5E9DD

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSTSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTKYSWGKLQFGAGTQVVVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 110
sequence length 110
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dD00
2MNUA 1EFQA 3KPPA 3A6OA 3QCTH 4YHPB 2QR0A 1J1PH 4LEOA 4PJXF 1EO7A 4EUPH 4YFDB 4GKSB 3WFEH 5ID1B 2XG5A 5EC2A 1GC1H 1A4JB 2X7LB 2FH8A 4P23C 1GH7A 4HUVA 4GAJL 5FYLE 2IWGA 4HLZG 5ADOH 1E6OL 5C6TL 1WAAA 4LAQH 4RAVA 1FAKT 3ARXA 4LKCA 3NCJH 1TETH 3KPPB 3IJHA 4WI5A 4LEOB 5DA0B 2LAGB 1CGSH 5EC2B 2IBBA 1DQJA 4IMLA 2Z31C 4HUVB 1HZHL 2EH7H 2WWMC 4RAVB 3TFKC 2WQ8A 2CSPA 4LKCB 1KOAA 3HB3C 5E4EB 5IK3A 2VDOH 3IJHB 4WFFE 3DX6A 2SEBB 5BW7A 1CLZH 2VLKD 4ZTOL 4NQDD 3LSOB 4E41E 1CLOL 4OD3L 4WVRA 2NY7L 1DQJB 3T1WA 2PTUA 4IMLB 1MFDL 4PJXE 3DI3B 5AZEH 5MI0B 4ETQA 5JZ7D 3KYAA 4J3OC 1YN7A 4GQ9H 5IK3B 1HOCA 1P1ZA 1JHKL 3NZ8A 2NX5E 2FO4A 4KJWC 1H8OA 4XMPL 2YKLH 4UINH 2EIDA 4BFBD 4GH7B 1YEGL 4PJ7F 4PS4H 4DKEL 1G7QA 4HH8A 1GYAA 4B7IA 4A2LA 4ETQB 2F5AL 1EMTH 3Q6FA 5DJ0A 3RL1A 1UT9A 1YN7B 4O02H 4PBVC 2Y5TA 1HOCB 3NZ8B 3OGCB 3IDXH 4I0PA 3LN4A 2FO4B 4NUGL 1RY7B 3KXFE 3QCVL 3MLZL 1FLRL 5F9DC 1A6WL 5DHVH 4M8VA 5CJXA 1LO3L 1T6VN 2DQUL 5SV3A 1QRND 1SJXA 1G7QB 3ARWA 5DJ0B 3RL1B 4XCFL 4I0PB 5J6GA 3DECA 4LIQL 2VH5L 4ZPTA 4HF5H 5GGRY 4NBYB 3G5XB 3U4BH 3K1KC 5KG9A 1BQUA 1P7HL 3D87B 2H32H 4YWGH 3PP4L 4U1MA 2DM2A 4RX4A 5F7LB 5BRZA 2UWEA 5DVLA 1HWGB 1S78C 2JK5A 4P2CG 1I8LA 2YUWA 1X5YA 3GMOB 5GRYA 5J6GB 5JUEL 1LO2L 3HNTL 5HHPA 2X6MA 1RUAL 4WFGE 3P0YL 4NO0A 5DMGC 2IBGA 3ULUD 5TE6H 1PG7W 3JTSA 1EIBA 3BE1L 4BZ1H 1PQZA 2AERT 1HILA 1XFPA 1OAXL 4U1MB 5T5FH 5J7CC 5C70A 2UWEB 4FZEH 3F7QA 2JK5B 1GXEA 2HKFH 2VZTA 3OGOE 4OGXH 4V2BA 2XTJC 2DI8A 4NRZA 2MJWA 2WNGA 1BJ8A 5FM8A 5HHPB 5GRVL 2OJEA 4YPGB 3DRTA 3BEWA 3MUGA 1NCDH 4NO0B 4ZUSB 5KSAD 3JTSB 1PQZB 1SQ2N 1JF1A 4NFDA 3GIVA 1VCAA 3VXSA 1HILB 2R4RL 3BISA 3RNKA 1E6JH 1U3HD 3ZTNL 4NCC1 1A1MA 4XNXH 2F53A 4DN3H 5A3IC 4NRZB 2WBJC 5DDHA 2OJEB 4D8PA 3DRTB 3BEWB 3MUGB 4X6BA 3TP4A 2PO6D 2HLAA 4PJFA 3D3VA 3IFOA 2BY3A 4NN6B 1IM9D 3IDGA 3D0VA 1JF1B 3VXSB 1X5FA 1NLBL 3FRUA 3GIVB 4I77H 1HHKA 1UH2A 2LTQC 3DX8B 4S1SH 3RNKB 1BEYL 4KKBC 1OAUL 4JKKA 5EUKB 2PTVA 4Y88A 1A1MB 2FD6L 5H35B 2AXGA 3O8XD 3IDUA 4KZDH 3RWDA 2VLKE 3HKFA 5DDHB 1UKTA 4UV4L 4PJBE 3FONA 2F8XC 4NQDE 1BVKA 5F1NA 4D8PB 4RWYH 5E2JA 3E2HB 1OY3B 4X6BB 6FABH 2YUXA 4HSQA 4PJFB 3D3VB 3IFOB 3IDGB 4JDZA 2C3HA 3D0VB 1UACH 3FRUB 3RPIB 3ZKXC 1HHKB 3PNWA 3SJVD 3GM0A 2EH8L 4FNLH 3FQNA 4FOMA 4HX1A 4JM2D 2WP3T 5AWNH 4NWUH 2AXGB 1VKXA 3EYSL 3QRGL 3RWDB 4NZTH 3KPRD 1BVKB 2P8LA 5F1NB 4L9LC 4CL7A 3VGDA 3DVNA 2X4RA 3LIZL 4HQQH 4LSRH 4JDZB 3SY0A 3HC3L 5BOZG 4JFFD 2CQVA 3ARFA 3PNWB 2AEPL 1JE6A 3FQNB 1CDHA 4HX1B 3QUXA 3V4PL 4DOHE 5D70L 3E6FA 4N9OB 1Q94A 4XP1L 1U3JA 1VKXB 4X9GA 1RZ7H 4LDLB 4DTGL 1IGJA 1U8KA 1YYLH 2OL3H 5HYIA 2P8LB 1TJGL 1TENA 1YPZF 4PRID 5D5ME 3DVNB 1OAYL 2CRIA 5CEZL 1U92A 2GEEA 2X4RB 4M03A 2CLZA 3SY0B 1QRNE 1FVEA 4LASL 3ZDXF 2HA1A 4F33A 1DBAH 2BSTA 1SM3L 3C08L 3QUXB 4ZQKA 1JPSH 3E6FB 1S9KC 1B0RA 3SO5A 3O6ML 2QLVB 1BFOA 4YR6A 1OTTC 3PWPA 1GHFL 4LMQI 3QEUA 1U92B 4HK0A 1DLFL 2CLZB 1CR9H 2FBJL 2NY5L 4LHUA 1FVEB 1G7MB 1R24A 4F33B 2BSTB 4ZQKB 3P9LA 3HAEG 1XH3A 3PWUA 5IJKA 1LDPL 8FABA 2NTFA 4GAJH 3WDHA 1XMWA 1BFOB 4YR6B 3PWPB 5KJRH 1YNLL 3QEUB 4PP1C 2IGFL 1OP5H 1H8SA 4NZDA 4HK0B 2IG2L 3ULUE 4LHUB 4WY7H 4K3DH 2VJXA 1FFOA 1R24B 2X4OA 4MNGE 4MA3A 5JW5A 1RZFH 2VXQL 5GGVH 3P9LB 1G6RA 5E4IA 3PWUB 1NFDF 4R8WL 4H1LA 8FABB 2NTFB 1Z9LA 3G6JF 1MI5A 1KIUA 1LP9A 2BMKA 4OZFG 3BQUD 4XMKL 4TYUA 3O6LL 1ZHKA 5C0GB 4GAGH 2PYEA 3B3IA 3WIHL 2HT2D 4ZTOH 1FFOB 2X4OB 4JZJA 5ILTL 4MA3B 5JW5B 1G6RB 2NY7H 4N5ED 4H1LB 2VLRD 5CIPA 4NPYA 4ZSOA 4KJPC 1ZHBA 1MI5B 2BMKB 1LP9B 3ZE0F 1QR1A 4NZRL 4U1GC 4HT1H 4WHYH 3MRDA 1OF2A 3EZ8A 4LCWB 1ZHKB 2PYEB 1KEGH 2CRMA 4JY4A 3KS0J 5LBSH 3B3IB 4MSWA 4JZJB 4XMPH 1WISA 4P9HL 3OAZH 1WZMA 4EI5A 5K9KB 4U1JA 5DSCA 5F9WB 1YEGH 5CIPB 4NPYB 4ZSOB 1JPST 4DKEH 4ENEC 2OBGA 4O9HL 1KC5H 5MP6L 1QR1B 1P6AB 4ZUTA 4PY7A 3MRDB 1OF2B 3S96A 2P5EA 4NKMA 1F4YH 1FL3A 4NUGH 4P9ML 4MSWB 1A7QH 5L8LB 2NQCA 3SJVE 1WFNA 3QCVH 2VYRE 4JN1L 5EWIL 1A6WH 4EI5B 4U1JB 4XPTL 5DSCB 5AAWA 5BS0A 5L2JB 2APFA 3WDJA 4ZUTB 2DI7A 1IAOA 3KPRE 4PY7B 3V6OA 1DBJH 5JMOC 2P5EB 4NKMB 2W9EL 3EBAA 4XCFH 3GJFH 5C92A 5KZCD 2HFGL 1UXWA 1FL3B 3B43A 1I3UA 4POZC 4JFFE 2Y07H 5I1GH 3M1BA 3B6SA 3OPZL 5E4EC 1YEKL 4JG0L 2VH5H 4LIQH 3ZE0E 4NO5A 3ESVF 1YEJH 1ZGLP 2NW2A 5C0EB 4NHUA 5BS0B 4F80A 5C0FB 2R0WL 2F54A 1IAOB 3PP4H 1RZGA 1AKJD 4PRIE 4YDVA 2X4QA 4N1HB 5MI0C 3K7UA 1IMHC 1UXWB 5J6HB 3M1BB 3NIDF 4K23L 4MJIA 1JZ7A 1LO2H 3HNTH 4NO5B 5K33A 4R0LA 1T4KA 2JCCF 2NW2B 2YN3A 5BW7C 3QDGA 1FH5L 2BRQA 2ZCKL 1GRWA 3BE1H 4LCCA 2VDLL 4APQD 3AC0A 4WEMB 5GIRA 1V8HA 1RZGB 4P5MA 3WCYA 1X5GA 5FUCC 4YDVB 2X4QB 4KU1A 1J18A 1F2QA 1BGXL 4MJIB 4R0LB 3V0WL 4DJMA 4TSBL 2A74A 3QDGB 3CFCL 3RGVD 4OI7A 4X80H 4LCCB 1OAZL 5EPMA 2DB8A 5GIRB 3ZMRA 4Q9RL 4P5MB 5I8OH 3UJTH 4M48L 4H5SA 3QEQD 4PYGA 