 4UIKL 3BPNC 2VIRA 4Q9QH 5T33H 1XF4B 1FAKT 5I6XC 1BFSA 1BFVH 1IAKA 2R1YB 1KSRA 2VDNL 3MRMB 2DWEB 4YDLC 4QRRD 4XBGA 1Z2KA 4J1UA 3B3IA 2BVOB 3F58H 3HI1A 1Y18A 4XP9H 3S98A 3KYAA 4HKZB 3I84A 4XP4L 3U9UA 1J1OL 3PV6B 4RGMB 3RY6C 4YQXL 2NZ9D 1ZT7A 4G7YL 1H8SA 5DJDA 3T3MF 5SX4I 4J3VA 3RDTA 3LB6D 4ZO9A 4YHYC 4LSUL 3QNYB 3UPCA 4ODTL 1RZJH 4P46A 3OKLA 2WQ8A 4QRQA 4YAQB 3HC3H 5HDLA 2DQHL 1UJ3B 1P1ZA 1IAOA 5C3TA 5J11B 4XBPB 3BO8A 3S88L 3NIFF 2VDRL 4OGAC 5H37H 5F7DB 1BFTA 1B0GB 4U6TA 3MA7A 3SCMC 5FV1L 5DJ6A 3HCVA 2XXMB 2MOVA 1JI2A 4Y4KC 3X3GL 4CMHC 5GGQL 3DPBA 5HBBA 4Q6IB 4XMLL 1KC5L 1UQSB 4GS7C 1XR9A 4GRWH 3O9WC 1F2QA 4LCWE 4N5EA 3W5NA 2FD6H 1P7QD 4XPFH 2ICEA 4X6DE 4OFDA 5F96L 1U8OB 2WBJB 2ZUYA 3VE0A 2R2BB 4L3AA 4YHZH 4QGYA 4IRJC 3RZCC 3MYZA 3T77A 1XGUB 3GMLA 2FO4B 2X4QA 7FABL 3NBNA 4JFOB 2CLZA 5C0RH 5JHDD 4E5XA 4UV4H 4ORGA 3MJ9L 5JO5B 1F2XK 1XCTA 2AJZA 4FFWD 2XWTB 2EKSA 1WEJL 3QHFL 4JZOA 1DQQA 1K4CA 2VSDA 3QFJE 2W60A 5GS0C 2VWEE 5HVFB 1MIEH 3DVNA 3C6LC 5HHPB 4Q9CA 5KVFL 2GY7B 3ROLA 4GXUN 2A83B 3U79A 1WBXB 2HVKB 2OTWB 1CL7H 4GW1B 1A6VL 3SGDH 2EO9A 5BRZA 1IEBA 4MJ6A 1C5CH 4PR5A 1HHKA 1D6EA 2NXZC 4Y8AA 4RFNC 3IYLW 4KZEH 4KDTA 1RUAH 4PP1D 1JHLL 1NGYA 1KPUA 1AFVH 1X4ZA 4MJID 4OZHF 4YHIB 4I0KA 3QIBA 1Q72L 4P57A 4YPJA 1QRNE 3GJEB 3TT1H 5KAQG 4HX1B 1WZ1L 3MNWA 1E28B 5DSCA 1VESA 4WI8A 3V79C 4Y4HA 4BZ2H 3WJJC 4PLJD 1LP9F 4P5KB 1S7UB 1QEWB 1I1YA 3CVHL 4JRXA 3C5ZA 5M7QA 3MXWH 1J1PL 4X8XA 3D3VB 4NN5C 15C8H 5I1KL 5KJRH 2YPLD 3QULA 4ODWA 4BSWB 5M95B 1ZHNA 2BERA 4PB9L 3EUUA 1FHGA 1IFHH 5DFWH 4FQJH 3BZFB 5I8OL 4Y88A 3ARFA 3GKWH 3TNMA 2W07A 3T8XB 3TESA 2EXYD 2D7PA 3SKOA 3TJHD 1AHWB 3LRHA 5F1NB 3W2DL 5GXBB 5F7LB 4EVNB 3ARBC 1P53A 4KI5F 3GHEH 5KSBE 1ZLVH 3UXFA 2F58H 3VXQB 1YYLL 3EYSH 4IMKA 3RZWA 1UWXH 1Q0XL 3TF7A 5D2NC 5C0JA 3LHPH 4P9HC 1W72L 3L5XL 1DTUA 4P57B 1KEGH 1I1FB 4K7FA 4UTBL 3C2AL 4R4NC 1FCGA 3ARGA 4FQHB 1A7PH 3OKYA 4Y4FB 5TE6L 3LN4B 2XQYG 3TN0B 3UYRL 3VG0H 1P7HL 4QRPB 4HUXB 5E03A 3CMGA 2IPKB 3MRRA 4HHAB 3U83A 1IM3B 3B43A 1HKLL 2YWZA 2ZCHH 2J8HA 4Z0BH 2Y4SA 1BJMA 1MIML 5FIEA 4KKLD 3CDFA 1TETH 3CXDL 3RTQD 3OZ9H 4IOIB 1MAML 4IHOA 3JTSB 4YX2H 4HUMB 4C56A 1SYSA 4DUWA 1P6FA 1MNUH 1I7ZB 2VLLA 1ZVSB 1JPGA 3VGAC 1CDJA 4ODWB 4HK3N 1CD0A 2VC2L 4QOKB 2DTMH 5C0FB 5I71C 3NA4A 3RNKB 4JZNB 3INUL 1FFPA 1FRGH 4HUUB 4RGND 4MNQE 3RWHB 3BZDA 2ENYA 1MQ8A 1A1OB 1G9NL 3QXUA 3IDUA 3TPKA 2K7QA 4KK8D 2DJ4A 1A47A 2DN7A 4X4YA 1TNNA 4RFEB 1BZ7A 5DJYA 3WDHA 1S9KC 1CXIA 1WFTA 5GRVL 4NKQB 3NIDF 3QG7H 1ZHKB 4I77H 4LQFH 4MNGA 4JHBA 4K7PL 3AM8C 3MBXL 4PJ7A 5GGTL 1AC6A 1R3LA 3I9GL 1OLLA 3BPCB 4WU7A 2HH0L 3GSOB 3QDJD 4Z9KB 4XPHL 1DE4A 2VITA 4LKXA 3UYOD 2YWYA 5I1EL 5EOCJ 1CDGA 2F53D 3CXHJ 4MMXC 1WIUA 3EDKA 4WEUD 3LKNA 3SKUD 1R3KA 1D6VL 1YJDC 1T3FA 3DIFA 3MGTA 4G9FA 4S1QL 3CFEA 2VH5H 5DEGB 2Q20A 2SEBB 3NFSL 4X6CB 3CCHB 1RZKC 2JELH 2YS4A 4GKZA 4XNXL 5I1HL 4MQXD 4OJFL 5I9QC 1TXKA 4MXWH 5T1DH 3V4VL 1PG7H 2DLGA 1BJ8A 3NABL 4OZIE 3SDCA 4QXTA 2OZ4H 3HUJF 4MAYB 3ZKQD 5J6GA 1JHKL 1YEEH 1KN2L 2HLAB 1W0WA 1CL7I 4UINL 4CL7A 4KI5E 4JLRB 3VXSA 4NFCA 3ARXA 5D71H 4S0TD 3ROOB 5FM5O 5HHMD 1AH1A 4N0FB 4ZOAA 1T89C 3Q5TA 2FR4A 1X9QA 5ACMA 4H0HB 2QR0B 1UXWB 5DRNB 4QWWD 2A6DA 5DC9B 5EC2B 3NTCL 1X4XA 4JKLA 4UOW0 