5E9DD

Rd-1 mart-1 high bound to mart-1 decameric peptide (ela) in complex with hla-a2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
110
structure length
110
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSTSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTKYSWGKLQFGAGTQVVVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title An Engineered Switch in T Cell Receptor Specificity Leads to an Unusual but Functional Binding Geometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 26
structure length 110
sequence length 110
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e9dD00
3G9VA 5MEPA 1RZKL 3DTXA 2AEPL 3JV6B 4S1SH 3RWGA 4WTZA 4G8GD 2YKLL 4UQ2B 4XNXL 1A3QA 3P4OA 5EU6D 3C8KA 4PJCE 5ICZB 3V0WL 4Z6AT 3CU1A 3FFCA 2PNDA 2BXZA 3MJ6A 2D0FA 5D5MB 3DUUA 3DX6A 4Y2DB 2V7NB 1DUYA 4JPVH 2DICA 3IFNL 1MCDA 3ESVF 3C2AH 2IBBA 4M7LH 3VFRB 2BSSB 3ARUA 3W11D 4PJFB 2HRPL 3P2TA 3GBML 4KQ4L 1KTRL 4U2YA 4KVNH 1JPFA 3TZVD 4Y89A 4Y88A 4HAGA 3Q3GB 1HYSD 3BE1H 3QNYB 3BIKB 2HMID 1K5NB 2ZSVA 3TVMC 3HI5L 5FDWA 4NQEE 4EI5C 3N9GL 4F37K 4XVUC 4WCYL 3K8KA 5GGUB 1JPSL 4Y4FA 4KDWA 1WCBA 2B4CC 3C6SB 1T5WA 3PG2A 2VLKA 5FUCC 1NBVH 3D3VD 2YZ8A 2PF6A 1HHHA 4M5ZH 1ROWA 4P57B 4GKOA 1BQHA 3V5HB 4X8XA 4G8FA 1NAMA 1FDLL 1MAKA 2WWMC 1TCRA 4U1HA 5E95B 1DN0A 5J6HA 1FCGA 1ODAA 1N6QH 4NO3A 4ZXBA 2VIRB 3KPSA 4H1LB 5C0CD 3F7QA 4H5SA 5HHNB 4OQTA 1IAKB 4U3XA 1H3PL 2YSSB 4M1CD 4LLWB 3GUTB 2BVUA 4JGJA 4NJAL 3TBYA 4JKPL 3SQOH 3DSFH 3QDMB 1CTNA 3DJ9A 2M8XA 1VB9A 3FKUS 3LS4L 1MWAB 1L7IH 3IJHA 4LSSH 3VFUA 1KCLA 5C0EB 5DUBA 2XG4A 4X5XB 4OTXL 2EH8H 4JR9L 1T83C 1RZIB 5KJRH 5HGHA 3BGFC 2RQ8A 1D6VL 1FZOB 1Z3GL 1U8NA 1FE8H 4ZS6D 1AGEA 4KK5C 1KLUA 3D25B 3QFJB 1W72A 4TSCL 2OR9L 1J87A 5F6IC 1REIA 2IGFH 4OQ1A 3G6JA 1WZ1L 5DA0B 3DYMA 4EJ1C 4C55A 2ESVA 1RK1B 5K9JL 5D6DC 4MMZC 1P2CB 3NZ8A 4X83A 4DW2H 5FGRA 4TTDD 4DOHB 1T80A 4MNGA 3DVNA 3OL2A 3QULB 3TBWB 3D0VA 3PGFL 3ESUF 5MHSD 5DS8A 5I1LA 1N5AB 3REWB 3IDNA 3B9KA 5E2TL 3VWKB 4MDIB 3RWEB 4WI6A 1JGDB 1I1AA 2VAAB 1MCRA 3OKEB 5ERWA 1T7ZA 4E9LA 1S9XB 1EEYB 2VZOA 3TT1L 3ULUF 1MRCL 4N0UA 1UA6L 4OD3H 5KSBB 5FCSH 4YPGA 5F1KC 5DEZA 3NA4A 3WCYA 2CH8A 2MWCA 4R97B 3MFGB 4OF7A 1MFBH 5DVMA 5K33A 4I3RH 1NJ9A 5EPMA 4ZTOH 2BHUA 5KSVB 3BDBA 5DFVC 1WZKA 4LAJH 4WO4C 3BZ4A 3QISA 5HHME 2C3VA 3F65A 4R4FL 5F9JB 1NCDH 2CR6A 2XFXB 4GAJH 4WU5B 3PHQB 1P4LA 3TO4B 1R3LB 5DJZA 1OWRM 1CGSH 5GPRA 5BZWA 1FLRL 1KLFA 3VRIA 2YD8A 1Z6JT 4XP6L 1Q0YL 4PGEB 1BOGB 1UYWH 5EIIB 3RVXD 3U36A 4K9EC 5DK2A 4RAVB 3ZLQC 1BOYA 4NKIL 1JGUL 1KPRB 1CDJA 5J57B 3KPPA 3IU3B 2DI8A 3O2DL 5BXFA 1BQLH 4QHKJ 1WITA 2Z92B 3ROOB 4IRJD 3P9WB 3MRCB 1X3DA 5DJYA 3MJ7B 4HIHA 4PRAA 4FTVB 5GSRA 2YD5A 1IFHL 5FDYA 1J10A 4ZD3L 5SWSD 4LLDB 4PY8J 4C83A 1L6ZA 43C9B 3UO1L 2EDTA 1C08B 4P9HH 4HUUA 1KJMA 1DUZA 2NY6D 3TNMB 4R0LA 2PXYA 5BO1H 4LQFL 5DO2C 3KDMB 4CN4A 2DJSA 1AQKH 1JZ6A 2CSPA 4OZHA 3QIBB 3WSQH 2E6QA 2P5EB 3PL6D 1F6AA 1UWGH 2XZAH 4YR6A 2NR6C 1QFUL 5EWIL 2DB8A 1A4JB 4GW5B 2DRUA 1AD9A 2GFBB 2NW2B 1SM3L 2F58L 3AFLA 4Y4HC 3BRGC 1TVBA 3JTSB 3FB8B 3V6BR 3HPJA 1IGYA 5I2IA 5I6XC 2C1OB 3MLVH 4LDLB 3G5ZB 4JY5L 2XTLA 3NOIA 5CGYC 1JWMB 4J6RH 5B39G 1UKQA 3PWPB 4I8DA 4R8WH 3C6LA 1G6RB 2HRLA 3LH2L 4Z8FL 3NIDF 4P5MB 4BQCA 2VUYA 4FXKB 3QPQD 3VJ6A 3VXQB 2PW2A 5DDHB 1I1FA 2AXJA 2W9DH 1QSFB 3O4LD 4QNPF 2NY4C 3GMPB 3RNKB 2JELL 3BP7A 4WFGE 2ZJSH 3WFEL 5JQ6L 4KI1A 3C5SA 5E5RB 5ETUB 5E6IC 4F7MA 3GB7A 4K3JL 1JRHL 2EDXA 2EDFA 3HG1A 1T5XB 1Q94A 1CK0L 2IF7A 3LKRA 4LARL 4HZLA 5ESVA 4I77L 4GW4B 3UMTA 2X1WL 4QOKE 4A6YB 3MRMA 1I7TB 3NFNA 3LKSB 3BPLC 4J8RB 4PP1D 2Z31A 3PV6A 4MJ4A 3VXTB 5EO9B 5LCVH 1BFVH 4X7SH 1HCVA 3K3QA 5DMGD 1C5CL 2FDBP 2X4QA 3QUZB 1YECH 4WW1B 2Q6WA 1WZMA 2DQGL 3MROA 4Y16A 4ZUUB 4EDXB 4GAGH 5CJ8A 1U8JA 1UWXH 3RDTC 1PG7L 1YYLH 2YD4A 4OD1H 3TCXA 1GXEA 4U1IA 1OAXL 2JJTC 3OHXA 5GS1B 4DN4H 1HXMB 1I3RA 4H0HB 1MFEH 4RNRB 1WWCA 3PABB 1PGRB 2R8SH 5F9DC 4Z7VA 3JWOC 5GS0H 1JWSB 4X6CE 3SKNB 4AG4H 1S5IL 1KLGA 3D85D 4JFOB 2KBGA 1TTGA 2DLFH 4P2RE 4KPHH 1T0NA 1LP9E 4S1RL 1JMZA 4GH7B 2Q86B 1OP3H 4HCRA 4JKMA 1F2XK 5BQ7B 4HIJA 1Q9OA 5C08D 5ITFA 5T3XD 1AQDA 4FQXB 5IKCB 3EYQC 1NCAL 1FO0A 4GW1A 1LEGB 1B6UA 4XI5C 1A3RH 2F19L 3CPLB 4K3EH 1NFDF 3OKKB 1TZGH 2EEDA 4TNWK 4F7CB 2NTSP 3MRBA 1QPXA 1U8QA 4F9PA 4OZGA 1FGNH 2VDPH 3QG6A 3GI8L 1RJYA 2AQ2A 1DBKL 4KKAC 3MJ9L 5AZEL 4XTRD 3GSNA 3QJFB 4DCQA 3O3BB 1HYRC 1PKQA 1F4HA 1NC2D 4F7PA 1J1XL 1ZHLA 1IGMH 4NSKA 4KJYA 1U8KA 1RURH 1IAOB 5C6PB 2KQMA 2DJUA 4XNYL 1G1CA 3QDJE 3MOAH 3WUZA 4YNYA 1AP2A 5DJ2A 4M6OH 3WKMH 2FR4A 3CH1A 2D9QB 4B0MM 2GTWB 2P49B 3RX5A 1BF2A 1U3HB 2R9HD 2ITDA 2WBJD 3BUYB 4I9WD 5EA0H 3QO0A 3PQYD 3SDAC 4CNIA 1B88A 3HE7A 3UZEA 3CVIH 4PRBA 5J9PB 4BH7B 4I0PB 2MQCA 1U93A 5D71H 3B2UC 1F5WA 2B2XH 2NY1C 4H26B 1WFOA 2ZCKH 3P77A 2ZUTA 5I66A 3VG9C 5BRZA 4PJBE 4FFYL 3RIFK 2VJXA 3L1OH 5HYJB 4XPHL 2OJZH 5CEZE 2V2TA 5F9OL 4PJHB 3QA3A 1ZKAA 4NNPH 4RGMC 4E5XB 2VN7A 4AIZA 2O5YH 3EYOB 3SGJA 3ZT6A 1JNNH 2BRQA 3FRPG 1N2RB 1VFOA 4IS6A 3KPRE 1CXFA 3GNML 4IMLA 1KNOB 2ATPB 3T08A 2NX5E 1QO3A 4GRLD 1DTUA 5JTWA 