5EA9A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0130
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5ea9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ea9A01
1PE1A 5J5RA 3SECA 1V7YA 1R2RA 3NDOA 4JEQA 1C29A 1K02A 3FJ6A 1NEYA 1VYPX 2X30A 5CZTA 3W3OA 3BG5A 3FKRA 4ZQOA 1QOQA 3NL3A 2VEPA 4O17A 3IVTA 4K37A 4AMAA 2AAMA 5F2GA 2VFFA 2C0AA 1IIHA 3L2IA 4O1DA 2A7PA 4LOCA 2C6QA 2QDHA 4EIVA 4Y9AA 3T4CA 3VE9A 1TYGA 3SGUA 4NX5A 4ADUA 4UTWC 3GLCA 4W9TA 3EWXA 3UD6A 4UTKA 5FEZA 3KXQA 5CG7A 4ADSA 3H55A 4N4PA 5HULA 4LVGA 2ZCGA 1OABA 1T8XA 3W1LA 4M6QA 1C8VA 1AG1O 4LV4A 1K7EA 4Q4KA 3O8AA 1TREA 4XKYA 3VFLA 3W1NA 1OFQA 1G6CA 1UCWA 4MIMA 3P74A 1H7XA 3TC7A 4O1BA 2WPBA 4NUWA 2R94A 1DHPA 4Q33A 4A2SA 3O6YX 3GDKA 1JCMP 3R13A 3TKFA 4YLWA 5A8GA 3NM1A 5DBTA 2RDTA 2W6RA 4Z1BA 4DO5A 4RZ6A 1SW3A 3MI6A 4UTUA 1ZFJA 5BNKA 1OFPA 2OT0A 1B4EA 2ATMA 5E1QA 2YYUA 4A21A 3EX2A 3R12A 2GQAA 1FXPA 5CKSA 4KWVA 2C1HA 1TMHA 1KM0A 2C13A 4O10A 2VC6A 4RR4A 4UFJA 3WK0A 5AHLA 3UZ5A 4XBSA 3ZFHA 1VCFA 8TIMA 2NV1A 4LWWA 4WJEA 4DF1A 1YYAA 3LCGA 4UFIA 2WKJA 3NQCA 5H2ZA 3CIWA 2Z1BA 2F7FA 1X8FA 1ZNNA 3W88A 1RR2A 4LY8A 1WXJA 4IQLA 4O18A 3T78A 3G0SA 3I65A 1R2TA 3I7QA 4AWSA 1TTJA 3E02A 3FLUA 2ZA2A 2WSYA 4DF0A 3W7DA 5MHBA 1Q6OA 1TRIA 4BF9A 3W1RA 5DY3A 1XXXA 1SFJA 2HS8A 2NZLA 4M7SA 5KZDA 2DZTA 2NV2A 3S42A 1WYIA 1WOAA 3GR8A 3CIXA 1KM3A 1JR1A 3UNDA 5IBXA 4J9JA 3G22A 3TUUA 1VPXA 4NNBA 2TRSA 1OFDA 3TSDA 1TPWA 1HO4A 1SFLA 5D09A 4A22A 5FEWA 4XBKA 3EX1A 3MP3A 3TE9A 4QJ1A 3IRDA 3NPWA 1GT8A 1SUXA 1KFKA 1XUUA 1ZHAA 3HO8A 1LYXA 3PC0A 3S1UA 3BPWA 4AXKA 3DXIA 3O06A 4FX8A 1S5TA 4UTTC 2V2HA 1UASA 1KFLA 3O1NA 3GKAA 4K38A 3LDVA 4LS1A 3FEMA 2G95A 3TK7A 3IIVA 2Y61A 3SY5A 1TPC1 3EEGA 1KM2A 2WSRA 4O28A 2TSYA 4Z1AA 1DV7A 3N73A 1FWSA 2X16A 5G2WA 1KTNA 3B0UX 3USBA 3BLEA 3KVLA 1H5YA 1A53A 3KVJA 4RCXA 1VR6A 2J24A 2QUTA 2QCGA 4TU1A 3S5NA 5AB3A 1OF6A 1KM6A 4E0CA 4K8HA 3DENA 3I68A 4WXZA 1QMLA 1O60A 3PS7A 5I3HA 3PBWA 2Q3OA 3EWBX 3UWVA 1OF8A 1QPRA 5D2VA 3QSRA 2ZQ0A 3L0KA 3FJLA 1YPFA 3E12A 1W8SA 