5ESQB 3NACL 2HT3D 5IWLA 2Q7NA 4UUJB 4JEGB 3SDYL 1DR9A 4FXKA 3SHSA 4F37K 4NQSA 1B2WH 1XF3A 4ZYKA 2FX7H 1T1WB 2IQAB 1CDHA 1U9KA 1WT5A 1ES0A 1XZ0A 3HE7C 3RPKA 3BAEL 1OP3K 4LHQB 5JLZB 2VITB 3WS3B 4PJCF 3D6GA 4JFYB 1F00I 1G9MH 4RDQG 4JM2F 5JW4N 1KB5L 1A7RH 5D1XB 3VFUB 4C59B 1DANT 3A6BH 3MCKA 1B4JH 2VR5A 4PREB 4TULH 4YZFE 4MVBD 3ET9F 4GMSL 4U1MA 3VFTB 1BD2B 4I0PA 5I74B 3ARRA 5C7XH 4L4TB 2I9TA 3E3QE 1JE6A 4D0BA 5DVKA 1N0XL 3B9KD 3PHQB 4IOFD 1EVTC 5JW4R 2ARWA 4M5ZH 2Z8VC 1DVFD 4K71B 2OYPA 1MLCA 4KAQL 2DL2A 2HVJB 4O00A 1X6NA 2CK0H 5CIPH 1NLBL 2Y5TA 3HHRB 1MJ8H 3E2HC 2FR4B 4I3SL 3TCLA 5ENWA 4M61A 1MH5B 1FGNH 3S9DB 3BSZH 2YPVL 3BXNB 3ULUF 1OAZL 1RK1A 4ZO8A 2V5RA 1LO5B 3T65A 2X4UB 2IH3A 1IGIH 2AJUH 2K9UA 1QVOB 2NTSP 4HIJA 4KKCD 1KT2A 1INEH 5MEPA 3DTXA 1JRHH 5GSRB 1T83C 5I30L 4L3EB 2H3NA 3SDDA 1KIPA 1ZLVK 1K6QH 3MPCA 4PG2C 1A7BA 5H2BB 5CGTA 1UWXK 4OF7A 3U6RB 1OQOA 4YIQA 5KSAC 5BQ7B 2VNCA 5E1AA 1UWEL 3S36L 4DW2L 2Y07H 1S9XB 2OTUA 5CD3B 4NGHL 3TC9A 3VFSB 3ESUF 5C6WH 3MV11 1JPTH 3BQUC 2FWOB 4NZTH 1GHFL 3CMOL 3PUCA 4K3GA 5AWNH 4LLUB 4QTIH 3MV9B 2VXSH 3PG2A 5DD0H 3DRQB 4RRPA 1DCLA 1SJHA 4LDOB 3BP6B 5I8EA 1QFWM 1MFEL 3WFEL 3LV3B 4K55A 3O4LD 1YEFH 4KJQC 5DMJB 1ZA6B 1K3IA 2ADIA 4M61B 4R4FL 1JZ2A 1T5XB 2I60H 3QNXA 4JO2L 4LSRL 1X3DA 4PJFB 3GNMH 1XGQB 4HKBB 2VAAA 2BFVH 1E4XL 4OF5A 4U1NB 4PRPA 3NVQA 2H1PL 1HSBA 1T03H 4LF3A 5HGAA 4N8VB 3MA9L 4M6ML 1EFQA 1HI6B 3AROA 3TBYA 2Q6WA 2VLRA 3G6AB 4W4NA 3EYFB 5D70H 4IIQB 1K8IA 5ALCL 3KPLA 3VXRD 3DO7A 1CD8A 3HAEG 5EIQA 4C55A 3EYUH 4Y8DC 5C0CB 5GS0L 3MJ6A 4PB0H 1PY9A 5FO7B 3UO1L 4G6KH 3C60C 5ELIA 5E1AB 1TQBB 3NH7H 2V6HA 3QUYA 2BMKB 3CLFH 3VWKB 2FIKB 4BQ9A 4KRLB 4AT6A 2I27N 1AGEA 1U8QB 2GYSA 3LS4L 2IPTL 2AK1H 3CFIC 4K3JL 2I07A 1RUPL 1MI5E 4HLJA 4DN3L 4WV1B 4QHKJ 5JIIA 5J13C 3FN9A 4KK6C 1MCWM 5JW5B 5JOPE 4G6MH 1H0DA 2BJML 3HE6C 3ABZA 4UT9H 3B6SB 3LKRA 4PLJC 1NMAH 3BZ4B 2OR8A 3RL2B 5EU7C 4X7SL 1IMHC 5FF6A 3AREA 4KROC 5DWUH 3PQYA 4EN3A 4HEPG 3U2SB 3GSNB 3R0MA 4N0CD 4OAWB 3MSPA 1F6AA 3B2VL 1INDH 1FVDA 1RVFH 5ICZA 3IDGA 5ACLA 2HFEA 4FOMA 1V3MA 1VADA 5B3JE 2KH2B 1R3HA 3IU4L 1MAKA 4X4XB 1CE1H 1RULL 3QG6A 3DX6A 3KPSA 3RHWK 3ARDD 2IAND 2P5EB 3X14A 3FRPA 4P5TB 4AEHL 4XVUD 3VFNA 1G7JB 2JJSC 2HYMA 2VQ1B 4TYUA 4OLUL 1F97A 2PCPA 3FRPG 1U8JA 4G6AD 4LEXL 4OD2A 1QACA 4TSBH 4YXHL 3G6DL 3DURA 2Q76A 4FG6C 1UACL 5D1ZC 5IHUH 3GM8A 2CH8A 3DUUA 1IGMH 3SBWA 2OCFD 2JJTC 3ZDYF 2H6PB 3VWJB 5ACZB 1NFDB 3PJSA 4GBXA 4WI6A 5KBNC 1IQWH 3FFCE 4TQEL 3RVTC 1FG9C 1E4WL 3OBAA 4ONFL 4P9HL 4PJ9A 4HWBL 1FPTL 1CFTA 4IM8A 1EGJL 4KUZH 3PGDB 1DN2A 2E6JA 4NO0A 3M17B 4HXAH 4GAGH 4NC0B 3IB4A 3SDXF 4YBLC 4J3OC 3TVMD 5LVEA 3Q6FA 2H41A 4GRMA 4XC3L 3PDOA 5E56A 3JWOH 3THML 5HGHB 3LN5B 3DRTA 4OCNC 2KQNA 3EHBD 5I8KL 3VI4F 4HFUH 2MQCA 5ITBL 2ITCB 1RIVL 1CQKA 4HCRH 4KXZH 1FZJB 3RDTC 1X5IA 3B5HA 2XXCB 5FHAL 2CDGB 3JV6B 4HUVA 4OI7A 4P46C 1QFUL 5EU6B 1EIBA 5IJKA 5KTEL 4C83A 2GSGA 2GJ6A 1U95A 3CSGA 4KUCF 5D7JB 1ULVA 1AE6H 1TPXC 2XY1A 2NY2C 1PKQB 2W38A 5JXAH 4MDJA 4XP1H 2DQUL 4KJPD 3BEWB 3MOAL 5FO8A 1MUJA 3RWCB 1TVHA 4HWUA 1BPVA 3RFZC 5LQBH 3ALXA 1I3GH 2EECA 1YUHB 4UIKH 4P59L 2B4CC 1NMBL 1DEDA 5MENB 5IT2L 2VDNH 1KLGA 2MKWA 3NIGF 3IXAA 2ADFL 4OZHA 4WI9A 3GHBH 1T0NA 5CFHA 3TJEL 