4U0QB 1NKOA 1DQLH 4QHNA 4ZQKB 4K3DH 4Y19D 1N59A 5EBWA 3TBVA 5CAYB 2IH3B 2RCSL 2FEEL 4JPVL 1ZA3A 4YDVA 3MBEA 4XC3L 5EU7C 4DKFH 1F90H 1IGFH 5HVGB 5EULV 3KXFD 3QI9B 3T04D 3ALWA 2IEPA 4UINL 3V79C 2VC2L 1JNHB 1FYTE 5EOTB 1PY4A 2ICWI 3TPUA 4IDJH 1AGBB 3RWFB 3TA3D 4MAYB 3BEWA 3EOTH 4HPYL 3BE1L 3HAEA 5I1AA 4KTDH 3WFHA 2BCKB 4ZUWB 2A6DB 4R2GB 1CFSA 2E9JA 2Q76B 2BOBA 4EQ3A 3KHOA 4FFWD 2X5PA 5KVDL 5D1ZC 4HKXA 2X40A 2FIRT 4QLRA 5HSFA 2GSGB 5GZNC 1RZKC 3PHSA 1CFBA 5C09D 3QQ9D 3QR2A 4R96A 3DX7B 4WDIB 5HYSA 1FFOA 4MAUH 2VL5B 2DIBA 4PJ8A 4LLYB 4U1GB 4D9RE 4GLRH 4WHTA 4JY4B 4ZTPL 3ZKND 2A6KB 3QB7C 1EA9C 4JFDE 4TPRL 4ZODA 4BZ2H 2UY6A 3AAZA 5D7JC 4WHDA 3MC0A 3VXRD 4KUCD 4APQC 1UJ3B 3X3FL 1MI5A 4UDTB 3MPCA 1IEBA 3IU4H 2C3HA 4YZFE 3CSBA 1GAFL 3BH8B 2BNQD 1IM9D 1OCWL 4ODHH 3L6FA 1C5DA 2P46B 4KY1H 1CWVA 4M5YL 5GGTL 4P4KA 1OAYL 3JXAA 3C60C 3X11A 3G04B 3ZTJH 3L3IB 2YEZB 3IDIB 3MV01 3S5LA 4NZUH 5FK9B 2IPKA 4NIKB 2EH8L 4MA3B 3KJ4B 4GG6A 1NLDL 3TYFA 4AEEA 1H9VA 2LFGA 1Z5LB 4NM4H 1GVIA 2EIDA 1NMAL 4ODWB 2ARJB 5T1KB 3MRQB 3O11B 4NDMA 5HJ3B 1EHNA 1SY6L 2YUZA 1YDPA 4XVSH 2IGFL 1XGUB 3THMH 2JCCF 5T1LD 3CMOL 1MJ8H 4HS8L 2PCPA 5DD1L 3H3BC 1E4KC 3SKMA 3ME0A 3QXVA 1P7QD 2WP3T 5D7KD 3STZA 5FUZL 3EHBC 2Q8AH 5IW6A 4LCWB 1LO4H 4BK4A 1U92A 4G8GE 3LIZH 4F9LA 3FB6A 4EVNA 5EU6E 1OVZA 1QFWH 4KRPB 3AS2A 4QY8B 1JZ2A 2JIXB 4HMCA 4PRIE 1OAZL 1VFMA 4O2EB 3NCFB 3RA7L 2E9IA 3UAJD 4LDOB 4KXZI 3ARFC 2YPLE 3QUXC 1X4XA 4GMSL 1S5HB 4Y2DD 3T2QA 1QSEB 4OZ4B 2IAMB 1KUMA 5EU5B 4G6MH 2HKFH 2FHBA 1XAUA 5CBEA 1HKLH 4JREB 4QRRA 3SY0A 3QJHA 3N1QC 3F7RA 3RZCA 2NYYD 4NCC2 5A43C 1OGAB 3I84A 3LMJH 1FN4B 4YH6A 4K55A 1BIIA 1XGQA 2Y5TB 2YRLA 3C5JA 5GJTL 4EUPG 3PIQB 1U0QA 1MFBL 3ZKMD 1PW3A 5DF0A 4QXGH 4HT1L 3W2DH 3EO0A 2JB6A 4TSAL 3V4PL 1J0JA 1VGEL 3PV7A 3P0GB 4HWNA 5L9DH 2X4OA 2ADJB 4UMGA 5IB2B 1CXEA 2P8LA 4WI4A 4LVNC 5TDPA 1AC0A 5LQBL 4NP4L 2FYYA 5A2KH 1T6VN 3D3VE 4FNLL 5ISZA 2OTWA 5DR5H 3O2WH 1QLEH 4OCSL 4XNQA 4JJ5A 4XBGA 5E4IA 2NY7H 4PJ5B 3OB0H 4OBSA 1ZTXH 5DJCB 3EUUA 3PGCA 3UTSD 2VXTL 1EHXA 1LDPL 4P2YA 2GTZB 5C0CE 1B2WH 4OFKA 5JMOC 1MCWW 5TDOA 2VZ3A 3PWLA 4JFEB 4OFDA 5D2NA 1INQB 2X89D 4Z7QF 1NGQH 1BJMA 1X44A 3QDMD 4GMTH 4PJGF 1ZHNB 4CU7A 3D39A 4Y2OA 3DO3A 4R90L 4IJ3C 1CLOL 3KGRA 4NKDA 2VDOH 3IDJB 3LD8C 4P9HL 3IAPA 4ORZC 3V0AC 4F8QA 1J05A 5BO1L 4ORGB 4JKWA 4L4VB 3VMNA 5MERA 3NN8A 2XY2A 1MF2H 2V2WA 4EDWH 1BEYL 4G5ZH 2B5IC 2R1WB 4WW2C 1E4XI 1XR8B 3IS1X 1YNKL 3FQXB 4OLEA 1DBBL 4JM2A 4OCRH 4UU9A 1NAKH 5JMRA 1JWUA 2IH1A 4UT9H 2OL3H 3EKCA 1YMMB 1HILA 3WN5C 2YOCA 5DTFB 4J6RL 1S7QA 4JY6A 4YHML 3W39A 5BW7C 5L7XH 2Q1EA 3VWKD 2XTJE 1KJ2H 5CIPB 1Z9SA 3FO0H 3E6HB 1TZHB 3RKPA 1N0XL 4UV4H 5E8DH 3EOYG 5CEYA 5SX4I 2DDQH 2D7OA 2EDWA 4HZAA 4YBQD 5SWZA 4AMKL 5FHBH 3GKWL 4MNQB 1RHFA 3IFLH 3UPRA 1LEIA 3CFKB 3R8QA 5E8EB 3GI9H 5JHDA 4J4PD 1QRKA 3IF1A 1QEWA 3RGVA 2LQRA 3DXAB 4CW1B 4WFFD 1XF5B 1JPTL 3MRIA 1TVDA 2EDJA 4JAMB 2DWEB 3SDAB 2FATH 3GMQA 2JLLA 4X6DA 4KU1A 1XF3A 3U0TB 5ACZB 1YPZB 4K7FB 4XAWH 1UM6H 3PXHA 3P9LA 3TO2B 2H3NA 1BFVL 1YEJH 3LZFH 4OF8A 3VFPA 3WIHH 3LKNB 1T4KB 2Z8WC 3AB0C 3S3PA 2A0LD 2FNBA 4X7TA 3QQ4A 2FSEA 1YYLL 1CF8L 1MAJA 1P4BH 3KLHD 4HIIB 2XN9E 4UBDD 1EEQA 3PF2A 3QUYA 1I8LA 1D5IH 5DLMH 4K2UH 1U42A 4C56B 2VDQH 1OQOA 3MJ8B 5HDBF 4XWOD 4L3EA 3WHXA 5IR1A 3RJQB 5GS0L 3NH7H 3FN0H 4J3WA 3S35L 2V17L 3U4EB 1QKZH 1KB5H 2KZWA 3EJYD 4S2SA 4R26L 4TUJB 3A67L 3PDDA 1QA9A 2DLFL 2R0KH 4FTVD 3Q5YA 3UYRH 4O4YH 4NYLA 3FFCE 4WEBL 5CWSA 1I4FA 4KHTH 2QADC 4XPAL 3B5GA 3DMMC 1U8MB 2P8MB 5J89A 2UWEF 3HNVL 3GJEA 4Z78A 1XIWD 3PWVA 4CU8A 3WS6A 1CD0A 3SGDI 3EO9H 2ADFH 1ZHKB 1AXTL 4K3EL 4RMVA 1TZGL 3QIBD 1DLFL 4CADB 3PWJB 3QUMH 3VE0B 4NZRL 5HGDA 4XCNB 1YQ2A 3QUKB 3V6OA 5HGAA 5CILL 2GY7B 2B1HH 2PO6C 3IDGB 3VXUB 1P5VA 2KH2B 1IAIH 2OCFD 3ZDYF 3MV8A 5B4MC 1CFNB 2VLRD 2IQ9L 4N0FB 5KOMC 4ODUB 2Z8SA 3OGCB 5F7NC 1SQ2N 1W0VB 2VLKE 3TN0C 4HJ0D 4GAYB 1JRHI 3M07A 3OAYK 3PWPD 4XVJH 3C09C 3FL7A 3MOAL 4G9DB 5IIEB 3EYSH 3MGTA 4M6OL 3WKML 5KSAD 2R4SH 4NO2B 1BAFL 3EOAB 3AREB 3O6FA 4NHCH 4BSWB 1SYSA 3RL2A 4N8PA 2M2DA 1QSFD 2YUXA 3KPSE 5E8OB 4WW2F 1J8HA 3CVIL 4G3YL 5HY9A 2HFEA 3IETA 1X7QA 4F33B 5J13B 4FQHA 2OSLA 1VSCA 4HX1B 1NGPH 1IAMA 3I6LE 4Z0XA 5E70A 1ZA6A 3MRHA 5LG1A 2VKWA 1MCPH 2XOTA 5D96C 4K8RL 1R5VB 1LO5A 3L1OL 5GGRA 3SE9H 5FB8A 1MFDL 4H1LG 4PJ9C 2O5XL 2ZCHL 1UCTA 5TPWL 2GJ6B 3DVGB 4OCYH 3I50H 1PLGL 5I76A 3QEUB 4NNPL 4JN2B 5DUPH 4NNYA 2XQYK 4OBRA 3QUZD 4RISL 3BWUC 3FAXA 5HHOD 2E27H 4AH2A 4NUGH 4KDTA 2A2QT 1OQXA 4HBQA 4NBZB 4LPYA 4ZPVB 3LRSB 1Q9LB 1N3NB 4MJID 5K93A 5HPMA 4M48L 3G6JE 4JZNB 1NBZB 2VL4A 4CJ0A 3P4NB 4PJDA 3H8NA 1EO5A 2ESVE 3HCVB 4Z0BL 1D5MB 4K3DL 4KMTL 3KS0H 1T1WA 5D9SB 5IFAL 3STLA 2I60H 4MNGE 3H42H 3BH9B 5I1CL 1T21A 1OM3L 2GY5A 5CZKA 4HGWB 3E6FA 2ZUQC 1HIML 1RJZB 5FM8A 5CJBA 3ZYJA 1FFPA 1N0LA 4XXCC 4IDJL 5H2BA 1R5WA 1HDMB 4YHPA 4QF1A 2BVPB 2GEEA 5ANMB 3UJIL 1KB9J 4CVXB 5C08E 2OI9C 2A1WH 2DWDB 3QAZB 5T3XE 4FQXD 2J5LC 3SPVA 4LAQH 2J8UA 3AS1A 4OAWA 5DSCB 3MNVA 4N0UE 4NQSA 5K9OA 1JV5B 4NQXB 1BJ1H 3S4SG 2ED8A 4D8PB 4KKCC 4QHUA 4M7KL 3LKQB 1CXKA 