1DP0A 2FHFA 4W6WB 4PFEA 4XBEL 2OYPA 3BO8B 4I0PC 2A74B 5IFJA 3O45B 2IJ0C 1NLBH 5CJXC 4J3WA 4ODXA 1BEYH 1ZA6B 2GTZA 5I8CA 4WEBL 5CBEB 1DQML 4U0RB 1UKQA 2CUHA 4H5SB 5KW9L 3TJEL 4UV4H 5AYUL 1AGCA 3FQUA 4FZ8L 1AE6L 4HHAA 5DWUH 1FO0H 1DLHB 2VLRE 2IH1A 1BBJA 1UYWL 3QNYA 5IB2A 1I8MA 1P6FA 4MQ7A 2WANA 2OZ4L 1U8MA 3FZUD 4ODXB 2GTZB 3GSNL 2EH8H 5I8CB 3SE9L 4UNTA 2M1KA 5IBLC 3EYSH 1MQKH 5AYQA 1AGCB 3FQUB 1I8LC 2BVPA 2YS4A 4RFEB 5E2UH 3TN0A 1EHNA 2IH1B 1BBJB 1I8MB 3C6LA 3ZYOA 2FGWL 3HC3H 3UAJD 4MQ7B 5I66A 1U8MB 3B2VH 3MO1A 3Q3GA 4X6FA 5JQ6L 2AEPH 1EPFA 2EDRA 1DCLA 3CDYA 3MODL 4M00A 4KQ4H 1A0QH 3RVXC 4XWOC 1QLRA 3RDTD 4DTGH 2E5EA 3B83A 3OKOA 1AQDA 3STLA 2B2XL 3QIBA 5JOPD 3S88L 1SHMA 1C5CL 2BVPB 1TVBB 4MQXD 1TJGH 1OAYH 3KWWA 5CEZH 3TN0B 3C6LB 3WIHA 3D39A 4D9QD 1A7BA 1NMBL 3Q3GB 4X6FB 5ISZA 1SY6H 5I66B 2ZUWA 3SE4A 3FT3A 1KPRA 1SM3H 1NANH 3VWKD 4QT5A 3C08H 4NN6C 1H8NA 4PJGA 4U1KA 5E7BA 1TIUA 4KTDH 1MRCL 2IQ9L 2QTEA 3OKOB 4LLAA 5DTFA 3U30B 3STLB 3QIBB 1GHFH 4W6XB 3F6IA 3HG1A 5CSGA 3KWWB 3GKZA 3O2WL 5EDXA 4J4PD 1QKZL 4WU5B 5ISZB 4PJIA 3E2HC 4P99A 3FT3B 1KPRB 4YPJA 4QT5B 5BJTA 4A2MA 4HKZA 5ESQA 1UC6A 4U1KB 4PJGB 1WSST 3KPOA 4ONFL 2Z8VC 3V6ZA 5IVZB 3WN5A 5DTFB 4ZG1A 1YNLH 2IGFH 3HG1B 2IG2H 3B5HA 2EZ0C 2H2PD 1Q9WA 3NOIA 4PJIB 4R4NC 3F12A 3QQ3A 5ICYB 5FM5O 3UJIH 5F3BA 3U7AA 5BJTB 2VXQH 4HKZB 1X7QA 5ESQB 3BKML 4OGAD 3KPOB 4R8WH 1X5JA 1KUMA 1Z9MA 3V6ZB 3BJ91 1CDCA 1TVDA 4ZXBA 2ZUSA 2B8OT 4UI2A 5DZLA 3WHE0 2GJZB 1LWRA 1T0MA 4N8VG 5TE7L 5F7KC 4Z7QF 4BKLA 1Q9WB 4AEEA 3RY6A 3F12B 1CFNA 1Y6MR 5ILTH 5F3BB 3OKNA 1X7QB 1OD7A 3H8NA 1W8NA 3ARFC 3S36L 1AR1C 1QQDA 4ODBD 1ZT4B 3QEQE 3QUXC 4NQCB 4NZRH 1U42A 2FX9L 1TZGL 4PJCB 1MCBA 1JF6A 1T0MB 4GRLA 4NJAL 4DFHA 1HIML 4YO0B 4BKLB 5DO2D 5LVEA 1MOEA 1CFNB 1U3ZA 4P9HH 5ANME 3OKNB 2CRZA 3BH9A 3JWDL 4J3VA 4WTXA 1MJJB 1QQDB 1FYTA 4C54A 5EB9A 3P3YA 4O9HH 2A77L 3GNML 1S7TA 4RZCA 4LLVA 3ULSA 4GRLB 1VFAA 1XCTA 4P9MH 3GZKA 5KSBF 2J5LB 1CDJA 4JN1H 4XPTH 3CFKB 4OZHE 3BH9B 5FDWA 2KZ1B 4IM8A 5D7IF 4IOFC 4NKOA 1FYTB 4DAGL 1S7TB 5IJKC 4RZCB 4LLVB 2ZUUA 2OX5A 3S37X 1VFAB 1XCTB 1PX3A 3NFNB 2HFGH 2EDNA 1E28A 3KPQA 1AH1A 3OPZH 1YEKH 2X89D 4LKXA 4YFLI 3VI3E 2DQCH 5FDWB 3IDYB 4HFWB 1J05A 5CINH 1ND0B 5DS8A 3HHRB 4NKOB 1DN2A 3C5SA 2R0WH 4Y2OA 4BZYA 3MUJA 5JOPE 2AQ1A 4TUOA 1KN4H 1P7KA 1JYXA 4X7TA 1F90H 1PX4A 4OQTA 1E28B 3KPQB 4D9QE 3T0WA 4GUPA 5EG6C 1ZANL 4LKXB 1Q72L 1IGYA 1J05B 2XZAL 1FVCA 5DS8B 4JZJC 1FH5H 1N6QL 2ZCKH 3C5SB 4TSCH 1QD0A 1KELL 2PN5A 5F9AC 3CSBA 5DJXA 5KSBE 1C7TA 5F9WC 3RGHA 1P7KB 3VGAB 4JFDD 1AP2B 4X7TB 1JWMB 5FYLL 5KANG 4TNVF 2IMMA 5JORA 5D7IE 1BGXH 5T1DL 3VCLA 3O4LD 4FQ1H 4GUPB 1S7SA 4PREA 2R2EA 1IGYB 1EFXD 3V0WH 4JO3L 4TSBH 1FVCB 5BXFA 3CFCH 5HI4D 3L3IA 4EI5C 5MERA 2AW2A 2R9HD 1OAZH 4R7NA 1F02I 5DJXB 4Q9RH 5IIEA 5D1QA 5DMKA 1AJ7L 1GOHA 2R15A 4M48H 3JV4A 3BP7B 3QXAA 1J0ZA 3VCLB 5KN5B 4JREB 1S7SB 1YC8A 2R2EB 4HS6A 3V7AG 2NY2D 4Y5VA 4JQIL 3NA9L 1C08A 4EQ2A 4XAWL 2A6DA 5BXFB 2P45B 2DMKA 4OD2A 3L3IB 5MERB 1WV7T 4ZNEA 5IIEB 2FJHA 4M02A 5I71C 2A9ML 5D1QB 4UNUA 1DQMH 5DMKB 1BPVA 1XGYL 3JV4B 3QXAB 4NO2A 3HMXL 3V6OC 5KW9H 1CGYA 2XWTA 3Q5YA 3BKJH 3GMPA 4BFGA 3ZTJH 5AYUH 4FZ8H 1AE6H 4HS6B 4YXHL 4IRSD 3QHTC 2H45A 1CGUA 1C08B 4B53A 5IVXA 2A2QT 2A6DB 4DUXA 2JKXA 2OZ4H 4OD2B 4GG6A 2EYSA 1UEYA 3D85D 3GSNH 2FJHB 2KDGA 2HP4A 4OFIA 4X7DC 3MGAA 3P73B 4GW5A 3GHEH 3QUZD 5E6ZA 3B9EA 2XWTB 3GMPB 4JCLA 4X9FA 3PWNA 2KQNA 4Z9KB 1LEIA 1CT8A 5FEBA 3L7EA 5IVXB 2OR9L 2QADD 4HK3N 1QFPA 5CBAB 2DL2A 1OAQL 4R0LC 4GG6B 5JQ6H 3VFUA 2VQUA 3F7PC 3ZDYE 4KFZC 3MODH 5D1ZD 3H3PL 4LCCC 4GW5B 5EIQA 5C09D 3VDCA 2FEEI 3MRRA 1KCRH 5EN2A 4F7MA 1T1WA 5EOCL 2FB4L 4XPAL 3NMEA 1C5CH 3PWNB 1ZTXL 2I5YL 3NIFE 4KDTA 4NN7B 1LEIB 3L7EB 4LHJB 5IW6A 3MSPA 2JB6A 3MTRA 1NMBH 3B5GA 3VFUB 2F9BT 5I1KL 4M62L 1N5AA 1P4LA 3RVVC 1G9NC 5J1AA 1BQSA 3SKMA 4JHBA 3RI5F 3MRRB 2BVEA 3UPCA 4OV6F 2GUOA 5EN2B 3QWRD 4F7MB 1T1WB 2IQ9H 4M8QA 3SBWA 4DQOL 4F7PB 2DDQL 3FHAA 2YA2A 4X7CC 1T1ZA 4U0RC 3FRPA 2Q6WA 1NQBA 4CVZA 3PWVA 3MJ6A 4XPGH 5IW6B 3O2WH 2DLTA 4FHBD 2JB6B 4GMTL 4QLRA 1SBBA 5HHXH 2BSRA 4MNQD 1N5AB 1P4LB 3T0ED 5J1AB 3SKMB 4ELMF 4HH9A 3JUZA 4ONFH 2COQA 2E8ZA 2GUOB 5FF6A 2CDEA 5CCKL 4M8QB 2H1PL 3TBVA 3AM8A 1T1ZB 2Q6WB 4CVZB 3L5IA 3PWVB 3ZZ1A 1FZMA 2F58L 2NY1B 2BSRB 4FQHA 4XHJC 2A83A 4JFDE 3GSUA 3BKMH 4HH9B 3EZJB 4NKQB 5FF6B 3WMSA 1W0WA 2CDEB 3O4LE 4G5ZL 3TBVB 2WP3O 3V5KA 3NCYS 5BOPA 1I9IL 3TO4A 5TE7H 4GW1A 1JGUH 1FZMB 1JP5A 2VSCA 3RVUC 1ZLUH 3P0GB 4LLYB 4YXKL 2FL5A 4RSVA 2XKSA 1JMXA 4FQHB 3TN0C 2A83B 5C71A 3C6LC 3GSUB 5ETUA 1SJEA 2FSEA 3AS1A 1HNFA 3S36H 1G6VK 1W0WB 1BFSA 4HWBH 4M1CD 5ICXA 2V7HA 2QQKL 3SDDA 3V5KB 2FX9H 1A6VH 5TGBA 1TZGH 1DBKH 3STBA 4JZNA 3T3PF 3TO4B 4GW1B 1NAKL 4LLWB 3HLAA 5EZIL 4ELME 3U30C 5HBBA 4MXVF 3QIBC 1F6LL 5SWSD 1A6UL 2FL5B 1QP1A 1AGEB 3EO9L 1L0YA 5DJAB 3BEVA 5H2BA 5ETUB 5H37G 3JWDH 1SJEB 3QXUA 1GPOL 2FSEB 3SE4C 3IJSB 1U8QA 1UM5L 3SKNA 1P84K 5CS7A 1W0VA 2A77H 5F1KC 2V7HB 3SDDB 3GNMH 5TGBB 4JZNB 3HLAB 4FRWA 5JXED 5MEQA 4L4JA 1DZBA 5LQBL 3I2CL 