5E9DD

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSTSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTKYSWGKLQFGAGTQVVVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 26
structure length 110
sequence length 110
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dD00
1JGDB 1FFOB 1BWWA 2HMID 4IRJC 1N5YL 4NC1E 4OCMC 3G6JB 4ERSL 3SE8H 3JTTB 3V0WH 4NO0D 1PKQA 1R5VA 3WN5C 3NCFB 1LO3H 5DRNB 4OD2A 3I3DA 1S7RB 1UA6L 1TETL 5FA4B 4XNUH 4F7CA 5CLWA 2ATKB 1PQZA 1F45A 4LPYA 5E56A 2GAZA 3W0WA 1JGLH 5JDSB 3IFNH 2QHRL 4P59L 2R0WH 4O5LL 5C0AD 5ITBH 1DBBL 5TE6L 1QFWM 4JRYD 3W0WE 3NCCB 4V1DB 1KEGL 1CGTA 3HFMH 4F8QA 4PJ5E 4TQEH 1MI5A 1WFUA 4PJXA 2V2XB 1JNLL 1MAML 1H5BB 4Q9CA 1NCDH 4KJPC 1U42A 4R8WL 2D31B 2Q8AH 1JN6A 1QFUH 1EFXA 4NKMB 2XKSA 4EUPH 1WC7A 2NY1C 4GFTB 4D0DA 4Z77B 3MRHB 4O02H 2X9XA 1NLDL 1KN2L 2NXZD 2B2XH 2VIRA 3UBXA 3BDBA 2R2HA 4OJFH 1I1AA 2AEPH 4YXHH 5I75B 3KAAA 3MCLL 1D5ZB 2B1AL 3DUSB 2QL1A 3RA7L 3CVIL 1CFQB 1CWVA 1N3NB 1IBGH 2VLJA 3BSZL 3H8NA 3LKRA 5JW4R 3D3VD 4JO1L 4AEIH 2DQHH 3I6GA 1W0WA 3F7VA 5ENWA 3TGXA 5B38B 1LEKB 4H1LB 4HIHB 4NM4H 2NLJB 3ZE0E 1GL4B 3QDJA 5ID1B 1LO4H 5FB8B 1RZGB 2OR9L 1FP5A 3PP4H 5IB4A 3KPRD 3MZTA 3CVHA 1YY8A 3ALXA 3O2DH 3VI3E 4MAYB 3F8UB 5IW1B 1TJIL 5C09B 2NY0B 4R97C 1A6VL 5E70A 2FJHB 2IBGA 4XP1L 1UZ8A 1ORQB 3ZKXB 2BHYA 5ITFA 4KI5F 4Y19E 1NDGA 3WFEL 3X3GH 4F37F 1CT8B 1S9VB 1C12A 2DTSA 5SWQA 2H41A 2O5XH 2CK0H 5IBUB 2IG2H 4M7KL 3H7LA 1U8IA 3PJSA 3BPNC 4OLYH 3VFOB 4Z76B 4WDIB 4L8BA 4ZUWA 3HR5B 2YRLA 1Y18B 3TEUA 3IDYB 2LVEA 2XQBL 5CSZB 3UBXI 2J8UF 2BSRB 4HS6B 5IMLA 2AQ1A 3IDXL 2YZ8A 2NY5L 4XPGH 4BFEA 5GGQL 3LRHA 4NDMB 3BXNA 4A6YH 1CFSA 2HTKC 2VQTA 4I2XB 1UJ3A 1KCSL 3UTSD 2B39A 4GRMA 1V7NL 4JR9L 3T3PE 5EO9B 2VQ1A 3IVKA 4UILL 4RFEA 4DOHE 3QUZC 5JQ6L 3GFUA 2HJFA 3U7WH 1I1AD 1LWRA 3A67H 3PHOB 3KLHD 1NCAL 1U3HA 2CLZA 4U6XB 2ORBH 3ARED 3MRMA 4RX4A 2DN7A 2VUYA 3VXTB 3C60C 3CH1B 2Z92B 4NO2B 4R4BB 4TUKL 5DD1H 4M5ZH 4XAKD 1MJ7L 43C9B 5D2NE 1AKJD 5HGBA 1F3RB 1HQ4B 1I7TB 4G43A 4LCWA 4QEGA 1QLFB 4LVNB 5FOBA 1ZLSL 5JLZA 2CUMA 5BV7B 4ZYKB 5I1JH 4ZTOH 1MCOL 1G7QA 3QJFB 1MCDA 1P53A 2ICEA 1JZ5A 2DYPB 1MIEH 4YHOL 1U8JA 4UIMA 3BP7A 2P8PA 3B6SB 3ZDXE 3IJYB 3LS4L 3O6ML 4BFIA 1SM3H 3ROOA 2QQLL 3UROR 4N0UE 4WHCA 3QIWC 4XP5H 4XMKH 5D1ZA 3CVHL 3RL1A 3V4PL 2IFGA 3ZKNC 4LLDA 4DGYH 4NQXB 1GVIA 5DUMH 1CLOH 4QRTA 2V7NA 3PWNB 2R1WA 4NT6A 4F9PA 2YSSA 8FABA 4P57B 5IHUH 4HWUA 5BZWA 2EH8L 3TO4B 1IGTA 1W72H 3NIGF 3VXPB 3SDXA 3SGEH 3GSUB 4DZBA 3KYOB 3QWOB 4FTVD 1FLRL 1Y0LB 1H3UA 4XGZA 3VJ6A 1BJMA 1EX0A 3VXQB 4FQCL 2VR9A 3N1QC 5DJXA 3F7YA 2A6IA 2IF7A 2X5PA 1F8TH 2JJWA 2P1YA 1BP3B 4PRNB 2VLMD 4PJDF 5C6TH 5J4MA 5F1NB 4PJIB 3QCTH 2BVYA 4WI2A 5KS9A 4JZOA 4P0DA 4NGHL 1PKQB 2H1PL 2IH1A 1NFDE 3RHWF 3IXAA 1S9XA 5E00A 2UUDK 4LFHD 4LLVB 4XZUB 4Y4HA 1AJ7H 4HUVB 5JW3H 1D5IH 2VSCA 4C58B 2ADIB 2A9ML 1VDGA 3C6LC 3FQTB 4Y4KD 5GS2D 3V6OE 4N1EA 1FNEB 4PJCB 4R6UA 5T3ZD 1F02I 4MXVE 1T89C 2XTJD 3WLWC 4BSVB 4UTAL 3B5GA 4LSQH 1ZEAL 3VA6A 4OFPA 5GRZA 3UJTH 3R06A 5J56B 2J3SA 2NY2D 3HS0B 5HSFA 2YPVH 2P5ED 2R4RL 3A6BL 2PYED 2VB5A 4NPYB 4LPUA 2YEZA 3QUZD 5EOCH 5I8OL 3TVMA 2F19H 2DLGA 5IEKB 4U6YB 5C08D 2CJUH 5E5MB 1NSNL 4PJFF 4ZS6C 4U3CA 5JHLL 3TWCL 2CDFB 5DJ0B 4HG4K 5BS0A 1GHFL 5J6GA 4MD0A 4OD2B 3QIUA 1S7RA 2ADGB 4K3JH 4NO0A 5GGVL 3SDAC 4MJIB 1V3KA 4JFPA 1FV1A 5DI8A 1MCCA 1AD9A 2IC2A 4MD4A 2BSSB 3BD3A 5DQ9A 1OWWA 2H6PA 4OZIF 1F3JA 2P5EE 4POZD 5A3ID 1HSAA 2JB6B 3M17B 3ULUC 1U6AL 1CBVL 4DTGL 4OSUH 3QAZB 4D8PA 1WZ1L 2EDRA 1HILA 4GBXD 2DQCH 4EZMA 3HG1B 1JRHI 1EFXD 1C8PA 4JY6B 3QUXC 5BW7A 4HUMB 4EN3D 1MAJA 3RWDB 4LPTA 4PREB 1RUKH 4GXUM 4HCRH 5J1AA 3BPNB 2YWYA 5LJYH 3SGDI 2LQRA 1QVOB 4L4TA 2XZCH 4GXUN 3PWPA 3BGFB 3D2UB 3H0TB 1F3DH 3BN3B 3HI6H 4IOFD 3L3GB 5DHYA 3WNNA 4C56B 1NFDB 2P5WA 5DR5H 1QLRA 3TNMB 1FZOB 1B2WH 3EOYG 4O2CB 1T1YA 4GRMB 1QFHA 2XQBH 2B4CL 4M02A 3MXVL 5TDNB 5CILL 4OF7A 4D0BA 3Q1SL 4HMDA 2AGJL 1URLA 4P2YA 3GNMH 1BGXH 5F7FA 1MWAL 4NQSB 4M7LT 3KJ6L 4Y1AB 4MSWB 3C08L 4PRHD 3X12A 3E2HC 3NFNA 1NAMB 4X6BB 3X3GL 4P2RA 1A8JH 2HTLC 1JGEA 3GMRB 3VGFA 1DN0B 3RKDC 1Q9OA 3EUUA 4YWGH 3O4LB 2O5ZL 1ZT7A 5BRZB 3QDJE 5CJQH 4YIQA 1OAQL 3FMGH 4M6NH 5EZLB 1NQBA 1NANI 2IBZX 5DMJB 4P9HC 3IU4L 3NH7L 1A21A 3DMMB 5D5MB 3MRCB 5FYJD 1A6AB 3ES6B 2CDEA 4DUVA 5I0ZA 4DW2H 4NCC2 3WHXB 4RGOL 2DB8A 4UMGA 5LQBH 4PLJD 1YYLH 1DQJA 3KPLB 2FEEI 3VXTA 4Y2DB 3CH1A 4Q9RH 4U1GC 5DVNA 3VW3L 4Z7OF 3D0LB 5FCSH 5HDQH 2UZXB 1E4XH 3O3UN 3X3FL 2DWDA 1KBGH 5T1KB 4W4OC 2R69H 5I0DA 3EDFA 3UZQA 4JQVA 1KIQA 4LASL 1AP2A 4YFLF 1HOCA 3FQUB 3DVFA 1F5WA 4ZYKA 1U92A 1TIUA 3UTSE 4NQDE 4OV6F 2WP3T 2GTZA 5I71B 5E9DE 4LU5L 3STZB 1CLZH 1PDKA 4YUEH 3NA4A 5FUOL 1FL5B 1NBQA 4K3DL 4JRXE 4PJIA 1FNSL 2B8OT 1XCTB 5I8EB 3MRIB 2QQNL 4KHTH 4JB9H 4KV5F 5JPMA 4YFDB 4HXBH 2DL2A 4NQDB 3VG0H 5HPMA 4ZD3H 1LEIB 3Q6FB 1YA5A 5GRVL 2XFXA 3TV3L 2FZ3B 5D8JH 5ANME 3WS3A 1BEYL 1UQSB 3CGTA 4OZHB 2Y06L 3A6OA 3N06B 2XOTA 3FONA 5DZOA 3UMTA 3BH8A 4OIAA 5D2LB 5I8CB 4BUGA 2QHLA 4LSTH 5AZ2H 3PGFH 3FO0H 4DVRL 3ZZ1A 