2VDRH 1E0OB 2QTEA 3MV7B 4FQ2L 5I9QC 2K9UA 1QTYT 5TE4H 4RX4A 2VNCA 1DEDA 4QXTB 1DSFL 2XWJA 1G7HB 1DBMH 3HPLA 3IB4A 1DE4B 4BZ2L 4G9FA 3QCVL 5DD3H 4YC2B 4G8EB 4HH9B 1AO7B 5D72H 3FQUB 5DYOB 4BSVB 2Y36H 2BVOB 1YEEL 3NGBB 1GCFA 2XY1A 1BPVA 3I3DA 3UROR 5GGQH 4OZIE 4FABH 1A7NL 1CE6B 4O51B 3R4DA 4HJGA 5DEGB 4ZUTA 4LVHC 1JGLL 3L7FA 2QR0A 5GQBA 5C7XL 4JFQA 3G5YB 4OQTH 3BXNB 4I0PD 5C0DA 5DT1L 4NM4L 1GGIH 4JB9L 1I1AC 5KS9E 1I8MB 4X4YA 5L88H 3CUPA 1X5KA 1NGWB 5IFJB 4PJIA 2YD6A 4KQ3L 1BP3B 2EICA 3QEQA 4G80A 4UILH 4WWKA 5HYJD 1QLFB 4JRYB 2AI0H 5HHXH 5CEZL 2MQ0A 4M7LT 1D3CA 4XNZC 2IPTL 2FEEI 4XCFH 3OAUH 3FRPA 4ZFGH 3P0YH 1W72H 5HI3D 1GGCH 4OZHE 1IC5H 1LO4L 4PRHA 1I9IH 3FO2B 1M7IB 4N68A 4V1DB 1MCSA 4NM8L 2CO7B 2YN3A 1HINH 4LRNL 4CBPA 4AJ0A 1Y0LA 1XF2B 3L5IA 1T2QH 3GBNH 4MVBC 3HR5B 3B9DA 3GM0A 3NABH 5SX5K 4HK3N 1MIMH 4YQXH 1B0RA 1C12A 5I30H 2OMNA 1VFAA 4TSBL 4PG2C 1CL7H 2HFTA 4ERSL 3KXFE 3QI9D 1CLCA 4BKLA 1BZ9B 1OAQH 3Q6FB 3BZDA 1FC1A 5J1AB 3DECA 4MAYD 1K3ZA 4QGTA 3V4UH 3UTTB 3KYAA 4ODSL 4FXLA 4K94H 2CK0H 2J88H 5T3XH 3VWJD 3KJ6H 4JFYA 4L8CB 3OKMB 1ITCA 2W60B 2PKDA 1BVZA 1FV1B 1P53A 1LMKA 1RZFH 2BVQB 1PZ5A 3S96B 3TCLB 3CC5B 5DEFB 1I7RB 2BXYA 4YHOL 3OXRA 3EFDL 1CD1A 1MHPL 3BQUA 1MVFA 1A1MB 4EIGB 3BGMB 5I1DB 3G5XA 2W59A 4Y1AB 1JZ3A 5B8CA 1K6QL 1TITA 3QIWA 1ZTXL 5I18L 2PYED 5TGBA 2F54D 3SDCB 2H2SD 4UTAH 2D0HA 3MV9A 1XGPB 1H8SA 2P47B 3RPIB 3VXRE 2DTMH 4TUKL 4D0DB 4FA8A 1S9YA 5C0BA 5AD0B 2WV3A 3BW9A 2A77H 4MDJA 3ZKXB 2EC9U 3AUVA 1ZWIA 4XCEB 1RVFH 2CRYA 3O41B 2APXA 3C9NB 4L1HA 1ORQB 2BNQE 3UTZB 1A1NB 1J1PL 4QYOB 5DQJA 3ZDXF 5F7LB 5C92A 1J1OH 2XWBB 3MXVL 2VDOL 5E24E 2NY5H 2VMFA 4JCLA 4NC2B 3ZL4H 4UDUB 5T33H 1KPUB 5T1KD 1KCUL 2AW2A 1V05A 2P48B 1AKJB 1HQRA 3BP4B 2YC1A 4N0CD 2F5AH 4TOYH 2BC4A 4Q2ZA 1AHWA 3OKLA 4DZ8B 5GGSA 3GGWA 3OJ2C 3OBAA 3SQBA 4QTHB 4ZMAT 5JA8B 1GYAA 1TPXC 1YQVL 3BEVB 4GS7C 5KTEH 5EBLB 2A74A 3VCLA 4N1EA 4Z7UF 5ILTL 3H3KA 4PGBB 4UT9L 1YY8A 1A6TB 4LCWD 5J1SC 1S7RA 5MI0C 4M6AA 3B8YA 3MRPB 1I9JH 1AY1L 5B38B 2BHZA 4KRPD 3SE4A 2JIXD 1OGTB 3QNXA 1RZGB 2I24N 3QHZL 4OLYL 4KWUA 5D5ME 3OG6B 5EU3B 1QSED 3W81A 2IAMD 32C2A 1PKQE 3O8XB 4YXKH 1N7MH 3DETD 3DSNA 4P5KA 3TV3L 4P9HC 3CDGA 2O61A 1HEZB 4EUPA 3KPQB 1MJUH 1YY9D 3B9EA 1ZOXA 1KG0B 4QHMB 4OF6A 1VPOH 4QGYA 2C7UB 3CSYA 4OCXH 1DVFC 1JHKL 2H9GA 2FATL 4NKMB 3T0EB 1G6VK 4LPUA 4PJAA 5CD5D 2CIIA 3EYUH 3NPSB 1UM6L 2EH7L 4LLUB 3RI5K 1K4CB 1G9EA 4KH2A 3LZFL 5SV3A 2HFGL 3E8UL 5K59F 5C0JA 3EIFA 1IC4L 2R69L 5DQ9A 3HS0B 4M9OA 3ARGB 2F74A 5DI8A 1D5XB 1RHHB 3NA9L 2VZTA 4JHWH 4QHKI 1C16A 5D7IF 3V6FB 4X98A 3KWWA 4PJ5D 2R2EA 2DQCH 1P4BL 1HSBA 3T3ME 3LKOA 4Q6IB 4XNMB 1R24B 3UTSE 4WU7A 4P99A 1D5IL 2DD8H 3ET9F 2NXYB 2WZPD 4Q9QH 1NCBL 4OLUH 5D2LB 3QDGB 4F9PC 1G7JA 4O02L 4NO0B 3SDDB 4PY8I 4LCYA 4JFED 5AYQA 2FJFB 1IEAB 1MCIA 1KB5L 2OM5A 4JFPA 1DQJA 3C5ZA 1ZGLB 2NY2C 1I7ZB 5BV7H 3IXTA 3RWDB 4O4YL 2NW3B 4YLQT 2HH0L 3BKJL 2VDNL 3PJSB 1JZ4A 4XRCB 3U30C 2W0FA 5FO8A 3MRRB 5FXCH 3LQMA 5BMFL 4JFHD 4W6YB 1OAUL 2CPCA 3EO9L 1C5BH 4C54A 1OT1A 5HDLA 1WEJL 4L4VD 3IJYA 5DC9B 3GMRB 4KI5F 3HE7C 1JF5A 4RIRB 25C8H 4X8JA 4HCRH 4MB4A 4QT5B 1Y18A 3ILPB 3GEWB 5E6ZA 4OV6F 1A6VL 4M6MH 1LE5B 1MIEH 4K71C 2B1HL 4JN1H 4ZUSA 3MLTB 5IOPA 2Y06H 4KRLB 4XMLL 3H9SA 1HOCB 3WS3A 2OK0H 3DRTB 4DGVH 5GS2D 1NCUA 1UM5H 5T1MB 1XGYH 4U6VH 5L2KA 4Q6YA 4M6NL 1YNTA 4PGCB 1P7HL 3NTCH 2QQKH 4XPFH 3JVGC 3SDXB 3OR7B 2EDKA 4U31A 2IPUG 4NBYB 1NGYB 1A9BA 4LHUA 5CP7A 4HBCH 1RK0B 4GRMA 2DM7A 4MNQD 2BSRB 5CEXA 1R3IH 4YHNA 1MI5E 4OT1L 1RZJH 2IFFH 3VG0L 3QFDA 1I85C 5C8JB 3UBXI 2AK1L 2ZNWA 2Y23A 3HB3D 2H6PB 5FEBA 3DXAD 3EYVB 2QKIA 3QHFL 4LK4A 3S3JA 2VR9A 3ISWA 4NN7C 1NGPL 4FP8H 1HWGB 1JVKA 3ULVD 1QR4A 4PRDB 1MCNA 5DHYB 1HCFX 4Z7WF 1DL7H 5DFTA 4BFEA 3VD5A 3SE9L 1BWWA 3RRQA 3HE6A 4OF5A 3RVUD 5IFHL 4ELMA 2YHGA 4W81A 1L0YA 4OCYL 1ULVA 1ADQL 2VISA 1OY3B 4NC1C 1YN6B 4BH8A 1KTKE 1TQBB 1G7LB 3AU1A 4NZDA 3I6GB 4NUGL 1BBJA 3CFBB 3EJJX 1KJVA 5JNYB 2R23A 4BFIB 4ZAKC 1T0PB 4LPCA 2N1KA 4J2XA 3VDCA 3QBTB 4DWHA 4ZPTB 4Z95H 5IB1A 5BVPL 4XNZB 4HWBA 1NCNA 3SHSA 5EFIB 2V2XA 5JDSB 5IMKA 2X4TA 4U7MA 1T1YB 1BECA 1D5ZA 3EO1B 1HQ4A 4C56D 4LSPH 2UVFA 1UFUA 3RUGB 2VE6B 4ENED 2I60L 3ARVA 4PJXA 2BNRB 3TC9A 4Z76B 2ARJQ 4DVBB 2X4SB 3ARDC 1LO2L 4HKJA 2BNUA 4HKBB 1OOAA 3NIFF 4X5WB 3QXTA 3BWAB 1U2HA 2QQQA 3JV6A 3LHPH 4CDGC 1MOEA 2ZOKA 3VGHA 4K8RC 3DURB 3HRZA 4HS3B 4WV1B 4AT6A 2RIKA 4EN3D 3V4VL 2AJZB 4JO3L 2VABB 4WNQA 5CZVH 4LAQL 3FFDB 4LU5H 4RGNB 1OTUD 4NFCA 1PY9A 4MXQD 5KANI 2FGWL 1UGNA 2YR3A 5IEHB 1RUMH 4NRXB 2IANB 3VMPA 2V7NA 3HAEH 3GSOA 1FYHB 2BSSA 4JQXC 4XT1C 3X14B 4MQ7A 4S11A 1RUAL 5IHZB 3GSQA 2VITB 4OLVH 3VXUD 4I4WB 5GRXG 3CDYA 3Q3GA 2VLRE 1U3ZA 3MLWH 4PJCB 3UTQB 1K5NA 4OM0L 1LK2A 2XXMB 3MCKA 4U6HB 5F89B 4OI9A 5B22A 5IBLD 5ISZE 1URLA 2KDGA 1EMTL 3QH3A 3AY4A 4CRPA 3X3GL 1UENA 3IKCB 3ARRA 4FABL 3W5MA 3ARED 5DVNA 1NGZA 4ZFOA 4YXLH 4OF0A 1KTDA 4YHIB 4F9LC 4OGYL 1LILA 4P57A 2MTPA 5HDOA 4YBHA 5JUEH 3WD5L 2CUHA 5EZLB 1FNFA 4F7TB 3A6OA 2IQAB 1A4KB 2XZQL 5J6GA 4FMKA 2PW1B 3Q2CA 3PP3K 2HVJB 4XVTH 1U6AH 5F3HA 3D39E 4UIKH 4NQEB 1BREA 