2FIKA 5HI3C 3BEVB 5H2BB 2EECA 1JTOA 3PHOA 1XGTA 4AM0A 2VXUL 5ESAA 2VR5A 3LEXA 4DAGH 1U8QB 3SKNB 2J6EH 1W0VB 3EFDL 5GGSB 5I2IA 2GK0A 5K9JL 1X6LA 4KKLC 5MEQB 4LSTL 5E8NB 5J57B 2YOCA 1X4XA 2FIKB 1RV6X 5DUBA 3PHOB 1XGTB 4GRWH 4AM0B 3LDBB 5ESAB 5C09E 1CGTA 4AENA 1VGEL 3QNXA 4HV8A 4E41A 4MXVE 1TQCB 1I9RL 3EDFA 4KTYA 1H15A 4K94L 2VLLB 1W2KT 4M7JL 3VFRA 4M7ZB 5I2IB 2GK0B 1HDMA 4ZXBC 4PJXA 5HDOA 5GXBB 4RISL 1YJDC 4G6FD 3HMXA 3CXDL 3MOQA 5A40E 5DUBB 1Q72H 2E8YA 2V5RA 3BD3A 4G8GD 3RY6C 5JO5A 2DWDB 2XZAH 4AENB 1DEDA 2QQNH 1HXYA 1N6QH 1KCUH 5A2IH 3D5OF 3QNXB 4HV8B 1KELH 3NABH 4E41B 4LSSL 4AG4L 5DURB 1I7RA 1H15B 3HN3A 1AGFA 2DJSA 4FQJH 3CX2A 1MCHA 4WI4A 2B4CL 4YDJA 1V3KA 1HDMB 5FYLH 3HI6L 4RMVA 5JA9A 5T1DH 4MNQE 3MLRL 4GRLC 5AD0B 3ZT5A 4R26H 5D7SL 3T0EE 3ULUL 1FCCA 4JO3H 1ZXQA 2J5LC 1HXYB 1I7RB 3ARDA 1AGFB 1U8HA 3FFCD 4YDJB 1CD9B 2FIRT 1MCCA 1MIML 3V4VL 2ADIA 1FE8L 1HHGB 4JQIH 3NA9H 4HUKB 4MYWB 3GMMA 3ZKMC 4D0DA 1CF8L 3EO0A 4O4YL 3ARDB 1G7LA 1S9VA 2HG5A 1U8HB 1UCBH 4X9IA 2ZUQB 2FX8H 5FAAA 3O3AA 5IWLA 2ADIB 4YXHH 1EZVX 3GMMB 3AB0B 3HUJF 1EAPA 4ZO8A 4D0DB 3HI5H 4HC1H 3IDMA 3RU8H 5DXWA 2YRZA 2D7TL 4OM1H 1ADQL 1G7LB 2HG5B 1BF8A 4ZOAA 2L0DA 2HT3D 1A6TA 4HZLA 2QSCL 2CLRA 2OJZL 5SWSE 3S5LA 1QZ1A 3VGAC 2D7MA 3O3AB 1YEEL 3GBML 1YC7A 3NA4A 5FFLA 1L9NA 2OR9H 4PJ7B 4PRBA 4DKAA 1OAQH 3IDMB 5B38G 1UWXK 4QTHB 1OGAD 4JFYA 3H3PH 1FIEA 2VIRA 4JHZA 1A6TB 4HZLB 2CLRB 2D7OA 4RNRA 3S5LB 5I1LA 2FB4H 5CD5C 4OZGE 4XPAH 1N64L 1ZTXH 2J8HA 4NHCL 2GT9A 4R90L 4N0CC 2XZCH 3QDMD 4PBXA 1CK0L 4JREC 5E5MB 1RI8A 1ZOXA 4X5WA 4PRBB 2IALA 3UTTA 5I1KH 1H9VA 4KI1A 4HULB 2ADJA 5C2UB 4JFYB 3OXRB 2VIRB 3FHQA 3NH7L 5C0IA 2IPUG 4M93B 4RNRB 2LU3A 1G0DA 5I1LB 5D1QC 4DQOH 2C4XA 4ZUWA 5T3XH 1LILA 4GT7A 1KCSL 4XAKD 3HR6A 2GT9B 2MHAA 1FRGL 4X5WB 4GMTH 5GRWA 1EEUA 4NQDA 3DGGA 4PLKD 1I8IA 2IALB 3UTTB 2LAAA 5DD0L 4Z7UF 3VFMA 4K3EL 3IYLW 2VO5A 4X5XA 3TF7C 4PY8J 1JV5A 5I74C 5C0IB 4NGHL 4QHKJ 5D7LA 4OI8A 1MCKA 1MJ8L 3OSKA 3U7YH 4Y2DD 4PJDE 2NR6D 4Y16B 4G8GE 3MGTA 4XNYH 2VKXA 4IHOA 3WFBL 2MHAB 3SQBA 4X4YA 2F58H 4PJ9D 3DGGB 4L4VD 1I8IB 3AAZA 4XNQA 4XVJL 4QOKD 3VFMB 4P4RB 3VI4F 5J8OA 4X5XB 5D7LB 1LHZA 4N0UE 5C6WH 3HPLA 4G5ZH 1CGVA 3CCHA 4FFWD 4P2QA 1A22B 3MGTB 2EICA 4IHOB 4X4YB 4OCRL 3TJHC 1A5FH 4OJFL 5IBTL 3AAZB 5DEFA 4NN7C 4XNQB 4P5KA 1EXUA 2ZOKA 3R0MA 1LK2B 4LGRB 4EQ3A 1I3RA 3FFCE 1QRNA 1IGFL 4KJYA 5MHSD 2EDEA 4BSJA 5LAXA 1HK6A 1WUNT 3HPLB 3NFSH 4ONGL 2QQKH 1Q38A 3CCHB 1HQRA 5C08D 3ZT6A 5I18L 3I50H 4P2QB 3H9YA 4Z7UE 3PL6A 5C0BA 4NOFA 5EZIH 5K9QG 3DXAA 4X6CF 1A6UH 2EXYD 5DEFB 4KDTC 2ICES 4Z0BL 3N9GL 1EXUB 3EO9H 2ICEA 5J1TC 1V7ML 3EHBC 3LVEA 1I3RB 4G9FD 4Z7NE 3B9KD 4KJYB 2W0LA 1UM5H 4HJ0D 2NZIA 5LAXB 1U93A 2UZYB 5I6XB 1HQRB 4ODTL 4GOSA 5C0BB 3PL6B 4TUKL 1XF2B 3NCMA 3SBWC 2RGSA 3DXAB 4F9PA 5EC1A 2AV7A 2ARWA 4HWUA 4UUJA 3I2CH 3VXTA 2ICEB 5IVNA 4KK9D 4KMLB 3WUWA 2X9XA 2NY1C 3LRSB 1LVEA 2VXUH 3Q2CA 4XX1E 1YY9C 1P84J 5CILL 4KI5C 4MNGA 2XN9D 1U93B 1KTLA 3FO0H 3IU4L 3L5JA 1LO4H 2P43B 1YPZA 1OAKH 3TLRA 5CGMA 3KJ6L 2ARJA 5DUMH 5EBGA 1NPUA 2ZSWA 2J1KA 4NQEA 5K9JH 3DWTA 2GIYA 1N0XH 5EC1B 2W92A 5C7XL 4QHUA 4F15B 1TNNA 4UUJB 3VXTB 1T22A 3MV7D 1OGAE 4X98A 1BAFL 2G2RA 3R8QA 3WUWB 1MWAL 2VN7A 4HJJL 5CZXC 3RWIA 5I0DA 1OP3H 3RX8A 1KTLB 1I9RH 5HGGS 2QQLL 1YPZB 2IANE 4K94H 4M7JH 3EKCA 2ARJB 2ZSWB 2HAZA 3QDME 4NQEB 2YK1L 5SWZD 4RISH 1FGNL 3CXDH 4KHTH 4AEHL 3UC0L 5AZ2L 3ME0A 1T22B 3RVTD 1ONQA 3TO4C 2GCYA 4X98B 5GS0C 2G2RB 4YFLF 1HE7A 4UT9L 3REWA 1CFQA 3VXRD 3QHFL 3RWIB 4G8IB 1NBQA 2O61B 5EBMA 4ONOA 2A6JA 4LSSH 4AG4H 1FIGL 4FFYL 3QQ4A 4XAKE 2HTKD 3O8XA 4PD4K 2B4CH 4M43L 1KBGL 1Z0MA 4R2GB 3SDDC 3MLRH 5MEND 1OVZA 1ONQB 1PAMA 2GCYB 4QHLA 2DICA 5D7SH 2V7NA 3ULUH 5CGYC 1CFQB 2WQRA 3MBXL 1VDGA 1E4WL 2HRPL 3G6JA 5DVOA 5EBMB 1MCNA 3QEGH 3W0WD 2A6JB 3LAFA 3E0GA 3QQ4B 5EOQL 2D7NA 5FGSA 2BDNL 2ADFL 3CH8A 4IRZH 5IQ9A 3GBNL 5K59F 3QFJD 4L4VE 3JV0A 3BKYL 1MIMH 1RPQA 3EOAA 2Z8SA 3CXHJ 3TO2A 3V4VH 4QOKE 5CLWA 4QHLB 4PB0L 3HRZA 4KPHH 4O51A 2V7NB 2B5IC 1NFDB 3BZEA 5GGSY 4JFFA 1CF8H 3G6JB 1L7TL 3SDXE 3R0NA 4O4YH 5B8CA 3S4SG 3U9UA 5GJTL 3WJLA 1TQCC 1S7RA 1ZVYA 5INCA 3C2AL 1SJVA 1P5VA 4M7ZC 3EOAB 4PRIA 3D48R 3HRZB 4O51B 1CZ8H 3TCLB 3B9DA 1WBZA 4NP4L 1FLTX 3BZEB 5LCVL 3V0VA 2BNRA 5MHSE 4I3SL 4MD4B 1KJVA 2Z9TA 5B8CB 3FFDA 5C08E 1ADQH 3U9UB 4MQSB 1I8KA 1S3KL 5JXAH 5CLTA 5E8EA 4KHXL 4O00A 1S7RB 2D4DA 5INCB 4PG2A 4BH7B 1U6AL 2NY0B 1FVDB 5GPRA 1YEEH 4OZIE 3GBMH 3PUCA 1WBZB 3H7LA 4IEFB 3FO9A 4G9FE 2BNRB 1NEUA 1KJVB 5F6HI 3AFLA 4NC0B 3QA3A 4PGJA 4HG4K 4EN3D 1QBLL 4DCQA 1X5KA 5E8EB 5TQ0H 1NDGA 1O5DT 4YUEH 5IF0B 1CU4L 5DQDL 5IHBA 3ZT7A 4PGDB 5ALBL 1RUQH 1RFDL 4YBQD 2HTLC 4R90H 4LSUH 3FO9B 1HWHB 1S7QA 1K6QH 1CK0H 1NBVL 4OI9A 3LN9A 2XN9E 5E2VH 2D0FA 3QA3B 5FGCB 4DCQB 5BV7L 1U8NB 1NDGB 3NH7H 4JM4L 3BW9B 32C2A 3ARDC 2NW3B 4IJ3B 4Z7OF 3GIZL 1U9KA 2HWZL 3DRQA 3SKOA 2ZUQC 3TVMA 3TYFA 5JHLL 3MV7E 2AEIT 2WV3A 2JCCA 1CD1B 2EXWC 1S7QB 4XTRC 5E1AA 4RRPG 2D31A 3OG6B 1S7XA 4D2NA 3BP5A 1OTUD 1NKOA 2VNCA 5DD0H 2M26A 2RFXB 3AB0C 3OAUL 