1IM9B 2CGRL 3CFEB 4E42B 1BBJB 2X4RB 3H9HB 3QIUD 3KPRE 3RWHA 4AIZA 2P49B 5DHVH 1I7UA 3KWWB 1JPGA 3TBWA 4L9LA 3T1FA 1IAKB 2NY1B 1QSFE 4ALAH 1NEZA 2JK5A 4NCDA 3D3VE 1J11A 2ICCA 4FA8A 3LEYL 1T4KA 5I1AA 2VRAA 4U7MA 1S9YB 2QJDA 1LP9F 4X5WA 4GKSB 4NQCA 4BQ8A 5ICXB 3PQYB 3JV0A 4J2XA 1HWGB 5JHDB 2Y36H 1Q1JH 1A1OA 2AJVL 2AJXL 3QA3B 2Z93B 1ZLWK 1XCQA 3PGDB 1HYSC 3PF2A 1G7IA 4S1RH 3ARYA 3QO1A 3VH8B 3BZ4B 1R5WA 5ECJE 1VFMA 2GT9A 4I13B 4XX1E 3OBAA 5B39B 5B8CA 4PJ5D 5DLML 4HZLB 4ZOBA 4HJ0D 2F9BT 1E4WL 2VDKL 2M26A 5IFAL 1ZOXA 1F6FB 3T8XB 2AJYL 4KPHL 1WAAF 5DJCB 4KTYA 4U2ZA 1WLHA 4ETYA 3TJHD 3AROA 4NQCD 1NJ9A 5IVZB 1J0KA 1KCVH 3BN9D 3RUGE 1SEQH 4JFOA 5GGTL 3CDYA 4MNGA 4ZFFB 5IIEA 1BOGB 3QDMD 1RUAL 3ZT5A 2V2WA 3IKCA 3MJ8B 4RZCA 1L0XA 3D48R 3ZT6A 2J7LA 1CE1L 2ZSWA 2VAJA 4GRWE 3NA9H 2LV4A 1EGJL 3MR9B 3NCMA 4JCMA 4MJ5A 1AD0A 4HSQA 4DUWA 1T04A 3U6RA 5GXBB 1YEIL 4G9FD 5TDPB 5F1IB 1BF8A 1KB5B 5I30L 4JFXA 5CINL 5CJOL 1N4XH 5FXCH 3HI1A 4JM2C 5T3XH 2CSPA 3WIHH 3PHSA 5DQ9B 35C8H 4JRYA 1AC6A 4KKLD 1MH5B 4ONFH 3DARA 3EYFB 4ACPA 4UTBL 2W65A 3E6HB 3LKOA 1YEJH 4G7VL 2AKRA 4G8IB 5L2KA 5DD5L 4D8PB 5KTEL 2XZAH 1OT2A 4WHTA 1HHGB 5F7MC 5GS3A 3VXSE 5IT2H 2IQAB 4LNRB 1K4CA 3S35L 1XR8B 4GS7C 5BVPH 4C57C 1U58A 2N7BA 1U95B 4CGTA 4BELD 1ZGLB 2XN9A 2MKLC 1A7OL 5ADPL 4K8RL 5BV7C 4D0DB 4FQ2L 2IGFL 3LSOA 2R29L 4KKNA 2G60H 5C0FA 4QT5A 1E28A 2XA8H 5MHSD 4LPXA 5JZ7D 3TN0D 4AEHH 4X6DE 3FN0L 4U1NB 5F96L 4EDXB 4K94C 3QH3A 4AEHL 2AXJA 3L3HB 2DQIL 1J8HB 1EVUA 4X6EA 4RFOH 3VXUA 4JDTL 4M7JH 3DXAD 2IGFH 1QACA 2BMKB 4F9PC 1SVZA 2D4DA 1KJ2B 4X4YB 1OSZB 2DKMA 1WEJH 3BMWA 2YD4A 3GMPB 4BKLB 2NY0C 1F11B 1MIML 3HUJF 1NLBL 2X9WA 1WTGT 1NH6A 2XXMB 3GHEL 3S7GA 3VRIA 2JJVA 3MREB 1VPOL 2N7AA 4DUXA 1J1XL 3V6OC 5BO1H 2MWCA 4HLZG 4AQ1B 2C3VB 5C0GA 3VFNB 4FFZL 4J3XA 5ESVA 1GPOH 5F8RC 5JPNB 5IJKC 4GKZA 4FQHA 5DD5H 3Q48A 3V5DB 1TZIB 1CT8A 4L3AA 5TE4L 1KSRA 1KIQB 3MV8B 5DJAB 1FIGL 4UTBH 4IRJA 4HWBL 1OAXL 1DEEB 2V7HA 2PW2B 3BH9B 3M1BA 4MNGE 2VLLB 3DX8A 4YDJB 2CLRB 3REWA 2GK0B 4XPAH 5I30H 4Y2OA 1G0XA 1CDYA 2P8MB 2Y7QB 1U93B 4Y5XA 1QSED 4R90H 1RQ5A 1YEIH 5L2JB 2VXTL 1HEZB 3SDDD 3MBXH 5DMGC 3U46A 2VC2H 3NZHH 1CXLA 4IJ3C 4XNXH 3NA9L 1NEUA 3MTRA 1R3LA 4NFCA 5ENWB 2V9QA 3MGTB 5A16A 1UJ3B 1CE1H 4Z7UE 1N0LA 1KCRH 5LXGL 4J6RH 1N26A 2RHEA 4D9QD 2CR3A 5CZKA 4WHDA 3G08B 2Q3ZA 1OAYH 2DQFB 3EFDH 1WICA 3LRSA 2QKIB 4TRPL 5T1MA 2EXYC 4KROD 5CZVH 1GGTA 5CCKH 5GS0D 2CLZB 4KKCC 1UJ3C 3VFPA 2EDOA 3NFPA 3T2NH 3P30L 3CMGA 4GAJL 4HIEA 1E4WH 3F12A 3SJVA 3ZE1F 1HYRC 3KYNA 3HNTL 2APXA 3ARFA 2NY4B 2WBJB 3SO5A 2DI9A 1HQ4A 2G5BB 3PL6C 4NRZB 1KFAH 2G75A 4YH6A 5T3XD 4I77H 1TCRB 3WMSA 1B4JL 4Y4KC 1SYVB 4ZFZB 4NRYB 3HB3D 4K3HA 2Y07L 1MHCA 1TQBC 1FC1A 3CXDL 5C92A 1INQB 3ARTA 5T3ZH 1FL5A 2NW3A 3HA0A 3L3JB 3ZKXC 4DKDC 4Z18A 4DN4L 5JR1H 2W60A 3IDGB 5GS2H 1KIPA 3HRZA 5MEOA 3RU8L 1KTLB 3RJDA 3HC3L 2V5YA 3KVQA 4CVUA 1LE9A 4Q6IA 4FXKA 2WQ8A 3C9NA 4BFGA 2GFBB 4QXGL 3G5YB 4O58L 4HS8H 3GB7B 3HAEG 4ZOCA 3FAWA 5GRJL 5CP7A 5D70H 3MRMB 2PTUA 1RIVL 4AL8H 3KLAA 4Q9BA 4G8EB 3VFUA 4XRCB 1S7WA 1RHHB 5GZOD 1JHTB 5J1TC 4JHWH 4IRJD 4OZGF 5GGUA 5D7SH 4K8RH 1G7PA 1CE6A 1HI6B 1OTUD 4LP4A 3TV3H 3ZYJA 2DQTH 4LAQL 1MFDL 4XPBH 5BVPL 1IAKA 1INEL 1IGIH 2HFGH 3VG0L 3ARRA 3CLFH 3VXQA 4RCAA 3UDWC 2YUWA 4JANA 3MJ7A 1FNSH 5F71A 4G6KL 3WIFA 2J6EA 3BWAB 2FO4B 4U33A 1PZUB 3DV6B 3QEQB 4GKNB 5ICXA 4BH8B 3CSPA 4L4VD 5IVNA 3IJYA 1R24B 1PAMA 2HVJA 4LDEB 3LIZL 2UUDH 1MCBA 3GSNL 1AGFA 2X4PB 3LIZH 4PJGE 3U0PB 1ZHBB 2Q76A 1FBIH 2BCKB 1Y6MR 5DMYA 4LASH 5GGSB 2VO5A 4IRSA 2RB8A 3QFJE 3RVTC 3BMVA 1A02N 1NEZG 4PGDB 4J4PA 1SJHB 3MLWH 5IP4A 4MJ6A 4JAMA 4WHTB 1K6QL 3FFDB 2R0LH 3IU3B 1K4CB 3NFSL 2LABA 3V4VH 3ZKMC 3RWEA 3SHSA 4ZOEA 3LN9A 4C83B 2R9HC 1QPXA 2WV3A 3C6SB 1U8QA 5JHDE 5JA8B 3OJ2C 2D03L 4X9GA 2VXUH 1W0VA 4QTHB 1MCWW 4I3GA 1RIVH 4AL8L 5JIPA 1P5VA 3N85H 4JGUA 4M62H 2A77H 1J1PH 1ZAGA 5D70L 3HAEB 5E00B 3QULA 3GSVB 3TO2A 1KB5A 5DEGA 5F7DB 2BXYA 4S1RL 2NXZC 4U1MA 3T77A 5A2LH 1CICD 1J05B 2AEQL 4H0HB 3CXHK 4ZQKB 4OCWL 3MOAH 1UEMA 4BKLA 2YK1H 3NCJH 4RISL 1YN6A 5EU4B 4PTTB 5BXFB 2YMXH 5F6IC 4RAHA 3UTOA 1JTTA 1S5IH 1GXEA 5ESVB 5D2LE 2YPLD 4P46C 3FJTA 2H32A 2X4SB 4L5FH 3PWUB 1ZMYA 1PW3A 3ME0A 1OTTD 2BC4A 3JWDH 3MV9D 3DJ9A 3NMEA 1TMCB 5ANMB 5KSAB 2Q8BL 4NN6B 4NO5A 1T5WB 4PLJC 3AMKA 4H8WL 1XH3A 1T7YA 2VLLA 1CTOA 1QLEH 3DURA 4E0RA 5IJKA 2AV1B 3SKNA 4FQQA 1DR9A 4H8WH 3LKSB 3P30H 3GJEA 4Q6YA 1SEBB 4WEBH 1PZ5A 2HT3D 5ICZB 4PG2A 1FO0L 4WO4C 5SX4I 5F7HA 1FNGA 4JHAL 3SQOH 2R56H 2P5WB 3CZFB 1UWXH 3GMNA 1OLZA 1MEXH 4RNRB 3X11B 3LRGA 3DO7B 4OLXL 3WV0A 4BA8A 5ESQA 5CD5C 1OSZA 1R3KA 5D4QA 1IM9D 1YQVL 5I66A 3CX5J 4D3CL 2FD6L 3MROA 2MFNA 1H9VA 2QQQA 4M8QB 4J4PD 4NC2B 5CZXD 3P0YH 3OB8A 4K7PX 3FFCB 4LCCC 5E2WH 5C0IB 3B2VL 4UT9H 1LK2B 4KI5D 4U1KB 4OIBA 1R5IB 4XCYA 5BS0E 1WZ1H 2ESVD 3RKPA 2A6DB 1FORH 4BZ1L 3FFCD 2ADJA 4M1GH 4X6BA 2A6KB 2XKNA 1IEAB 5FKPB 1OAXH 3GUTB 3D3VB 4JFHD 4OFVA 3WE6A 1ZHKB 5L7XH 4OZFG 4M62L 4MZ3A 3AREC 4O2FA 1UXWB 3DX8B 3O4OB 1FVDB 1MRFL 3RQ3A 1FCGA 5D7KD 4F7MA 