2G5WA 3M9YA 3SSJA 4N9BA 2GOUA 4CQ8A 3BW2A 3TCEA 3THQA 2Y7DA 5F2IA 5CSSA 3T44A 3HPZA 2O7QA 1YXYA 5CPNA 4Y90A 1Y0EA 4JXCA 4Y6GA 1JRCA 2X2GA 1EWEA 5F2LA 4FNUA 4PL1A 1DJNA 3M1ZA 4XTDA 3G1DA 1OFAA 1VH7A 4NNCA 3GR7A 4NZFA 2ABBA 3DI0A 3NL2A 1X6UA 3OVRA 2ZA3A 1X7FA 4FHAA 4GXMA 2Y62A 3HB9A 1R46A 4ZQMA 5SWUA 3PM6A 3I7SA 1JCLA 3PBVA 3K30A 3N3MA 3GNNA 1F76A 3NAVA 5G5IA 3NQ8A 3WJYA 1HG3A 1OYAA 3H54A 2DORA 3ELFA 1IXOA 3EWUA 3NG3A 3MHGA 4RJEA 3TSBA 1ME9A 3QJAA 3W86A 2QCCA 3MHFA 1DOSA 4S2CA 1J2WA 1XI3A 1DQXA 4JGDA 3W7NA 2ZRUA 1TQXA 5FF7A 3G8RA 5HUOA 4UTTA 4MY9A 5CPOA 1GZGA 3S9YA 1O4UA 3V75A 1YXDA 3G24A 1FQ0A 1NFBA 1X1ZA 2GVLA 2JKPA 3OVPA 4Q32A 2Q8ZA 4EOUA 1C9DA 4JTTA 1XDLA 4JTUA 2VEMA 4AF0A 4AH7A 4M6VA 1HFBA 1FWWA 5D2YA 1K03A 1Z44A 5AN7A 3I6RA 4FX7A 4MJZA 1FDZA 1Q6RA 4BWLA 4WD0A 2BZNA 1Q3NA 2QCMA 2XN2A 3CU2A 2A4AA 2VFGA 3TA6A 4HNVA 4QAIA 3NQEA 1XDMA 4I7UA 3UWZA 1GVFA 3C2RA 1G4PA 1SZEA 1I8JA 1OYCA 2B7NA 2JKAA 3RF9A 3ABOA 3BVJA 4JN6A 1F73A 5KMYA 3L21A 5D33A 3LGEA 4PODA 5DCEA 2Q3RA 4WOQA 1IXQA 4NJJA 2ZRZA 3CEPA 5AYYA 1I2OA 3F4NA 1AW5A 4GUHA 3SI9A 4KKXA 2AQWA 1LORA 3PF3A 5LNVA 4N6FA 3PUDA 4MFEA 4FNTA 1ZJIA 2H8ZA 2CZ5A 1H1YA 3TROA 3UXDA 3W7LA 4HN4A 4PL2A 5BOOA 3DFNA 2EPHA 4PFMA 1CW2A 1MXSA 2H6RA 3W72A 3E96A 3O63A 3A21A 1NVMA 4YCPA 3GAYA 2QJIA 4XTIA 5FEPA 5G2IA 3FKKA 1I2PA 3MYPA 1GTEA 3P81A 3AJXA 2QEZA 4EVZA 1JJKA 4IUOA 4TMCA 3W1QA 1JULA 4CLMA 2AGKA 3LM7A 1ZY9A 3C2VA 4DO4A 2E6DA 1SZNA 5KZMA 1UUMA 3M0ZA 1EUNA 1I4NA 5G4EA 3W7HA 4O0ZA 3MJYA 3KFTA 5K2ZA 5D2TA 2XFWA 4ZQNA 1M7OA 2QCDA 3BO9A 3GVGA 1LDCA 4ZZ9A 4AHOA 3LLDA 1TPVA 5KZEA 2FB2A 2Z0IA 3W75A 1QO2A 5G2HA 5D02A 1QWGA 4OGZA 4JDBA 4MYAA 2C16A 3NPUA 4OBTA 1LRQA 2WQPA 4JTLA 5DXYA 2RKXA 3KRZA 1W5MA 3JR2A 3FFSA 4DBEA 4NX0A 3GAKA 3LTPA 5A5WA 1S5WA 3W7CA 3LV6A 1JQVA 4UUIA 1XC4A 3NQ2A 1YLVA 3EXTA 2QUVA 3QQ0A 4QSHA 4UMBA 5HR7A 1TB3A 1JUKA 5K9XA 5EKYA 4GUIA 1BWLA 3HGOA 1K7FA 2ZBTA 4NQ1A 4IX0A 3STEA 3QQ1A 1SQ7A 3G1SA 1Q6LA 4MYXA 3ZS4A 1EIXA 1XCFA 2Z2UA 4GBUA 3ZWTA 2HS6A 1VZWA 1XFBA 4MKNA 2Z6IA 2YW3A 1JCNA 