4Y4KA 2IADB 1K4DB 4HD9A 5HHXL 3IFPA 4JANA 4Z77B 5KVEH 1FIGH 1N64H 3OB8A 4BM7A 1D9KB 4XCFL 4XCYB 2D4FA 5FOBA 3R1GH 2GJ6D 4ZFGL 1YJDL 1WF5A 1QYGH 2BRRL 2UV3A 5HHOE 1ZANH 3K80A 3QZWB 4YE4H 5EIQA 4X5XA 4MLSA 4LBEB 1RZIA 1VA9A 3GMLB 4WI7A 1UCBH 4MJIE 1FZOA 2Y6SD 3L5XH 1H5BB 3L9RB 5KW9H 5C9JA 3D25A 1WGOA 3QFJA 1GJIA 3CXHJ 2EECA 2KQNA 2HJLA 3U0PB 1FORH 3HUJA 3VXSD 4K7PH 4WEUD 3NABL 3RZWA 3TNNB 5JOEA 1FVDB 3MLSH 4NNXA 1MIML 1S9VB 4WWID 2G9HB 1NANI 1T3FA 3IDYB 4B41A 4KTYA 4LSVH 1OAQL 2W91A 3QWQB 1PQZA 4UIMB 3SCMB 2KUTA 2E3VA 1CZ8H 2MHAA 1MCOH 5F3BB 3V4UL 3K8MA 4RDQF 2WUCL 3TBWA 2CK0L 3LN9A 4PY7A 5T3XL 1A7RL 2NXZB 1BX2A 1N5AA 5I15L 2WUBL 1S8DA 3S4SA 5IROC 2D31B 3BHBB 5DRNB 5J0BA 2E7LA 4YK4B 5JHDE 4GUPA 4R7DB 1QRND 2ZKHL 1YA5A 1EIBA 4PTUB 3WE6B 2ENSA 4JO4H 4GBXA 4RAHA 5I8OH 3MV7D 4X6DE 1SEBB 1V3LA 3SE3C 1G0DA 1SEQH 2VXSH 3VFTB 2FO4A 1E4WH 4P59L 4MA8H 1MPAH 3T1FB 3MRJA 4LCIL 4XAKD 1JHTB 3AM8C 5C9KA 2DTML 1JF1A 3MRDA 4RCAA 1M4KA 3OF6A 1E6OL 5IVXE 2A77L 2VSDA 4ONHB 4PJEE 2G60H 3SOBL 5K9QI 2YD7A 4WU5A 4ODXA 3FOMA 4X0KB 4JHAH 3TO4A 3PP4H 4FQ1H 2YMXH 3DOSA 3RTQC 3RP1A 1V7ML 1FHGA 1NCWH 5FIEA 3F7YA 1UJTA 1KEMH 4JG1H 3VI3E 4O2FA 2AXGB 4L3EE 3UJTL 5EIIA 3KVQA 3ZSTA 5JR1L 4KC3B 4RAVA 4LSQL 4L3CA 5HHMB 3RPKA 4JRYD 4E41A 3TIDB 2Z92A 3ROOA 2OR7A 4NQVB 1AGFB 1LP9F 1T1XA 4BSJA 2PTTB 1JPST 3H0TB 2HTLD 1ORSB 5DQDL 4V1DD 2NNAA 1C08A 3QWRA 1I9JL 1VACB 4G6AD 1U3YA 3TNMA 3CDCA 3C2SA 3V6OE 2IBGA 5IBUG 3KDMA 2IG2H 4KTEH 2P5EA 2O5ZL 3PHOB 4XMPH 4W4NA 2FJGB 4U1MA 3ARBA 1Z9OA 1L4IA 4L1DA 3N1FC 4KAQL 1LEKA 1ZT1B 4PV8A 5DZOA 3AXLB 1JGVH 2NW2A 4YO0B 5H94A 3O3DA 2XV6B 4N1HB 3JTSA 3FB8A 3WNKA 3BO8A 5GSVA 1GGBL 5EO1A 1PZUB 5F9AC 1CGVA 1DP0A 3OZ9H 3QQ3A 1SBSL 4LCUA 4OCXL 4F3FA 1S3KL 3O9WD 2I25N 2EIZA 1FVCA 2EXYD 1EO7A 4ETQA 3BJLA 2DAVA 4NJ9L 4NN6B 3P73A 3ZYZA 1H3VA 1C1EH 5D8JH 4B53A 1S7SA 4L9LA 1BFTA 4P23A 1I8KB 3VXQA 5DDHA 3MRLB 2EDBA 4LP4A 1IQDB 1T0MA 1N6UA 3VXNB 1EHLL 1WSST 1NDMB 3S88L 4Y1AD 5IBTH 5C0GA 4J1UB 5ETUA 3VFWA 3FTGB 1F3DH 4MXWL 2PYEE 3CFEB 3SDCD 2F54E 1AJ7L 4N9OB 3WLWD 3OAYH 4HIXL 1T5XA 4Q9QL 4RFNC 5JW3H 1EJOH 4OLUL 3W11C 3CXDH 3LQZB 3DGGB 3HZYB 2GCYA 3OPZH 3TZVC 1MHEB 3VXMA 4MZ2A 1OPGH 3X12A 5ALCH 3T65B 2DYPA 2YPKB 3GMMB 1HYSC 3DROA 5BV7L 2RFXA 2HMIC 4ZDHB 4PJDE 5DK0A 2D7NA 5E6YA 4F7EB 2XWTB 4EDXA 4I18C 2CXKA 4NRZB 1ZT7A 2DN7A 2AABL 4BZ1H 5KBNC 3O6FC 1X5JA 1G7MA 5EUOF 5FO9B 4RWYL 1AKJD 1AXSA 4PV9A 1GHFL 2BP3A 4QOKB 4D9QD 3PABA 1Y6KR 2QSQA 5CJXC 4U1JA 2VDLH 3LDBB 3FQWB 4N0RA 5I71B 1MIEL 2DQHL 4G7VH 3WFZA 2G2RB 2ZUXA 1WLHA 2J8UE 5CFHA 4WUUA 2Q86A 3MR9B 7FABL 5I73C 4ODVH 3KYMA 1WT5A 2OK0L 3BOVA 4K7PY 3HI1B 1S9WB 2FEDD 4OIAA 1UM5L 1XGYL 2P43B 4U6VL 3FB7B 1CR9H 5IKCA 2IBZY 3NCEB 1T04B 3PDOB 4K7PX 5D93C 5IF0B 3MFFA 2GUOA 1BHGA 2ZG3A 1K2DA 4G9FE 4X6CB 3QRGH 3O8XD 5DRXB 4CAGA 2IBZX 4RFOH 4EQ2A 1EFXA 1NC4A 5ACLA 1P69B 3TVMA 1FNEB 4EI5A 2RB8A 5IT2L 4P2RB 4NCC1 4UQ3B 3BPNC 1QHOA 1IM3A 5SV4A 3WDJA 5HI5C 3QJFA 2WMPA 4LEOB 1HHIA 5KG9B 3MLXH 4FP8L 5BOZG 4IOFD 5IJKC 4YZFF 1S7UB 4I48B 3T3PE 5HDQL 5I75C 4IRSB 4WGWB 3BPOB 4KZEH 3O0RL 3S3SA 1JCKA 4KFZC 2BVTA 3CLFH 4TTDC 3QCUH 3BDYL 1U3HA 5F96H 4FMFA 1HH6B 4JZJB 3AC0A 3ARGD 3QO1B 5F7DB 2PTVA 5IB3B 3QEQE 4NKQB 4OFIA 5F7HA 3PWUA 2AJSL 3SBWC 3BVNB 1FAIH 1NMCC 3E2HB 1UEMA 4XBEH 2MSPA 4CN6A 2NXYD 3DBXB 2X1OA 3QDJB 5GGVL 5TE7H 4PLOB 3WXVH 3BRDA 5IQ9A 1T83A 4NO0D 3SDDD 4S1DD 3S36H 4JFEE 3CH8A 2MCG1 4PRHE 4J12A 3NIGF 1A7PL 1WBZA 1A7BA 4GT7A 4MNHA 3ZYIA 5MENE 1G0YR 4UAOB 1MWAL 3TLRA 2QEJA 3BPCB 4LRIC 4N0YL 4D9LL 2QQLH 4WTWA 5ICXA 3K1DA 4H0IA 5CCKL 3NACH 2JE8A 2DQEH 3SKJH 1IBGL 4IRZH 1QG3A 4JFHE 4ZQKA 4DAGH 4ZO8A 4P2OB 2YPVL 1U58A 4HF5L 4PJBB 1UACH 5TH2A 5IMOB 2C3GA 3MLZH 5ESAA 3TF7C 1S7WA 1F8TH 1IT9L 3HFMH 1FJ1B 3QXDB 3RVXC 4P46B 3A6CH 1P1ZB 5EOTA 1VENA 1MRFH 3KPTA 2VH5H 4I1NB 4BA8A 3L3KB 4Y5YB 4QRPD 4Z7NF 4WWKC 4OJFH 4H25B 3NAAH 2NX5B 1H3WM 2R1YA 4DVRH 4CUCA 4XB7A 1A5FL 1R3JA 2F8VA 1S7TA 4N90E 5HD8D 5SX5H 3RU8L 5E1AB 4O5LH 5IHBA 3WFBH 3U0WH 3VFGL 3DX7A 4PUBH 4FZEH 4DTGH 1D5BB 1CG9A 1RMFL 3HNSH 2Z91B 4LLYA 1MNUL 2Z93A 4P48A 2NY6C 1UQSB 3MGOB 5D6CB 4I2XA 5JUEL 5LBSH 2KPNA 1T03L 4WTXA 1QP1A 1YNLL 1KENL 3PL6C 3CVHA 4LCCB 5EBMB 4EEEA 3ULVE 4NKOB 5JO5B 3MBXL 1J0YA 3ZZ1A 1KXQE 3SJVA 1INEL 1BVKB 1TQCC 3N1GC 2EYTA 4X7CC 1BIHA 2JB5L 1NCCH 3L3IA 2YEZA 2CDGB 3WJJC 2VXQH 2PYFB 1L6XA 3U9PL 2GSIB 2G75B 4OGAD 2XA8H 1UCBL 4JFDB 2EO9A 1Z5LA 1WUNT 4OV5B 4W4OC 4HH8A 4RMRA 4MD4B 3L5XL 4NGHL 4ODWA 2ARJA 1CLYH 5F1IA 2NZ9D 3K8LA 3QPQC 5I17B 3MRQA 3O11A 3BP5A 1NFIB 2D7TL 1RUPL 3F6IA 1S7XA 3B6SB 1XGUA 3QXAB 3D2UD 1I9RH 2K7PA 5CJ5A 2JF1A 4WJ5B 1VADB 3ARXA 2BNRD 3MLSL 3NMEA 3RHWF 1TZIB 3QG7L 2CUIA 4L5FH 4XPGH 4FFVD 3QIUB 5GRVK 3MNWB 5D1XB 3INUH 1CZ8L 4LGPB 5IK3B 4PJ7F 3N85L 4I13B 4G7YL 3B9VA 4Y4HA 4MXVE 4PP1C 4QY8A 2HJFA 3RKDD 4JDZB 5DMGC 1YJDC 3LY6A 4RGND 3G5VB 5B38G 4RZCA 1MRDL 2JTDA 4ZNEA 1ND0B 4PGDB 4UT7L 2VQ1B 4UB0H 2AEQH 2OMBA 3ZE1F 1OF2B 2XZZA 5I8OL 2AK4D 4OIBA 1YEDA 3HMXL 1SEQL 2VXSL 4OFYD 1DDHA 4X99A 5JXAL 4PJAE 1OGAA 4JM4L 2C4FT 4MA8L 3H9ZA 4G8GB 3EDJA 3U1SH 