4NQEA 2HG5A 4XWGH 1BVKA 4XP4H 1J1OH 4WEBL 4TSAL 5EG6C 3T4YB 1L9NA 4KVCL 3OL2A 4YQXH 1RZ8B 1OCWL 1RZKL 4G7YH 1QP1A 4FFYL 5EN2B 3QZWA 3RVVD 4URTB 2AXFA 5IMLB 4JN2B 2DQDL 1EHLL 3VD7A 1LP9A 3HG1A 4LSUH 3QZWG 4P2CG 4ODTH 5GJSL 3V0WL 3WBDA 1A6UL 3TO2A 1S8DB 5E9DA 5IJVA 1I4FB 4YFLI 5JZ7C 1C5DB 2DQHH 3BHBB 4LCWD 3SE8L 2MQ3A 1NGZB 2YC1B 5HJ3B 4X4ZA 2FB4H 3CFBA 3GSWB 2VDRH 2M8XA 3H3PL 1OTUD 3G04A 3QQ3A 1DP0A 2W0FB 5C0NC 4HDIB 4OKVA 1T04B 4JPVL 1MSPA 5K9KB 1G1YA 1PKOA 3X3GH 2AI0L 5GGQH 5GRYA 4S1DD 2BNUB 4XMLH 1KC5H 1DEEA 4PGBB 3UBXA 2OL3A 4L8SB 4NQTA 4HH9B 4OLVL 4KDTC 2CLVA 3OHXB 1LHZA 4KRMB 5MHSE 3QEUB 1LO2L 1MJUH 3LD8C 4O2CA 3SKMA 4G8FA 5B38G 5F96H 4NQXA 3QIBC 1BJ1H 3IXAB 5FK9B 1BX2B 4X9GA 4XP6L 3KLDA 4XNQB 1SEBB 3QFJD 3PWPA 1AXSA 5I0ZA 3OX8A 2HFTA 5F6IC 3BP4A 3O8XA 4Y4HC 4Z7WB 1WBZA 1LEIB 2XWBB 2OR9H 4QHLB 3GMRA 4AIZA 3P9MB 7FABH 1ZT4A 4P23B 3FT3A 2BVQB 1TZHA 4WUUA 5GIRA 4H25B 1BIIB 2VAJA 2IFFL 4HUWB 3D3VE 3WS6A 3ZKXC 1NL0L 5IM7A 3MJ9H 2NZIA 6FABL 3O11B 4LSDA 4M1GL 4LDLB 4M3JA 1WEJH 3HS0A 3O0RL 1UENA 3H9SD 1RIUL 1VKXA 4P2QB 4PJGB 1QRND 4X6CF 5E8PB 5IB2A 3FO0L 1KJ2B 2DTSA 5KVFH 2V17L 4G5ZL 5AG8A 3J7HA 3VFVB 4GKNA 1A6VH 3QUKB 2YOCA 1K2DA 4OCSL 2DD8L 3MRDB 3OGCA 3IDIB 3ILPB 2KBGA 1RHFA 3BDXA 1YEIL 3RVXC 5HYEA 4XVSL 2X6MA 4ODSL 1JHLH 2R9HD 1Z9MA 3OJDA 1MCPL 1Q72H 3JV0A 2Q8BL 3MJ8B 5HGGS 4NOBA 4CMMB 1WZ1H 1ORQB 3O2DA 3ARGC 5AAWA 43C9A 3QIWB 4GO6B 1FO0A 5T1LB 4KXZI 4QRPE 1XH3A 4CADA 4I9WE 3B4NA 3CUPB 4FQQB 5C92A 4WW2B 1ZVHA 3VG9C 2JLLA 5E6IB 4AM0B 4Y2OA 4HFWB 1BBJA 1CFQA 3CVHH 3LRSA 1J1PH 5I1KH 1FZOB 3C9NB 5CINL 4O51A 4QF1B 1CGWA 3Q2CA 4Q7DA 4JDZB 2XACC 3VFGL 5C09A 4IJ3B 3ES6A 4PB9H 3B2UC 5H94A 5KSVB 3HUJA 5B4MC 2H2PD 2NQCA 4QOKE 1GH7A 2ERJC 4YNYB 5CZKA 1CT8B 2PKDA 5I8OH 1O7VA 5LG1A 1BVZA 5TDPB 4JQXA 5IQ9A 3WL9A 3KS0J 4OUOA 3W2DH 3QUZD 2BSSA 3AC0A 5GRUL 1EXUA 1X5JA 1BIHA 5JA8B 5CKGA 4ODUB 1AD0B 5J56B 1YYLH 5BV7C 1J86A 4EBQL 1NGXA 1Q0XH 5HD8C 5C08A 4L8DA 4HGMA 3IS0X 1W72H 3L5XH 3B83A 1T66C 4UTBH 5KVDL 4DZBA 3C2AH 4NNXA 5J1AA 5TE6H 3UYRH 4R4BB 4ELMF 5F7KC 3H3KA 2WP3O 3UTTA 3ARUA 2QEJA 3HPJB 1NJ9A 4I5BA 5F6HI 2DM7A 2H9GB 4LLWA 1ZLWH 4MNQD 1FO0B 2Z4QA 1U92A 4K23L 4U0RB 2YD3A 2MCPL 2QKIA 3RWFA 4ZG1A 4PJCA 2D7TL 1MIMH 3WIIL 2RQ8A 2IH1A 3UTZA 2BC4A 4JM2A 3RP1A 4WDIB 3RIFF 2FEDD 3L95A 3D0LB 4X6CE 5E6ZA 4XC1H 1P5VA 1N8ZA 2JK5A 4XWOC 4ZXBB 5CJXC 1AR1C 4OSUH 2UY7A 3PIQA 4AZ8A 1LD9A 3O6LL 3ZHKA 1BVLA 5JTWA 4UDTB 2VC2H 3SDCC 3PWJA 3INUH 4U6HA 5FHBH 1WVZA 1G9NH 5A16B 1J18A 1G6RB 3CLEL 3DARA 3MQIA 4QHMA 4YR6A 3QPQC 1B0WA 3GMQA 1BREA 5D6CB 3CFKB 3MUY1 4DKFL 5GGSA 4N0UA 4LU5L 4ORZC 1EFXA 2EEAA 1UXSB 4NCDA 4GKOA 1KB9J 3IJYB 3STZA 5IWLC 5KSUA 1B6DA 4D8PB 1RZFL 1Z5LA 1AKJD 3MGOB 3VFPB 4K7PH 5CHNA 4GQPH 2B1HL 3MBXH 5GGTH 2VR4A 3I9GH 4MD5A 4PJ5A 4FTVD 2HH0H 5SV3A 4I18B 5C3LD 2Y9RT 3O3BA 4XPHH 1JWUB 4KI5D 3FZUD 4N1CA 5GGSY 3IFLL 1D6VH 4ONOA 4S1QH 3X13A 1N2RA 3MRLA 3NFSH 4XNXH 1MOEA 4XB7A 5I1HH 1E6JL 1U8PA 5B39G 4I4WB 1ROWA 2YMXL 3IT8D 4OJFH 3H0TA 5DRZA 3GSUA 3HLAA 4I0PC 3WUWA 1FN4B 1BOYA 2JK5B 5E4IA 1BD2E 5EPMA 5SX5H 3V4VH 5DK2B 2H8PA 4DVBB 1M7XA 3PWLB 3NABH 3ME0A 1LD9B 4L4TE 3C6SA 3LSOB 3WUWG 1JHKH 1OB1A 1KN2H 4X7CC 4DTGL 3O3AA 3BH8B 2CK2A 4WO4A 3PWJB 3ULVF 5EIVA 