1OG0A 2H3BA 2X1RA 3IIXA 4UC5A 2Q8LA 1B57A 4DF2A 3PWAA 2BX7A 1T99A 4RX0A 2EHHA 3TJXA 1JRBA 3FOKA 4FX6M 4EWND 4ZMGA 3HG5A 4NNAA 3NZ1A 3PY2A 1LP6A 2H8XA 3RLUA 3W7JA 4MZ1A 4ORMA 1RD5A 4R53A 3TXVA 4O54A 1SO6A 1Q6QA 1TPB1 3LCHA 1T0OA 3G1XA 3HQ1A 2ISSA 1OYBA 3UY7A 2A85A 2RH9A 5HWJA 2ZRVA 1K8XA 4XKYB 3KVMA 3PULA 4TO8A 1W0MA 4I7WA 2E68A 2TPSA 5LGXA 2Y7GA 4O13A 1EUAA 3C2EA 4CQ9A 3CB8A 2FDSA 3SGZA 5EMUA 4MVAA 6ALDA 2RHGA 3T40A 3HPXA 2CZDA 4YL2A 5LZLA 1LOLA 4GUGA 4CNPA 2Y88A 2VEIA 4G1KA 3W7GA 4JX6A 4A2RA 4AHPA 1QPNA 1H7RA 2WNZA 1VYRA 3GIYA 1TSIA 2JGQA 3NQDA 3CPRA 4MY1A 5HJLA 3IIPA 2A21A 1N8FA 1KTBA 3W70A 3QC3A 3PSWA 1W5PA 4MY8A 3PBUA 1P0NA 1G69A 4JX4A 2B7OA 4XZ9A 3TDFA 1GEQA 4LVDA 2VXNA 3WK2A 4DPPA 2QCNA 5F2MA 2CFFA 5LKYA 3W1PA 4K8EA 4HNNA 1H7OA 1KBJA 3PG8A 4N4QA 3KOFA 1N7KA 1IXPA 1TPH1 1YDVA 3G1AA 2YCEA 2J27A 4PA8A 1EB3A 4JTJA 4GUFA 2JKEA 2GPTA 3MI3A 3A5FA 4NJGA 3M47A 5DELA 1Z42A 3B06A 4K7VA 2BWGA 1TPDA 3FYPA 5TIMA 1ZENA 3O05A 1WAUA 3M5YA 4XQ6A 1YPIA 1ONRA 5BRBA 2PRHA 1ALDA 4JTSA 5AHIA 2ZZ6A 3A9IA 3N19B 3P5YA 1LM1A 2VENA 3LX9A 4LVAA 1O5XA 4KFNA 2YZRA 3TJLA 2V30A 2Z6JA 4FEZA 2FPVA 1KFCA 4UTMA 1YDOA 4IMCA 3NPXA 1IIGA 4RV8A 3U8GA 1KV5A 1J4EA 3S5ZA 1TTQA 1OJXA 3QW3A 3BV4A 1F74A 3VKJA 3RNDA 2QCDB 3L5LA 4JY8A 3STGA 3IVSA 3P5ZA 1FWTA 2P10A 4JTIA 4FO4A 1W31A 4JYDA 2VEKA 3NO5A 2NXIA 4UXDA 3A23A 4JNMA 3LBMA 1ZCOA 3CTLA 3MBDA 4M6PA 4RZ4A 3DFQA 3NGJA 2V5LA 2XN1A 3LB0A 3EB2A 5G1YA 3WJSA 1VC4A 5HINA 2Y63A 1PIIA 1TJRA 5I3FA 1F7BA 2CLIA 4JICA 1GOXA 3DFTA 1EWDA 4ZQRA 3LRLA 1KM5A 5IBXC 3BW4A 3DFSA 3IV3A 3LERA 3G8EA 3KAOA 1A5AA 3GYEA 3GZ3A 3UWYA 3B04A 3PB0A 2YR1A 5FF0A 2RDUA 4LS2A 3T7VA 3TC6A 1S5VA 3PB2A 1XBZA 4MUZA 2HTMA 1LLZA 4FF7A 1QO5A 2A2IA 3UWUA 1G4TA 3W7KA 3L5MA 3PVFA 3SIZA 4R34A 2RFGA 3W2KA 4FXRA 3U6WA 3DKLA 1VS1A 3GDTA 5EPDA 4O14A 4GFSA 3QZEA 1FCQA 4RZ5A 3TU9A 3HGJA 4KWWA 4LTSA 1KBIA 3CQ0A 3LI1A 1OFBA 2C18A 1OHLA 1PCKA 5AHEA 1HO1A 4Z08A 1DL3A 3JS3A 1RV8A 3ANYA 4IMFA 4MZYA 3RK8A 2WV8A 4AVFA 2VFDA 2I14A 1YTEA 1DKWA 1IF2A 2E6YA 1RZMA 2CLFA 