5LAXA 3K8LA 3PV7A 3ARDD 3WFBL 1CYGA 1X7QB 3GBML 1DLFH 1VPOH 4IHOB 4GG6F 1C16A 1V7ML 5I1HH 3TNMA 3HE6C 4RGOH 4PB9L 2ZUQB 5J6HA 3MA7B 4O00A 4ZO8A 1JTOA 4WENB 3L1OH 1A6AA 3PXJA 3BO8B 1JPFB 2GFBA 4UAOC 4QNPE 4YEFA 4I9WD 4LQ1A 3S96A 1MF2H 2XG5A 4E41B 4M43L 2ZUVA 2OK0L 4HC1L 1SYSA 1KCUL 1I9EA 3FT3B 5T5NG 3S4SA 4KC3B 2ZUUA 4TNVK 32C2A 3LN4B 5KS9E 3LEVL 3OPZL 4UINH 1AO7D 1INDL 1C08B 3VCLB 4LLYB 3VG9C 2X4TA 4M7LH 1FORL 2V5SA 3UEZA 2O5ZH 4X80L 4DGIL 3F58H 5F9WC 1VFAA 4GRLB 1FVEB 4U1HA 4NKDB 3TO4D 4J3SA 2QTEA 3TBVA 2F5AH 4L3ED 1SY6H 1UCBL 1C7SA 5J13C 2AK4D 3NIFE 3L5IA 2H9GA 1CFNB 5C8JB 5IUSA 2EYTB 3FZUD 5E4EB 3CLFL 2MQ3A 1YQVH 5CWSB 1E6JL 5FKAB 3EOBA 2FYYA 4KJWD 3HRZB 4JFFE 3DMMA 2IPKB 4P2QD 1FZJB 3B4NA 4FQCH 5EIVA 1ES0B 5GGRB 2HG5A 1FDLH 2ZNWA 4P49A 4N0UA 3UJIL 5D9SB 4WEBL 3UTSA 3O45A 2X4PA 3QHZL 3FB8B 1KTDA 2LU4A 1HHHA 4H20H 5AAWA 2PYFB 3FB5A 5CP7B 1DCLA 3DVGA 5GGSA 3V7AE 4PJEB 3GMQA 3JWDL 4HFWB 5D5ME 3TC9A 1D5XB 1EVTC 3TFKC 1JWUA 5DT1H 3B9AA 3QEGL 1XGQB 5TF1H 4HHAA 1MHEB 2BVQA 5KG9B 5KOMC 1WBXB 4OQ1A 4XMKL 1BWMA 3EYUH 3U0TB 1JUFA 1RUKL 2LAAA 1AXTL 1JRHL 4HH9B 4OF0A 3VXMD 3JWOL 3OQ3B 4C83A 4WTXA 5T3ZL 5D7LB 4WU5A 3CXDH 5EU6B 1U3ZA 1TVHB 2A1WL 3DLQR 3CPLB 1MJJA 1QA9A 3GMLA 1XCTA 3S9DB 5DHVA 5C0CE 1TPXC 1CBVH 3MNZB 3UYRH 1NGXB 3QULB 3P77A 1RJZA 3EOTH 5D7KE 3T65B 3IFPB 1KB9K 4HEME 3T77B 5EUOF 2JCCA 1F58L 4GG6B 2Z93A 4MMZC 4JDVA 2ATPA 5JIHA 3U0PA 3T2NL 2E7HA 2VXUL 1F00I 1UQSA 4OZHA 1EV2E 3K1DA 4X7CC 3QO1B 2OL3B 3BP5B 3S4SG 1GAFH 1MCPL 1OTUC 1Q9WA 4QTIL 2PKDA 5E6ID 1JNJA 2G2RB 5HY9B 2EEDA 4PJXB 1YPZF 2X4RA 5H37H 5EULV 3GSWA 3FOLA 2NW2A 2Y6SC 5HYEA 4JFZL 4J8RB 4JZJC 4E5XA 1MVFA 4UILH 4G9DA 3VRJA 5IJVB 1C5CL 4ZFGL 4R90L 3KPNB 4NBYB 2PXYA 1FFOA 2BVPA 1M71A 4YZFF 4QF1A 1Y6KR 5CGMA 3LD8C 2VISB 4NP4H 1YMMD 1TENA 4J3OC 5L6YH 5DO2C 3BOVA 4YBQD 5D8JL 3QUKA 1RJCA 1CR9H 1K2DB 3MV9E 4JRYB 1DQDL 1MUJB 1ZLVH 1J10A 4R4ND 2O5XL 5C0DA 4TVSa 3VH8A 3U30C 3VFWA 2N1KA 4R4FL 2I27N 4TUOB 2D9QB 3EGSA 4LEXL 4UU9B 1MFBL 3VWKD 2AK4A 1JVKA 4LAQH 4OZ4B 1HKLL 5FUOH 3K8KA 3ZKMD 3MUGB 2C4FT 5C6TL 1OWRM 4APQB 1G9ML 1YJDC 4YDKL 3T8XA 1EEQA 3U9PH 2GTWA 5J9PA 5D7SL 4Z7NF 4XVSL 1U8OB 1H5BA 5SWSE 3T0WA 5BV7L 1UYWH 1K4DA 1Z6JT 1WVZA 1YY9D 5FYLE 1INDH 4HGKC 3WIIH 2O5YL 5IM7B 1C12B 3PP4L 3UJJL 1CF8L 4XPFH 3T0VA 1ZGLA 4OF3A 2DLTA 4ETQB 4O58H 4PY8I 4GG8A 4HDIB 5LAXB 1CLOL 3S35X 5EUOB 3P4OA 2PR4L 3HE7A 5TDPA 1HHIA 3I6KA 3U36A 3CNKA 5TPWH 5FO9B 3C5SB 2DI7A 2AEPL 4YXHL 5I1HL 5JHDD 2QQLH 3B9KB 3DV4B 5ISZE 3T0XA 4H88L 4YR6A 1RZ8A 1SM3L 1DL7H 2H32H 2VLRB 4Z7WB 1X3DA 4ELMB 4UV4L 4YHZH 3QUYB 2BDNH 1QZ1A 4EKXA 4QRSA 5SWZB 2R8SL 2CUIA 5F9JA 3LN5B 5DJ6A 1IGJA 1D6VL 5BOPA 4TSCL 4I77L 4UQ2A 1QUNA 1R5IA 4LSVH 4XCYB 3BQUD 2NQCA 2VJXA 4M1GL 3VXSB 2BNRE 4FTVA 4PJHB 5HGHB 5I71C 3KDMB 5E6ZA 4ZO6A 2RBLA 4OZGE 4WW1B 1ZLSH 2R0WL 1FZKB 4NKDA 3RGHA 4W6XB 1EA9C 3PJSB 4Z76A 5E2VH 5DZLA 5IOPA 2DIAA 1ETZB 1AFVH 4L4VE 4D3CH 2WIMA 1BFVH 2BHUA 1LD9A 3EFDL 3HPJB 3F6IA 1I8IA 4HUUA 2EDHA 2E6PA 2OZ4H 1P6FA 4IHOA 4XC3L 5FKAA 3QWRD 4X6EB 1CU4H 1SEQL 4XTRC 4D9RD 3ARPA 4I2XA 1K85A 1CDHA 2HRPL 2EDTA 4M7ZB 1IKNC 4LGSB 3BQUA 5EO9A 5CZXC 3BO8A 3X17A 2KUTA 3VFVB 2VDML 4YHLL 2BJML 5ADOH 1YQ2A 2EEAA 3GK8H 3OKYA 5E5RB 2XICA 4XAWH 1FFNB 4CN4A 3Q0HA 2ZSVA 3T04D 4YHKH 2EC9U 2HLFD 4PLNC 4QRTB 1NUNB 1JWUB 3LMJH 2EDQA 2ERJB 5C09E 1UKQA 2WBJA 4P57A 2ZCKL 4M5YH 4HCRL 1S5IL 4WNQB 1MFCL 2YN3A 3S97C 3KXFD 4I0PA 2YN5A 3TBVB 4WFGD 5EOTB 4BM7A 2W9EL 4PJ9B 1S7TB 2PW2A 3LEYH 4H0GA 1DANU 1BREA 5EU3A 15C8L 2EDNA 8CGTA 3RTQC 1D3CA 2OR8A 4LRIC 1IL1B 4CKVX 2DQCL 4PJ8A 2Q87A 1L0YA 1P9MC 4QOKA 3RIFF 2A0LD 1FLTX 1M6OB 5IWLA 2RFXB 3S36H 1R3LB 3QWQB 2MQ0A 4OGYH 1TJHH 3HC4H 2AAVA 4DVBA 1LO4L 3IJSB 2PO6C 4JM4L 2XWTA 1HHKB 5BQ7A 2F54D 4JCLA 5HVGB 4UQ3B 5CEZL 1AQDB 3KYMA 3FQTA 3SY0B 2R29H 4LBEA 2EC9T 3EFFA 5FAAA 1IC5H 3LKNA 1WBYA 3TWCH 3K2UH 1G6RH 3F12B 3HE6A 4YZFE 1CXEA 2E7CA 1OM3H 2Q6WA 3L3OB 2JIXB 2R0LL 2J8UA 3SDDB 5T33L 1KCKA 1YEDB 1YMMA 3B9DA 4K7FA 1AHWA 3ARSA 4QCIB 3TYGL 2AJZA 4JQVC 1XT5A 2XN9E 5IW3A 1BD2B 1UXSA 1CLZL 2P47B 3QZWB 4MD5A 4HIXH 3WL9B 3EW3B 3TIEB 3MO1B 4NJAL 5FGCB 3BIBX 3K46A 4PJBE 4NM8H 4TSAH 4UT6H 5K9QG 1QSEE 4HMEA 5CINH 4JY5L 1EMTL 4MVBD 3O6KH 4LLVA 2DM2A 3WKNA 4MQ7B 3ARFC 3C9NB 4OZFH 1RZJL 1E4XL 1EGJH 4JDVB 3BE1H 1FAIH 1HSBA 4GRWH 5FK9B 1HINL 3GB7A 4UT7L 4X8JA 3DRTA 4JFQA 3QHTC 4HWEL 4ZPTB 2HFGL 5AYUL 5BJTA 4TULL 3RVVD 4OZ4A 4XRCA 3C6LA 1A1MA 3WO4B 1UKTA 4Z0XA 1P7KB 3K80A 1N59B 4GLRI 3PQYD 5ICYB 5DVMA 5J9PB 1RULL 1IC5L 4N0YL 4G3YH 3JVGA 3GSWB 1GOFA 2F54A 1EUTA 3KLDA 2JF1A 3BI9X 3VXUD 3MRDA 4YPGB 1EZVY 3W9DA 4EXKA 4RSVA 3DXAE 3TVMB 5JO5A 4WUKL 3ARUA 3UO1H 4L9LC 4HT1H 4X6DF 4L4TD 4WHYG 4DGYL 3S98A 1CQKA 1JGVL 3UTPD 2EE6A 5MHSE 1R24A 3RU8H 5FA4A 3CUPB 1FJ1A 4K71B 5HDBF 5CJ5A 3UTPE 3RDTC 4JPWL 5ETUB 3V4UH 4LPWA 2W91A 1AGFB 15C8H 4XMLH 4ZXBA 5HYJA 4ELME 2H6PB 2W9EH 3GNML 3RNQA 1XF5B 1OHQA 1MFCH 3VMPA 5IB4B 3T4YB 4TUOA 1SBSH 5ISZB 2FSEB 2ZCKH 2N56A 4M5YL 1KELH 3DYOA 3QIWB 5GHWH 1P6AB 1YY8B 3VXUE 3SDXE 3SO3B 4YFEA 