4L3CA 2X2YA 1AI1L 3MV7B 5J89A 4G8IB 4U0QB 1HH9A 2VXQL 3NTCH 2DYPD 5EUOF 4LBEB 5DI8A 5FOBA 3NACH 1OHQA 4JHWL 1WC7B 5F1IB 4NQCA 3SDYH 4ZAKB 3QA3A 2VLKA 3LQAC 2N56A 2VISB 1SM3L 5FYJE 2XZAL 5GS1A 5AUMB 4EXPX 3WV0A 4Z77A 3SDDC 2YBRB 4LPCA 4L3EE 3BAEH 3SGJA 2Z31D 2NTFA 3TO4A 5FDWA 4XHJC 2XTJB 3UTQA 2XG4A 1KB5H 1C16A 1JPFB 1P4IL 4NBYB 1DDHA 1Q9KB 4GMSH 2FGZA 4WI4A 4M1CC 3BT2L 3OB0K 3EGSB 2XZCH 2R39A 3QUMB 5F7NC 3W39A 3UAJC 1FH5L 1N0XH 1EV2E 4HULB 5F72S 1NAMB 1CF8L 2B4CL 4NRYA 4MMZC 4B7LA 1HCFX 4PRBA 2AK4B 3WIFA 4U4BA 5C6PB 1A6AA 3HAEH 1JGLL 4KAQH 1KXQE 5TQ0L 3MV9E 4HIHA 3I2CL 1R3IL 32C2A 1TMCA 1NLBH 4WEMB 5I18L 1FL5A 3QWOB 4NKDB 2YPVH 1ITBB 1OAZH 1BOGB 2X4SA 2I5YL 1NFDF 3G9AB 4KGJA 1S9VA 2EE6A 2EZ0C 5BCAA 4KK5D 5D7IB 1M7DB 4PJFE 4PP2A 2OSLA 3TNNA 3O2VL 5LAXA 1WFOA 3G5YA 5J8OA 5I30H 1SY6L 2LV4A 3QIUA 4W6YB 3P4NB 5C07B 3MMEB 4J8RB 4M02A 5IQ7L 3MGAA 4PRDB 4Q97A 5D9SB 1UKQA 3C8KB 2VABA 5C0CE 1UWEH 1GOGA 3WNLA 4P2RA 3S36H 5AZEL 4UIMA 4DW2H 4AEIL 3LQMA 2NY4B 1WK0A 3QUYC 4NGHH 3ULVE 2C1OA 1MCNA 4BH8B 1X7QB 3GKZA 3PL6D 3L3DB 4PJBB 1LE9B 1UZ6F 1T2QL 1CGVA 5FUCE 1X4YA 1G1CA 3DECA 2VLME 4P2OD 2CDEA 1U6AL 2P7TA 1DUYA 2PTUA 4JZJB 1GHFH 3CMOH 2P8MB 4KPHL 4M8QA 2M1KA 4JRYA 3QJFA 1R5VA 3ZKMD 4PJIB 4JY4A 1OGAB 1MFEH 2WBKA 4YUEL 3WFEH 5DMIH 2UZXB 4R96A 3BUYA 3L5IA 4YHOL 3UTPE 4KHTL 4TSCL 4U1LB 3WIHH 4MCZB 4NO2B 4R4FH 3TA3D 3CDYA 4LVHB 3HPLA 3F12A 3AREC 1H3VA 3CGTA 4LSRH 4JO2H 4EN3C 3SDXA 2IALA 5SWSB 1E4XH 2FZ3A 2H1PH 4MXVF 4PJEA 2VXVL 4PP2B 1YA5A 4PTUB 1AGDB 5GRVK 2V2WB 2EIEA 3MA9H 5FA4A 1N5AB 4M6MH 5FKAB 2ICWA 5FM8A 2BXYA 5ALCH 5IW3A 3OKOA 1MI5D 3BIBX 1A02N 5GS0H 4JFHE 3ECBA 3UO1H 1M4KA 4HF5L 2P5EE 1FCCA 1DBMH 1NFIB 5JOPD 1BZ9A 1HSAB 3T1WA 3F65A 4YE4L 3V0VA 4K8RD 2QL1A 4H1LH 4AIOA 5ADOL 2XN9B 4Z7NE 3LS4H 3GJFA 2IPTH 4JY6B 4K3JH 4HW6A 1MCQA 1PZ5B 1RUPH 3SBWC 4R3SB 3Q3GB 3T4AB 4ENED 3R4DA 4JFEA 4RBPK 4N8PA 4GBXC 1NFDE 3IAPA 5DYOB 1HILA 2P4AB 4PGJA 4CW1B 2BJMH 3BP7A 4G43A 4PJ9C 5E7FA 4ODHL 3CZJA 4X7SH 3AGVA 2G75B 3HNTL 3L3GB 5CCKL 1Z3GH 2J88L 2Q8AL 3B2VH 4X4MA 3UP1A 2IGFL 3KYNB 3RVWC 4XBEL 3IU4H 3ZSSA 3JUYA 4LLQB 1LWRA 3ZE2F 1HYRC 1RULH 3CSYB 5EIIB 3VRJB 1WWWX 3FFCD 3WNPA 4AEHH 5EU6E 3WYRA 4OFYA 4OLUH 4Y19A 3OAZH 1A4JA 4LEXH 4TTGA 4K9EH 5JUEL 4YXHH 3G6DH 3S37X 1PKQE 1UACH 4LCUA 5E8EA 2EIZB 4CJ1A 3WKNA 1BEYL 5EZLB 5IVOA 2LFGA 4CUCA 4Y16A 4LVOB 3GSRA 1OSZA 3MACL 5BV7L 2E7LA 2EDJA 4TQEH 4LLYA 1CICB 4NO3B 1JFMA 4P9HH 4PJGF 3I6LE 5T1KA 3DX8B 4HWBH 1FPTH 5MENE 1EHXA 1EGJH 1PLGL 1I1AA 4LCIL 2YD1A 1NUFA 3T09A 3IDNA 2BDNL 2JB6A 4BFIB 1S7WB 4OZGA 4WHYG 3FOMA 4NO5B 1IGCH 1H5BB 3QUXD 3THMH 3W9EA 4ZUSB 2RB8A 5I8KH 5ITBH 3KAAA 2HKFH 3X11B 2R23A 5EB9A 1KLUA 1QG3A 1RIVH 1PFCA 4IDJL 2PXYD 3VXNA 5I16A 2K3TA 5FHAH 5I1DA 2ZSVB 2XNAA 1QFUH 4NQDB 8FABB 2XFXB 4MJ2A 5KTEH 3L3OB 4MNHA 5F1KC 5I1IL 2KL6A 1O7SA 4MJ5B 4R6UA 4DWHA 4F3FB 4FFEX 2DQUH 4E0RB 2WBJD 3MOAH 1FG2A 4HWZA 5C0AB 4S1RL 2VZ3A 4AG4L 3UTSB 2NY0C 4K94C 3GUTA 1RUKL 3WLBA 4B41A 4FMFA 4HAFA 4OD3L 1J5OL 4YBQC 4P59H 1OSZB 5FYJL 1NMBH 1TVBB 5ID0A 1FNFA 1U93B 5IT2H 1ZVYA 4ZSOB 5IOPA 3K0WA 1WBYA 1N0LA 2GTWA 1ZTXL 4KRPC 4Q6YA 2ADFH 1E4XI 4PY8J 3TJEH 1JL8A 3C5SA 3MRKB 3CXHK 4TSAH 4V2BA 4WEBH 2EDNA 5C0EB 1Q0YL 2IQ9L 1J0IA 3AVEA 