4QNEA 3RMJA 3KRSA 4NJIA 3B4UA 3EWYA 1OX4A 2E6FA 1SO3A 2CLKA 4HSOA 4DPQA 3ATYA 1I2QA 3DAQA 2QKFA 5G1TA 1Q45A 2VFIA 3EXRA 3QMTA 1VGAA 3UPWA 2RDWA 3UZJA 1XBXA 3OA3A 4JTFA 3F03K 1E51A 2B4GA 2ZA1A 3L65A 3S8HA 2HSAA 4POCA 1W3TA 1L6YA 1M5WA 1H50A 3Q94A 4FIRA 4JYEA 3N9RA 3M6YA 4GJ1A 3HG2A 1PVNA 4WUIA 4ZQCA 4Z1DA 1G7UA 3WFAA 1SO5A 4C1KA 4IXHA 4CCCA 4JIQA 2QUUA 3GK0A 5EYWA 3MW7A 4HT3A 3TSMA 3NQMA 1THFD 2YX0A 1FCUA 4A3UA 4OT7A 3O15A 3EWWA 4U28A 1MEIA 1UBSA 5HQEA 3NM3A 3C4UA 3TR2A 3LV5A 2PC4A 3PAJA 1M6JA 1I2NA 5CPLA 3MP4A 4GRSA 2NX9A 1QCWA 4RLIA 1D3GA 3W07A 5EY5A 1L6WA 4HKPA 3DZ1A 3P62A 1BTMA 3FYOA 5C54A 1HL2A 1RQEA 3BGJA 1L6SA 2R8WA 4DXVA 3WJWA 1G7VA 4N2YA 1UB3A 5J5DA 2J88A 4N9EA 3LRMA 2YPIA 3L5AA 3OVQA 3I7RA 3BG9A 2V2DA 1V5XA 1TPFA 4IWWA 2QCHA 2E5CA 3QW4B 1FWNA 3LBCA 2E1DA 2WJZA 3C56A 3IVUA 1DJQA 3UQNA 1ML1A 4LS0A 4KFOA 3G0XA 4CCDA 2GJLA 4UTWA 2ZZ1A 4I9AA 1RQHA 1SSDA 3MYOA 3NQGA 2FB3A 1TO3A 5K9DA 2V2CA 3FS2A 3HBLA 1R2SA 2C3ZA 3E0IA 3GDLA 4WZHA 3RLVA 1OK4A 3W7IA 1P5BA 3TQVA 3W7QA 1JCXA 4DBDA 3DHFA 4M7TA 4CNNA 4E2DA 4PEKA 5K4ZA 3THAA 4IOTA 2B7PA 5F4WA 3S1XA 1QNVA 5CPMA 5U7SA 2YW4A 4O12A 4YMZA 5D38A 5KITA 5TBOA 5E0KA 5BMXA 3BW3A 1KFBA 3DKJA 2BSLA 4TIMA 3Q37A 5EL1A 4AAJA 4I7VA 2WNNA 1OFRA 4ML9A 4WXYA 2EF9A 2A7RA 4H6KA 2ABAA 3FA5A 3WJXA 3LHTA 2ZFAA 3LCFA 3QM3A 1ZALA 4JTHA 2C19A 3JRKA 3OIXA 2PCQA 3TXZA 3H53A 1WA3A 1H1ZA 4K7YA 1XBYA 1QR7A 1HTIA 1MZHA 3CWNA 3VE7A 2YSWA 1W3NA 5DCDA 1K7XA 2ZTJA 3L67A 3U2OA 5DLCA 1EP3A 3HGSA 1JVNA 2R14A 3P7YA 3TFXA 1TRDA 3EX4A 3QSTA 1OFEA 3E9AA 4EF8A 3SZ8A 3M41A 2ZRXA 2FFCA 4BI6A 4LRTA 4O4WA 2ZRYA 1GG1A 5EBUA 4LUJA 5AC7A 1FUYA 2ZTKA 1PS9A 2GVGA 5DN1A 1R30A 1YDNA 5AHFA 4JTGA 1WX0A 1H60A 3STFA 4FXSA 5AHMA 1W1ZA 1JCJA 5CZSA 1QPQA 4MJMA 1H62A 3BARA 2Y85A 2W79A 4UNKA 5D30A 3TH6A 1ME8A 4Z0JA 3UWQA 1F05A 1KTCA 1R47A 4S1FA 1SR9A 1ADOA 3R89A 1YTDA 3N2XA 2J9XA 3W87A 3W74A 4IJBA 3S1WA 4MZ8A 2XN0A 4Y8FA 4ALDA 5F4XA 5KSWA 4BI7A 3W1TA 3S6DA 3OG3A 3VI2A 2UV8G 3ZR4A 1VHNA 1WQ5A 1L2UA 4TR9A 4ADTA 3N2MA 5HUPA 3W6YA 1FCBA 1TV7A 