5FUOH 1F58L 2F53A 3HC3H 5EU6B 4G8IA 4HUWA 4PRIB 4P4RB 4P5TB 1G6RL 1W2KT 1WBYB 1KJ2B 5JLZB 2YPLB 4F58H 5E6IA 1YEFL 5DMKB 1HHKA 4LNRB 4QRQB 2A6IA 3OKOA 4XCCH 2C9AA 2VXVH 1PEZA 2ADJA 4FQLH 4O9HL 4FQ1L 3T4AA 4RAUB 4XP1L 1MQKL 4PRPD 2VDML 1NCWL 1Z0MA 1RIVH 1KIPA 4C4KO 3CU7A 3JV4A 4LQ1A 4DGIL 2R29H 3REVB 4PJ5A 1WAAF 1AIFB 4PJIF 4LMQE 4AZ8A 1NGXB 2NMSA 3T0AA 2H2PD 4UOW1 2DOCA 3ULVH 4D94A 1JFQH 1CDUA 4NQED 4OI8A 4YIQB 1BLNB 3RDTA 4DKEH 1NLBL 5INDA 3GSVB 2JJTA 2YD3A 1MFCH 3M8OH 2ICWJ 4XTRC 2NQCA 1JPGB 1AGDB 4JFXB 4KZDH 4ACPA 2X10A 5BS0D 4GQPH 1FLTX 3T77A 2O26U 1YMHA 1HZHH 3KYNA 5LGHH 3MMEA 1S78D 1AXIB 2EYSB 3V7MA 2BOCB 1T2XA 2N7BA 4L8SB 4N8CH 1UWXK 5AYUL 1TVHA 2R9HC 1S9KC 5C0CB 3S36X 4ORGA 1FZJB 5JORA 1AC6A 3H9SE 1U95B 5I1JL 3VXSE 1ZLWK 5AEAA 2N7AA 4M7JH 1XR8A 2ADIA 1KB5B 2DQUH 4GRWE 4XBPB 5L2KE 4ONFH 4UUJA 3FQXA 2WM0A 5DUMH 3SCMD 2X41A 5I1GL 3OXSB 1GIGL 1YMMA 3H6JA 1XH3B 5DRWB 2NXZD 5AZ2H 2C3XA 5KVGL 4WO4D 4EUPH 5L8JB 3E6HA 4WUKH 5D8JL 5C0NC 1ZLSL 1RULH 4MA1C 1P4IH 3QUMB 1QRNE 1QPPA 2F5BH 2JCCA 4ZUVA 4GRLC 4HWUA 4LLVA 5E8EA 2YBRB 5B3NA 1WZLA 4NQCA 2FBJH 4CW1A 3H9YA 3H3PH 4R7NA 5D1QB 5E7BA 4ELME 4JAMA 2C1PA 4AIXA 3SDAA 4P9ML 1CGYA 4XPTH 5ACZA 1FIEA 3U0TA 1QFPA 2XZCH 3T0VA 1SJHB 2XTJB 2I9TB 3CXDL 3FT2A 1MCHA 4AEHL 3OJDB 3SKUD 1C7SA 1KCSH 1U9KA 4ELKB 3MREB 1E27B 3BT2H 3VFMB 1GZPA 4Y5XB 1J0HA 1NMCB 2XI9A 3GMOB 5TF0A 3TA3C 3IGAB 4L29A 3RY6C 5HYIA 1RIUH 1TCMA 3RL1B 1FG2B 2L4OA 1FL5A 2ICWA 5E00A 4XP4L 2V7HB 1IL1A 3U6RA 2VZUA 4FFWC 1TETH 1A3LL 2FJHB 4NQDA 2HJKB 4BZ1L 5FV1L 1K8IB 3QQ9C 1DQDL 1OD9A 5DO2D 1F42A 2HWZH 1ED3B 2EE6A 5IHUH 5KN5B 3JZ7A 5DMJB 4HKZB 1X9QA 5JIPA 1WFUA 1YEGH 5C6TH 2BDNL 4KHXH 4MD0B 2X44D 2BMKB 4YDIL 4TUJA 3EFFA 4G7VL 3TIEA 5AWNL 1X6LA 5KVFH 1A64A 1FNGA 4PRNB 5EC1B 3D18A 2WIIB 4R9HA 3HC0B 2AKRB 1RFDH 2XN9B 2J6EA 2QSCH 2VLJA 2YWYA 1VDGA 1UWEH 3IDXL 5HYQB 4P3DB 2LAGB 3EZJB 1ZS8B 3DTXB 4N9GB 1M7DA 1PKOA 3VE0A 4FQPA 3VI4E 4RFOL 3P4OB 4IRJB 3C8KB 4GRWH 4WFEE 5T3ZE 5D1ZA 3DRQA 3IDGA 3FFCB 4YDJA 4L4TA 4PJGA 1CFNA 2DQTL 4OSUH 5I16A 3DX6B 2D9CA 1DUYB 3QNZA 5DJAB 2APWA 1JK8A 4MLIA 4JJHA 2M1KA 3Q1SH 1NQBA 5IIEA 4KZEL 5D7JA 1U8PA 4BSWA 4O58L 4APQA 5T1DL 1WIUA 5HVHB 1GC1L 2NTFB 2ZSVB 4LSUL 1OAKL 4N5UA 3MGAA 3L3GB 3RY4A 5FDWB 3GO1H 3UAJC 1EUUA 1FNSH 4Y4FB 4Y2DC 1WCBB 3C60A 4XP9H 2VLKB 4XBEL 2VZSA 5IHLB 3JTTA 2V9QA 3F58L 4RA3A 1KBGH 5DMYA 3DARA 5TE7L 1HHHB 3AVEA 4PS4H 3P30L 3S9DB 1BQHB 2NYYC 5DZLA 5L6YH 3OKNA 2AJXH 2D7PA 4HWBH 5A16B 3O81A 1VGKB 1DN0B 5FO7A 4OB5H 5J6HB 3BSZH 5MP6L 3GJFA 4NO3B 4ZXBB 1KN4L 3KPSB 2Y1VA 3RY5A 1OTTD 4HULB 4H5SB 4Q97A 1W0YT 2X2YA 1BM3L 4WHYH 1N3NA 1T20A 1CDHA 1E4KA 3TPKA 5IMMA 2QQNL 3C08H 4HS6B 3GIZH 3PP3H 3MLYL 4HQQL 4KVCH 3SKJL 3O6ML 2FH8A 4IRZL 3TBYB 3MLRH 3EYQD 5C0RH 4LL9A 4XI5D 1L7TH 4LSRL 4IHOA 1JIBA 3IJHB 4QOKD 3VFUB 5DUBB 3C8DA 5GGSY 1IARB 3BH9A 5HGHB 4WI5A 4X5LA 3LSOB 5J12B 2OLDA 1AGEB 5A2IH 4NWUH 2W1NA 2X42A 4PBWD 1KLUB 3ARFA 4P3WA 1DQML 1W72B 4AEIH 1IGJB 1MRFL 4A2MA 5DK3A 3S37X 5D4QA 2D0GA 4OJFL 3G6JB 3UTOA 4J3VA 4ZOAA 3UZVB 2ESVB 3CLEH 1RY7B 1LO3H 3NZ8B 3CK0L 4QTIL 3MA7A 5B3JF 4MNGB 4X7FC 3DVNB 15C8L 5A1AA 3D0VB 3D85B 3NFSH 5T3ZH 5DS8B 5I1LB 4N5ED 3IDNB 3B9KB 3GIVA 1G7HA 4YUEL 2EKSA 4KUCF 3TFKD 2OZ4L 3RIAF 4KUZH 4LFHG 1FAKT 4HH9A 1AO7A 5JW4M 5ERWB 3O4OB 5C08B 2P24A 4O00A 1IGCH 2XKSA 1T7VA 4BSVA 3IRZA 5JW4Q 4YJZL 4IRSD 5M95B 3O45A 2UWEA 4N0UB 3KLAA 4WIQA 3BAEH 3KPLA 4YPGB 1CE6A 2P4AB 5I8CB 4LLMA 1E6JL 5IM7A 1RV6X 5EPMB 1L9NA 1LO0H 4PLKD 1A7OL 3G5YA 1V3JA 1I3VA 4JZOB 3PNWA 3VWKC 5KAQF 1XT5A 3BZ4B 2EC9T 2XA8L 1XR9A 2C3VB 4E41E 5HHQA 1CU4L 1I8MA 1NC2B 4G43A 1P4LB 4YBQC 3OB0K 5DJZB 5CHNA 1NGWA 3H9HA 1UM4H 1X5ZA 2VZVA 4OLZH 4PJXF 3QDJD 3DYPA 4ZO9A 1I9RL 3VRIB 2ATKA 4OZIB 4J4PC 5DRZA 2MCPL 5I8KL 1QBMH 3I85A 1UXWA 5IB4A 2WBJB 3U36B 4R97C 4FZ8H 3T0BA 5DK2B 3D9AH 1VERA 5GRUH 3N50A 3VRLF 1VFBA 3INUL 1YEHH 3UZQA 1EVUA 3KPPB 3IAGC 4WENB 2CLVA 4H20H 1Q9KA 3UBXG 4PYHA 3FO2A 1M7IA 3H7LA 4YWGL 5BXFB 1JZ7A 2DKSA 5KS9B 2GQHA 3GSRA 1EX0A 1YEKH 1VKXA 5DJYB 5D5MF 1QR1A 5DJDA 3TO4C 4HIHB 1IQWH 3V2AR 4P2OD 5GSRB 4HUXA 3SDYH 5JXEA 5GZND 2A0LC 3QCTL 2NY0B 4PJFF 1G9ML 3WN5A 3ZTNL 4JRXA 5E8NB 3O2DA 4OF3A 2YD9A 4HUUB 5BW7A 3I9GH 3KLHC 1KJMB 1DUZB 1MUJA 4UBDC 5EZOL 2RHEA 4R0LB 2PXYB 3WYRA 3CSPA 3Q6FA 2V6HA 5J1AA 1HI6B 3MODH 4OZHB 3CFCL 3U1SL 4XP5L 1XFPA 4TRPL 2FECL 4PLJD 4QRPE 4YR6B 3UTTA 2NX5D 4MA7H 2APTA 35C8H 1AD9B 1MCJA 2W60A 4WFHE 3HPJB 1IGYB 5I2IB 2BVQA 3HC4H 4XCCL 2VXVL 4JE4B 3GKZA 4M1DL 1KTLA 1U8IA 4O2CA 1SJEB 3RVWD 1UZ8A 4OIIH 1BFOB 2F15A 1UB5A 3U82B 2Q7YA 1RIVL 3BGMA 2Z4QA 3JBG7 3KXFB 5DZNA 1YC8A 3C6LB 1A9EA 3SGEI 3VXME 3TA3B 3L5WA 3QIBC 5EIVA 3VJ6B 2PW2B 2L7JA 1XGPA 5CZXD 1I1FB 3ULVL 4EIZC 2BZDA 3IXAA 2OP4H 3A6BH 4FG6D 4HDIB 3TYGH 4RMQA 2IALA 3RJDA 5IEKA 1KFAH 3BP7B 2ZSWB 3K81A 4FHBD 4XCEA 4FFZL 4RDQG 1DFBH 1ORQA 5KANG 4KZDL 4F7MB 5JDJA 3GB7B 3V5KB 5IW1A 3IDUA 4OLXH 2Z35A 5TDNA 4HZLB 2XWBA 2DL2A 1FQ9C 5F21B 5ESVB 3WHE0 2BFVH 4NT6A 2EDHA 2X70A 2EYRA 3MRMB 4XB8A 3UP1A 3ZSSA 6FABH 3NFNB 5DC4B 4M62H 3WIFA 2Z31B 3PV6B 3GHBH 4HIEB 