4K3EH 1BFTA 4WWKD 3U0WL 4NGHH 3PP3K 32C2B 4UDUB 5SWZE 1IGIH 3DRQB 3SKOB 3TYFB 3TVMB 2X4TA 3BYYA 5DYOA 2OLDA 2F5BL 2YRLA 4J1UA 1IAII 5GJSL 2JCCB 2P8PA 3EGSA 3PV6B 3QH3A 3VXRE 3WFBH 3BIBX 2D31B 5EU3A 5IWLC 4ONHA 3BP5B 3U6RA 4XVJH 1QHPA 2JIXA 1MRFL 5DFTA 3D9AL 1E0OB 2A9NL 1NLDL 3DUHA 3LQAC 3DMMA 5C0JA 1WWAX 5MENE 5DYOB 1SMAA 2GSGA 3C60A 4J1UB 1MCWW 3RA7L 3QH3B 2P8PB 4BZ2L 1R0AL 2O93L 4CADA 1R6VA 1VACA 4UTAL 1YNTA 4OCRH 3WHE1 3LPWA 4OJFH 4ERSL 4ONHB 4RMRA 5IBTH 3W0WE 3U6RB 1T7XA 4WUKH 5EORL 5AUMA 1I1AD 2JIXB 1J0JA 2YD3A 5GRUL 2BHYA 4LOUC 4WIQA 1EV2E 4DGVL 3SCMD 4FQQA 3DMMB 3QFJE 4OKVB 3MREA 3N1PC 4ONGH 5D96B 4K8RC 2GSGB 3C60B 5JHDA 4L3CA 4M93C 1JZ3A 1K8IA 4D3CL 4P5TD 1MJUL 4CADB 1VACB 3RJDA 1YNTB 1REIA 2VZOA 4LRNL 5L6YL 4XVUD 1PFCA 4X9BA 4Z0BH 5AUMB 4OFPA 4UBDC 1V7MH 5E6ID 3HNSL 1O7SA 4DUVA 2JF1A 5L9DL 3ULVD 1MAKA 4FQQB 1CWVA 3PDOA 3MREB 4XGZA 2HN7A 5JHDB 4L3CB 1K8IB 4TUKH 5D7JD 3VD3A 3W82A 1U3YA 3LS4H 4WHYG 2C9AA 2OS7A 4NFBA 1QLEL 3NN8A 1QRKA 1S7UA 3C8DA 1RIUH 3ARGA 1ORSA 1FC2D 3HFML 4LSVL 2C4FU 4MVBC 3OWEA 5CILH 2KQMA 1NUDA 4CN4A 2JJVA 3PDOB 2RAMA 2FO1A 2F19H 4XGZB 2HN7B 3IU4H 2EC9U 5E2WH 5IFHH 5HJ3A 3KJ6H 4TPRL 5J3HD 3WUZA 1T5WA 3U82B 5C7XH 3GO1L 2C7UA 3NN8B 1VFOA 1S7UB 3ARGB 1ORSB 3RGVA 4HJJH 4EKXA 1WTLA 4YHNA 2I25N 3H2WA 2QQLH 4GKZA 1CDGA 5HJ3B 2BSSA 1JMZA 1NGXA 3WNNA 1T5WB 3O9WA 1FGNH 2C7UB 3KG5A 1RZJL 3TNNA 4MXQC 5TH2A 3HMWL 4ZPVA 5JLZA 4YHNB 5DFVD 3ISWA 1FIGH 3EOTL 4FFYH 4R4BB 4GKZB 1Q9LA 3WBDA 2BSSB 4OZFA 4LU5H 4UIKH 5H94A 1P4IH 1KBGH 1NGXB 4M7KL 3L3KA 3TH4T 3O9WB 5I6XC 2MKWA 4HK3J 2QSVA 5C07A 3U4AA 5KSUA 2CPCA 4J3XA 2R0KH 3PL6C 4N0FA 4QY8A 5TH2B 3IVKA 3NACL 4LVOC 3TT3L 2IBZY 4QRPD 4G7VH 1E4WH 5JLZB 1H5BA 4PD4J 3MNWA 2EDOA 4DEPC 2APXA 1Q9LB 4DW2H 1FNGA 4MS8D 4OZFB 4I8DA 5H94B 1Q1JL 1JJUA 3L3KB 4ODUA 2ADFH 4OLUL 2Q76A 2NY6D 3GBNH 5C07B 4I2XE 4PRDA 5KSUB 2W60A 3S34H 1C12A 3BKYH 5HHOA 4N0FB 4JR9L 4EVNA 1F2XK 4PB9L 1FJ1B 4M6NL 4Y4HD 2KL6A 4PB0H 4L3AA 3IVKB 4F9PC 2F15A 4F15C 1L7TH 2DTML 1KB5L 1KENL 1IC1A 2CH8A 3LKPA 1H5BB 5DD3H 3TBWA 4RFOH 3MNWB 1FNGB 4I13B 2IAMA 5GJTH 4WCYL 3QIWB 2Y6SD 4ODUB 1T2QH 1QSFA 2Q76B 4PRDB 2W60B 1C12B 5HHOB 4EVNB 5HDBF 5FGRA 4XPBH 4V1DE 4JKPL 5LCVH 1J7VR 1UZ6F 4ORZC 4PJEE 4I3SH 4LK4A 2NXYD 2GHWB 1WWWX 4UB0L 3PDGA 3TBWB 3LKPB 3RZCA 25C8L 3LKNB 4NSKA 5F96L 3UEZA 4UOJA 2X1QA 3LKRA 1S3KH 2IAMB 3DO7B 3MJ9L 1QSFB 3PQYA 5KSBA 1AXTL 5I1CH 1KXVC 1U6AH 3F65A 1VB9A 1X4ZA 1ZMYA 3HE7A 4R2GC 1OWWA 1T7WA 1QSED 2OI9C 3UTQA 4OFDA 1YJDH 5D7IA 3ULVE 1J8HA 3DOSA 3Q1SH 3VD7A 3LH2L 2CJUH 5EUOF 1WLHA 3RZCB 4NSKB 1T04A 4RMWA 4MZ2A 2AK4A 1RU9H 3LKRB 4DVBA 4G3YL 4OV5A 1KT2A 2XZQH 3PQYB 1CU4H 5DQDH 5KSBB 5ALBH 3KYMB 5GZNC 3QUYA 2EDFA 1L6XA 1RFDH 3HE7B 3W11C 1AXIB 1AY1L 4QYOA 4CBPA 1TTUA 3B8SA 5D7IB 4AQOA 1NBVH 1J8HB 3MMEA 5IEKA 4GBXA 4HG4J 1T04B 4Y1AD 2VXSL 2AK4B 3CFIC 4DVBB 4OV5B 3I3EA 4OKDA 5BV7H 4QO1A 3AUVA 3EOYG 3H9SA 3TGXA 3GIZH 2UYLA 2HWZH 5JHLH 3WHXA 5CFHA 3QUYB 1RZ8A 1OGTA 3K4ZA 1FZKA 3O3BA 4QYOB 4R96B 5IV2B 4YHML 3MMEB 4GBXB 5DJ8A 5HYFA 4QXTA 2J8UE 1MFBL 2WIMA 3OAUH 5TF0A 1AHWA 3U0WH 1EBPA 5B8CC 3H9SB 1GGCH 2UYLB 2AJ3A 4MHHG 1IQWL 5CGTA 1IT9L 1RZ8B 1OGTB 3K80A 3WJLC 2F5BH 1WC7A 5SX4H 3U0TA 4JQVA 1FZKB 3O3BB 5GJSH 5D8JL 4C55A 5FHBH 2NY0C 5CP3A 4TULH 5DJ8B 4YDLB 1F4XH 3ARZA 4QXTB 1KTRL 3PG2A 1MRFH 1AHWB 5JPMA 4BQ9A 2AV1A 4EEEA 4OCWL 4YHLL 1OPGL 2AJ3B 1J8KA 3MJ8A 1IAMA 4M7LL 4DFIA 1JHTB 1WC7B 3U0TB 3MV8D 2XKNA 4TOYL 4BZ2H 1R0AH 4FXLA 4PG2C 3QZWG 4QRPE 3U46A 1F5WA 2HLFC 2YPVL 4GXUM 4Y89A 2E27L 5EORH 5I1EH 1N3NA 5GSRA 1RHHA 3N85L 5GRUH 5JPMB 5CKGA 1LE9A 2AV1B 1DR9A 3MV9D 3O6FD 1WBXB 4KMQA 3MJ8B 3C6SA 2E6JA 2CUIA 1NGYA 2XKNB 5GZOD 4YDKL 1A6PA 4D3CH 4XB7A 4IJ3C 5EU7E 3SDCD 1MJUH 2K9UA 1IJ9A 2FHBA 3U46B 3ARYA 4ZS6D 2X89A 4Y4FA 1K4DA 2D7QA 5GSRB 3A6BH 1CICD 4PJ8A 2R8SL 2CGRL 3VFPA 4DUWA 2CR6A 5L9DH 1LE9B 1QSEB 2MCG1 3AROA 1QYGL 2HMID 2DM7A 4K9EC 2ZPKL 3C6SB 1NGYB 3CMGA 3VMOA 1A14L 4OFYA 1WIOA 3TVMC 2O5YH 4Y4FB 2HVJA 5KS9E 1KJ2L 1CDYA 3HZKA 4JO4H 3VXUD 4GS7B 5HVFB 1K4DB 1A3QA 3WLWC 1JGLL 5ECJE 4PJ8B 3KDMB 3TBTA 3VFPB 1WEJL 4QXGH 2Q7YA 1ZEAH 1FZJA 4DK3A 5HGAA 1RURL 1WIPA 4TPRH 4XI5D 2Z4QB 2HVJB 3GO1H 2RIKA 3DV6A 3HZKB 5E8PB 3RY5A 3TBTB 4S1DD 2Q7YB 3ROLB 3MA7B 1UFUA 3Q5OA 2X1OA 1TCRA 1NUFA 3BGFB 3BKCL 1RMFH 3SDAD 1G1CA 1NAMA 1ITCA 1FZJB 5HGAB 5C0CD 3MRGA 3SGDI 5L7XL 3DMMC 3LS5L 3IKCA 4LVEA 1YA5A 5D96C 4YXLH 1G7HA 3C60C 3DV6B 1UG9A 4Y1AE 2P5WD 4ELMA 3HMWH 3GGWA 1TCRB 3U79A 5I0ZA 3EAKA 3O6KL 4H0IA 1NAMB 3VXMD 1EAJA 3MRGB 2YPLB 3G9VA 1I1YA 2WUBL 1YQVH 3IKCB 4M7KH 1HHHA 1EX0A 3L5XH 4JFED 3QI9D 4G6JL 4HIIA 4F57H 4M9PA 1G7HB 2YD6A 4U6HA 4IRJA 4LSQH 4N8VA 2FNBA 1MVUA 5A2JH 3NACH 4XHQA 5FYJU 4KK5D 2NY4D 2PUQT 2R2BA 3F8UB 4PJHF 4HKBA 4OLZL 3GEWB 1I1YB 4P59H 1Q1JH 5ID0A 1HHHB 4HIIB 4OLUH 2XRAL 4U6HB 4IRJB 4N8VB 1AQKL 3O6FB 4PB9H 2P7TA 4JGMA 4M6NH 1MVUB 3CMOL 4UNVA 1IL1B 5LGHL 3RUGE 5F1OB 5E9DA 2R2BB 1JNNL 1KENH 2UY7A 3ARGC 3BD5A 4HKBB 1Y6NR 3MXWL 3MV8E 1CCZA 1EBAA 3WD5H 3ZYJA 1R5WA 1L6ZA 4WCYH 5C1MB 1R5VB 