1QEWB 1JNHB 3JUZA 4KRPC 3T09A 3HG1A 3GHBL 2XWBB 2E3VA 3T3PF 5DEFB 4XVUC 3TZVC 3PGFL 4LSTL 3H9SB 1TVBB 1YECH 4L3EB 1LO5A 3KPOB 5EU5B 3G5XB 1L7IH 5B4MD 5F70A 3U4EA 1AY1L 1A9BB 5J3HD 3FB6B 4ETQA 5C0BE 1LVEA 2DWEA 2J8HA 1RUML 1D5ZA 2MTPA 4G9FE 3BPLC 5D1XA 9CGTA 5C08A 1CU4L 5EUOA 1D7FA 1IM3B 2BSTB 2JELH 1MCKA 4P9ML 4RBPH 2MPAH 3LDBB 3MJ9H 1OY3B 2BFVL 5DJ2B 1JZ7A 5AG9A 1BVLB 4WEMB 4OLVH 1Z0MA 4YAQB 1KIRA 2XYCA 2J12B 3AC0A 1WT5C 4U1LA 4B53A 4OSUL 4M8QA 4IDJH 4X8XA 4ENED 4H5SA 4HWBH 1BQSA 1YY9C 3HTLX 4ZOAA 4NN5C 5E7FA 1DE4A 3S34H 3NFNB 3RVXC 4R4BA 4P5MB 1EEZB 2VDQH 4GJTB 1GPOL 1RJYA 2IG2L 3VW3H 4NHCL 3DHJA 4W68A 2QQKH 2Z31D 4GRLC 1ZVSA 4PJGA 4JPWH 4E0RB 4WDIA 3WFEH 3U2SB 3RWCB 3CDFA 2F19L 2B20A 5IKCA 2H2SC 1PZ5B 1IZJA 2F54E 3CFCL 5HHPB 4YHNB 5TGBB 4QRUB 3CLEH 4HWBA 3SKUD 5CHNA 5T1KD 4U6HA 2R4RH 2D0FA 3D9AH 2YPVL 1CD1A 4P3CL 3UO1L 5IMOB 3DO7A 1M7DB 3MLZL 1QSFD 5EB9A 2CRIA 5D7LE 1CF8H 4XPFL 4BFIB 2FZ3A 4XVTL 1R0AH 3OR7B 1NCUA 3MODH 4WWKD 1F4WL 3NN8A 4I4WA 4JO1H 4PPTA 4PV9A 2GK2A 3EJYC 3FT2B 2CO7B 5H2BB 3O8XC 5L88L 1I85C 2VXVH 4K71C 4NKQB 4WFGE 3P9LB 4PJFE 3JWNC 4DFHA 3KXFE 3DI2B 4JDZB 3BH8B 4OFYA 4Z7UB 4HJJL 4HAFA 1YC8A 1D5IL 4U31A 1C08A 3VCLA 2GY7B 3PWNA 1F4AA 4NT6B 2W0PA 5IEHA 3OMZA 3C08H 4UOW0 3KJ6H 3QCUH 4PRAA 4Z8FH 4HPOL 1HINH 5F9WB 5F7LB 2J88L 2F8XC 4NN7C 3EYQC 4DZBB 1RZJH 5I19L 1CR9L 3U79A 4ZG1A 5ERWA 3V5HA 1AR1C 4XGZB 3VJ6B 1WISA 4PJ8B 4JY4B 4KZDH 4ODTL 2YKLL 4MDJB 2ICEB 1KEGH 4QLRA 4DWHA 3MFFB 2HKHH 2D2OA 5EZJB 4KK6D 4UT6L 2YUVA 3O8XB 1A6TA 3L7EB 2VLKD 3MUHL 4G9FB 4NQDD 4HIXL 4D9RE 2GSGB 2A83B 5I6XB 4QHMB 1NFKA 3GRWA 3T0EE 4OGAC 1E6OH 5JORB 2X10A 2NY6B 3ZYIA 3PHOA 3B2UD 4X8JB 4G8FA 3O9WA 4PRID 5HGGS 3LKNB 2MNUA 4XP5L 4ZAKA 4RQQB 2XQYK 4APQD 4NQXA 1YMHA 5JZ7C 4RMRA 4POYA 3FRUA 2W38A 3O6MH 1Q0YH 5I75C 2YSSB 3VD3A 2XRAL 5I17A 3AS1A 3SDDA 5DJ8A 3ARDC 2Z4QB 3LDBC 5GGVY 2X6MA 5EBGA 4ZS7L 4WWKB 1J8KA 2ZCLL 1CFVH 3QG6A 3KYOA 3QWOA 2UZYB 5CD3B 2VN7A 3GI8H 3MA9L 5FYJE 3W2DH 4PJAF 5H37G 4YXKL 4Y4KA 2NY0D 5EU6A 1TVHA 4OGYL 2WANA 3UPRB 3QIBA 1P7QA 3D0VB 5I1CH 4Z5RB 5I2IA 2IH1B 1EO8L 4FFWD 1ZHLA 4NWTH 1LDPL 5HBBA 2X42A 1TTUA 5KBNC 5JHDA 3R4DA 2H26B 4JFPB 1NBZB 1NMBL 3L5XH 4HIJB 5D1ZB 2VXSH 3W39B 3A67L 5B8CB 4PRHE 4CMMB 2FIKA 2HFFB 1WF5A 1IAOA 1UVQA 4WI9A 5HHNB 3KXFA 4I0PD 4ZXBC 2CGRH 1I8KB 1TZHB 1XF1A 3UJTL 3TCLA 1EAJA 1NJ9B 2R2EB 5FUCE 3FO0L 2A38A 3GIVB 1RURL 1G0YR 5B21A 4JZJA 4GH7B 1HDMB 4WI6A 4QRRE 3H3BC 2HKHL 3AM8A 3UJIH 4GUPA 4G3YL 4NWUL 2E7LC 1II4E 3P0VL 1UWGH 1M71B 3IFOA 4FQPA 1E28B 1A9EB 3SGJA 2YPLA 3KR3H 2RR3A 2MCG1 3T65A 5D96C 4HWEH 2DQJL 4HEPG 1H0DB 1V3MA 5DD0H 3PWLA 3C60B 4OLUH 4PY7B 4L8CB 3BE1L 3QCTL 3V6OA 1FYHB 3FL7A 3SDYL 4YUEL 4J12A 3RKDD 5CS7A 4IOIA 1PKOA 4N0CC 4BQ9A 2F8OA 5F21B 1FFRA 1L7TH 5GRUH 3QI9D 3C2SA 1ND0A 4S1DC 3ZDZE 1KJVA 3F58L 3MNVB 4MWFA 4JY5H 5DRWA 4BQCA 5FO8A 2LTQC 2X1XR 5TDNA 3IXTB 3MODL 2P5WE 4UINL 1U2CA 5CD5D 5M95B 2E6QA 2CQVA 5DJYB 4AEFA 5HDQL 1KXTB 3OXRB 4RBPK 3A0OA 5HHVH 4P3CH 5E9DB 3HZMB 1VADA 3MBEA 3BSZH 3F7PC 4UUJA 3BGMB 3OKLA 3MRPA 3RA7H 4TTDD 5CUSL 4FQXC 3G6AB 1H3PH 5TQ0H 1HIML 5IV2B 5CUSH 5FYKE 4Z7WF 5DDHB 3FN3A 3Q5YA 2QQKL 4XNQA 4AM0A 4KDWA 2Q8AL 3P73B 3RHWK 2H3NA 5C08E 2CKNA 5I1LB 1A14H 1MRFH 1QG3A 2Z35B 2BSSA 3T0DA 2IQ9H 3IKKA 1ZT1B 3SO3C 3WNPA 4ZAKC 3S34L 1N6VA 3UJJH 5JW5B 4PIRF 2AS5M 1X5ZA 3KYKL 5D93C 5DVLA 1K8IA 3NN8B 4LPVA 3VE0B 2ESVA 1JF1A 2YC1B 3VXME 1G9MH 4CVZB 4EI5B 1ZA6A 5TFSL 5E2JA 4Y2DA 1HKLH 5T3ZE 4ZFOA 1I1RA 5JNYB 2GIYA 4HW6A 4FQIH 1D9KC 4K7PH 3SBWA 2MPAL 3CD4A 5CGTA 2ENSA 3IAQA 5F7KC 4BZYA 3G9AB 2W0LA 2YD6A 4ZDHA 1RUMH 2GK0A 3C8KA 1IEBA 4MCYB 3V6FB 1MHCB 5FYJU 1UWGL 3P0VH 3PL6A 4N0FA 1T0NB 3MRJB 4YHKL 4JHAH 4MA3B 5L9DL 2DL9A 5BW7C 4L8SC 1CFBA 3UZVB 5LGHL 1KOAA 4I0PC 1KIPB 4P2QE 5MEOB 4MB3A 4JRXB 4JFFD 1A64A 2GJZA 2ZUWA 2IAMA 4H26A 3HI6L 5I6XC 5EORH 3O3DA 4OF5A 2PO6B 2WIIA 4XNYL 1JNNH 5IQ7H 5JIIA 1OPGH 3G5ZB 1W72A 2MHAB 3B8SA 1DUZA 5ACMA 4YHPA 4QKXB 5K9QI 4K8RC 5DRXB 4XC3H 4M7KH 1FL3A 2JJTC 3E6FA 1T1XB 3EDDA 2OZ4L 1CL7H 4Y1AA 4ZUSA 3QEQE 1BFVL 3BPOC 2P44B 1JGEB 2APBA 4KQ3L 3ULUF 5ALCH 2DS4A 3KPPA 3U1SL 3MRLB 3UTZA 1IT9H 1LNUA 3HC0B 5D7IB 2E5EA 5JOFA 3GGWA 1FG2B 4HT1L 2Z31B 1FGNH 4EEEA 3IDMA 4Y4KB 1MVUA 4LSVL 5L8KB 1H3TA 3DMMD 3SGDH 1P7QB 2ZCLH 2V6HA 3D0VA 1FNHA 2W0FB 1S7XB 4Y1AE 1UB5B 4Z95H 2YD9A 4KWUA 3WD5H 3EJYD 2Z9TA 3O3EA 1BFOB 3PQYA 5DS8A 5K93A 2BNUB 2OTWA 3FO2A 4H88H 1UG9A 4NNXA 1JRHH 5IB2A 1HIMH 1H3PL 3KS0J 4XXDB 1XZ0A 3SKMA 4LBEB 1EZVX 2EIDA 4UBDC 3KPLA 3ALPA 4HXAH 4XAKE 1Z9MA 4ZPVA 1ZVHA 1TNMA 4Q58C 5B39A 5C3LD 3BIKA 2DLHA 5EUKA 1FAIL 2HFFA 2F15A 5I73B 5BZDA 1NCDL 1I3GH 4DEPC 3U4AA 4YFLI 3BGFC 2GSIB 2IJ0C 1BBJA 1T80A 2ESVE 2ZPKH 3KPQA 1EMTH 1ZKAA 4H20L 5IVZA 4MHHG 4KI5E 3VWJD 2WINB 1AC0A 2O5YH 4TPRH 1EH9A 1M7XA 2C1PB 2YKLH 4P2OB 1IL1A 2EDJA 5KSUB 1TJGH 5ITBL 4MYWB 5CGYC 3AM8C 3U9PL 3OXSB 4Y4FC 1M6OA 2NCMA 1P1ZB 3IFNL 1H8OA 1GZPA 2GJ6E 2J8UE 2AK1H 4Z5RA 3TYGH 3WCYA 2UZIH 4Z8FL 4I48A 2X05A 4CNIA 1N2RB 1T0PB 4R4FH 1T1WB 4EI5D 1TETH 1XIWA 2B5IB 