1GZQA 1L0XA 4KJWD 2BERA 5DD5L 3VXRB 3L3DB 1IE5A 2MPAL 2X4QB 2Q6WB 3QUXD 1LE9A 1KC5H 5DWUH 3DMMA 4WUUE 3OSKA 2ITCB 4HC1L 1U8JB 4OZFG 2BNQB 4M7JL 2H1PH 4HUVA 3KYKH 4U1IB 2XA3A 5CP3A 1CIDA 3BIBX 3OHXB 3BEVA 5BV7B 4ONFL 2HG5A 3G08B 3IT8D 4WY7L 2X4UA 5FA3A 3QIUD 1I3RB 4X80H 5D1XD 2V5SA 1T7WA 3CFJB 4FQIL 1A6TA 3FRUB 3F7VA 1WIPA 4KMQA 1BD2D 4Z7VB 2ICCA 3O2VH 5B38A 4PG9A 5J4MA 3U2SA 5J7CC 2DKUA 4XC1H 4YFDB 3SKOA 3QUZC 1DBAH 5EU3A 5C0AA 4CJ1A 2P5WA 5T1LB 4J23A 4HIJB 2F8OA 2ZCLL 3L3HA 5KSBF 1R5IA 5H8DA 5ITFB 1CT8A 2AK4E 1AQDB 3AROA 3OX8A 5GS1C 1J0KA 1CICB 5BCAA 3KPQA 4GW1B 3I75A 3HNTL 1KG0A 3MOBL 2C7UA 3BKML 3V52H 3MRBB 3MNZA 3P4LA 3FHAA 5HVFB 4NKMA 4XPTL 3T0EA 5FCUL 5I1IH 1U8QB 4PRID 1P6AB 3LPWA 4P5TD 1AFVH 4OZGB 5K9KB 3VH8G 3BP6B 3QPXL 4MZ3A 3QG6B 2AAVA 2YPLD 4WVRA 1RJYB 3VMOA 4DCQB 2AJ3A 4UTBL 3DWTA 1PKQB 4OLWL 5C3TA 1WT5C 3JWDH 2HKHH 3HS0A 5HYFA 4KJYB 5I0DA 1U8KB 4OM1L 4YX2H 2CK2A 3KNBA 4PRPE 5DURB 5A3ID 4HFWA 2CMRH 4FQXC 3FQRB 4PJ9A 4YDKH 3WJLC 3V95A 4DN3L 4YNYB 1AP2B 1OTSD 3CH1B 4HHAA 5DGRA 3QSKB 4PB9L 5AAMA 1GGUA 2ITDB 2N56A 1R24A 5LJYH 3NIDE 3QO0B 2CJUL 4DFHA 5IHUL 5D2LA 3QDGA 3HI6H 5D7LD 2YD1A 3LRGA 3I3BA 4PRBB 5GGVY 1YEGL 5C6TL 3ULUH 4QNPE 4YHYB 1U93B 4QRUA 4Q0XL 4JPIB 1NEUA 5CJQH 5CKAA 5BS0E 2DQJH 3P77B 2X05A 5I66B 5KVFL 5BZDA 1FCCA 4K3HA 4RQQB 2CIKA 3ZT7A 2QLVB 2H8PB 1XCQA 4LVOB 2DLTA 4D3CH 2V2TB 3UTSB 1U3HC 4MWFA 5C07D 1IGIH 3UPAA 4XXCA 2V9RA 4QKXB 2GI7A 3GHEL 3ILPA 4I0PC 2I5YH 5ELIA 4IMLB 5K9QG 3WO4B 2OR8A 3D1MC 4LASL 4QHNB 4V2BA 4HPOL 1N59B 1HOCA 5EBWB 3TBVB 3WEXA 1KJ3H 3V8CA 5GISH 3GRWL 5E8PA 4LEXL 5I1HH 1K8DB 4YDVB 5IG7A 3KPNA 4HEME 5AG8A 1KCRH 1J12A 1IEHA 4TNVF 4U1NB 3Q1SL 5TF1L 4IEFB 4P2QA 4AL8L 3SDXA 4MQXD 3MXWH 4I2XE 2XRAL 4KJPD 5HI3C 3BEWB 4TULH 3HAEB 3WFHB 1CS6A 4ZO7A 4M43L 1MREH 1BBDH 1CFSB 3NCBB 1MFAL 3T0DA 5C8JA 2BOBB 4NWTL 1DQQB 1QLRB 2XYCA 1NMBH 5D1QD 4ZSOA 1A1OA 2QJDA 3SJVE 2FX9L 1JZ5A 4Z7UA 2YS4A 3F62A 2FHFA 1F6FB 5IVZA 4MJ5B 3W0WA 1NFDE 4OCWH 5DHYA 1FFOB 4ODBD 2XTJD 4PS4L 3JUZA 4WHTB 3QI9C 4XWGL 3LN5B 5TE6L 4GJTB 3ZKSD 2RJMA 1PEWA 1RUKH 2K1MA 3AAZB 3BSZL 4MAYC 3KAAA 1G9NL 5DD0H 1G7LA 2A73A 5E2VL 4H88L 1MI5B 4R2GC 3RWJA 3CFBA 1ZK9A 4HGMA 2LU3A 4UI2A 4MCYA 3TBSB 4Z9KB 1A6UL 4JPWH 3C08L 3LKPA 3L6FB 1C5DB 1T1YA 4P4KB 5I1KL 1GC1C 3X11B 5FF6A 3FOLA 4U1GC 1FVEA 3S5LB 2ORBH 2IPKB 1A6AB 1JNLL 4GG6B 3TYFB 2Y7QA 4HUKB 4HFUL 4LLQA 3KLSA 4DVBA 4TVSa 4LOUC 1B0GA 3ROLA 2PO6D 3GK8H 5GGTA 3WNMA 4EI6B 1UJ3C 4MD5A 4NDMB 1XF1A 3UDWC 1EAJA 1YDPB 4ZNEE 1TDQA 3FB5A 5EN2B 5TFSH 3DURA 4HS3A 3RAJH 2EDEA 1NCTA 2PCPB 5FYKU 1IGTB 3TGXA 1TFHA 2XN9D 3MRNA 4PG2A 3TN0D 5D7IA 4OCMC 5J11B 2AJZA 2GT9A 3STZB 1LO3L 4WRLA 4BJLA 1O7SA 3BKCH 1SY6A 2JKXA 3MRFA 1PDKA 2CRMA 2IANA 3D0LA 5IW6B 3KJ4C 5HGBA 2F53E 3FB6B 3WUWG 1F4XH 4QXUH 2A6JA 2VITA 3FFCD 4YBLB 4XXDA 4POZD 1CLZL 4KUZL 2R1XA 3BKYL 2UZXB 4N0CC 3FZUD 5CUSL 2D3VA 1RU9H 1IGCL 4AQ1B 2PTUA 5CBEB 1HE7A 4QRRB 1XIWB 5SWQA 3SY0B 4ETYA 3BN9D 3QJHB 5GJSH 3RZCB 3JSSA 3ECBA 3LQAL 1BIIB 1XGQB 3C5JB 1X5IA 4XGZA 4JCMA 3G6DL 3CVHH 1CI5A 1U3JA 4KRPC 1QD0A 4AYFA 4UV7L 3EO0B 2JB6B 1GL4B 4M7ZB 3VXOA 3L3JA 2IQAA 3MLUL 4Y4FD 2VLRB 4ODTL 4K9EH 2X4OB 1G0XA 2PW1A 3UC0H 1RZ7H 1I7UA 1KEGH 2IAMC 2P8LB 4M3JA 5ADOH 2VLKD 1TMCB 1X4YA 5TDPB 3V5DA 3K2UL 3DETC 4JREC 2FYYB 1F4WH 4NQEA 5ISZB 2AJVH 1A6WL 2OTWB 1K4DA 3SO3B 4JJ5B 4PJHF 5KSAB 2DBLL 4Z77A 4XBGB 1LNUA 3IVKA 1YY9C 1NBYB 1D9KA 1QBML 4ZXBD 3PGCB 3D9AL 3MX0A 4JFFA 3KPSD 1FBIH 1FL6A 5F7EH 5MEQB 1WV7T 5CD5C 5ITBL 2NY3B 5TDOB 3PWLB 3VXPB 1FFNA 4N1CA 4LHQB 5D2NB 1HH9A 2AEIT 2X7LA 1H5BA 3BISA 1OL0A 1ZHBA 3I6LD 4YHKH 3DX8A 1IQWL 1CXIA 3LVEA 3DVIA 3D39B 3U0PA 5E4EB 3TP4A 2OTUA 1HN1A 3K7UA 1OARH 1O7VA 4KKCD 4X6BA 3TNNA 4Z7WA 1PYWA 1TJIH 4M93B 1S9VA 3I9GL 3TJEH 1M05A 4XPBL 4FQCH 2G9HA 4UT6H 3H2WA 5HHOB 1J05B 3U79A 3SCMA 1MCFA 5FYLE 5MERB 3NN8B 3L3OB 2DMBA 3LPFA 2GJZB 4MJIB 2SEBA 1A22B 2W9LA 3I02A 4MA7L 35C8L 5D7SH 2ESVD 2E6PA 3FONB 2JCCE 3D48R 1B9ZA 5DRNA 1ZLWH 1AD0A 4NQCE 4JM2B 1HKFA 3HC4L 4UU9B 3NCJL 1DVFA 1JWUB 2VDKH 1I8IA 2IH1B 4P3CH 2CLRA 4RFEA 1HILB 1AE6L 4GKSA 4E0RB 2R0LH 1N6VA 1S7QB 1CFQB 4JY6B 5FYKE 3GSUA 1SEBA 2FRGP 3VFSB 2AJYL 1RIHH 3B9KD 5EDXA 2W38A 2OX5A 4QRTA 4YAQA 5IP4A 5JPNA 2XQBL 4H8WL 1T89A 3S98A 1I1AD 1F4YH 4TQEH 1JHTA 1H15A 5TQ2H 1G9MC 5E99L 2ADGA 2OP4L 3L95B 3UPRB 1LEIB 1QNZH 3O6KL 5C2UB 1KFAL 2YA1A 5JHDB 1QEWB 1DFBL 3RNQA 4NQDE 1CBVL 1JGEA 4G6JL 4KKNA 1G1YA 2CRIA 4XNUH 1ZGLP 4CVZA 2XKUA 4QXWA 1R3KB 3GMQB 4QRSA 1KIUA 4AEFA 5IMLB 4X6DB 12E8L 1XF3B 1GH7A 1NH6A 4X9HA 5F7WC 3M17A 3RVVD 1WWWX 4OUUA 4X6EA 1WCQA 6FABL 3P9LB 1LK3H 2R2HA 4M9PA 2W0PA 3EYFB 1UH4A 2WSKA 2H3NB 3AMKA 4R4ND 1MY5A 1BVLB 4OD2A 5IVXB 1UT9A 1QBLL 4MSWB 4X7TB 4ALAH 4DZBB 3QQ4B 5CSBA 3JWOH 2FSEB 5I1EH 4PJEB 1M71A 3FQNA 3HB3C 4LVEA 2H1PL 1AGFA 4CMMA 3KYKL 4HXBL 4TTGA 2VLJE 3QUYB 1W0WA 3UBXA 1Q0XH 4L8BB 3UCRA 4L3EB 3WHXB 4L8DA 5IR1B 2QHRH 1NBQA 2CD0A 3RVUC 4ZNCD 3N1MC 3QEGH 5GIRB 4S2SB 3I3EA 1X5AA 1TJHL 1OSPL 1QA9B 1A14H 3FMGL 4WHCA 4NYLB 1CTOA 5CWSB 1XCTB 4Z7QE 5ECJE 1DBAL 1I4FB 3ZO0A 3NCYP 4JO1L 1DCLA 