1OHQA 2VABA 3DLQR 3ZHDA 4YIQB 2YZ1A 2P7TB 3G5ZA 3IRPX 4JKPH 3EJYD 3QSKB 4LNVA 5E9DB 3QO1A 3MV9E 4OQ1A 1J9CT 1IQDA 1FORH 2PR4L 3L95B 3RGVC 25C8H 5F96H 3V95A 4YEFA 4RAUA 1BLNB 1R5WB 1M4KA 5C0NC 5JQHC 3MJ9H 2VABB 3NAAL 2R0ZL 4U1LB 3TZVD 2RJMA 3G6AA 4MGXA 2E9BA 4PJHE 4ODSL 3G5ZB 3O9WC 2ZJSL 4C58B 1A6ZA 2DM4A 3DYPA 4RGOL 3WIIL 4OSUL 1QVOA 3QO1B 3G04A 1F58L 1IQDB 3LH2H 5GS0H 5AEAA 4RAUB 1U8OA 1QSZA 3QUML 3MBEA 1UJ3A 5T1KA 4Q2ZB 3L3JA 1P7QA 3VXUE 3G6AB 3GSQA 3U7WL 1DBML 4XP4L 1AY1H 1WCBA 3H9HA 4RIRA 4LCYA 1A6ZB 5C0CB 5IMLA 1QVOB 3G04B 2Z35A 1A7RL 2FH6A 1MCDA 4QCIA 5D2LE 2UZIL 1X5ZA 3J8F7 4C56A 1RZIA 4CW1A 2VXSH 1U8OB 2FATH 1YEFL 2AQ3A 2H8PA 3VRLE 3MBEB 1UJ3B 5T1KB 1H5BC 4HLJA 3L3JB 1P7QB 1CFBA 3GSQB 4J3SA 1WCBB 3H9HB 4LCYB 2HFTA 2BVYA 3OZ9H 4ZO9A 3KYNA 5IMLB 4YHMH 4LAJH 2Z35B 4QCIB 2M8XA 3ILQC 1T66D 4C56B 1KEML 1MCEA 1RZIB 4CW1B 2VDKL 4KY1L 2XIDA 1MFBH 4FABL 3QULB 4I9WD 3GHBL 4UIMA 3UXFA 3EYVB 4YHKL 1IQWH 3WDIA 1IT9H 3JWOC 2IAMC 5FXCH 2P5WE 1EGJL 1EHLH 4HWEL 5D8JH 5SWSA 1J10A 3KYNB 4P23D 2WZPD 3UO1L 2O5ZL 4HBCL 2Z91A 3T3MF 1KJ2A 4JDVA 2X05A 3VXME 4MCYA 1JFQL 3KLHD 4FFZL 3UP1A 3GFUA 4UIMB 5EH1A 1QOKA 3RZCC 4JFEE 3DJ9A 5FUZL 4KKCC 1OPGH 1XIWA 4M7LH 1B4RA 2VXVL 4PTUB 5IQ7H 2D03L 2A38A 2BX5A 3IDJA 3DSFL 5DEGA 3HE7C 2Z31D 3WV0A 4EDWL 4JDVB 1A7PH 2E27H 3HC0A 4Y4KA 4MCYB 2WWMD 1F45A 3TFKD 8CGTA 3HB3D 5E99L 3WE6A 2DMBA 1JHLL 3L3HB 4HUNB 4Y0GA 4P2RD 1XIWB 3T09A 5A2KH 1JIBA 3JTTB 3HUJA 1JN6A 5CAYB 3QUYC 1N4XH 5K93A 4AZ8A 3VG9B 4AL8L 4NNPL 4M1DL 3HC0B 4Y4KB 4JVUA 3VFVA 2R8SH 1PKOA 4GBXC 2CGRH 4UAOB 4QWWC 3INUL 4XCYA 1UVQA 4Z5RA 3L3DB 3WE6B 1AC6A 1CDBA 3GSXA 3T3ME 4JFOA 1TJHL 2ZPKH 3UTSA 4KJWD 2VLJE 5IB5A 5J9PA 4JKMA 3BP4A 4NRYA 2VN4A 3HUJB 1ES0A 1NEZG 1CVRA 2R56H 4MDJB 2J4WL 3ZKSD 3FRPG 5FV1L 4U7SA 5JW4M 1V7NL 1JGLH 1A9BA 3VFVB 4XCYB 1JL8A 4YDLC 4Z5RB 1X5XA 5F9OH 3E3QE 4PRHD 2ENSA 3GSXB 1AHWC 1UWEL 4JFOB 3UTSB 5IB5B 5J9PB 3PABA 3BP4B 4NRYB 1ES0B 3W81A 1U8PA 3IT8D 3MZGB 5IG7B 4JQVC 4AQ1B 1A9BB 1KF9B 3OF6A 1AGDA 4HCRA 1F4WL 2A1WL 1G7JA 1RD6A 1YNKH 5J1SC 3BKCH 5EFIA 1INQA 4ODVL 1ITBB 3PABB 4M7LT 5L7XH 1INEL 4ACPA 1GOGA 1IILE 2OSLA 3MXVL 2FYYA 3DGCR 2ARJQ 5CUSL 1U8PB 1BD2E 2VWEE 4LARL 4Z7VE 4CVXA 1MF2H 1CL7I 4K7PL 5I15L 4Z7UA 1F6AB 3DPBA 3QAZC 3T4AA 3VXPA 1YMHA 1FZOA 3OV6A 5HPMA 1S78D 1G7JB 4A6YA 5FO7A 3R8BB 5EFIB 1INQB 4XC3L 2VDQH 1J1XL 1WT5A 1WZKA 2OSLB 5F6IB 2FYYB 5DMGD 4G6JH 4CVXB 4K8RH 1RJYA 5C2BH 1G9EA 3I6KA 3T4AB 1E4XI 4I9WE 3BAEH 3DURA 1YMHB 3VXPB 1FZOB 4Y4FC 4K7FA 1RZJC 5HPMB 4OF0A 4GS7C 4A6YB 4PRPD 3BWAA 5FO7B 2XTJD 3ZE2E 4PJ8C 2E3VA 3QUMA 4OF7A 3X14A 1PW3A 3K0WA 1IGML 3OAYH 4OLZH 2F74A 5ITFA 4Z8FL 4I5BA 2X4SA 3LKQA 4PV8A 1MREH 2XRAH 4WFED 4FQIL 1RJYB 2WBWB 4FFVC 1AQKH 5ACZA 3CMOH 1NGWA 3LRHA 1WCQA 1YUHA 3BJLA 3QPXH 5LGHH 1H3UA 5T1LD 4ZDHA 2EIEA 5A3ID 4P0DA 1EO5A 5GGTL 2WBJD 1N8ZA 3X14B 4MD0B 4C4KT 3MXWH 2NCMA 5F7EL 2JB5H 4YBHA 2F74B 1HYSC 3OKLA 3BGFC 4FTVB 4I5BB 2X4SB 3LKQB 3NTCL 4PV8B 2HVKA 4X6CA 4JAMB 2KBGA 2IANA 4WI8A 3FB5A 2J88L 5ACZB 3QDJD 1FG9C 4KKBD 1OQOA 1NGWB 1YUHB 1G9ML 4ODHH 4ZDHB 4L4TD 4XZUA 3QCTL 1EUUA 5E95B 3UYPA 2PTTA 4JRXA 3BPNB 5KTEH 4P2RE 1N8ZB 3OKLB 1PD6A 5EZJA 3CX5J 1NCUA 4X6CB 2HVKB 3NAAH 2IANB 3K2UH 2R0ZH 3FB5B 4KV5F 5ADOL 4LAQL 1K3IA 1NC2A 2ZJSH 4RGOH 3WIIH 4OSUH 3NCJL 4XZUB 1TETL 3KNBA 1F58H 3DUSB 3IFLL 2PTTB 4JRXB 1GZQA 2K7QA 3O11B 1UM6H 5DHXB 4L8SA 3E1F1 1CGSL 3D6GA 3BDYH 3BVNA 5EZJB 2V9QA 5EU6D 2R1YA 4W4NA 1CQKA 3U7WH 1DBMH 1Z9SA 4XP4H 1NC2B 4LPCA 4L4VA 4IOIA 4IRJC 2VDOL 2DRUA 3KNBB 1UCTA 1GZQB 4PRHE 2GSIA 5I9QC 4L8SB 3BESR 2R1YB 1D9KA 5HHMD 4J7RA 3ARVA 4B0MM 3K4AA 4BK5A 4HXAL 3D0LA 1MPAH 4IOIB 4YX2H 2GK2A 4NRXA 1IARB 1P2CA 2GSIB 4G80B 1KEMH 1YECL 3IF1A 4Z7WF 2OMNA 2VDKH 1VGKA 1OTTD 2YKLL 5D1XA 4UINL 1JZ5A 4FQXA 1J0HA 2X1XR 5SX5K 3TH3T 5C0RH 1RJLA 1D9KB 1ZSDA 4GLRI 4PS4L 4Q9CA 1OARL 2VL5A 3VRIA 4QRRA 4ZD3L 3WS3B 3D0LB 5BMFL 1EMTL 3MLXL 3IS1X 2B20A 3SDYL 4HBCH 4NRXB 5HYQA 1P2CB 3EO1A 4L1HA 3EOBA 1BHGA 4L3EA 1CXLA 3IF1B 3ZDZE 1VGKB 3B9KA 1JFQH 5D1XB 4OCXL 4PP1D 4FQXB 1PG7H 2EDHA 4J8RA 3VD4A 1RSFA 1RJLB 5FUZH 1MCPL 1ZSDB 1QFWL 3DUUA 3U0PA 4PJAF 2VL5B 3VRIB 4L8CB 4QRRB 2DKMA 4N8PA 3LOWA 2MMXA 2VXVH 3RRQA 3DSFH 3IXAA 2ESVA 4JFHD 5HYQB 2R2CA 2ICWA 3EO1B 2XTJE 3EOBB 4L3EB 2ATKA 3LPGA 2FHCA 2YR3A 4W70A 2DQTL 1XR8B 3W39A 2X5PA 5FA3A 4WFEE 3UZVB 3G6DH 4RQQA 3DUUB 3U0PB 3MBEC 1UJ3C 1EUTA 4BM7A 4XPFL 3IXAB 2ESVB 5JIIA 2AXFA 3M17A 4JE4B 2VISA 2ICWB 4UU9A 3MV7A 5DD1L 4KJPD 1MHPL 5IROA 4AL8H 4IIQA 4M1DH 1GL4B 4I0CC 4X6DB 1C5BL 1FG2A 4N1CA 3ZKXB 3INUH 4RMQA 4WW2F 5TE6L 5FA3B 4RQQB 1NL0L 4BZ1L 4GAFB 3QDJE 2FZ3A 3WXWH 1ZLWH 4BSVA 2LABA 4L4TE 2AXFB 4HAFA 2HKFL 2VISB 1F3JA 4UU9B 3ZE1E 3Q0HA 4ENED 1CXIA 4IIQB 4BK4A 1IFHL 3VXRA 1UZ8A 4OD1L 1LEKA 1FG2B 3ULVL 1G7IA 5B38B 5B3NA 2JELL 4M9OA 4FN0A 1MVFA 1UWEH 4FQLL 4DKDC 4KKAC 4AIZA 3NIGE 2EO9A 1FAIL 3UBXG 2CXGA 4BSVB 1Z0NA 5F9JA 5CEYA 1MCQA 3BPCA 4GG8A 3K3QA 1F3JB 4XXDA 1UZ8B 1LEKB 3FT2A 4TSAL 5L8KB 1G7IB 3EJZC 1INDL 1JVKA 4GJTB 4JDTH 1SEQL 1RZKL 5TFSL 