4I5BA 4O51B 1FSKB 4X6DA 3VWKC 4KK8C 2BY3A 3VFSA 5C0JB 4JM2F 3BVNB 2QBWA 4X4ME 5B4MC 4APQC 1JFQL 2F5AL 3BPOB 2NXYC 4MXQC 4JM2D 5FK9A 5I1GL 1XGYL 1S7QA 2VN4A 4NWUH 4RIRA 5C6PB 1VEMA 4LSRH 2XNAA 4S1SL 5HTSA 5LGJB 3OJVC 4CMMA 1YN6B 3EAKA 5EU4A 1ACZA 4FFVC 2F74A 4NP4L 3FONB 1N7MH 4Y19D 4XVTH 3OZ9L 1K3IA 1FYTB 1FGVL 3FT4A 1N64L 1KCUH 2YPLE 3RWHB 2L4OA 3HUJB 5B3JF 1CD9B 3RWEB 3D9AL 3LH2L 4HS8L 4YBHA 4L9LB 5SV4A 2DQDH 3T1FB 3B5TA 1BD2A 1UXSB 4ZFFA 4QXGH 1FFPB 2WWMD 3MRDB 4LEOB 4NQVA 3CFCH 4UDTA 5GGSY 1T5WA 1ZT4B 3Q3GA 3CFJA 1B0WA 3LEXB 1I1AB 1PG7L 3MGAA 5AUMA 3TESA 1D6EA 4IRZL 1DLFL 4HV8A 2YPLB 1AGDB 1LDPH 2CKBB 3GIZL 2PTTB 5DEGB 5CLTA 4FXGA 3T2OA 4AENB 4ZMAT 1TTGA 5EA0L 4EJ1C 5IG7B 2VKWA 3DOSA 4I1NB 2QR0B 5I1CL 4P5TD 2JJTA 4OIIH 1B4JH 1IKNA 2R2BB 5L7XL 1DVFA 4HS3B 1LO0H 4DCQB 1I1YB 2OQJB 4JFDA 1IGYB 5HYFA 3GI8L 3W2DL 2AKRB 5F1KC 5CBAA 3IXTA 1CFVL 1F4HA 3MUZ1 2EXWC 3JV4A 1DUYA 1ZA6B 5L0QB 2CLVB 2OJEA 3OG4B 3W0WD 3MJ9L 4PJEE 3VFRA 5KVDH 4AT6B 2OR7A 4OFYD 4P9MH 3IT8D 4L3EA 1AXTH 1NUGA 2Q86B 4LKCA 1SJVA 4NN7B 3QFJD 5DRZA 4JFEE 3ARBA 3QNXB 1KJ2H 2V2TA 1AFVL 2X4OA 4IM8A 4P5KB 4MJ5B 3KHOA 5CP3H 4JR9H 1L7IL 4PJGF 4P2QB 1QBBA 4NHUB 2JCCF 4OD3L 5E2UH 5CEZE 2WNGA 2C3HA 3S3SA 3REVB 4XHJD 4DEPB 2P8LB 2NY5H 2Y72A 4HGWA 2Q8BH 4L4VA 1FDLL 1I3VA 1JYNA 3GMPA 2W9DH 3P2TA 3WFHA 1D6VH 1P84J 1QP1A 1SJXA 5L2KB 3K4DA 4P23A 2R15A 3FFCA 2DLIA 1JF1B 1U3HB 3KPSD 2J88H 2YC1A 1MLCB 4UV4H 4YHZL 3WJJC 4I18C 3H9SE 3BP6A 1QO3A 1DE4B 3VGAB 5CJBA 4CVXA 4X7TA 1U2HA 1XGRB 5KVGL 2HVKB 5DFVC 1L0QA 5TPWL 1MIMH 4OCWH 4M00A 2B4CC 3AB0C 2GQHA 2BHZA 4FQ1L 4NRZA 4TVPE 1LNUB 5D7IA 3QDGB 2FO1A 4DGIH 3M1BB 1ZVSB 4NRYA 1IEBB 4M7JL 5IMKA 4QT5B 5JA9A 5EZIH 2FGWH 5D1XB 5TDOB 5CMAA 3LEVH 3OPZH 4FFWC 3RP1A 2BXZA 4P46A 5EBLA 3D85A 5F96H 3H42H 1RPQA 3FN0H 4AMKH 1HN1A 1NGZA 1YEKL 2D03H 4C59B 2BMKA 4LHUA 4YHIB 3Q6GH 1A7OH 1RZIA 1QD0A 2UYLA 4B7LA 1A0QL 3VWKA 1X5XA 2OZ4A 1MFBH 1DUZB 4DOHB 3SKMB 4FABL 4MNHA 4TUJB 1H3XA 2VXQH 1K6QH 4NOBA 1U8NB 4HMCA 5IT2L 1S78C 4HH8A 3RAJL 1DQDH 4NHCH 3LQZA 4JDZA 4Z7UA 4JHBA 3MOQA 3P9MA 2VDQL 4GW4A 3V5DA 1EXUB 3SQBA 4KI1A 2X70A 4LCUB 3TF7C 3DETD 2XY2A 4YNYA 4PLKC 1ZGLM 4TQEL 2WAHA 3SDCC 3TO4A 4JKLA 3BEVA 3RY5A 1WCBB 3BYTA 4EN3B 2FWOB 3GSNH 4IDJL 5E1HB 3IGAB 1Z9SA 1MSPA 1MLBB 4XP9L 1KJMB 4WVRA 4M61A 1JGLL 4PRNA 5K9OA 2E9JA 3BKCH 3CPLA 4UT9L 3DSFH 3EDEA 4R3SA 4D9QE 3HZVA 5HI3D 1NCBH 2BVOB 5J7CC 3ZSTA 1A5FH 1N2RA 3AGVA 2IBZY 1J86A 3B6SA 4BH8A 4S1DD 1BFOA 1U8PA 4UAOB 3V0WL 2OCFD 4OFKA 2DQTL 1RHFA 4XBGB 4QTIH 3HCVB 1MEXL 4XI5D 4MXVF 2GKIA 4Y4HD 3CFKB 5GSVB 3SQOL 3NGBB 4X4MA 2EIBA 3EYSL 3ECBB 3CC5A 4ZAKB 4HFWA 4WW2F 3QPQD 4DJMA 5HYQA 3FRUB 2BVQB 3H2WA 4Y19B 2K3TA 4NZJA 3EBAA 1BIIB 1X6NA 3EOTL 2I9TA 2LU3A 3I84A 3E3QE 1IGFH 1LK3H 2WWMC 2QLVB 3VXRA 4O9HL 4L8DB 4E5XB 4MLIA 2XACC 1FFPA 1GZQB 3MX0A 1PVHA 3WNLA 3CK0L 2A6JA 1R3IH 3BUTA 4QHUB 4UDUB 4MB4A 3Q3GB 4HULB 4MDJA 4QRPE 4ISVB 3GMLB 3LS5H 4DN4H 5JR1L 4N9GA 4KRNA 3JWOH 3H6JA 2YMXL 5DK3A 4LLAA 3JTTA 3QAZC 2NTFA 1MCJA 3MLSH 4OKDA 2VLRD 2PTTA 3EYUL 5DUBA 5GRXG 4ALAL 5C0JA 4OUUB 4HX1A 2ZUYA 1LMKA 1KLGB 1MREH 3JV6B 5EPMB 3TBYB 2A73B 2D0HA 4U1JA 3ZDYF 2JLLA 4XAWL 2BCKA 5D7JC 5IROA 3M17A 4MAYD 3MFGB 3K7UA 2DIBA 1IZKA 3DVIA 5AZ2L 4CUCA 1CGXA 3UYPA 2CR6A 5SWSA 1WJ3A 2KL6A 3PIQA 4P2OC 4N0YH 3TJHC 1HQRA 1DBJH 1T2JA 3BKJL 2CLVA 3RPKA 4N8VG 1I9IL 2HRPH 3RDTB 4GKOA 1JZ4A 3GIVA 3EYOB 4TRPH 3O8XD 4KVNH 4LGPB 3QG6B 4WW2C 4WJ5A 1MY7A 4NPYA 1ZHNB 1EEYA 3NFSH 3V4VL 3KPSE 5AYUH 4I3RL 3TBSB 4NQVB 4MA8L 4Z7VF 1BZ9A 2J5LB 1E6JH 2OTUB 3OKMB 3LEXA 3VA2C 2LFGA 5F9OL 1Z3GL 2FX9L 2ARJQ 3MLWL 1A9EA 4NNYA 3SKOA 3QQ3B 3DSFL 3BKCL 3HAEA 3JWDC 5EO1A 4BSWB 1NFDA 1JWSA 4AENA 4X80H 5CEZD 4F7CB 4XP9H 1AR1D 1T2XA 3BRGC 3NPSC 4NUJA 3QCVL 4KTDL 3QXDA 5CFHA 3QQ4A 3UZEA 2VABB 2IAMD 4GMTL 3MV9B 4JFED 5CBAB 1FZMB 2HP4A 2BDNL 1KTKE 3R0NA 3WO3B 1UC6A 3JBG7 3I02B 1G7LB 2W59A 5T33H 1WBZA 4NQCE 3X12B 4JPIB 3EO1B 4JZJB 1GC1H 1U8LB 4PRBB 3SGKA 3GMRA 1JN6B 1Z2KA 4AK1A 2HT4D 3TVMD 1BAFL 3NZ8A 4ODXB 4YDVB 2CRYA 5ABDE 4HBQA 3RWFA 1JF5A 1RUQL 2VIRB 3UBXB 4QRRA 4L4TB 2XTJB 2YPKA 4YHML 3WS6C 2DQIH 1F90H 3DUSA 3ZO0A 3GJEB 5MENA 3GSRA 5DRNA 3QYCA 3GSVA 3SE9L 3HLAA 1QSEA 3R1GH 4R26H 5FEBA 3VXNB 3HC4L 4GAGH 3L3KB 2ZUSA 2G60L 4MCZA 5I1KH 3TZVB 2NX5A 2UWEA 4FQ2H 1I8MA 1LP9E 2XIDA 5L2KE 4Y8DC 3BDYH 1YPZA 4MQSB 3SDXF 1WV7T 2P24B 3BKML 5DRWB 3SEPA 4E41A 4O4YL 5D71H 4P4KD 1DZBA 1LK2A 1DANT 3KPTA 2BVEA 5JOPD 4FZ8L 4CVXB 1IGMH 4X6CB 1LO2H 2EDEA 1S9WA 4PJ5A 4G80B 1I7RA 2R56L 5B38G 5IBTH 2ADFL 1ACYL 4JVPA 4Y4FD 1BZQK 3TO4C 5EU3B 5I8KL 5DGQA 1X4YA 2FATH 5IMMB 1FVDA 2FJGA 3GSQB 4LCYB 1QLEL 3HPJA 2GTZB 4NQEA 4EI5C 1CFQA 1N3NA 5E2UL 3THML 3RPIA 1C5CH 4ZFGH 2P7TB 2D7TH 1CS6A 4WUUA 1PKQE 1RZ7L 2CDGA 4HUXA 4KMTL 2V5RA 3HG1E 5I1LA 4L5FL 4H1LA 4HIHA 4X99B 4X83A 4KV5E 4DQOL 2QSCH 1A6PA 4YK4B 3BP7B 3C5ZC 4H26B 3ILQD 3TP4A 1RZIB 4QHLB 3Q5TA 1JPFA 1KCRL 5LXGH 4F15B 3ULUE 1MCPH 5E9DD 5JUEH 3NCJL 3NZHL 4XB7A 5IW1A 3MOAL 5IHZB 5DUPL 1AGCA 4HLZH 3TH3T 4JFFB 4HUNB 2AEQH 4TSBH 2FL5B 