2NY0D 4L4TE 4PJGE 5J1TC 3B2VL 3NZHL 4ZS7H 2WLYA 1NEZA 4IMKC 1ZT1A 3WLBA 2HLAA 3JVGA 3MUGB 3U7YL 3PWVB 5DJ8A 1R6VA 5JA9A 2PXYD 8FABA 5F1OB 5FYLH 2GK0B 1Q8MA 4S1SL 3VFNA 1MHHA 1V3KA 3BYYA 3WFCH 4ENEC 1ZVSA 3VW3H 4KI5D 1HHGA 1I85A 5E2WH 5EUKA 5FKAA 5HGAB 5C1MB 1U2CA 4OI7A 3F12A 2UYLB 2OS7A 2COQA 3C2AL 4M7LL 3JWDL 1QHPA 5INCA 3MRLA 5FYKH 1N4XH 4EN3C 4M3KB 2CMRL 3ES6A 1FL3A 4KVNL 5E08H 3C6LD 5E2UH 3MGTB 1OTUC 4MX7A 5LKNA 4MXQC 2R4RH 1O0VA 3CFEA 4W68A 1SYSB 1AH1A 1MH5A 3VWJB 1MLCB 5FAAA 4Z5RA 2Q3ZA 1MCBA 4ZAKA 1UXSA 2PUQT 3HI6L 3DGGA 4HLZG 5HY9B 2VUOA 4JQVA 4MYWB 2HFEB 1X7QB 1BZ7A 1CFTA 1H0DB 4M4PA 4I0KA 2YPKA 5EORH 1NBVL 2DQJL 1WC7A 4X4ZA 4Z0XB 3HG1D 4M5ZL 1ZA6B 3MRHB 1HXYA 4S1QH 5E1HB 1LO5B 5IBLC 5GGRB 5FB8B 1YUHA 3O3EA 3X13A 2PYEB 3ARDA 2F54B 3HLAB 1N6QL 2Z31D 3AREC 2XNAA 1CXLA 1IGIL 1WWAX 2I07A 4OZFA 5ID0A 3UPCA 1Q72H 4AH2B 3O6LH 4Y16D 4G6KH 4ZOBA 1NDGA 4B7IA 3BRFA 2I5YL 5J13C 1RZ8A 3LV3A 3FQWA 1QBAA 2J6EH 3SQOL 3DSFL 3KPOA 4PJDB 1EAPA 4EOWH 1L7IL 4LSSL 1WQVT 1T1WB 2OXHA 3ETBF 4HG4J 5KJRL 3F7PC 3J8F7 4JQXA 1BD2E 3STLB 5I1HL 1T7XA 1FE8L 4ISVA 2OXGA 1V7NH 1T21B 1NUGA 1P9MC 5HDBE 2CDEA 4GXVH 5LVEA 3E6FB 2FX8H 5HHVH 2AV1A 3PDOA 1FFPB 1RZKH 2AEPH 5H2BB 1R5WB 4U49A 2YKLH 4XNXH 2HTKC 3T4YA 2V5TA 4DEPB 4PPTA 2Y6SC 3V0WH 1JN6A 4URTB 3NCMA 2WLZA 1JHLH 5GXBB 1ZXQA 1CICD 4P2RA 4U7KA 4DW2L 1LP9A 2J8UB 2GK2A 1V3MA 2UWEE 4HUNB 1RSFA 2BY3A 1YPZF 1X5FA 4QHUB 3IFNH 3VH8A 3DLQR 4LMQI 3DUSA 4OCWL 2E6JA 2AXFB 5FA4A 3GBMH 3E3QC 4JDTH 1ERNA 3QDAA 5E9DA 5EG6C 1KGCE 3HPLB 2X4PA 4MCZA 4G9FB 3ZHKA 2DMKA 5DD0L 5C0FA 5IJVA 3QO1A 5DURD 1CGUA 3QAZC 4KXZH 3MZTA 3OR6A 4U0RB 3HI5H 4OD3L 3N9GH 1MCCA 3ZDZF 3ARSA 4WCYH 2ED9A 4F15B 1JPSH 3QT2A 3GJFH 4HJGB 3DHJA 4I3RL 4ZTOL 1QOKA 3L7FB 3PDGA 3HE7D 2QR0B 4JFQB 5D7LE 3ALXA 3GMNA 1NCDL 4GAJL 4P49A 4YC2C 3CUPB 3GK8L 1XF4A 3DV4B 1CGSL 2WP3O 3MRGA 5IB5A 4JLRA 2ZUVA 4PLNC 5BRZD 3QEQB 4G80B 3NGBC 1WVZA 1H3PH 3BD5A 1UYWL 4Y7MA 3FJTA 2IC2A 4NJAH 2GW5A 5C07E 2OJEA 1G9NC 3LS4H 2P7TB 1QACA 4X6FA 1UC6A 2AS5M 1BQLL 2QSVA 2BVEA 4OTXH 4JR9H 4PRHB 2J4WH 1D6VH 1FJ1A 2I27N 1Z3GH 5IROA 4P46A 5GRVL 1JI1A 5MENB 1EBAA 1P1ZA 5C0IB 1EFQA 1Y0LB 2H26A 5EO0B 3TBTA 2EXWD 3KPRA 3L5JA 4Y5YA 2EDDA 4KV5F 4I3GA 1RU9L 1WZ1H 2HYMA 1QVOA 3MBED 3JV5A 1B0RB 3SE3A 5K9JH 2VWEC 1XGTA 2P8PB 4NRYA 1P7KA 2FIKB 4GOSA 1FH5H 1AQKL 5EUOA 3WSQL 5C2BH 1UWGL 2XZAL 3AM8A 2HTLC 1K85A 3DX9A 1KCKA 3PGFH 4JFYB 2Z91A 4G6AC 1UQSA 5D6CA 1FYTA 5BOPA 3MLVL 1E4XH 1PZ5B 4PP2A 5JXEC 4ZYKB 3RTQA 1KEGL 3AGVA 2ERJB 3OXRB 5JO5A 3VGAB 3BQUB 1MELA 3TT1H 1ZMYA 4G42A 4PJ8D 4R8WL 5DXWA 2AJVL 5A40E 4GXUM 2C4FU 3G5XB 1UA6H 2DIJA 4FXGA 3QIWB 5TGBB 1YC7A 2W9DL 3MV9B 6CGTA 1OB1A 5IESH 5F7EL 1MI5D 2CDGA 3MYJA 2EXYC 2ZJSL 4HG4K 3BW9B 5SX4H 1ONQA 1ZWIB 4JFDA 1HWHB 4R4FH 2BSTA 3LQAC 2AQ1A 5I17A 1SYVA 4P4KD 5DQJB 1NFIA 1FG9C 2R2BA 3B6SA 4XHQA 3QXAA 1F3JA 43CAA 1FLRH 4XP6H 3OAZK 1Q0YH 5LCVL 1BQUA 4X7SL 1A2YA 2DM2A 3SDCC 3V0VA 2VAJA 1YECL 4NKIH 2XKNA 3BMWA 2YC1B 1JGUH 1MHCA 5IK3A 4GAGL 3P4MB 2BC4B 4Q2ZB 3ZKXC 1AHWB 3PXJA 5E2JA 3OKLB 5C0AE 1CCZA 3RWIB 3GGWB 3O2DH 2P5WE 4OD1L 5F8RC 1A6ZA 2HA1A 4DN4L 5J3HD 5EBGA 5JZ7D 2LV4A 2A74B 1MFEL 3VCLB 5KAQG 1IFHH 2I26N 3WUWA 5F1NA 2ENYA 2VDKL 2R8SL 5LWYH 2ZUUA 4P3CL 1S7RB 4L3AA 3P40A 2CUMA 4AG4L 3FT3A 3UO1H 2EE3A 2B0SH 1QQDA 1VFUA 4KPHL 3QNXB 4MHHI 4LQFH 5CSZA 5HPOA 4G8GA 3CX2A 4GKZB 4TQEL 5F7KC 3KPMA 4BELD 4UNVA 5FECB 1UZ6F 5EU6A 1QFUH 3GSXB 4EN3B 4QRRD 1AGCA 4P5KB 2F58H 3CDGB 3VRJA 3QWOA 3RZCD 4EUPB 1A3RL 4IBLT 5E03A 4JY5H 1NUNB 3CSYB 2H9GB 3T8XB 1JYWA 3F5WA 2X4NB 2FEDC 3SGDH 1FGNL 3L5HA 2VDPL 3TZVA 4PJAB 2CIIB 4E42B 4JHZA 3LH2H 2F8XC 5CD3A 5B39A 4XH2B 1AIFA 4RMTA 5DFWH 3PWNA 1F13A 2DKMA 1IGML 5FGCE 3LEXA 5CS7A 5LXGH 1RURL 5C0JB 5DQ9B 1CFVH 3O8XC 3G6AA 5L2JA 1R0AH 4NO5B 2F74B 3QXUA 5ISZD 4I18A 5I74B 4LSDA 2EE9A 3WFEH 4FQQA 5JQ6H 4LF3A 5KSUA 4X98B 3KWWB 4JKKA 1JPGA 1AGDA 1MJJA 4H8WC 4JFXA 3LKOB 1JRHH 5EA0L 2PN5A 4UOJA 4WU7B 4IOFC 3FT4A 3D3VA 3T0EC 4LKXA 4LARH 2K3TA 4M61A 5ICYA 3ORJA 4I77H 5CJXA 1G7JB 2NY3D 5FHAH 3NPSC 4LCYB 5D71L 3MO1B 1P84J 3DGCR 2B2XL 1DQJB 3C5ZB 5CP3H 2ZCKL 2EDOA 1T2JA 2H32A 3IXTB 5HGGS 5C0CA 3D39D 1JTPA 3VI4F 1FZJA 3NFPA 3ARGC 2DQGH 1MVUA 5F97E 3UYPA 3ZE0F 2Y5EA 8CGTA 1JE6A 3ZDXE 2OJZL 1PG7H 2W0FB 5FO8B 2HFFA 1KB5A 4DK6A 1OAXH 3P9MA 4Q6IC 2O5YL 1JNNL 4P2QE 2NXYC 3IJYB 5JOPE 5DHVA 3OXSA 3X17A 3FO9B 2HLFC 3SDDC 4S1DC 1Y18B 1PBYA 2UZIH 3TESA 1ZSDA 1DQLL 1X5LA 2AV7A 4HJJH 5IOPB 4MJ6A 5L0QB 3H9SB 4JM2D 1INDH 3VXSB 3OKYA 1B6DA 3Q5OA 5IJKA 3WS3B 4ZSOE 1JZ8A 3KYOA 4Z7UE 4DKFL 1F90L 1IGFL 2JK5B 4GRWB 3W0WE 5L2KB 5JW4R 1YNTB 5E08L 2YBRA 4BK5A 4FS0A 1NCAH 5AAWA 5E2UL 2WWKO 3QP3A 3EOTL 2F19H 3D69A 1A9BB 4LHUB 2YXFA 4F2MB 1FNHA 4KTDL 4QWWD 5SWZD 1GRWA 4GRMB 4PJ7A 3F8UB 5CEXB 1M6OA 3LEYH 4YHNB 1A7QH 3QFDB 3U4BH 4ELKA 3TJHC 1E27A 3SBWA 5JHDD 1X5HA 3DIFA 3GI8H 3RGVD 1DBKH 1QFHA 2VQUA 2QKIB 3GMOA 2Y25A 3L7EA 1QRNB 1UVQA 3U7AA 2DIAA 1J1XH 3VD7A 4MAUL 4WGVB 5E94A 1I1RA 4XNYH 1BF8A 5GZOD 3HE6B 1D6EA 3SGKC 5HD8C 1LD9A 4ELMB 3P0VH 2FZ3A 1SVCP 1TIUA 2JJWA 1CGXA 2VISB 3WDHA 