1PDKA 5I8KH 5EU6E 2A1WH 3W5NA 4PGBA 5IMMA 2M2DA 4POZD 1EEZA 4I77L 3CUPA 2LVCA 5C0AB 3SGEH 4AIZB 4S1SL 3WFCH 4ODVH 3Q6GL 4OLYL 1DUYA 5CEYB 5F9JB 1QSVA 3BZFA 3MXVH 3BPCB 4GRWF 5CUSH 1XIWC 4LARH 2VMFA 3RWHA 4K7PH 5I15H 2DS4A 3UMTA 2Y4SA 3BMWA 3FT2B 2R69H 4TNVK 4XWGH 1SYSB 3VG9C 5FYKD 4PGBB 4Y4KC 5FCUL 5HHME 4EUPA 5IMMB 3DTXA 4I0KA 1EEZB 3CUPB 4UAOC 4XC3H 4U3XA 3KPLA 4FNLL 4LQ1A 1B6DA 1DUYB 3FQTA 3BZFB 2CO6B 2V6HA 2A6IA 4YGVA 3RWHB 5IM7A 2R1WA 2PCPA 5E00A 3BSZL 1XF3A 2V5MA 2B39A 5HVHB 1BJMA 2Q20A 4LSRL 4QNPF 2UVFA 1JPFA 3DTXB 5CZVL 5JW4Q 3PV7A 3QFDA 1V3JA 2FJGA 3K74B 3G5VA 4Z8FH 4MMZC 2A6IB 4KRNA 3QBTB 2BVUA 5DJCA 4X7EC 3KPSA 4FQIH 4YGVB 5IM7B 2R1WB 4UOW0 4BFEA 2OL3L 3CSGA 4Y19A 1PZ5A 1XAUA 3GRWL 1XF3B 1WZLA 4XCCL 1GGTA 2AI0L 3QUKA 1JPFB 3WUWG 3EFFB 5GGTH 4NZUH 3WSQL 5IMOA 3QFDB 4LP4A 5F7EH 2FJGB 4NQTA 4I0PD 3G5VB 4H8WL 3IS0X 4JFHE 3NTCH 5DJCB 3KPSB 3IAQA 3VFNA 4Y19B 4FQ2L 4PUBL 5DD6A 4JRYA 1G9MH 3G9AB 3X17A 5DRXA 1CR9L 3QUKB 4OF3A 1F8TL 3CVHL 4HMDA 2DIAA 2AEWA 3B8YA 1T21A 2YD8A 4QNPE 3VFNB 5F6IC 3HC4H 5HXMA 4U6XA 2Z8RA 5KJRL 2IH3B 5DD6B 4JRYB 4OF5A 5DRXB 4ZOEA 2QR0B 5IBLD 3IFLH 1S7WA 1IEAA 4WY7L 1TVHA 4K3DL 4RX4D 5DHVA 4X4MA 2PXYA 3VXQA 1RZFL 5GGVL 4HJGA 1ZVSA 2IEPA 3O2DL 1T21B 2OXHA 2QSTA 4WI9A 5SV4A 3VJ6A 1JZ2A 1WT5C 3RI5K 4NO0D 4U6XB 1Q9KA 3FQXA 5I17A 4ZNCD 3QXWA 4GAGL 2N56A 3RVXD 4XWOD 4QRQA 1S7WB 3BN9C 1TVHB 4NKDA 3I9GH 2Q1EA 5DHVB 1N5YL 2PXYB 4HIEA 4HJGB 1ZVSB 3HRPA 4CMHB 1AI1H 4PRNA 3NCCB 2H32A 3VJ6B 2DOCA 2NYYC 4HXAH 5I76A 1Q9KB 3MUHL 4HT1L 4OFKA 4OLVL 5E08L 5I17B 3VXSD 3DX6B 1KEGL 4V1DA 1WAAE 5LBSL 1YECH 4NKDB 1FN4A 3SCMA 3EDKA 4D0CA 4HFUL 4HIEB 3QQ9C 4LGPB 3BPNC 1LE5A 2IC2A 4XH2A 4YHOL 5HYSG 4QHMA 4BSWA 4PRNB 2H32B 5FK9A 1OARH 1KC5L 2R39A 4ZD3H 5BMFH 5I76B 3MLXH 3D3VD 1I3GL 3BMVA 3SDYH 1P1ZB 1F4YL 2IPTL 5FYKE 3PWLA 3TESA 3WIFA 1A7QL 3UTZA 4O58L 4D0CB 4OCXH 1QPPA 5DZNA 4BQ6A 4HMCA 1LE5B 1D6VL 1VADA 3BFOA 5D6DA 4XH2B 3S4SA 4QHMB 1MCPH 2EZ0D 1QFWH 4ZFOL 5FK9B 4HPOH 3MLSH 3KLDA 4R4ND 4LCIH 3HAEH 3Q6FB 4TRPL 1DBJL 1HINL 5FUCE 2Z92A 2Y5TB 4MDIA 5HYJA 4RBPH 2X40A 1CDIA 4ZMAT 3LN4B 1HXMA 3CSYA 3ORJA 2Y07L 3T2NL 3UTZB 5I1GL 2YC1A 3MYJA 2DQTH 1YEJL 1VADB 4CVUA 4CDHA 3S4SB 4L8SC 4UILL 4TQEL 3EYFA 2G5BA 5KVEL 4XPFH 2P46B 2Z92B 4MDIB 5T3XE 5HYJB 4F3FA 4QTIH 3ARFD 4OZFH 1BQLL 1AR1D 5DD1H 5JDJA 1HXMB 1MHPH 3CSYB 3QUXD 4Z95L 4WUUA 2YC1B 4RGMB 3BN3B 3MYJB 1C5BH 4ZPTB 1CN4A 5JMRA 5KG9B 1NL0H 3I02A 4PJBF 5HD8C 5BO1H 3C09B 3EYFB 2G5BB 2I26N 1D9KC 1OTSC 5BRZB 3DROA 4F3FB 5EUOA 4YK4B 5E8OA 3WS6A 4E42A 3MRQA 4LLUA 4U05A 4UTBH 5D2NA 1IFHH 2JE8A 4WUUB 4OD1H 3ULVH 4N0RA 4NYLA 1SVCP 2JELH 4LRIC 1QFHA 3PWPD 4X80L 3I02B 1ERNA 5D1XC 4FQLH 4ALAH 4KQ3L 4FQXC 4LHQB 1FAIH 4LHUD 5F89A 3DROB 5I8OL 4PYHA 3UJTL 4IOFD 5EUOB 2RBLA 3MRQB 1VFBA 4LLUB 4OFVA 2OL3A 5D2NB 2UWEE 4RRPA 4K71B 5B39A 4TSAH 4NYLB 1INDH 2NXZB 2VTFA 1SEQH 1RZKH 1EVUA 1BVZA 1JNHA 1UA6H 5TFSH 5J0BA 4DZBA 3QHZL 2G5RA 5TDNA 5IGXL 1DTUA 2XWBA 4J23A 5D5MF 3U36A 3Q6GH 4OLYH 5F89B 4S2SA 1MNUL 2F53B 4YDIH 1NCCL 5IBUG 3OKKA 2E7MA 3PHSA 5B39B 3HI1A 5DWUL 5ABDE 3P4NA 1FO0L 1JNHB 1MI5D 2W59A 2HLAB 3PGFH 4DZBB 2X1WL 5FCUH 4HXBL 2L4OA 4XP9H 2XWBB 3M07A 4LCWD 3DETC 4NOBA 2XXMB 3U36B 4KUZH 2PYED 1MCOH 4S2SB 2Q3ZA 3VXSE 3MRJA 3OJ2C 1MQKL 5KVFL 3OKKB 3FONB 5TE4L 1IBGH 3BSZH 3HI1B 2I9TA 3P4NB 4URTB 5E2UL 5IROC 4LLQA 4IIQC 2RB8A 5CZVH 2VRAA 4ZOBA 1S5IH 3B2VL 5JPNA 2DLGA 5KBNC 5HSFA 1NCWH 4PJFE 3ULUF 4OCYL 4KQ4L 1A0QL 4X8JA 3S3JA 2CDGA 2WWKO 1JI1A 4QEGA 4EI5D 4MX7A 4F7EA 2D2OA 3GRWH 1A2YA 2I9TB 4AMKL 4WWID 2BERA 4LLQB 4X7FC 4XCCH 3D69A 2AI0H 4R9HA 3MRCA 1KFAL 5DC0A 5JPNB 1SY6L 3WSQH 3ARFB 2P5ED 1VERA 1UB5A 5F7UA 4H8WH 1CGWA 1Q94B 4KTDL 4X8JB 1FNSL 1IGJB 5A2LH 2CDGB 1U8KB 12E8L 4MX7B 2HFFA 4AT6A 4F7EB 4FQ2H 3KJ4B 4ZYKA 1A2YB 1F97A 4PUBH 5BS0D 3P77A 2H26A 3ARBA 4KK8C 3RWJA 3D69B 4Y1AA 5FM5M 4K7PX 5BQ7A 3MRCB 3MACH 1F8TH 1VEPA 3CVHH 1B9ZA 4X6EA 1JGVL 3V5DA 1UB5B 4H25A 4JPWL 2QJDA 1B0RB 2C5DC 2HFFB 4AT6B 3CAFA 4P2OA 5DK0A 4ZYKB 3FAWA 1YMMA 3ARBB 4P46A 3ZKQD 5BQ7B 2DTSA 1SYVA 3TT1L 3WKMH 3MUZ1 3UJIL 3V5DB 5HVHC 2P8MA 2EEBA 2VB5A 4H25B 3T8XA 2UUDH 1XH3B 5IJVA 3O2DH 4MJID 3W2DL 4NCC2 1GC1C 2DBLL 3TNMA 5IUSA 1MJ7L 1CE1H 4MJ2A 4P2OB 5DK0B 3WL9A 3QDGD 4JM2F 4FP8L 4YHIA 1Q0YH 1YMMB 3DNKA 3GJFA 5IT2L 2J7LA 4Y5YA 4P46B 4RGNB 2ORBL 3PWPE 1XR9A 1SYVB 2NY3B 3V5HA 1ZA3A 3UJJL 1N5YH 5TF1L 3T0AA 2P8MB 3T8XB 5JIPA 5IJVB 4CKVX 5DVKA 4PP2A 1NMAH 4OLWL 2KZWA 3TNMB 5ITBL 3WL9B 3L6FA 4OLVH 3RVVD 5E08H 5IHUH 4YHIB 4HZAA 4LVNB 3MOAH 3GJFB 3VU2A 4Y5YB 1U8JA 2BVOA 3FAXA 2DQFA 2BNQA 1AO7A 1EHAA 4HFUH 3JSSA 2BCKA 4PP2B 4YHOH 1H3PL 4C4KO 5EULV 1ZHBB 1W72L 5DMIL 3L6FB 3MRHA 5DJ2A 1I3GH 1MI5E 1IC7H 1LP9E 1RQ5A 2DYPA 3P2TA 2IPTH 3VGFA 4PJHA 1U8JB 4JY4B 3TBYA 2BVOB 2E9WA 4O58H 5FKPA 4X99A 4LCWE 2DQFB 2BNQB 1AO7B 1FL6A 2PYEE 3RL2A 1D6VH 4O2FA 2BCKB 4Z76A 4Z18A 4BFIA 4XHJD 4TRPH 3MRHB 3S96B 5DJ2B 1HINH 4ZSOE 5DGQA 2DYPB 3KS0H 3NCYP 4PJHB 3TBYB 4F58L 3T2NH 3HE6A 4X99B 3KLAA 2Y06L 5E1HB 2PETA 3JUYA 4MAYA 4ZFFA 5KANI 