2ADJB 1A6ZB 2VR5A 1DBKL 4X6CE 4HHAB 4U1IA 2IMNA 4HQQH 3V52H 3GKZA 4G43B 4JFDD 4IJ3B 3MRLA 1AH1A 1J5OL 1WCBA 4HKZB 4KK9C 4O2FB 4WO4A 3NACL 4L29B 2R8SH 5D5MF 3OGCA 3TA3B 2FR4A 1Y18A 3SCMB 2MMXA 3JUYA 43CAB 1T0NA 1YNLH 7FABL 4OZIA 5EOQH 3QUXA 5IVOA 4F57H 4R97B 2E9IA 4PY8J 2RFXA 3D69B 1QA9B 3UAJC 1CFSB 1DP0A 1JPSL 1Q9LA 3QNZA 4UIMB 3KNBA 4Y1AD 1W8OA 5EH1A 1MNUH 3P9WB 1R3HA 4EBQH 3QUZA 4Z0BL 2PR4H 3O3DB 3OKDB 5EOCL 5I8OH 2A9NH 4BYHA 4PGCA 1A1NB 4AJ0A 4OCNC 4DGVL 3A6BH 3FB8A 5BMFL 2ICWB 2JE8A 5CJ8A 3AXLB 1T5XA 1WBYB 2E9WA 4BUHA 1MOEA 1DSFL 4GBXB 1ZEAH 32C2B 3LN4A 3EZ8A 1ORSB 1D5XA 3SOBH 5JOEA 5DMIH 4U6TA 3QHFH 4Y19A 1I3UA 4BFBD 3OKNA 5C1MB 1DDHB 3CFEA 1UT9A 4PJIE 5DTFA 1VKXA 3ET9F 3HS0A 3QEQD 3HI5H 1EHLL 1J0HA 1JFQH 4L8DA 4YC2C 2H9GB 2OSLA 3LKPA 1ZHNA 3DGGA 4P2OA 4G9DB 3VRJB 5C07B 4MQTB 4YLQT 4OCSL 5DJXB 3D2UD 5I76B 4IBLT 1AHWC 1W0YT 3DX7A 4OZGA 3ZDZF 1QSVA 2AK1L 3D87B 3BAEL 1JF6A 4PJAB 3O0RL 1UJTA 4LKXA 5K9JL 4G7VH 1YEJL 5DFTA 2ADGA 3OAYH 2NY4C 2WBKA 2WBJC 1D5MA 1E4KC 3DUUA 1FV1B 4NFBA 5DI8B 1WT5A 5H94B 3JV6A 5EPMA 3TBYA 2QADC 2V17L 3KS0H 5HYJB 1U41A 4J4PC 3G6DH 3SDAA 1GGIL 2IPTH 2K7QA 3LKOB 1N0XL 1C5DA 4X4XB 5AD0A 3KPSB 2R69L 5TQ2H 1HXYB 1I3GL 5AWNH 5GRJH 3X3FH 1MF2L 4DGVH 3VDBA 3RVWD 4XPHL 3PNWA 3NPZB 3TM6A 4JRWA 1G84A 1MQKL 2R0KL 1A47A 1JJUA 3D18B 3V4PH 5CAYB 4LARH 2G9HA 1BVKA 1EBAA 2EYRA 4K8RD 2J2ZA 4R7NB 5C0RL 3AB0B 5BRZD 3VGHA 1GAFL 4NC0B 4PYHA 2VZUA 5D6DC 5J11B 5EOQL 4KPHH 3OKMA 2HN7B 5FO7A 4XNZC 5IFAH 4U6YA 3RTQB 5DYOA 4NBXB 3MLPA 2Z31C 2AEWA 1F58H 2VERN 2D7NA 3SKOB 5C08B 3VGDA 1G1YA 4XB8A 5I18L 4CNIB 1AGEB 2JJSA 4EDXA 5D2NC 4YHYB 3L9RA 3VXNA 3UYRL 4P5TA 4NFDA 1BX2A 3MMEA 4MAYC 3RI5F 1Q1JL 2AJVH 3ARBD 4ZS6D 4X9HA 4YR6B 1ZANL 1ROWA 4POUB 4RIRB 4LHQB 1A6WL 4JJHA 5ALCL 1YN7A 4NKOB 3GSXA 2MSPA 3W5NA 4NYLB 4LK4A 4DK3A 3FQNB 5CZVL 3WN5A 2C3GA 3DETC 2FD6H 5ACZB 1O7SA 5F9JB 3LN5A 5IF0B 5C7XL 2FHBA 2BOCB 4NQSA 5GRWA 1DUYB 4OLXH 5KSVA 4JY6A 3BJ91 1PEWA 2A74A 2PYEA 1MJUH 3QEGH 1TVBA 4PJHA 4X98A 4J8RA 4XNYH 4U1SB 3U83A 5CEXB 1A7RL 3BPLB 3GJFB 1FZKA 1KNOB 1EAPA 2DD8H 4LDLB 4WGWB 3KJ4B 4EI6A 1BF2A 3D5OF 3O4LA 2CLRA 5IOPB 4KRLB 4LQFL 3RWCA 5GS0H 2FJGB 1IC4H 4HDIA 4ZUUA 1FNLA 1IM3A 2BSTA 1LD9B 3GSRB 1FE8H 3BGAA 4MD0B 3LHPL 1R3JA 3UBXG 4KRMB 2CUHA 2XZCL 5IBTL 5T1LD 2NY3D 5TE4H 4WCYL 4HKJA 5CGYD 5K59F 5I16B 4KMQA 2X4NA 5FA3A 3UC0H 3H7BB 5E7BA 4C4KO 1FPTL 1KEMH 1YPZB 1HSAB 4QRQA 4OI9A 1UH2A 1J1XH 4XNMB 5BO1L 4M7ZC 4UOJA 4X7SH 4F7TA 5A2KH 3GHEH 4AQOA 1NLBH 2R1XB 3L3IB 1U3YA 2GTWB 3O11B 3MRKA 4XBEL 2RAMA 4Y8AA 4FQHB 5DFWH 1OARL 3LZFH 4LDOB 4P4RB 1NGYA 1PY9A 4Y16B 5EWIH 4GAGL 2G75B 4H1LG 4XMPL 1KENH 1LHZA 5SWZE 1DEEA 2V7HB 4NQEE 1SYVA 4Y16D 2HJKA 3MV7B 4L29A 4U0RC 4M43H 3V0AC 2OK0H 2GJJA 3P4NB 5GGVH 5GQBA 3VGAC 4OZIB 1QBLH 5JXEC 1P2CB 2X1OA 3KPMA 3CFDB 4G8GA 1IBGL 5HDLA 2AVGA 3BUYA 2B1AH 4LLMA 1GC1L 4MQXD 1NC2A 1A6TB 3ZDXF 5D5MA 3SDCA 3O6LH 1UH4A 2B2XL 2QSVA 2IBBA 3WFBH 1DLHA 3AS3A 1HZHL 2UYLB 1GGUA 4IIQB 4X6CF 2XZAL 1L9NA 5KTEH 4X0KB 5C70A 3NCEB 3SY0A 4JO4L 1CDUA 3FMGL 4M6NL 4X9IA 5E6IC 3V0VA 2PUQT 3KLAB 4IOSD 4YBLB 3I85A 3V6ZB 3D0LA 2WUCH 3FRPG 3RL2B 5EO0B 4F3FA 5T3XL 3DWTA 3ULUL 5E03A 3ZKND 4QYOA 5I17B 4RFNC 4DK6A 3C8DA 3CMOH 3TNNA 4PRAB 2DMCA 3MNWA 2VDPL 4WY7H 1Q9OB 4N8PA 4G6KH 4EN3A 1LGVA 5C07E 4KK5D 1YYMH 3MRQB 2MCPL 1SMOA 5MEQB 1LEGA 5DD0L 5L0QC 1WZLA 5JDJA 2UWEF 3QUXB 1S5HB 1MWAH 4I18B 4KY1H 4QOKB 1RUAH 3Q1SH 3AU1A 5KVMC 3WIFB 2EDXA 5HI4C 4M9PA 1S9YA 2VLKE 4F7EA 1UB6A 3GRWL 3QB7C 3GZKA 1FO0H 5IFHL 3MLXH 2FCBA 2OMNA 4M03A 3W11D 1A1NA 1Q72H 4Z7NE 3DUUB 1PBYA 2H8PB 2Z8RA 4KHXL 3GM0A 1A1OB 3ZHLA 2EH8H 1MFAH 3ZKSD 3V79C 2CXGA 3TFKD 4OGAD 2Y36L 3P4MA 3MRGB 2X70B 4LCUA 4PJFB 2JIXA 1FSKC 1E27B 2V5TA 3QEUA 4X6FB 5FDWB 2AQ3A 3MLSL 4ZUTB 1MRCH 2I9TB 1HH9A 1FO0A 3EDJA 5J12B 4MNGB 4ZAKD 4WUUD 2D9CA 4R4NC 2YRPA 3E2HB 4XPTL 5A3IC 4N8CH 4YDLB 2F53B 4PJ7F 5D7LD 2FX7L 4R3SB 3HZVB 3BWAA 5I15H 3H3PL 1MHHB 3MRIA 5AZEL 2EO9A 1A7BA 2IPUK 1KFAL 1NFIA 4YX2H 4YQXL 2AJSL 5C86A 4PBXA 3MV01 1B0RB 5F1OB 2IALB 1OGAB 3V7AG 2A77L 2DBJA 3HNTH 1PQZB 4GAJH 4JQIL 4KKBD 1I8LA 5E8NB 4P23C 5ACLA 2HT2C 1I1FA 1KLFA 3OKKA 2J6EL 3BZ4A 4WU7A 4KQ4H 1GHFH 2FIKB 3T4YA 4M5ZL 2HJLA 5HYQB 4Z9KB 4JAMB 5EIIA 3MYZA 5SWSB 3RJQB 4ZD3L 2AV7B 3DX6A 5FHBH 2WBWB 3OX8A 4HXBL 4LCWD 4MNQE 5DJYA 3PDOB 5IQ9B 4LMQE 4XNXL 4WEUD 3UX9B 4GS7B 3L7FA 1JYVA 1VADB 3ZHDA 1BOGA 5DD6A 3IJHB 4LU5H 4PJDE 2WLZA 2HN7A 3MLRH 4JRYE 4EN3C 3MGOA 4NRXB 4LFHG 1KCSH 3V7MA 2B1HL 3FB6A 1EO5A 4ZUUB 5GGQH 5GSRB 2BOBA 2B0SL 5F72S 3IS0X 4R96B 5TH2B 4NIKB 4V2CB 1RVFL 2L7UA 1DQLH 3MMEB 4WI5A 2C1OA 5I19H 3QFDA 4NUJB 2AERT 5FYKU 5HVHB 3DRTB 3EYFA 4R9HA 3QCUL 5C0BD 2ITDB 4F33A 3C5ZB 2FJFB 3LPWA 1YN7B 4N90D 4NKOA 1F6AA 4WFHD 1ZVYA 4F7TB 4XPBL 3VRIB 5C0NC 4JGJA 1NMAH 3QWRA 1OGAE 1YUHA 3E8UL 1AXIB 4HJJH 3DSNA 1JK8B 3I6LE 3WHE1 5HHMB 1A6VH 2FIRT 1MRDH 3MLYL 2VXVL 5DJCA 2JKXA 5FUCC 3SGEI 2RCSL 2ZCHH 4JHWL 5DEFA 4JPIA 4P5MA 4ZTPH 2APTA 3VRLF 1WGOA 1YEKH 1FLRH 1J1OH 4JFOB 4OCXL 2F54B 4WI7A 1NGYB 4Y16A 5D1QA 