1YY8B 4KVCH 2A0LD 4OZGB 2A6IB 3NPSB 1OCWH 4UAOB 5HPMB 3O8XC 1RZKH 4FFYH 4Z7WE 2P46B 3VD9A 5C71A 1TQCB 5E7BA 2DQDH 1EHLH 4X7FC 3P0GB 1MFDL 5I75C 1YN7A 5GJSH 3V0WH 5ISZB 1A6UH 3WS6C 3RWGB 2GK0A 2ZUVA 1JN6A 1LO4L 1ZXQA 4HG4J 5MHSD 5CZVL 1KTLA 4O2EA 4KJWC 4ELKB 5KVGL 3QT2A 4RISL 3I50L 3T04D 3QO1A 2D7QA 1NEZB 3PGCA 4XVTL 3H3PH 4N5ED 4YPGB 4ZFOA 4P2QE 4PJGE 4POZD 2JIXB 4JDVA 1EBPA 1WWAX 4JPVH 2EYTB 2PYEB 4YK4B 2AI0H 2PTTA 3E3QC 2QTEA 5DUBA 1AGBB 2H32H 3O3EB 1DFBL 5JNYA 5ANMA 3KWWB 3RL1A 4OLVH 1YPZB 1M71B 3BYYA 2Y7QA 1C7SA 1RJLB 5DHYB 4AH2B 3JV4B 3D3VD 4Z18A 1S5HA 3WD5L 1RJYA 2P47B 4OT1L 4Z76A 5IG7B 5L2KA 4XP6H 4QKXB 2HTLD 3KLSA 2CO7B 2FATL 4MD4A 2HRPL 1JHTB 1QA9B 3BH9B 1F4YL 4ELMA 1HQRB 5DQ9B 3S6CA 5C0BA 3A6OA 3OJ2C 3P4OB 5EDXA 2VMFA 2FL5B 3DMMA 4NPYB 4RMWA 5D93C 1EEQA 4FQIL 4QHUA 1NL0H 3MUGA 1LQVA 1LK3L 3MLYH 6FABH 3V8OA 4M1GH 1JK8A 7CGTA 5I1LB 5BRZD 2JTDA 3O0RH 4G6FD 1RIUH 1E4KA 4NBXB 4AEFA 5K9QI 2IBZX 3FO0H 1TJGL 4KK5C 2YD2A 2ZOLA 2V17H 4G5ZH 4XNZC 4JQXC 2AJ3A 3TYFB 1WZKA 1JF1B 1F02I 4TUJB 1T1YB 5J6HB 3GSNL 3QXWA 4OCSH 4Y4FD 3TN0D 3QXDB 3U7YL 1JWMB 2DD8H 4QRPD 3OR6A 1YEIH 1KGCD 4LARL 3RKPA 4I9WD 4APQC 1AGCA 4P9ML 3ZT6A 3RIAK 1KBGL 3LQZA 4XVSH 4OUUA 5JNYB 4ODSH 2RBLA 3BOVA 1MCPH 1P7KA 2Q8BH 3C5ZD 1Y0LB 4Z76B 3DV6B 1NKOA 3LDBB 3D1MC 3L7FB 3QO0B 1MCIA 2DQCL 4QOKD 5CP7B 5DD3L 2NY3D 3DROA 1OAUL 4TNWK 1FNLA 5CWSA 3V6OE 4PLOB 5EC1B 5AD0A 5BS0A 2FEEL 3SEPA 5FDYA 3QQ9C 3ARFD 4HSQA 1IL1A 1FE8L 4JM2C 4IBLT 1AO7B 4WNQA 4P3DB 2X4TA 1H3UA 2A77L 2Z35A 1UM6L 4KK9D 5CINH 1R5IB 2AJXL 3VFGH 1T80A 1IARB 1CGYA 5BW7A 2JJUA 3RWIB 5DQDL 3MJ7B 1M7IA 1S7TA 2CLRA 5ERWA 5K9OB 4M7LT 5LKNA 4M7ZB 1RIHL 2EEDA 1WISA 2NLJB 4HIEA 4YHML 4YGVB 2ITDB 5DDHA 5F9JB 4YDVB 1KF9B 4WFGE 1QBBA 5GRUH 1YY9D 3GSXB 1A9EA 5EUOA 4U31A 1DSFL 3ULUC 4KY1L 4EBQH 4UILL 1RZGA 3WNNA 5L6YL 1U8HA 3KXFA 3OTTA 5KVDH 2GK2A 2WINB 4OF0A 1YZZA 1P9MA 4OF3A 5CP3H 4QHKI 2PW1A 4JPIB 1D9KB 4MAYD 4K23H 4LRNL 2OP4L 1HXMA 3OR7B 5JDJA 2MCPH 2EH7L 3O81A 3K8MA 2D7TH 3WIIH 4OZFA 3X12A 2W0PA 3HR5B 3T2NL 1F3DJ 3V5KB 3FFDB 2IG2L 5DT1L 3EJZC 4YDIL 4CU8A 5CIPB 4FXLA 3O6LH 5J3HC 3WXVL 3H9HA 3ZYZA 4DFHA 3FO9A 3L9RA 3MRNB 3GMNB 4LHUA 4F7CB 1I3RA 3WCYA 1YN6B 3K81A 3EDDA 1KIQB 4WO4C 1AR2A 3CLEH 5E2WL 3U82B 4EDXB 3LZFL 2JCCA 4Y7MA 3QI9A 4DKFH 3MV7E 3C5JA 3IU3B 4PGDB 1BFOB 1CFBA 4LU5H 4OFKA 2AEWA 3B8YA 3EYVA 3PDDA 1L9MA 4UB0L 1KLFA 2LTQC 3G5ZB 3SQBA 4EJ1C 1DQDL 4YFEA 4JFDA 3BEVB 1LE5A 1RZFH 3L5JA 2KUTA 1CXHA 5IROA 3U46A 4OCXL 3DV4B 1ZGLB 3C8HA 5D1XD 4G9FD 1UB5B 3BFOA 2B1HH 5I73C 4P99A 2PYFB 3HNVL 1BD2D 1XGYL 4IRSA 4NKOB 3VRIB 5EOQL 4BSVB 4L4TD 5IHLB 1CGTA 5EOTB 1RK0A 2Q3ZA 5AEAA 3IFLH 1KN4L 2ZOKB 4LGPB 3H7BB 2XTJE 3LKOA 2N7BA 1E6JH 2YKLL 2UZIL 3EO1B 4MJ4A 1MVUB 3D18A 3MLSL 3OXSB 5IB1A 5HSFA 3SKNA 1QLFB 1N7ML 3WHXB 1ZHLB 5D5MF 4OCYL 5E94B 3MBEB 5IVXB 1S7XA 5T3ZE 5F7WC 4DTGH 3QDMA 2EDOA 1HOCB 2XWJA 1QHOA 2Y25A 4R97B 4B50A 4BZYA 2RIKA 5FYJD 2AK4E 1WV7T 5EBLA 3F7PC 5GS2D 3HRPA 1PQZB 1AI1H 4L3ED 2I26N 4U6YA 4PLKD 3OF6A 3HTLX 4MLSA 2VXQH 2Q7YA 4BFEA 5DK3A 4MA3A 4JHWH 3U4BL 2AV7B 2BVUA 5D2LB 4ZFFA 43CAB 4JHAL 1A3LL 2VDML 1CFNB 3R06B 1GGUA 1T1ZB 5D7IE 3HZMB 1OF2A 1UVQA 3K74B 1SM3H 2XZAH 3JXAA 4JGMA 5I2IA 5HYSA 1JZ3A 1BF2A 5KS9B 