5CJOL 1FL6B 2DQCL 3RL2B 5HDLA 4O2FB 4Z76B 5CINL 3RVUD 5I71B 2BVTA 4BFIB 2Z93A 4UILH 2PXYC 4XPHL 4TQEH 3TBSA 3JV6A 3TN0D 2YA0A 5KVEH 2DQGH 4CMHC 1KN4L 3C6LD 4AYFA 3K81A 4M61A 1F90L 1BQLH 4P2YA 3BGAA 2P1YA 2Y5EA 3HE6B 4LLMA 2P5EE 3B6SB 3KLAB 4Z95H 4ZFFB 4MAYB 4U31A 1FO0A 1HSBA 4JLRA 4PGCA 4NHUB 3QIBD 2Z93B 4TSCL 1KN2L 2F54B 5EO0A 3TBSB 3JV6B 4U7MA 5E03A 2EE6A 5BS0E 3RVWC 1QO3A 4M61B 5ISZD 1FGVL 1CFSA 2HH0L 3KPTA 3V6OE 2CDFA 1A7NL 4FQ1L 4LLMB 4JHWL 3N1GC 3A0OA 1N59A 5F97E 1T4KB 1JRHI 1WWCA 1HSBB 4JLRB 4PGCB 3E8UL 3VXMA 3T2OA 3SCMC 4LGSB 3T0DA 2A0LC 5EO0B 1PYWA 3HG1D 4KQ3H 5HI3D 2BY1A 5E24E 4ZAKA 4UT7L 3S9DB 5CZKA 2XXCB 3K8LA 2CDFB 3FJTA 5B22A 4JO2L 3ZHLA 1N59B 2WBKA 2DQEH 4FA8A 4KKLD 4MJIE 4KJQC 3QHZH 5IGXH 1PYWB 2HJLA 5KVGH 5EPMB 3JWNC 2MCPH 5D6DC 3QDGE 4MJ6A 4YNYA 3TEUA 2V17L 1MRDH 4NQSA 1MNUH 4ZAKB 4WU7A 3BRFA 1NCCH 2NLJA 2AJUL 2C3GA 3MRFA 3BKJL 4YHYB 3MA9L 4DVRH 3BPOB 3CFBA 1Q0XL 2BOCA 5GHWL 4NQCD 3UYRL 4RGMC 4HXBH 1FPTL 5IFJB 3VFTA 4HUWA 4KZEH 2HJLB 4ETYA 3V79C 1ZT1A 1GGYA 5HHVL 1YEIH 4MJ6B 4YNYB 1NBYA 3V7MA 4NQSB 3C09C 3GHEL 3PXJA 2VLJA 3IDNA 4NWTL 4WU7B 4H20L 1DQLL 4L5FL 3RNQA 3A67L 5KVFH 3FO1A 1S9YA 3MRFB 3QZWA 5TE4H 3L5HA 2P48B 1KPUA 3C5ZA 3CFBB 4HHAB 2XA3A 4P48A 4YK4C 2BOCB 1BP3B 3D18A 5FUOL 1GIGL 2ED8A 1HYRC 5IB2B 3QNYB 2PW2A 4P57A 3VFTB 3MRNA 4HUWB 1B4JL 4GRLD 1ZT1B 2P24A 3MUY1 1NBYB 4OCYH 1MCIA 1PY4A 2VLJB 3IDNB 1FV1A 1KCRL 3RNQB 1RHFA 1EJ6A 1S9YB 3FO1B 3QZWB 5DQJA 5L2KA 1DQTA 4C59B 1KPUB 3C5ZB 4AMKH 1FYTD 3D18B 3WS6C 1BZ7A 5D2NC 2PW2B 2E6PA 2EO1A 1KFAH 4K71C 3MO1B 2NXZC 4EIZC 3BDXA 3VGGA 2P24B 5DFVC 4S1RH 4QXWA 1FQ9C 2AK1H 3ZKMD 2CXKA 1QLRB 1FV1B 4YC2B 1FNSH 4PJ5A 2WIIA 12E8H 5DQJB 1AQDB 5L2KB 1ODAA 3AU1A 2R0LH 1BD2A 5I1JH 4XPGL 4G6KL 5F7FA 3KPMA 2ZUTA 1JTPA 3D39B 1P4BL 5HHXL 3S6CA 3VFSA 1KLFA 1FFNA 1MY7A 1XF5A 2O26U 1JGVH 4MB5A 4XVTH 1YY8A 1DJSA 3BUYA 4JPWH 1FDLL 4OGZA 5DF0A 5AG9A 2NPLX 2N7AA 2A6KA 4PJ5B 2WIIB 1NC4A 3S3PA 3RIFF 3QDHA 1E27A 2ICCA 2IQAA 3AU1B 4QXUL 5F7MC 1BD2B 1MY5A 5HY9A 5H8DA 3KPMB 1F00I 2ITCA 2PYFA 4HD9A 1QTYT 5EU7C 1GJIA 2IPUK 3TT1H 4KUCD 1I7TA 3VFSB 1MCWM 1KNOA 1XF5B 4M6MH 2VZ3A 3WJJA 3BUYB 5ISZE 3W2DH 1IAKA 1TZIA 1VFUA 2A6KB 3FN0H 4POUB 2DBLH 3WN5B 1NC4B 1MJ7H 4PJGE 1E27B 2IQAB 4MMXC 4OZHF 4FP8H 3DYOA 1J86A 5HY9B 1XEDA 3W5MA 5ACMA 3LPFA 5IT2H 1JGUL 2ITCB 2PYFB 2ORBH 3HNVL 4XCEA 1GGUA 3HG1E 1I7TB 3UJJH 1HKFA 5CD5D 3QQ3B 1KNOB 5TF1H 3C5JA 3B2UC 4L8BA 5IB3A 4N0CD 3VMPA 4PJIE 4JVPA 1IAKB 1TZIB 4QF1A 4OLWH 4HWBL 2A73A 4ZXBB 3VI3F 1ZLSL 5ITBH 1A6VL 1DBKL 3RX7A 3SE8H 4MA8L 2XWJA 2K1MA 4R3SA 1XZ0A 3KJ4C 4XCEB 3VWJA 2EKJA 3AREA 5D1QD 1EO8L 2PNDA 3C5JB 3D2UA 3LCYA 5IB3B 3SQOH 3AMLA 4JFPA 1H3PH 1X3DA 1ZHLA 4QF1B 3CFJA 1W72H 5DMIH 1CBVL 2A73B 4U1NA 2VERN 2R1XA 3MLPA 2XWJB 4NQCE 3BP6A 4R3SB 1XZ0B 1TFHA 1BQHG 4PJCE 5EOTA 3VWJB 3AREB 3ARBC 4JFQA 1OP9A 1H3GA 2V5SA 3D2UB 5TJWK 2V5YA 4JFPB 1ZHLB 4Q97A 1BZQK 3CFJB 4HCRH 3LMJH 2J6EL 9CGTA 1GZPA 4Q9BA 4U1NB 3I84A 4RMSA 5I8EA 5GISH 3ULSB 1DFBL 3B4NA 3BP6B 1CS6A 4P2OC 4S1QL 2NZ9C 5EOTB 4MJ5A 4F58H 2X41A 5IFAL 3BRGC 2Y06H 4WO4A 4JFQB 5CJOH 2GFBA 4P46C 4RGNC 1NCBH 2NY3C 2CKBL 3TJHD 1PEZA 4QGTA 1GZPB 2AQ2A 1G7PA 4L9DA 4XPHH 5I8EB 1FYTE 2Y23A 4OCNC 4WV1A 3PE9A 4X9HA 5D72L 2K7PA 5HGHA 3ES6A 3MCLH 1N2RA 4MJ5B 1BIHA 4OLEA 4LVNC 1LEGA 4WO4B 2X4PA 4Y5YC 2GFBB 1MAML 2ZG1A 1IZJA 2QQNL 4KDVA 1KCUL 2OP4H 2R23A 2XTLA 2OZ4A 1S9XA 3NABL 1KN2H 1G7PB 3GSNA 4FQJL 1UWGH 3EHBD 1NSNH 4KXZI 4TUOB 1RIHL 3NZHL 3GK8L 4WV1B 1D6EA 2W0FA 4KK6C 5T33H 1FGVH 2VL4A 5AG8A 2HH0H 5HGHB 4OZ4A 3UZEA 3ZSTA 2HFEA 3ES6B 1A7NH 1MLBA 1LEGB 4JHWH 2X4PB 4R26L 2CIIA 3WEXA 1RUML 3BXNA 4K3GA 4FS0A 3E8UH 3BGMA 2ICWI 5CKAA 1B2WL 1S9XB 3OG4B 3RAJL 3VGBA 2ZNWA 5HI5C 1T83A 3GSNB 4HPYL 1T0NA 2LQRA 4BQ8A 5H37H 1Y18A 2NY1D 2XZZA 1YY9D 1D6EB 3RKDC 4HW6A 4UT7H 3QB7C 3I6GA 4KI5D 5DUPL 5I19L 4OZ4B 4R97B 5JORB 1I1FA 2HFEB 4ZS6C 4JO2H 1N0LA 1MLBB 3ZDYF 3JVGA 4KRPB 4PREB 5B21A 3WEXB 2OK0L 3BXNB 3BGMB 1T89A 1A3LL 4ZUUA 5LGJA 3QWOA 3NIFF 4R7NB 3W9DA 1T0NB 3CVIL 1M05A 1UCBL 1Y18B 4QKXB 4U6VH 2V17H 5CZXD 1V3MA 2FX8L 4NNXA 1YEDA 4E0RA 3NCBB 4AEFA 2B1AH 1I1FB 4Z7WA 2AJUH 2GTWA 3FQWA 2VAAA 1YN6A 3MA9H 3RBSA 2QKIA 3F5WA 1Q0XH 4Y5VB 5CSZA 5CJBA 5GHWH 2KUTA 2XA8L 4P4KA 1T2XA 1JZ8A 2XNAA 3HE6C 1NDMA 5KAQF 3UYRH 4MAYC 2FX7H 1FPTH 4G9DA 3HI5L 2ATPA 4HC1L 2FECI 2Y36H 3KPNA 5I74B 2G9HA 4ZUUB 3RU8L 3QWOB 5LGJB 4OM1L 3W9DB 2DI9A 3TO4D 1M05B 2YBRA 5HHVH 5GS0D 3GKWL 1H3VA 4NNXB 1YEDB 3EYUH 4E0RB 4NWTH 2WUCL 4NO2B 4P3WA 4H20H 1DQLH 4L5FH 4Z7WB 3A67H 2GTWB 3MLYL 3FQWB 1PKQA 2VAAB 1R3KA 5CJQH 4L4TA 2E7BA 3X11A 2QKIB 3F5WB 5FUOH 5FYKL 4P4KB 1GIGH 2XNAB 2DLIA 5E94A 3SDDD 4XNZB 4PJAA 3V52L 4G9DB 2ATPB 3KPNB 1B4JH 2G9HB 2EYSB 4FG6C 1RJCA 1LGVA 2YBRB 2GJ6A 1MFCL 5CGYD 1I9JL 1NUGA 1VEOA 1X5LA 2KKQA 1PKQB 1R3KB 1CXFA 3X11B 1BFVH 2VZ1A 5ICZA 1CT8B 4UOW1 2XZCL 2DLEA 1UM4H 3O2VL 5J56B 1XGRA 4PJAB 1DSFH 1YQ2A 4HIJA 4PRAA 1ORQA 5IVXE 5EU6A 2GJ6B 4GG6E 1FYHB 1QPXA 4Q7DA 4HWBA 2H2SC 1NEZA 5T5NG 3LD8B 5T3XL 3QXDA 4ZAKC 3THML 5ICZB 