2EAWA 1Z41A 1F5ZA 4O11A 4UFKA 1YADA 3MI2A 2ZZ3A 5D2XA 3M5ZA 3BK0A 1MO0A 3KRUA 3BLFA 3DI1A 5I3IA 4H3DA 4OE7A 2C15A 1K8YA 2EKCA 4PCFA 1EX5A 1TIMA 4K36A 1LBFA 4O19A 1OK6A 3M16A 3C0JA 1W37A 3B05A 1N55A 3LTYA 3PG9A 3TAKA 3VCRA 1XBVA 1KFJA 4DEFA 4O0KA 1AL8A 5CGQA 3C61A 3WK3A 2NXGA 4LVBA 4P61A 2O7SA 2A0NA 2X1SA 3C2OA 4UFLA 3DBPA 4JDYA 1P1XA 2X1TA 1NF7A 4AWUA 2F84A 3IIOA 3GNDA 2YDAA 1J5TA 4PC8A 4NXKA 3QRHA 1VRDA 3TX9A 4NT0A 2VFHA 4ZVJA 1LTDA 2D73A 5LHEA 1NSJA 2FPYA 4ZL1A 3C2FA 1DBTA 4BK9A 3B03A 2BLEA 3W83A 4QM1A 1H7PA 5FF4A 3WK1A 3G3DA 2I9EA 3LI0A 3M44A 4FIQA 4Z0SA 5LHFA 4GC4A 5F4SA 3P8JA 1GVQA 1W54A 3BLIA 4C1LA 3W85A 3TW7A 5CZ0A 1TV8A 7TIMA 4FB7A 2CLEA 4X3ZA 3B0VC 1TPUA 3N34A 3A5VA 4R33A 5D37A 5BMWA 3W22A 4LNYA 3B8DA 1SPQA 1TTPA 1GVSA 4QISA 1LROA 3P8IA 5E93A 5LNWA 3TQ0A 2QJHA 1QOPA 3O6CA 4OU1A 1FCVA 2CLLA 3IIZA 2CWNA 2FPTA 4ICNA 5HWNA 3LCIA 4Y96A 3DH7A 5C5YA 5F1UA 4O8RA 3HG4A 5CSRA 3W76A 1W5OA 1PHWA 5D04C 4AEOA 1TV5A 4B5NA 3P80A 2IQTA 1KLYA 2WOQA 3OHIA 4UFHA 1QPOA 4FNSA 3PUEA 5D03A 3W23A 3TW6A 3OBKA 1GWJA 1JUBA 3RFAA 4OHQA 2VOMA 3R2GA 4OV9A 4UTJA 1JCYA 2KZHA 4WY0B 5AFDA 2WSQA 3TV8A 4GE8A 4JTEA 3LHVA 2GQ8A 5TQLA 1WBHA 5IM51 4OV4A 3LXCA 4X9SA 2DZVA 2E5BA 1GVRA 1GPWA 3DGRA 4WOZA 1PL9A 3W71A 3LXBA 5DY2A 4MOZA 4AWTA 1FBAA 2A1YA 5C2XA 1OFOA 2YYTA 5K7JA 1TJPA 2V0TA 2Y70A 1LRNA 1JQXA 3W1MA 5KINA 3L0GA 3M7WA 3DFPA 4JX5A 3STCA 1VLWA 2PRMA 3G3MA 4X22A 4BWLC 2JBMA 3W84A 4GUJA 2ISWA 4LU0A 4IPJA 2J9ZA 3QH2A 4QITA 2FQIA 3GB6A 4N6EA 4N9CA 1SW7A 1KA9F 1AW2A 2QCLA 3QMSA 4O50A 4S2BA 5U4NA 4AHQA 2QAPA 2NX1A 1NF0A 1U5JA 1X1OA 3ABQA 5L6UA 2ZZ2A 4Z1CA 2OT1A 1LRTA 5LNUA 3HJZA 2ZZ5A 1CI1A 2NWSA 4GNJA 1LOSA 4NJHA 1XUZA 3EX6A 1G4EA 3IGUA 4BI5A 3TAOA 4IPIA 1QFEA 3QMRA 4CNOA 2DZUA 3P60A 5FEXA 2H3DA 4DELA 2E5DA 1K3UA 5HMSA 3TMLA 3NVTA 4MFDA 3FIGA 3ATZA 1BWKA 2NXHA 4DO6A 1VLIA 1GYNA 2A5HA 2DZPA 1B9BA 1ZAHA 4HIBA 2C14A 2DZWA 3PBYA 1OVDA 3GDMA 2J6XA 3MBFA 4U4MA 5HNRA 3S0CA 4NZJA 1H7NA 4JD4A 1OX5A 2EGZA 1A50A 2ZZ7A 1RPXA 2JGYA 4O4VA 2ZDRA 2CZEA 3LXAA 4JYFA 