5H35B 2HKHL 2MPAL 3QIUC 2VERN 4LLVA 2MWCA 4X6BA 3MRBA 5C07E 3T08A 2P49B 3ZYJA 1FNEB 2QQNL 3C09B 3O41A 1TVDA 3CU1A 3MV9D 3L5WB 1MCKA 4OCRL 3MNZB 1HHIB 1P4IH 1WIOA 3EDJA 4V1DA 4NFBA 4F9LA 3BT2H 4WHTB 1I7TA 5IB1B 3RAJL 1DL7L 4PJBE 4WWKA 3MRFA 3O3DB 3PP3H 4ZO7A 5IMOB 4HUKB 4KMQA 3TIEB 1FH5H 4DK6A 1N3NB 1WAAE 1CF8H 3MRPB 3U36B 3KYMA 1IKFL 1XAUA 4NWTL 1JGLH 2M2DA 5TQ0H 3RVUC 1R3IH 5KOVC 1J88A 4GRWF 4PJIE 5C1MB 5I18H 2CUIA 2W0KA 3TWCL 1OGAE 3BGMA 1G7PB 4NKMB 2GITA 2FH6A 3V6BR 2I5YH 5C0CD 4D9LL 3WFHB 2ILLA 5HHVL 3J8F7 1KTDB 1OGTB 5FB8A 3ULVD 3GMMA 5SWSE 1C12A 4OTXL 3O2VH 4X6EB 3VWKD 5IV2A 2VLMD 1SY6H 3G5XB 2J5LC 4ZUVA 2P24A 1E27A 1KJ3L 4LLVB 4XZUA 5IQ7H 1SJVA 2QQLL 3PABB 3ULSA 1JYNA 1T0PB 3IJHA 4RGNB 5AZEH 2NR6C 4XCCL 4AEIH 2PO6C 4Y0GA 1PY4A 5DHVB 1HINH 3UTPD 1CQYA 2VQTA 1TTUA 5DJ2A 3DBXA 1T2QH 4EQ2A 1A1MA 2EDKA 4QXWA 2WIIA 1U6AH 2GCYB 4M9OA 4O2FB 1U8LB 1NQBA 2XN9E 5HI3D 1R3JA 1F6LL 4KPHH 2WLZA 4N0YL 5IKCA 1K5NA 1BM3L 2QQKL 5HTSA 4PRPD 5HYJB 5DUML 4G7VL 4NUJA 3ZHLA 2ADJB 4Z7UB 4YUEH 5A2LH 3BGAA 1Y6MR 2X42A 4YHOH 4KHTH 3VD5A 1NCDL 2CKBA 1S7RA 3O2DL 5TDOB 2HLFD 3D85A 4GG6F 1HH6A 1CLZL 4JFHD 4LL9A 1FO0L 3ZZ1A 3BN9D 2F9BT 2P5ED 1AHWC 3HZVB 4P5TD 1LEKA 1DLFL 4DFIA 2BRQA 4RA0C 2VXVH 3M45A 3BKML 3FT4B 5HDBF 4KHXL 4LOUD 4LLDA 1HNGA 5L8LB 4HS3B 4N8CL 1OTTD 3W0WA 1VEMA 1IT9L 1LQSR 2HFGL 2OM5A 3H9YA 4HF5H 2ZZUT 1M1SA 4FN0A 1HCVA 2DMKA 5EBGA 1G6RL 4P5MA 1CTNA 4XT1C 4YE4H 1GC1C 2HFFB 5IW6B 3F62A 3Q6GL 2VDLL 1UB6B 4ETYA 2AEPL 4XCNA 3IXTB 5FGBA 5BZDA 3MRHB 3RGVA 1FL3A 1GGBL 5BZWA 5L88L 4Y16C 4U1GC 1UWGL 5F3HA 4L8BA 2PW2B 1GPOL 2E7LC 1L6XA 2C3HA 2WWMC 3L5HA 2WNGA 5DZNA 3HNTH 1I1AC 3W11C 5CCKH 2J88H 2CIKB 5DRWB 5EU6D 2Q8AH 1NDGA 3U0PB 4U1SA 1WICA 3DLQR 2IGFH 5FYLL 1FFNA 5ICYA 1FV1A 4XBEH 3BD4A 4Z7VB 2C3GA 3RX5A 5L2JB 2AJYL 4PY7A 1S7SB 3BX7C 4L4JA 3O6FB 4O02L 1GZPA 5TDNB 2FYYA 4MCYA 1INQA 4NN7C 1T22A 1MEXL 3AB0B 5MERB 3W0WB 3AS2A 4MQ7B 2DMBA 4NQDE 1T5WA 3I6LD 2AJSL 2FJGA 3WFBH 3L7EA 2IMMA 3S34L 5MEND 3KYOB 5JUEH 5DMYA 2H26A 1JNNL 2DQEH 3PNWB 1BEYH 3TV3L 3MREA 4OB5L 5FKPA 5C0AE 5DJZA 3E6HA 2N4IA 3K3QA 4N9OB 1FZKB 3MACH 3UTSE 3ULUL 4XHQA 2JE8A 4OCLC 4Q0XL 2GAZB 4MAYC 4PJ8B 4HMDA 1G7MB 1JGDB 1NC4B 3RWDA 5JOFA 4ZSOE 1PLGH 2P8PA 3HKFA 2BDNH 4PJHF 3HI5L 2WM0A 4KH2A 3WJLA 4AL8L 5JXEA 3MLWL 2QSQA 3FQRA 4RX4A 4OZGE 5I15L 1G7IB 1UKSA 2NW3A 3BKCL 4X5LA 4IDJH 4R2GB 3REWB 3V5DA 5ABDE 4S11A 1PEWA 3FRUA 5T3ZL 3CH1A 3MCLL 1NAML 1INQB 2UWEA 2XICA 4UDUB 5IMMB 5ISZE 4BYHA 5I1IH 1F42A 2E8YA 4JFPB 2DI9A 2ICWJ 5F9OL 3VXMA 2J6EA 1H3XA 4PGCB 4DUVA 4HH8A 1A1NB 2R1XA 4Y5XB 1JPST 2H26B 1JNHA 1NBZA 1H15A 4I3RL 4TVPL 1VFUA 5E2VL 2BP3A 1M6OB 4S1RH 2G5BB 4AG4H 5HHOA 2MKLC 1I3UA 3EYQD 1RUKH 2PYEE 1KB9K 1G7QB 1L0QA 4OD3H 5JPNA 4NRZA 1J5OH 2AV1A 5DJ8A 5FYJH 3DVIA 4FFVD 5SWZA 5GS2H 3OGOE 4KV5E 2J7LA 3GRWA 3IJSA 3L6FB 1YPZE 4P23D 2ARJA 5HHQA 4XCFL 3TBTA 4F15B 1ZTXH 3B9AA 3VGGA 2IBZY 4K71C 4PV8B 4G59A 4X8JB 1EEZB 1NGWB 2B5IC 3IRZA 1A6TB 3CX2A 3S35L 4PJDF 3G5VA 3NN8B 1Q0YH 1U3HB 2IQ9H 2A6JA 4QTHA 2D31B 4YO0A 2I9LA 1KG0A 1XIWA 2BVTA 4P2QD 4M5YH 5F88A 3ZMRA 1NDMA 2NY1B 1IQDB 1ACZA 1T0MB 5J7CC 3EYOB 1MFDH 4L5FL 4X9BA 1L7TL 1KJMA 1BP3B 5J9PA 2X4NA 2UWEB 1LO4H 1P4LA 4LCCB 3I6GA 5CZVH 1ZT1A 3QCUH 