5F72S 3TA3A 4WW2A 3MPCA 1H3TA 1QHOA 4G6KH 2J3SA 4GSDH 1XGRB 4YHYC 2VUOA 4UZGA 4X7SL 1P4BH 3BPOC 4HIJB 4PRAB 1ORQB 4EI6A 1FDLH 1U0QA 3U7YL 1NEZB 1G0XA 1CG9A 5FOJA 3NGBB 1DVFA 1NGPH 1TJIH 1NH6A 2MSPA 2XACC 3QXDB 4QXUH 3TA3B 4WW2B 4XNYL 3ALPA 4ZO7A 4E41D 1CTOA 5DURD 3GI9L 2IPKA 1R5IA 4IDJH 5KVDL 5K9QI 4OCLC 1L9MA 4EI6B 2NY5C 2X44D 5TPWH 2QHLA 1X5IA 3RTQA 2I07A 1N26A 3DARA 1CG9B 4XBPA 1DVFB 4YQXH 5DVNA 3DX9A 2GAZA 4PBWD 5CSBA 4ZFGH 1A5FL 3HNVH 2YUVA 3C5ZC 2IPKB 1R5IB 3RP1A 2YD2A 1EA9C 5DHYA 2HTLD 3FB6A 3QIUA 1B6UA 1T20A 4XX1G 4KI5E 1SEBA 5E2TL 3RTQB 4I4WA 3NFSL 1GCFA 1M7XA 5DK2A 4XBPB 1ZLSH 1KIQA 3I50L 4GKNA 1RK0A 3DX9B 4YC2C 2GAZB 2W07A 1JYNA 4G7YL 4MA8H 4GMSL 5IW3A 5FDYA 1RK1A 3ARDD 5F70A 1T7VA 1EO8H 1PSKH 4GRWB 2EXWD 4XTRD 1PJ9A 3QIUB 1T20B 3N50A 4KH2A 4LFHD 1SEBB 4R7DA 1CBVH 3L1OL 4HGWA 4I4WB 5ICXB 3IETA 3F62A 1KIQB 4GKNB 1OP5K 3D1MC 1RK0B 1KJMA 4KRLB 3CDGA 1RK1B 1VSCA 5FYJH 4LEXL 4F7CA 2OTUA 3VFGH 2DJ4A 2C3VA 3ILPA 4P9HC 1FHGA 2JJTA 4R7DB 4HGWB 3IETB 3FO0L 1MFEL 1LO4L 1OAKL 3U4EA 4GRMA 1KJMB 5DUML 1DFBH 3CDGB 1QFUL 3WN5C 4S1QH 1N0XL 2B5IB 1BBDL 1NGZA 5IFAH 4F7CB 2OTUB 3WFHA 4JJHA 1V05A 3CC5A 1AGBA 3LEXB 1FC1A 2CKBH 3UYOD 3ILPB 4TVPD 5KOVC 3WJJC 1M7IA 2YN5A 4DZ8A 2B0SH 3R1GH 1LQSR 3U4EB 4GRMB 1KB9K 4LOUD 5D72H 4XRCA 4YLQT 2EDBA 1NGZB 4KHTL 4K8RD 4LSDA 3OAZK 3F7VA 3WFHB 2NX5A 1RJZA 3O81A 1MAMH 4FXGA 1JZ6A 4BQCA 1PBYA 1J1OL 3KLHC 3CC5B 1AGBB 2LVEA 4G8EA 4KRMB 4HC1A 5DC9B 5I30L 4YHZH 1M7IB 4DZ8B 2SEBA 4UBDD 3VFRB 1MEXL 1RIHH 3NZHH 3LSOA 3GK8H 2EEDA 4N9GA 3P9WB 5ERWA 4PJXB 3UTTD 4XRCB 3MOBL 4JN2A 3K1DA 3O3EA 4PPTA 3S37L 4UT6L 2VXTH 3F7VB 1EHXA 4XVSH 2NX5B 1RJZB 5KVMC 4FXGB 4NC1C 1TPXB 5JO5B 1RUMH 3VWJC 4I48A 1EZVY 5E8DH 2FDBP 3AREC 2OM5A 3KXFA 4G8EB 5FHAH 4YZFE 4Y16D 1B2WH 3QEGL 3RAJH 3GDBA 1ZWIA 4HPYH 3GJFK 1LO0L 3QXVA 4N9GB 3B5TA 4MVBD 5ERWB 4JN2B 4PGZA 5DUPH 4IRZL 5I19H 3QWQB 1E4JA 1II4E 3O3EB 4CGTA 4KPHL 5D7LD 3MNVA 1MHCA 2OK0H 2F8VA 4I48B 1IAIM 2Q8AH 3KXFB 1TNMA 2ZCHH 1A3LH 3OGCA 2AAVA 4OZGF 1ZWIB 4ELKA 3IFPA 3CVIH 5D9SA 1BMGA 5LGKA 2YPKA 2YHGA 3QG7H 4WHCA 2X1PA 4TTDC 3DVGA 3ZL4L 2RQ8A 3U83A 5GSVA 1CGXA 3M8OH 1MELA 2OR8A 4PTTA 5ELIA 5DK3A 1CZ8L 5F7WC 3MNVB 1MHCB 2XPGA 3NPZB 2XA8H 1WICA 4WO4C 4GKOA 3EO0B 4P2QD 2DQIL 2HKHL 4ELKB 3IFPB 1S9VB 3P4MA 5D9SB 4MXQD 5CEXA 5JXAL 3GKWH 4NO3A 2YPKB 3GSRA 3DVGB 2WUCH 1G6RL 3T77A 5DEZA 3G5XA 3MLYH 4KROB 4NM8L 3QNZA 2CO7B 1G1YA 3OR6A 5GRVK 5GSVB 4WV1C 1A02N 4PTTB 5E6YA 4H26A 2XPGB 5FYKH 2WK2A 1OQXA 1EAPB 3BIKA 4PJDF 3V52H 1CXEA 5IP4A 3ZO0A 4MXWL 3WXVL 5C0BD 3PL6D 3GMOA 3P4MB 1MFCH 2E9JA 3DXAD 5CEXB 3ET9F 1I9JH 4NO3B 3CFDA 5TQ0L 3GSRB 4YUEL 4H88L 3T77B 3QNZB 3KVQA 3OR6B 1RUQL 3IFNL 4H26B 4LSUL 3IDIA 4R97C 1GGBH 1K6QL 5T5NF 3O2VH 5I1AA 3BIKB 4ODWA 4KRPC 5E2VL 2EIZA 1J5OL 4KC3B 1OSPH 1C1EL 3LB6C 4PJ7E 7CGTA 1HCFX 1FSKB 1G0YR 4YJZL 3CFDB 5ADPH 4YPGA 2FBOJ 2YWYA 1T83C 2PF6A 4ZUSA 3BYTA 4MD5A 3THMH 3IDIB 2VLKA 5I1AB 3JVGC 4PJBA 4TVPE 4ODWB 1OM3H 43C9A 2EIZB 4X7SH 4Y5VC 3O3DA 4NQED 2ADJB 1T89C 1HH6A 3SE3A 4POYA 2Y25A 3UBXA 1IGIL 2VSDA 4NUJA 4MD5B 4ZUWB 4Z7NF 3DX8A 4MNHA 1OLLA 2VLKB 5EUKA 4PV9A 3EW3B 3GI9H 4PJBB 4NQDB 43C9B 1CFVL 5H35A 3REVA 4P4KC 3O3DB 4R6UA 5KVDH 4R2GD 3AS3A 4EUPG 4XNZC 1HH6B 1JV5B 3C2SA 3UTTE 4DN4H 3UBXB 3K8KA 1F11A 4NUJB 2VDML 3RPIA 2BFVH 5EU4A 1CIDA 4MNHB 2I27N 1I1RA 2CMRH 4PV9B 5TQ2L 2FJFA 3BD4A 1L0XA 3REVB 3LEYL 4WUKL 1VA9A 5D5MA 5GZND 2C3XA 4Y7MA 3HA0A 1QLFA 3W11D 4WTZG 3TPKA 4JPIA 1V5JA 4KTEL 4NCDA 1F11B 3BH8A 5E2TH 2DQDL 4DOHB 4LSPH 2IADA 5D7LE 5EU4B 1UH3A 4KWUA 4G7YH 3LD8C 4GMSH 2FJFB 1T7ZA 2AJXL 5E0QA 5A16A 1YYML 4Q6YA 4P5KB 5D5MB 1QLFB 2P49B 2ZOKB 1A64A 1J11A 2VOTA 1NCTA 4TNWF 4JPIB 1QRNB 2APWA 3BH8B 3L1OH 1G9NL 2IADB 4NKIL 4OF6A 4WW1A 1BVLA 3DHJA 3U9PL 3LS4L 5IEHA 4LVOB 3NGBC 1CIUA 2XQBL 5A16B 4DKFH 4P2QE 4NFCA 3T0VA 4CN6A 4OIAA 4HUXA 4WW2C 3TA3C 4LEXH 5B4MC 1RIUL 4W6YB 5LJYH 2IFGA 4LPYA 4DEPB 2NY0D 4EBQL 2VDNH 3VA6A 2F19L 3JWDC 1MFEH 5E2WL 2MQ0A 2XKUA 4HIXL 2BNRD 2FEDC 4WW1B 1G7MA 1BVLB 5EIIA 5IFHL 2DKUA 1QFUH 3QPQC 5IEHB 3AM8C 1DVFC 4XBGA 2AV7B 1BBDH 5C0BE 4HUXB 5GS1A 5KSAA 3DXAE 1TZHA 2O5XL 4TUJA 3MRPA 3NCFB 4MNGB 1U3HA 2HLFD 2I60L 5E5UB 5CWSA 3RHWF 4GO6B 5EIIB 3RTQC 3S36X 3SDXF 4JVWA 4G6AC 4QHUB 4XBGB 1KIPA 5FB8A 3N06B 2VE6A 1TITA 5IKCA 2PO6A 5GS1B 5KSAB 1E6OH 3FB8A 5C6TH 1K2DA 1RIVL 1IM9A 1TZHB 1J1OH 3OJDA 4TUJB 3MRPB 1U3HB 1KG0A 2BC4A 3PGDA 5C0GA 5I30H 1F3RB 1ADQA 1KB9J 5CWSB 3QIUC 2JJSA 1ZE3C 1MEXH 4UIKL 4LU5L 1P4IL 1IAIL 2AGJL 2OI9B 3MOBH 1YPZE 1J12A 1KIPB 3S37H 2EE2A 3CD4A 2R0KL 4QGYA 4UT6H 5FB8B 2VE6B 3GJEA 4JPVL 4NQEE 5IKCB 1HZHH 2PO6B 3LEVL 1EVTC 3FB8B 3REWB 1K2DB 2AKRA 1IM9B 3OJDB 3SO3B 5DT1L 3ZDXE 3TVMD 3H3BC 4G7VL 4LCWA 3SJVA 1KG0B 2BC4B 3PGDB 5ACLA 4OZIF 3QXTA 4JM2A 3WLWD 3O8XB 4DW2L 1LO0H 1BOYA 3I3DA 5FCSH 1CLOH 3KPRA 4OD3H 5K9KA 3S34L 5F7HA 3GJEB 1MFDH 4CRPA 2BSED 3DSNA 3MV01 2AKRB 1JNJA 3VFOA 3SJVB 2YXFA 1JHKH 5DD3L 3CDFA 3CLFL 4JM2B 4RFOL 3TM6A 2FRGP 3HS0A 5HYSA 4JGUA 2JJTC 4IMKA 2UY6A 1T2QL 3KPRB 5IQ9B 1MCFA 3ZL4H