4E38A 4H4IA 4FNRA 2DJLA 1B4KA 1MSSA 3E49A 3G1VA 4QIUA 2LLEA 3UYCA 4LRSA 5L9FA 1FXQA 2FTPA 2ZZ4A 4O15A 4OWGA 1TQJA 3S1VA 1EP2A 2JK2A 1SO4A 1IGSA 4MLJA 1TCDA 3A22A 1EPXA 4O1CA 5GVJA 1FWRA 2PRLA 4RKAA 1B3OA 3D0CA 3L68A 4LV9A 2OCZA 5AYZA 5I3GA 4UNLA 3W7RA 2I1OA 3CT7A 2NWRA 1P0KA 4CCEA 2E77A 4N02A 4LC6A 2V81A 4YWIA 5LNRA 3W7OA 3GXNA 1U83A 2ZRWA 1ICSA 1KM1A 2E6AA 2NUXA 3LTSA 3W7PA 3O6DA 3W73A 3CM4A 1OX6A 3UXAA 2A6NA 3AO0A 3L66A 1SSGA 1O95A 1WOBA 3F1QA 5CZJA 1LCOA 1BEUA 1D9EA 3KX6A 5C55A 4UIOA 4HHPA 1XL9A 3GDRA 3HF3A 4O53A 4HNUA 3NQFA 4NJKA 3MHUA 1DORA 3NA8A 4XWUA 4IMGA 2OJPA 3UPBA 3S5YA 2ATSA 3P84A 1GYLA 2GQ9A 3LHZA 3SJ3A 5LSMA 4IMEA 3IEBA 3ABRA 1YTKA 2V82A 4E2BA 1ICQA 1LZOA 1G4SA 4JS3A 1FDJA 1PV8A 1F2JA 3GX9A 1SU5A 4FNPA 1VQTA 3TNOA 3KHJA 3PSVA 3C8FA 1FY6A 4YCOA 1VCVA 2PURA 4HPXA 5D05A 5AHNA 3NOEA 3NZRA 3MMTA 3TQKA 1TTIA 3F4WA 2NUWA 3A24A 2Y7EA 4OQVA 2PE4A 3NQVA 4L4MA 3YPIA 3QFEA 3W2LA 2VFEA 5K9CA 2V5BA 3NNTA 2W0UA 4UFMA 3EKZA 3W2JA 4UMAA 4AF0B 2WO5A 4UCGA 2YFNA 4FNQA 2P1FA 4PH6A 3NL5A 3EWZA 1GTHA 3CWOX 3G18A 1MEWA 4K39A 3L9CA 4WX2A 4JR5A 5C6MA 3W2UA 1AW1A 3GXTA 2BXVA 1LBMA 1O94A 5AYXA 2BTMA 1XKYA 3N14A 4LC8A 5K3VA 1EA0A 1SW0A 3HMJG 1HUVA 2B7QA 3GXPA 2G96A 4UTLA 3PUOA 3QF0A 4DQWA 4NXSA 4TMBA 2VKZG 1ZAIA 3L0NA 1T96A 2Y6ZA 4XUGA 4HNTA 1W5NA 4BFAA 5DBUA 1H63A 4IMDA 5DXXA 3O16A 5H91A 1XM3A 2FIQA 1AMKA 2OX1A 2CLHA 5LGZA 5HWMA 3P82A 2P0OA 4RXFA 1Z48A 3S5OA 1S3HA 3NYZA 1H61A 2CLMA 2CZFA 1A5CA 2V8ZA 3LCLA 1OX4B 1KFEA 4M5PA 3LHWA 1RQBA 1PHQA 1VHCA 4K6AA 2DP3A 3DHDA 3LHUA 5EA9A 4O1AA 1DQWA 3WJZA 5HR6A 3SW6A 1K8ZA 2QCEA 2TYSA 4O52A 3DU0A 1BKSA 2FLIA 4LUIA 5FF3A 4HSNA 4TX9A 3OEXA 1UUOA 4ZQPA 5F1VA 3R8RA 3ZWSA 1I45A 1TPEA 1I2RA 3TFCA 2Y89A 3LRKA 1LOQA 2R91A 3EX3A 5AC8A 3VNDA 1H7WA 2NUYA 5K4XA 2QDGA 3ABSA 4UTHA 2ZYFA 3TIMA 4LW7A 3UY8A 2OMAA 2DZXA 3G1HA 1SZFA 2DU2A 2QAFA 3MUXA 1EP1A 3CC1A 4CQAA 5AC6A 3HPSA 1QAPA 4D2JA 2G97A 2V9DA 1ME7A 3NQ6A 3NXFA 3NQ7A 1FDYA 3EKLA 3GKFA 1A5BA 4QQ3A 1ICPA 1SZGA 2E09A 1ZAJA 3LOTA 1IXNA 1O5KA 3O07A 1KM4A 3HGRA 