2P42B 3JZ7A 5KVGH 4RISH 3I50H 2X89A 2NCMA 1D5ZA 4PJXB 4XVTH 3ZKNC 1B4RA 1IM9B 4KRNA 2GUOA 5IK3A 4H5SA 3I02A 2VLJA 4L29B 1W72B 5CZXC 4PBWD 3QIWD 5IB5B 2GTZB 4EUPB 3PWPD 5T1LD 3BRFA 1DFBH 1AD9A 1PAMA 2L7JA 2A73A 4CJ0A 3ETBF 5E6ID 4LRIA 1JGEB 1JGUL 1FZMB 2FSEB 1IC5L 4YXKH 3WD5H 4WUUD 4OT1H 5JHLL 2RJMA 1QLEL 3VFWA 3WN5A 5EZJA 4P4KA 2FATH 3T1FA 2HRPH 1D5XB 5IB4B 2XQYK 4JANA 4JFFB 3GM0A 4RZCB 4QTHB 3ARPA 3BGFB 5IEHA 3TBWA 3EO0B 2L0DA 4NN6B 4Q9RL 4FQIH 2R2EB 5HHNB 4QGTA 2CDFA 1AO7E 1LK3H 4O4YH 1T6WA 3NZ8A 4Z95L 3PHOA 5BW7C 1GZQB 2UYLB 3JWDC 1MPAL 3VH8B 3NGBC 3LCYA 1CCZA 5A2IH 1TJGH 4L9LB 1PVHA 3TFKA 4S10A 2EO1A 3GSNH 1VACB 3U7YH 2X4RB 2J8UF 3OG6B 4AYFA 5F7HA 1WLHA 1QR1A 1VA9A 2V7NA 2A9NL 4LARH 5IVXF 5LGHL 1B6UA 4P9MH 1YNTB 3SDAA 2QLVB 3CFCL 2DOCA 3P2TA 2W65A 5IIEB 2HN7B 4U1KA 2Q86B 2BY1A 5D1QB 1AXTL 3S4SA 1CG9B 2D3VA 3H8NA 4ZXBD 2EXWD 2EYSA 4LLMA 4NHUB 3JTTA 1P9MC 3T1FB 3MLVL 2DQCH 3P77A 2FJFA 2HAZA 4WHDA 3I3BA 5DD3H 2A74A 3HZKB 1OAUH 3OAUL 4XVJL 5DS8B 2A6KA 4TTDD 2UUDH 4LNRA 2BX5A 1OT2A 1FE8H 1YMMA 2E7HA 4WFGD 4DQOL 2A77H 1UM6H 1FL6B 3T0EA 2AJXH 3H6JA 2CDFB 4YFLF 4CU6A 4KTDL 1I1RA 4RAUB 5DQDH 5D5MA 3RY6A 1HDMA 1KPVB 4QNPF 3QRFM 1C08B 1RIHH 1U91B 3MLPA 3TZVB 4BH7A 2NYYD 3H7LA 1W2KT 4YHMH 4PGEB 1JF6A 4X5XA 4LSPL 4UV7L 2R0ZL 1S7VB 3MRGA 1BWWA 3QI9C 1IGTA 2X41A 4GW4A 5F9WB 2WSKA 1T1XB 4JY5L 2NY7L 5GGUA 3VWJC 4KY1H 3VCLB 4UILH 1MLBA 1N4XL 3V2AR 5IROC 5D7KD 3H3BC 5L6YH 1PW3A 3GIVA 3FQUB 1DQTA 3GEWB 3VFRA 4GAYB 4IRSC 1PDKA 1I9RL 2JB5L 4Y4KA 2XPGA 3HC0B 3EJYC 4A6YB 1U0QA 3OKEB 1ONQB 3VFMB 4LRNH 2OP4H 5CJOH 3DUSB 4I2XB 2R2HB 2EH7H 3BPNB 1MRCL 1GC1L 3KPMA 5I6XB 4OLEA 3T2NH 4NUGL 3EOBB 4U6XA 4WUKL 2IG2H 4YDLB 2NNAB 5DT1H 3MV7D 4YDIH 1MHHB 1WTLA 1IC7L 1IGJA 3WNKA 3WXVH 4H26A 5IMKB 1ORSB 4X5WB 1PZUB 2P43B 4FZ8L 3G08A 5IVXE 5H37G 4X7TA 5DFVC 1NCNA 3L3IA 5D7JC 4E42A 1J10A 3LKQB 5E2WH 3ILQC 3PWUB 1RU9L 2AABL 3KHOA 5E2UL 1MWAA 4XH2A 3STLA 5DO2C 3IKCB 4R7DA 4OQ1A 3E0GA 1V3JA 4UB0H 1JI1A 4JE4B 4LMQE 4TUOA 3RX7A 1DQDH 3UJIH 1WCBA 4DCQB 4U1HA 4DEPB 3S96A 2XTJD 5D2LE 3MFFA 5IB3A 1EDQA 4OCXH 5DEZA 1VEPA 3P73B 3HNVH 3KPQA 1I8IA 4E41B 1XGYH 3SCMB 3WLWD 5EOQH 2DQFB 3T3PE 3RKDC 5KS9E 1CYGA 4GW5A 4JFQB 5T3ZD 1YYML 2D7MA 4CMHB 2OI9A 5FYKE 4F2MB 2ESVA 1DQJA 2XTLA 3H9SB 1KN4H 2AK4D 4GS7B 4DOHB 3O9WB 4KI1A 4QNPE 2YKLH 2UZIH 3GDBA 4RFOL 3MLSH 5K59F 2HJLB 2WLYA 1ZLUK 1AIFA 1QO3B 3RWEA 1N7MH 1F3JB 4LHJB 4WWKC 1MHCB 2NW2B 5MEQA 4OCYH 3LKPB 4IRJB 3RZCB 3OPZL 2WUBH 2CGRL 4F33B 1PG7W 4HJ0C 4NQCD 5D8JL 1J05A 4ZUTA 4P3CL 3CSBA 4EI5A 2YHGA 3LPGA 3QEQA 2BOCB 1TJIL 3SE9L 1EO5A 3G6JB 5GZOC 4PTTA 3KNBB 3MV8A 1BQHA 4MDIA 1P2CB 5C07D 5J1SC 5IHZB 3V5HA 2BRRL 4N9GB 3FB7A 5CGMA 4C4KO 2XOTA 4M48L 4XH2B 2EDXA 3DGCR 3VDAA 3CVIL 4Y5YA 4ONHA 3U4BH 4GG6A 4OZ4A 4JHAH 1A3LH 2VDMH 3IF1B 1VFBA 2K7PA 1TENA 1CWVA 3C6LB 2NY4D 4MWFA 2DLFL 5IVZA 1FVEA 3KPQB 2HKHH 1FBIL 2MPAH 3L3JA 5ITFB 3OKDA 4S1SL 5DHXB 5TGBA 4H1LB 2FEEI 3V6ZA 5JW3L 1GSMA 1RJZB 5C0DB 2QQNH 2NXZB 4FA8A 1QFPA 1TTFA 4G9DB 1FIEA 4RFNB 4LAQL 4Z7VF 1FFOA 1H3GA 5I17A 5ESAB 4P4RA 2H2SD 4RGNE 2OXGA 2KZWA 1OGAD 5B21A 1YDPB 4HK0A 4MX7A 4Y1AB 2QHRL 2XQBL 3ARYA 1DL7H 3RAJH 5EO9B 3GSVB 4OM1L 5ICXA 3S7GA 4JR9L 3RX8A 1A2YA 1MHEA 5SWSD 5INDB 2AQ3A 