4W70A 4LRIA 3JWDC 3AU1B 5HVWA 5KN5A 1Q72L 3IU4L 1BBJB 1KJVB 4G6KL 2R23B 5DJ0A 5E5MA 5K59E 1NAMH 4JKLA 3VD4A 4ODHL 3QRFM 3KG5A 4KY1L 5CBAA 2V2XB 1ADQA 1BQSA 5D7IE 3QUYD 3BZEA 5IMKB 2X4TB 4EOWL 1J0ZA 3T2NH 1D5ZB 4PRNA 1HQ4B 4NZUL 5EC1A 5FGBC 4FFYH 4ONGH 2NLJB 4L3ED 3HC0A 3EOBB 1MLBB 2AKRA 2CKBA 4PBXA 4XPHH 3W9EA 2WIMA 2ID5A 4HKJB 1WAAA 2BNUB 1TQBC 2LE9A 4P3DA 1FZMB 1ZS8A 1CVRA 4N9GA 4XVSL 4YGVA 3RHWK 2CGRH 3BI9X 3THML 1MJ8L 2G5RA 2ZOKB 3GNMH 4OGAC 3HRZB 4AT6B 4IRJA 3DO7A 1JHLL 2W0KA 5A2FA 3MRKA 2MFNA 4WNQB 2NZ9C 4KK6D 4F57H 5DVLA 2Q8AL 2VB5A 1EXUA 5M7QA 1OP5K 5ACMA 2RCSH 4LPXA 5SWSA 3LIZL 3GSOB 4KKBC 5DJAA 1J5OH 1QFWL 4XC3H 4KI5E 3VFOA 1UH2A 4MQ7B 5MEOA 1W8NA 4JDTL 3GSQB 3FAWA 5F71A 4UINH 2VC2H 4FFVC 3MV8D 1JL8A 3Q5TA 4X4XA 3PL6A 5EOCJ 4HPYH 4MQSB 2CDFA 3WNLA 4JVUA 4IIQC 4G6ML 2HKFL 1CQKA 1HKLL 4WV1C 1F45A 2NTFA 1LK2B 2CO6B 3MCKB 1HNFA 3L3GA 3M1BA 3RKDC 1KOAA 3LMJL 5KVDH 3QH3B 1P84K 4RGNC 4M8VA 3O6FD 1NGZB 2CKNA 5JOFA 5D2LF 5BVJA 2GITA 4ZFOB 3O9WB 3LS5H 5JPMA 3WJJA 1KTDB 4QXGL 4JFFE 3RWCA 3W2DL 1J8HD 2X6MA 1GPOH 1EK3A 4ZTPH 5L9DL 4W4OA 5A16A 4Z7OF 1MFNA 1VGKA 4TPRH 5J6GB 5CLWA 1G7QA 2YD2A 5ESQA 1CD9B 3O4LA 4ONOA 3X3FH 3HG1E 5F3HB 5DR5L 3O2WL 1QLEL 4KROB 4Y4KB 1A8JH 1DEEA 2NY7L 4JVWA 2YWZA 4U4BA 3IFPB 4JANB 5FKPA 1GAFH 3ZE2F 4Z7WE 4HS6A 5FOBB 1OCWH 1XGRA 4M5YH 5GGTH 1H3TA 1OAYH 3VFVB 2A9NH 1B2WL 5EZIH 2J4WL 1NLDH 1FP5A 4LKCA 1SMAA 1NGQL 4GKNA 3LSOA 2W65A 4GMTL 1NMAH 3MUY1 3MUZ1 2H2PC 5C9JB 2X9YA 2HJLB 5HI5D 1IGJA 4BQ9A 2AVGA 1SY6H 4D0BA 4XHJD 2IFGA 2E7HA 3HUJB 5HTSA 1KB9K 3CMOH 4Z7VE 4HS8H 5DD1H 4NNXB 3SDXF 1D9KC 3LB6C 5CMAA 2PR4H 3UYOD 4WEMB 1FH5L 1JUFA 1T3FB 2NPLX 1PQZB 3T0WA 5BJTB 5C2BL 1MF2L 1PG7X 3RVTC 1UKTA 5FUZH 2MHAB 3NIFE 4EDWL 1S78C 4G5ZL 2FWOA 2VLLA 5L8LB 3D85A 4PY7B 4U1KA 1BX2B 1T1ZA 1H5BC 5LAXA 1S8DB 3S4SB 3V6ZB 1OAZH 4BQBA 4TUOA 2Q8BH 4OCRL 3RA7H 1NAKL 4XMKH 1AR1C 1E4XL 2OL3L 4GMSH 3MYZA 4GUPB 2HT4D 3WNNA 5H35A 5C08A 2DQFA 1R3HA 4GBXB 5L7XL 1CIUA 1KJ2L 3IDMA 4OZGE 3FO0L 4MMXC 4RX4D 5JIIA 4PTTB 4AENB 2FO4B 3IDYC 4UV4L 5E8DL 2G5BA 1TNMA 2DDQL 1E28B 3SCMC 4G9FD 5GJTH 1ITBB 4YDLB 3MRJB 5FHBL 2ZG1A 5I8CA 5IESL 3IFLL 1JF1B 3MRDB 4U05A 2NXZC 3U83A 1OWWA 3GI9L 1VEMA 4JZOA 4HT1H 4R6UA 3K4AA 4I5BA 1MCEA 4TSAH 5IW3A 3V4PH 5EU4A 1VGEH 4U6XA 1ZLUK 4YK4C 1G7PA 2W07A 1NC2A 4ODXB 3VGFA 1B0WA 3FOMB 2HN7A 3RUGF 3VD3A 3H7BB 5LQBH 4NP4H 3K46A 4FNLH 3F7YB 4XAWL 3MACH 4OCSH 4OZIA 4O2FB 3U9UB 2EDRA 1T89C 3PE9A 2UVEA 1YEJL 2WBJA 1KIQA 3WIHL 3PQYA 2VXTH 4QO1A 1LDPH 3NCCB 5JIHA 1U41A 3QEQD 4L3CB 2PETA 5BRZE 4WWKD 4E41B 2B1AH 5KS9A 4LPTA 4KK8C 1GOFA 1IZJA 5DLML 1T1XB 4K2UL 1KSRA 2VDQL 2ZOLB 4R90H 3WL9A 4QHLB 5LWYL 1CLOH 1IKNA 3NH7L 1T22A 3FN0L 4PRHD 5E8NA 2DM4A 4EXKA 1QKZL 1EERB 2NNAB 4M03A 5MEND 2B0SL 1FC2D 1N5YH 2R0KL 3UYRL 1X5GA 2XQYG 3EDDA 4PJCF 1DR9A 1HI6A 4KHTL 2LVEA 1S7VA 2WBWB 4U1MB 3ARBB 3WDIA 1BEYH 4CDHA 2EZ0D 4I0CC 1LEKB 4GRLA 4PR5A 2MKLC 2YZ1A 4PV8B 2R0ZH 5F44A 1YNKH 5H94B 3BYTA 3O3DB 4Y19A 2ADFL 3WIIH 3JV0A 3U46A 3BO8B 2X4RB 5GSVB 1DBBH 5EO1B 2JJVA 4NPYB 3QQ3B 3QUML 1CVSC 3IJSA 4GO6B 1YN7B 4LCUB 1SJEA 1PG7W 2JJSC 4NC1E 1BFOA 4F3FB 2EIZB 1FVCB 2WQ8A 4YHMH 3KXFA 5DD6B 3I2CH 4ETQB 1QSZA 3JWNC 1FO0H 4C59B 1IAIL 2J7LA 3P73B 4NHUA 4OKVA 1I3UA 1CYGA 1HSAA 1F6LL 1N0XH 3TA3A 1S7SB 4L9LB 3RY6A 4QRPB 4LP5A 4P23B 5LXGL 2HP4A 4QCIA 3EW3B 4AMKH 3EGSA 5GS0C 1CFVL 3GKWH 4HDIA 1R0AL 3ARPA 3BQUD 1T0MB 4AM0B 4XVJL 2I9LA 2ZSWA 3EYSL 4N90D 3BFOA 2R4SL 5C0GB 2GAZA 5KVMC 3GSNH 3QIWD 4NHCL 4Y5VB 5C09A 1JPTH 4FRWA 3V5KA 3VFWB 5F9WB 1ES0A 2HVKA 3MV9D 2A83A 5C0BD 2E7BA 4NN6C 1EEZA 1KELH 2GCYB 3FQTA 5FHAL 3VXMB 1V8HA 3X12B 4HIEA 2DYPB 4NUJA 3VXRA 1UG9A 3L3DA 3DROB 2YRZA 2RFXB 5DK0B 1MCPL 3ULSA 1H3GA 1Q9WA 1OSZA 4X7DC 4K3GA 4M4RA 5F1SA 2ITCA 1F11A 2WINA 4GG6E 2BNQA 2D2OA 1IM9A 1VCAA 1CF8H 3I50L 1ZT7B 5DUPL 1G7MB 3G08A 2E27L 3N0PB 4YPJA 1AXSB 4U1SA 4PV9B 4HLJA 3OKDA 3CFJA 3FRUA 4LPVA 4JQVC 2UZIL 4U1JB 4TYUA 1DLHA 1U8HB 3IFOA 2XPGA 3S35H 2V17H 2FCBA 4R26H 3LEVH 3A67H 4HJJL 1OTTC 4WEBH 4WUUB 1INDL 3D2UB 3KYMB 1RJLB 1MAMH 3OTTA 5T1LA 1XZ0A 2R56H 3TEUA 3K4ZA 3H42L 4XPAH 4CU6A 3HNVH 1P7QA 1CICA 4KMLB 3SO5A 2RAMA 4TVPD 5E9DE 1AXTH 2ZNXA 4IIQB 3MFFB 4UQ2A 2GUOB 1DLFH 3WBDA 1K2DB 4N8VB 1ZT4B 4NZRH 5ICZA 3LDBC 2A1WL 1EFXB 1NC4B 3TVMB 4QRRE 5I71C 3LEYL 1A7QL 4EI5B 5CSGA 5K9KA 3BP6A 5CILH 4IM8A 3U4BL 1IM3B 5D5MA 2P1YA 3WFDH 4Y2DA 1QBBA 1HHIB 2IQ9H 5FGSA 3VFRA 2VDRL 1AR2A 4PJFA 2AK4B 2GJJA 3FN3A 5TE4L 3RIAK 3FQRA 1DBML 4ZOCA 5DD3L 1BAFH 4V2CB 1F3RB 3QNYA 3BIKA 3P0VL 5D72L 4NOBA 5FM5O 1KACB 2Y36L 3HZMB 4N5EC 4G3YH 2AXHA 5GGQL 4H0GA 1NAML 5C86A 1JF6A 5GGUA 2V5RA 1FRGH 3EZ8A 3PWUB 3TFKC 4JPIA 3C6SA 2OQJB 4WI2A 4ZFZB 4PRPB 3T2NL 4OZFH 2DF3A 4FOMA 4OQTL 3V5HA 3W5NA 4RQQA 1WTLA 4K8RH 5IQ9B 4TN9A 4IRSC 4ONGL 5I19H 3BPOC 3BGFB 1MFDH 2H8PA 5HYEA 1GGIL 2O5XH 2ZCHH 5E56A 5D2NE 5L88L 2IJ0C 3C5ZD 1WBZB 5TPWH 4MNHB 3UTSA 2VIRA 1PLGH 4RGOH 4H1LA 4JZJC 2R15A 2Q7NA 4RISH 5HHNA 5C0ND 2VYRE 5F6IB 4PLKC 1IAKA 4NFDA 4UILL 2CGRL 3LN4B 2AI0L 3K74B 2YSSA 5ICXB 3HTLX 3Q48A 4LLWA 3V9FA 3GUTA 2X89A 3OAUL