3M5XA 4BR1A 4A29A 3UWWA 1GG0A 3W7MA 4LVFA 1CX9A 2J9YA 3NQAA 3MO7A 3MP5A 1L9WA 1QDSA 5D32A 3NEVA 3W2MA 1D3HA 3RU6A 3SR7A 1W3IA 3C52A 4KFPA 1MEHA 4O16A 2CW6A 1G67A 1LBLA 4L4LA 3W1XA 3CHVA 1EEPA 3N9SA 2X1UA 3M5VA 3T55A 1F6PA 1VJIA 1AK5A 3SFKA 6TIMA 4M19A 4NVTA 3HOJA 1NAL1 5FF2A 4N9DA 2A6LA 5T26A 3Q2DA 2CLOA 4LT9A 4MLRA 1GJPA 2DZSA 3LCWA 5KTLA 2Y7FA 5I3JA 3P61A 2HMCA 3G1FA 3PR2A 3CEUA 4NU7A 4UR7A 1WV2A 3W9ZA 3W1UA 3BGGA 3QEZA 1YXCA 2VELA 4QNWA 1GQNA 3NR0A 2WNQA 3EXSA 4RXGA 2QCFA 3NPVA 3QYQA 4MPQA 2ISVA 1KV8A 1KLZA 1W5QA 3INPA 1UJPA 4IX2A 2YGYA 4JTKA 4WQ6A 4UMCA 4AB4A 3LHYA 3QPZA 4R7JA 3MWAA 4IGHA 3W1AA 1W56A 4GWEA 2QJGA 2NX3A 2B0MA 3M43A 3IGSA 2FJKA 1P4CA 1JUEA 1WBJA 3R5EA 1AL7A 3KVKA 4X2RA 5DCBA 5AOUA 2YXGA 4YXGA 3Q58A 1M7PA 3QPYA 5FI8A 4WY0F 2GUUA 3P67A 3LCXA 4WY0A 3V1PA 1VCGA 4JIPA 4RK8A 3G0UA 4IXXA 5G4WA 1A5SA 2ALDA 4ORIA 2A7NA 3W7EA 1H51A 3HIJA 5BW6A 3W2NA 5FESA 2DJXA 2H90A 4O57A 4UTIA 3TMQA 2CU0A 5D2WA 3B0PA 1FX6A 3DFOA 1VYSX 2GJNA 1DVJA 2YFOA 1F6KA 2NLIA 4ONVA 1KW1A 3C3NA 1PCWA 2GVJA 2OZ0A 3G1YA 3NL6A 1GVOA 4HPJA 2TMDA 2QF7A 4P2VA 1WDWA 2QR6A 4JY9A 3CLMA 4UR8A 5I3KA 5ABTA 3LLFA 4EF9A 3IGXA 3BG3A 3HG3A 3C6CA 5LNSA 4PTNA 1LLWA 1RVGA
chains in the Genus database with same CATH superfamily
1LL4A 1TV4A 3DG3A 2VX6A 1R2RA 3OHMB 5T8GA 3LBOA 1V51A 3FJ6A 3BG5A 4URIA 4ERAA 1R7OA 3U2ZA 4AZBA 3LY0A 4PMZA 2IQDA 4Q4MA 3PJTA 2C6QA 2HV5A 3GBDA 4EIVA 1Y8BA 2FZDA 4XZHA 5IDIA 1A3HA 1HJUA 3SGUA 4ADUA 1LJYA 4W9TA 2J66A 2PF0A 4L1WA 4B91A 3H21A 4HMEA 1PBGA 2AMXA 5CG7A 4EXQA 3ITGA 2SFPA 3WQ4A 4M56A 1W2VA 2ZCGA 1QK0A 1T8XA 4M6QA 2G3JA 1K7EA 4Q4KA 3VNYA 1OFQA 1BRLA 3ARZA 3BAXA 1C91A 4F0KA 3H4WA 1Q66A 4Q4QA 3E5PA 1H7XA 1UHVA 3TC7A 4GQQA 3W24A 3S2JA 3APYA 4QLKA 3SM0A 3EWCA 1UH3A 4Q33A 2C91A 1D7FA 4A2SA 3O6YX 1MDLA 1E43A 3TA9A 2RDTA 2W6RA 3F2BA 4RZ6A 3MI6A 1RY0A 4UTUA 1ZFJA 1B4EA 2YYUA 1NDYA 3EX2A 2GQAA 4KWVA 1TMHA 3TTYA 1KM0A 3CUJA 3OA5A 2OVLA 3WNMA 3WK0A 3TTEA 1D8CA 3OJGA 3UZ5A 5T91A 8TIMA 4G1NA 5DMYA 4WJEA 3TC3A 4HNOA 1YYAA 2PDUA 2Z4GA 2AKMA 