4G8EB 4NWTH 5EBWA 4ZOBA 4NDMB 3CFDA 2E3VA 2ATPB 5HYJE 3TWCH 5CSZB 1CDYA 3FB5B 1QNZL 4NN5B 4Z7UE 1EK3A 4J4PD 3NFNB 4PG9A 4DKDC 5JORB 1HN1A 3NCJL 1NEZG 1F3DH 1MCEA 2NXYC 2VDKL 1IJ9A 4KWUA 4D9LH 1J12A 3WO4C 3CZFA 3FHQA 5HHVH 1HYSC 1FC1A 3EOTL 1PYWB 4OTXH 1U8IB 1RI8A 3FQNB 4HIIA 3D69A 1FYTB 8CGTA 3ZE1E 2XN9D 1KJ3H 5INCA 3BZEA 2QQLH 3ARBB 1JTPA 4RNRA 4HG4K 1NBYB 2BOBB 1A7NL 4XCCH 3MRJB 3IVKB 4MSWB 3FB6A 2J8OA 5D2NB 3VXPA 3L1OH 1NUDA 4MS8D 3ARTA 2A2QT 5C2BL 3W5MA 4M7KL 4CVXA 3RGVC 1D5MB 1Q9LA 1BM3H 2QQKH 3DX9B 4FQXA 2Z93A 2P44B 5DUMH 1ND0B 4G7VH 3RBSA 1NCBL 3QH3A 5IW1B 4L8CB 1JMXA 3BW9A 4HGWA 4PJAB 1T4KB 4YHPB 3M07A 4FTVB 1NCDH 3RJQB 3O2DH 1CLZH 4NNYB 4QRSB 1FO0H 2LU4A 4UQ3B 4XB8A 2ZNXA 3VGAB 4PRNB 4PJHA 4KQ4L 1DLFH 3KPRA 1MRDL 5I71B 4KMLB 5F7YC 3BKMH 5ID1B 4X7EC 3IDJA 4Z7VE 4RGOL 4KHXH 2C3WA 4KU1A 3D39B 4ZODA 1U3YA 5EU5B 1EPFA 4ZQKA 4N8CH 1KCGC 2BVPA 5F7FA 2X1QA 4MA7L 1RHHB 5F8RC 1IT9H 2BCKB 2P5WA 2HFGH 4EKXA 3TH4T 3MR9A 3W0WE 5MI0C 4X9FA 2R1WB 4WU5A 3LOWA 2AKRA 4YC2C 3VXOB 4U2YA 4GRLC 2V5TA 1G6RH 2EEBA 4LQ1A 4YFDB 1CICD 1WITA 1PSKL 3QCVH 2OQJB 3V6OC 5IFJB 2IAMC 4Z0XB 2BNRB 4YXLL 3Q6GH 2A9ML 2VDLH 5EBMA 4KKAC 2AEPH 4NT6B 2C1PA 3HE7A 4PYGA 4ZUWA 5FUOL 1C5BL 4NC1C 1GGBH 5L88H 4XMPL 1FC2D 3WHE1 1GPOH 5A43C 1JPSL 3NFPB 4PJXF 3IETA 3I75A 1MFAL 2EDWA 2FHBA 3N1PC 4L1DA 4YBHA 1QKZL 4ZTPL 4QRRA 4GUPA 2HTKC 1J9CT 5DR5H 5DJXA 4WCYL 4NQDD 3SE3A 2R69L 4PJDA 5FYLH 3VFOB 3WJLC 1VFAB 3UPRB 2ZSWB 4OFYD 1W0VB 5JXEC 5JR1L 4WRLA 4EI6B 3ALWA 1YEJL 3FOLB 4XTRC 4U1JA 3E2HA 1F4AA 4O02H 3LRGA 1UT9A 2Z91A 5C0AD 3ELAT 1MEXH 1QHPA 1IEAB 3UTSD 5EU4A 3DXAB 4RIRB 4I18C 1MCJA 2BNQB 2F5BL 5J06A 2AJSH 2DJUA 2VTFA 3KPTA 2H32B 3S34H 4G80B 4M9PA 1VCAA 5T1KD 3TLRA 1CFVL 1VERA 1JNNH 2MJWA 5TH2B 3UBXI 1CIUA 2Z0BA 5CBEB 1WGOA 5CD5D 1NCUA 2HT2D 3O45B 4RDQF 5LWYL 3TV3H 2PETA 4OB5H 1FP5A 4F80A 5BXFA 3NZHL 4GKSB 2B20A 4QLRA 5T1MA 3ULUH 2XG5A 2CRZA 4Q0XH 1UA6L 1KXVC 2GSIA 3A0OA 3RWJA 4ETQB 5E99L 3PWNA 3VI3F 3MROA 3CFJA 3I75B 4QHNA 1P7QA 5CMAB 5FYKL 2JJVA 1ZLSL 5ISZD 3REVB 4YEFA 4CKVX 3HI5H 4ODXA 1TLKA 4ZNEE 2EDRA 2VUYA 2BSTB 1G7LA 5JPMB 4AL8H 5CBAB 4PRAA 1QSFB 5A3IC 3MLWH 5I15H 5F3BA 1A6PA 1XIWC 3SY0B 3BKCH 2Q87A 4ZAKC 4WVRA 2JIXD 5EO1B 2APVA 3QFDA 4UBDD 3TYGL 2C3VB 3PXHA 5T3ZH 3WSQL 1I85A 1NAMH 5I66B 3KPNA 5JHDA 1SMOA 2PYED 1J0JA 4PRIA 4ZFZB 2PR4H 3KDMA 3D25A 3U0TA 4NZRL 3V6FB 5F9OH 2UWEE 3F7VB 1KPRB 2EDFA 4FHBD 3UDWA 1CD1B 1CXEA 3S5LB 4PJXE 4I3RH 4TVPH 5JDSA 1DLHA 1V3LA 2CO6B 3P4MB 5E2VH 5I8CA 1EAJA 4OLYL 2X70A 1TDQA 2J8UA 2BSRB 2VO5A 5KSAB 4ONGL 3C60A 4Y2DC 2VE6B 5C9KA 2GJZA 3GI9L 2YA0A 3E6FA 1I8KB 1WSST 4MXQD 4NSKB 3P9LA 4NJ9L 5C9JA 3RWJB 4XCFH 3EFFA 5DJAA 5IF0A 1NMCC 4HXBL 2GIYA 5HHXL 4MJIA 4QRTA 3S35H 1BHGA 1JUFB 3WN5C 3L3HA 3OQ3B 4P4KC 3BQUB 3AU1B 1OY3B 3FO1A 1RMFL 2DDQL 4JFFE 4Y5VA 5E08L 2EYRA 3ZDZF 1ZV5A 5SWQA 4JN1L 4ZD3H 5L8JB 1RFDL 4RSVA 3QEHA 5F9DC 4AMKL 1M05B 4K3EL 5ETUA 4L5FH 4JPWL 1L7TH 2Z92A 2YPLA 2F54B 3VXUB 5DTFB 2F15A 1CE6B 3FQTA 4R8WL 5GPRA 2YA1A 3BKJL 1FVCA 3BIKA 4F8QA 5KN5A 5GSVA 2NX5B 3E8UL 4CVZA 1DN0B 2FBOJ 3MNVB 2V9TA 1JYWA 2X4PA 1IEHA 4Z8FL 4XCEA 4BUGA 3TFKC 1NC2B 1ETZA 3QDGB 5D7LB 1GIGL 1HHHA 5HI5C 3ALPA 3FONB 5L2KD 4F7EB 3MRIA 5FGSA 2FLBT 1QYGL 1ACYL 4