3IB4A 2NZ9D 2XTJC 3WLWD 1I75A 1BQHA 3ROLA 4ZO9A 4UUJB 4RAVB 1CG9B 3UTTA 2Y1VA 5JO5B 4QHNA 4WWKC 5HHOD 2D4FA 1U8IB 1HH6B 1MCFA 2WSKA 3DX9A 4W6YB 3ARXA 1SBBA 5FM4A 4X7EC 5DFVD 3CVHH 3P73A 3I3BA 3CVIH 3CUPA 1I3RA 4J3TA 3FQWA 1J0YA 5KVGH 2DYPD 4HKJB 5I16A 5E8DH 1QYGL 2VE6A 5DD3H 1DBML 3VFMB 2VQ1B 3IVKB 3P0GB 4L4TE 1KPVB 3Q2CA 3IDUA 1P84K 2AGJH 3TN0B 2I5YH 5C9KA 2CKBL 1P7QD 5D1ZC 1MAMH 3F5WA 3O3BA 1UM6L 5H2BA 1JGUL 3S4SB 4M6MH 3S37X 3VFNA 35C8L 2EKSB 4FS0A 1EHAA 1XIWC 4ZFOB 1VGKA 1U8LA 2KQMA 1G7MB 5DSCB 4TVPH 3CSYB 5IFJB 1I1CA 3DNKA 1G9NC 3SBWC 4KK5C 2WQRA 1MPAL 3PWPD 2ITCB 3GMOA 1A9BA 4KU1A 1T6VN 1LP9A 2ZCHL 3DYMA 2BZDA 1LEGB 4YC2B 3T0EC 4TUKH 1OF2A 2IPUG 3RPIB 4C56D 4LP5A 3KPMB 5E8OB 1JP5A 1UM4H 2EDWA 3L6FA 4DFIA 4JKPH 1QSEB 3FOMB 2JELL 2DQGH 2CIIA 2ZWLT 4FN0A 2O61A 1J9CT 5EZJA 1KCVL 5CSGA 2W0FA 4JO3L 5F88B 4KDVA 1A6UL 4DAGL 2NX5B 2UWEB 3ZT7A 3JWOC 3MA7A 2VC2L 2VZ3A 1ES0A 5GGRA 1BFTA 4X4YA 4RFEB 3DRQB 3ZLQC 3TYFA 2PO6A 2WIIB 4ZUVA 5DC0A 3RGVB 3ZMRA 4CJ0A 1JI2A 5IVXB 1PFCA 4FRWA 25C8L 4IMLA 5F7WC 1VSCA 3EO9H 4KUCD 2XN9D 4MXQD 3GSOB 1RZKL 5EZOH 4TOYH 5DJZA 1UKSA 1UZ6E 3ULSB 1L4IA 1B0GA 3OKEA 4FG6D 5ILTL 1TZGH 2R1WB 4U0RB 4NSKA 4PJFA 5EA0H 3OAUH 1WITA 1S7VA 1I7RB 1MCNA 3D85D 1VFAB 2HFTA 4GRLA 5IW6B 5DJ8B 3U0TA 3MNWB 4FFZH 3RVTD 1F4XH 1XGTB 5JLZB 5JXED 4HKZA 2J4WH 1PSKL 3INUL 4URTB 3OHXB 3QIWD 1C7TA 3QPXL 2IMMA 1AIFA 3GMMB 1NSNH 4WW2A 1Z5LB 5CD3A 5DVOA 5IBLD 5E0QA 1WEJL 3IETA 1INQA 3OAZH 4C54A 4JANB 3I2CH 1MJJB 2WW8A 4JN1H 4MJ4A 3DIFB 5EU7C 1FRGL 4JDTH 5AEAA 4JZOB 1JZ3A 4NZRL 3D25A 3FQXB 4RFOL 4F7EB 5KW9H 3OGOE 4OCLC 3QUZB 2BNUA 4DVRH 3MPCA 3G08A 1HHJA 1IQDA 2DQFA 3VFSB 2EDKA 1QBAA 5E94B 4EIGB 4OFDA 4P23D 4NM4L 2ADIA 3OZ9H 3WKMH 2X7LA 2PF6A 1G7JB 2NNAB 5D93B 5HGDA 2AJSH 4HIJA 3TBTA 5ADPH 1N6QL 3D39A 1KPRA 3VFPB 5D7JA 2WM0A 4L4JA 1XGYH 4JM2A 4GO6B 3B3IB 3AY4A 2D3VA 1S7WB 8FABB 5JW3L 4TULH 5KG9A 1AJ7L 1G0DA 5HHNA 2G5BA 4O02L 5C09D 2QQNH 1JUFB 4KHTL 5IVXE 3FOLB 4UT7H 1QFUL 2WMPA 4BZ2H 3FB7A 4E41D 1T1ZB 2BSED 4Z7OE 3JXAA 5E4EC 2C1PA 2W0KA 4HBCL 1X5IA 3IJHA 1JWMB 5D1QC 1JNLH 1JV5B 1JHKH 2NW3B 3HFML 4HKBA 3QIBB 4QTHA 2X2YA 2FH8A 1MHHA 4P3DB 3RX5A 3OTTA 5ESAB 4IOFC 3IXAB 4LF3B 5FM5O 1U9KA 3EOAA 3OL2A 3WO4C 4PBWD 5F89B 1FAKT 1W72L 4CVWA 1DEDA 5C9JB 5F7DA 3QUKB 3L95A 5EC1A 4WTWA 1WFNA 2GAZB 2ZOKA 3MLXL 4Q9RL 1E0OB 4EDWL 4IOIB 1I1YA 2OQJA 4JFDB 5GJSL 1DQMH 4HXAL 4KK8D 3UP1A 3RIAK 3RZWA 4X4XA 5AD0B 3KPSA 5LQBL 5F9DC 5IHLB 2NY6D 3K2MC 4BSVA 5GGTH 1OM3L 3ULVD 4PTTA 5BXFA 4XCCL 4GLRH 1EFQA 1G6RL 4MHHI 1DDHA 4F37K 2CMRL 3PUCA 1EEUA 1U8MB 1CE6B 1NDMA 3K1KC 5HHMD 3U9UB 3RWDA 4LVNC 1YDPA 1AQKL 1I4FA 4PRHB 1BQHB 3ROLB 4UDTB 2WZPD 3CMOL 3MBEB 1CQYA 4S11A 3Q5OA 5I76A 1DN2A 2DJ4A 5K9KB 5AUMB 3HPLA 1CLYH 3QR2A 3MRNB 4XC1L 2AJXH 2LU7A 5GZND 3H0TA 3WUZA 5DDHA 4Y5YB 1ZLUH 2F5BL 4JO4H 4LIQL 4JVUA 3U1SH 5EUOE 3L9RB 3C5SA 4IMKA 2DMKA 1WZMA 4EUPA 4U1MB 4MAUL 4JE4B 3TT3L 4RNRA 3X11A 2APFA 2CH8A 2Z35A 4ONGH 2X1WL 2X41A 4HGWB 1GGBL 4RAUB 5BCAA 2RIKA 3VFMA 3SDAB 3QDJB 5ID1A 2D7OA 4GRLD 4HIIA 2ITDA 4LNVA 4F33B 2FJFA 3VFGL 1KPUA 5HYJE 3QQ9C 4UU9A 1OTTC 4P5TC 2B4CH 1UVQB 2YD1A 1AO7B 4RRPG 1IAIH 5JQ6H 4TNVF 2R2CA 2EKSA 4KTEH 1ADQA 5ITFB 5KSVB 2YOCA 5SWSD 4FTVB 4LSSH 1HDMA 3PWUA 4M3JA 3GK8L 1R6VA 1KENL 5ELIA 4XWOC 5I1IL 2M2DA 1WIPA 3OF6D 2AV1A 3BEWA 2QEJA 3BW9B 4OLYL 4P9HH 5KSBB 3L3GA 2NY5C 4NHUA 5EZLA 4B5EA 2CK0L 4ZSOA 2HTLD 1YNTB 1JPST 4NO3B 3VXOB 3SDDC 3G6JF 3GO1L 4KI5C 4D2NA 1RI8A 3UC0L 3ZYZA 3TYFB 5DWUH 3QUYA 5D1XD 2GHWB 3DXAA 2QADB 1C5BL 4PGZA 4I0KA 4N68A 1BIHA 4CN6A 3KPRA 4PRPB 4A6YA 4JKWA 2VDOH 4U1KA 1MAKA 1IC7L 1CCZA 4TSCH 1W2KT 2PYEB 3VMOA 1WZKA 3KDMA 4Y5YC 4QHKJ 4LLYA 1NC4A 3WEXB 2HVKA 5D6DA 2YBRB 4D0CA 3QDGD 3D3VA 4U1SA 1A7RH 1T21A 3MRPB 3NCBB 5FOBB 1F6LL 1YYLL 4EI6B 3BDXA 1P5UA 4DKAA 3MV7A 1LP9B 3SKNB 4ZUWB 3VFGH 1AIFB 3QXWA 5IV2A 2ZZUT 4N0FB 4DW2L 1HXMB 4AM0B 3BISA 1W8NA 3ARDB 1AR2A 2DLFH 5HYSA 3BXNB 3TH2T 3NH7H 1RK1A 3T2PA 5HHVL 2XZQH 4XVJL 1N6UA 3UPAA 1ZANH 2F5BH 3VGEA 3ZL4H 5IROC 2ICES 4JJ5B 1CK0H 4PGEB 3FCTB 1OAQH 4NQDA 4UTAH 5DS8B 4ZUVB 3MROB 2NR6C 5CJQL 4O2EB 4XC1H 5C3TA 3S96B 3HN3A 1AQDA 3KYMB 3WFZA 1P69B 1T20A 1ZGLP 1UYWL 4YWGL 5C0EA 1OGTA 4XVSH 2GITB 3HUJE 2A9MH 1AQKH 2JJUA 3B3IA 3HE7C 4RDQF 4JG1L 4OAWA 3V6ZA 2N4IA 3BIKB 3CFBB 2Q6WB 1CFTB 5DURD 4X5XB 3BD5A 2EZ0C 1RK0A 1FVEA 4NGHH 4PRPE 4U1HB 3RX8A 1WWAX 3VXPA 1UWEL 3UTZB 1S7TA 3N50A 2FHCA 2X44D 2VDNH 3CZJA 1EHNA 4PJBF 1JZ8A 3IYLW 3MRQA 4QGTA 4L3CA 1N5YH 1G6RB 2A6JB 2R0KH 1QRND 3EO0A 4LRIA 2JK5B 1NMCC 1BM3L 2CIKB 2DYPA 3EDKA 4KJYA 4OD1L 5KANI 1QKZH 2XI9A 5FYLH 4QOKE 4Y2DD 3EOAB 3RGVC 4NC1C 1UB5A 1NGXA 3BIAX 1UB6B 2QSTA 5MP6L 1SMAA 1WIOA 1AKJA 3FO2B 4KVCH 1MWAA 2X7LB 3R8BB 1W72B 2MHAA 2ZOKB 4JFZH 5FM8A 1T22B 4UB0H 4NZTH 4PJEA 1CZ8L 3DHMA 4L3EE 2NY4D 2WBJD 2YHGA 1NAKH 4AG4H 4F3FB 3P4MB 1NL0L 1P7KA 3ARQA 4OZFB 1G1CA 3PIQB 1OL0A 3H9HA 4WV1A 1FQ9C 4FMFA 4GRWB 4YE4H 1AO7E 3EYOA 4HWZB 1QFOA 3HC0A 3SDXB 4JQXC 5JOFB 1EHLH 1MFEL 4TTDC 3TPUA 4NQTA 5D1XC 5F7EL 1OAKL 5CWSA 4WI8A 2OTUA 5AAMA 1FL6A 2AXGB 4NZUH 4N9GB 5HVWA 5INDA 4QNPF 2ILLA 4WGVB 2FB4H 4Z7VA 2VISA 1RV6X 3RWJB 1FZJA 1IILE 4RFNB 3LB6D 4OT1L 4X6DB 4OUUA 4JFXB 2XRAH 4QXWA 1PYWA 4KZEL 1KXVC 5JHLH 3MLVH 4ONOA 2CJUL 4BH7A 3D6GA 2ORBL 3HMXA 1R5WB 2OX5A 3DROB 3QUMA 3N1GC 5C0DB 4J7RA 3QPXH 3ZKQD 2VDLH 5HHQA 3VU2A 1YEEH 3RZCD 2VSDA 5IB1B 1MCQA 2J4WL 2AI0L 2ZUQC 5TF1L 1QEWA 4KUZL 4F80A 3D1MC 4JFHE 1HILB 1C1EL 3QUXD 4LSPH 2EXWD 3D39D 2XWBA 1HNGA 2IADA 3FFCE 1XAUA 1XR8A 4FZEL 3H9SA 1YDPB 4PRBA 5HYIA 1EJ6A 1J5OH 4MJID 4BSJA 3CU1A 5IIEB 3G04B 4N5EC 3KPNA 2VLJD 1DVFD 4KUCF 4POZC 5KANG 1VENA 3HPLB 2YPKB 1VFBA 3LQAC 3O81A 5H8DA 5GSRA 3BJLA 1NFIB 2EECA 3HE7B 5GGTA 5JUEL 1OLLA 2H1PH 1U8KB 5IG7A 4U05A 3REVA 1FH5H 4JFEA 1ZLUK 2ATPB 5EIQA 2YD5A 1MH5A 5FGCE 4XP6L 1SY6L 1UCBH 1TJIH 2VLRA 3AUVA 4E41E 1RY7B 2OL3A 5I1DB 4MS8D 1A7PH 4F2MB 1F4WH 3DVNB 1MFNA 4QGYA 2OR9H 4J23A 4C55A 2ZG2A 5F3HB 4CDHA 2KBGA 1RIHL 5HGAA 5FIEA 1BPVA 3VFRB 1MQ8A 1H15A 1JTPA 4QRPB 5DUML 5IBLC 4PREA 2Q86A 3I75B 4WI3A 3O2DA 4K2UH 1NGPH 1O5DT 1YEHL 4PB0L 5EBMA 3PHQB 1A7QH 1NLDH 3GSQA 4LCYA 4M9OA 1QNZH 4YIQB 1I8IB 1KGCD 4HUUB 4QRUA 1AI1H 2VKXA 1GRWA 1A3LL 3ARDA 5E8DL 4OV5A 2M8XA 3U48A 3IF1A 2QR0A 1HKFA 3QFDB 3BP4A 2P8LA 4U6VH 2DICA 2VAAB 2NR6D 1DVFB 4HS3A 3FCTA 3OSKA 4DCQA 4Z7WA 3ES6A 4JN2B 3AFLA 4OZHE 4AZ8A 5E99L 1IMHC 4ZTOL 1CVRA 1N5AA 1TQCC 2D7PA 2ZJSL 3QO0B 3WHXA 4P23B 4K9EC 4H5SB 1P4IH 3QUYD 5JIKA 4BZ1H 1EJOL 4P59H 2QHRH 2C3VA 5C0GB 4KH2A 1DQQA 2WP3O 5K33A 1U8NA 2VLKA 1U8OA 3PABB 4ORGA 2FECL 4YHMH 1S9WB 4PJ5B 3P9MB 1HE7A 3ZDYE 5EFIB 2XQYG 5DD1L 5IHBA 4GAYB 2I60L 4GSDL 4OQTL 1T21B 2CPCA 3WHE0 2D0GA 5FCUL 1DN0A 2BY2A 2XWJB 1AP2B 4ODVL 4PJGB 1NCAH 4PJ9A 4H25A 3WNMA 3HNVH 2X4OB 4YXLL 3QRGH 4A2LA 3TLRA 1H3WM 3K74B 1MCSA 5IKCB 2XKUA 2EDBA 2JB5L 1MLBA 1RIUH 4JY4A 3W11C 4UV7H 3P4OB 4JG0L 5CJXA 5CHNB 3MBEC 3MFFA 4HFUL 3WDHA 3T1WA 5FO9A 4C56E 3D69A 3BRDA 4FQJL 4G6MH 4G42B 4X99A 2NTSP 4GMTH 2X4UA 4G8GE 1BLNB 2VZVA 4YHIA 5DQJB 3QCVH 3HB3C 4PGCB 1AKJB 1T89A 4OBRA 5HPMB 1OP5H 1JHLH 3NABL 5D6CA 2ICWA 4N5ED 12E8H 3C8HA 4Y4HC 5E2TH 3ZE1E 3IDIB 2GITA 2NY2C 1QO3B 4QWWD 1ZTXH 4M3KB 2ZSVB 5KVEH 4RMVA 3H9YA 3ILPB 5GISL 3L3OA 2BERA 4Z7QE 1YEGL 4X5XA 5C0BA 5JMRA 4MA8H 4XP1H 4WNQA 5GPRA 4F9LC 1I7ZB 1NCWH 4LVHB 1UACH 2IFFH 1NKRA 4M48L 4QCIA 4KQ4L 4NJ9L 1M4KA 3W81A 4MS8C 1OF2B 3SDAD 4QHUA 4UDUA 1BQUA 3G9VA 2E8ZA 3QXAB 5KZCB 3DIFA 5SX4H 4ZNCD 3OJDB 1H8SA 3C09B 2AJ3A 4GKSA 2GSGA 4YX2L 5KVFL 4K07A 2XG4A 5M7QA 1RULH 3JV5A 4FXKB 1EUUA 3DRQA 3H3PH 5HHOE 3ARGD 1NC2D 3DI3B 1BQLH 3RZCB 3MCLH 4N8CL 3FRPA 5HJ3A 3O4LE 4MA7H 1KN2H 4LLQB 4P48A 4TUJA 3OB0H 3CC5B 1A2YB 1RZKC 2AABH 4ZO7A 1RHHA 2AXHA 2QV2A 4R8WH 1JYXA 4W4NA 4MJ6B 1OGAD 3HHRB 1WIUA 2YRZA 4YNYB 5GGUB 4XXCA 4P46D 5GZOC 1VKXB 2EO1A 4N90E 4I0PB 3U82B 2OBGA 1FBIL 1H3GA 1XGTA 4OLZL 4N8VB 3QEHB 1JI1A 1CDGA 3ABZA 2R0ZH 3LV3A 2E27H 5FDYA 2BY1A 2AXFA 4O5LH 5MEND 1GOGA 2B7DT 4FQJH 4G6ML 1T4KB 2DQEL 5TE7H 5I2IB 4PJAA 5FHAL 3RWJA 1AGEA 4QY8B 2GJ6B 5F1IA 2VOTA 1JWSB 5IB5B 3QRGL 2FEDC 3ARVA 1X5GA 1U8KA 5HI5D 1H5BC 3SE8L 1Q38A 3PV6A 1BOYA 1MFDH 2VDRL 3GEWB 4MDIB 1EO7A 4LCCB 5CIPA 1QHPA 2JJSC 1A5FL 4MNQD 2GT9B 3AS2A 4F2MA 5FHAH 5DC4B 4JM2B 4PS4L 4IEFB 2V9RA 1FZMA 3BT2H 4R0LA 4PV8B 3WUWB 4MNQB 4V2BA 5KN5A 1OQXA 2ED7A 3WIHA 4PJBA 1QR1A 2VTFA 2XPGA 2YR3A 2F58H 1P4IL 5CP3A 4PUBL 1QSZA 5ID0A 3OXRA 1X9QA 5DEZA 3SCMC 3VD4A 3S36L 1I4FB 4FNLL 2VNCA 5C0ND 2Q7YA 4LIQE 2CRZA 1EERB 3O41B 1GGCH 2ZSWB 4ISVA 5EBMB 3V95A 5CSZA 3WJJA 1J8HE 3O2WL 4WV1C 4LF3A 1CTNA 5TF0A 1NKOA 1A3RH 3PWVB 1S9KC 3DECA 1J8HA 3EJZD 4NUGL 5C0CB 3C60A 5E4IA 3VXUB 4HCRA 3L3KA 3SE3A 4EUPB 2Y23A 3BP4B 3CSBA 2Q3AA 4RAUA 3GI9L 5E6YA 4JFQB 3ULVL 1VESA 2KPNA 2W65B 1T7WA 3MV9A 2FEEL 2VR4A 3RDTD 1UZ8B 1U91A 5DVKA 2WWKT 4OM0H 2HLAB 3EO1A 4L8SB 4M48H 5E9DA 3VXSD 4X98B 4XBEH 4QRPA 1TQBB 1TLKA 1U95A 4NKMA 1F3DJ 4DKFL 1NCWL 1T66D 1JMZA 1ZSDA 4GQ9L 4XH2A 4XNZB 4K7PY 4J6RL 3BH9A 2FBOJ 3PHQA 3V6FA 3FHAA 4U1GB 2OJZH 3K3QA 5C0FB 1HK6A 1ADQH 1WAAA 5DGRA 4GQPH 5E2VL 1MELA 4LLUB 5KVEL 4J1UA 1PX4A 4TN9A 3KYAA 3BHBA 2VXTH 2L0DA 3HLAB 3NAAL 1UENA 4XPAL 5LCVL 2W9DL 1F97A 2X4NB 2IAMB 3RY4A 2ZUTA 3VDCA 5I66B 4M6OL 3FTGB 2VUOA 4QHLA 4K9EL 1X6LA 2QKIA 4S1QL 4D9LH 2HFEB 1QFWL 3OR7A 1YJDL 2HTKD 4YHPB 4OD3H 4JEGB 5FOJA 3QDME 6FABH 4I2XE 4U6XA 1ZS8A 2YS4A 4M4PA 4A6YB 3QZWG 3ZYOA 1DL7L 2A6DA 3I9GH 4X6CA 1MJUL 2LE9A 3BFOA 1YEEL 2FL5A 1Q8MA 4Y5XC 3S37H 1KC5H 4MXWL 5I1EL 4Q9QH 3TJEH 3E0GA 5FCUH 1RU9H 4XT1C 3X13B 4F58H 5DA0B 1BD2E 1UFUA 3HR5A 5C71A 4F7MB 1NUFA 3PL6B 3QG7L 3OGCB 3IDMB 5D7IE 5HHOA 4Y5XB 4HS6A 5HHPA 5IMLB 2P7TA 4PLOB 1ZXQA 4PJ7E 5KSAC 3RX7A 3IDNA 1EJOH 2ERJC 3AU1B 4FQLH 5LG1A 1MI5E 4HPYH 5CKGA 4RWYH 1RK1B 3WIIL 3UAJD 2AEIT 1YEFL 5E99H 3BWUC 5BV7H 1I9RL 4Q2ZA 4G9FA 3GI9H 3O3EB 4XZUA 2HYMA 4OIIL 4NQED 2OI9C 4EIZC 3ROOB 1MFEH 4IIQA 5E24E 3O3AB 4YE4L 1FL3B 4K94H 5SV3A 4PP2A 4RQQA 2V5MA 3QBTB 1LE5B 1NAKL 4AG4L 2X4TB 4ELMF 3VFUB 5EDXA 4LARL 1MHEA 1IQWL 5DHXB 4LCWB 4MVBC 3W9EA 4PJCF 3MXWH 2YA1A 3V5KB 2Z4QA 1ZLVK 3KPQB 3MSPA 4CN1A