2C71A 3NQCA 3MJMA 4XX6A 2F7FA 3U5UA 3W88A 1WXJA 4IQLA 3NYDA 2FVMA 3G0SA 3I65A 1R2TA 4AWSA 1LF1A 4H6QA 2WSYA 4NI3A 1TRIA 4YHGA 4BF9A 5FJJA 3W4RA 2DZTA 1WYIA 2XH0A 3GR8A 4KIEA 4GVGA 3GTXA 1QI0A 1W32A 1KXHA 3FVDA 2V3EA 4J9JA 3G22A 3TUUA 2QVNA 2BVTA 4NNBA 3LPPA 3PTQA 1OFDA 3TSDA 3H12A 3CQHA 4XBKA 3MP3A 4QJ1A 3NPWA 4S3KA 1ZB5A 3BCFA 4KRTA 2VQUA 4OIFA 1LYXA 1NFGA 4W84A 4JTDA 2RJHA 3H23A 2QHAA 4HA3A 1CYGA 1RJQA 4ZXOA 3ZOAA 3FEMA 3EEGA 3FVMA 1ITQA 4KQNA 3I3DA 4W88A 1KR0A 4P7LA 2TSYA 4L6OA 1DV7A 2X16A 2EG6A 1KTNA 3USBA 2XFRA 3BLEA 4FR1A 1VR6A 2QUTA 2QCGA 3S5NA 5AB3A 3GIPA 1OF6A 4MKVA 4I8DA 2OOGA 1OSEA 4E0CA 4REQA 1QMLA 4CNTA 1O60A 3UESA 3S6TA 4LSBA 3PBWA 2VC9A 5B7ZA 2Q3OA 5LA2A 5D2VA 1EBGA 1YPFA 1W17A 4NG3A 1GKQA 3BW2A 5F2IA 3HPZA 4JZ5A 1YXYA 5FAGA 3RCMA 3ZIZA 3LS9A 4JXCA 1WUFA 3AU2A 5F2LA 4PL1A 1DJNA 5M1TA 4J3UA 3GR7A 3DI0A 4AYSA 4AZ6A 1ITXA 3GVQA 2ZA3A 3T09A 4BQ3A 4FHAA 3WQ5A 5FOOA 2DZAA 2QF8A 3PM6A 3WD4A 1GHRA 4PRRA 3VABA 1K8CA 5BROA 1UKSA 1IEQA 3NAVA 1F76A 2J8GA 1HG3A 1OYAA 3H54A 1YHTA 3K2GA 1ME9A 5A6BD 2Z7KA 3CJPA 3CWHA 3MHFA 1DOSA 1XRFA 3ZT6A 1RA5A 2ZRUA 4UQCA 3KZPA 4MY9A 3AIEA 3GD6A 4F0MA 3OVPA 1XDLA 2PF8A 1LG2A 1TWWA 2CITA 3S2LA 1FWWA 5D2YA 1Z44A 2I5GA 3U4FA 5AC4A 2ZX7A 1VBHA 4WD0A 1CXHA 4US5D 2VX5A 3T81A 1S5MA 3NQEA 3SB0A 1MMFA 1OT1A 1I8JA 3HV9A 2IQ0A 3RF9A 3BVJA 1TUXA 3S6OA 3L21A 2ACQA 4DBWA 4ZSUA 2HXUA 3KBSA 4NJJA 2ZRZA 5A6BA 3R0DA 5AYYA 5IDZA 1C7SA 3SI9A 4Y8EA 4CKQA 1U33A 1R8LA 3PF3A 4M81A 4HMCA 2H8ZA 4UQAA 3W7LA 1V77A 4HN4A 4PL2A 1JDCA 5BOOA 3DFNA 2EPHA 4WGXA 2H6RA 1J9YA 3BE7A 4LGXA 3WNKA 1YRRA 3A21A 3FW6A 4IIBA 5ABGA 3BANA 5A8OA 2QJIA 2BXZA 3FKKA 3BUVA 2BHUA 1AQFA 3F2CA 2JE8A 3EDEA 1DWAM 4XB3A 3C0SA 4GYFA 1E6QM 3THDA 2V3DA 4IUOA 4RNHA 5JIPA 4CLMA 2XISA 2AGKA 3R6IA 2WVVB 4A8RA 1SZNA 2I7GA 5KZMA 1UUMA 3M0ZA 2HRWA 4O0ZA 3TCSA 3KFTA 3BLLA 2WMGA 4ZQNA 1DWFM 2QCDA 3BO9A 4YVPA 1LDCA 5EMMA 3LLDA 3ARWA 4KW2A 2E8ZA 4WIWA 4OFCA 1C90A 1GQJA 1T5AA 2G3IA 2C16A 4CEUC 3UR7A 1LRQA 4JTLA 5E6YA 2RKXA 3AWOA 1HIZA 2FFIA 3MZ2A 5XINA 2G37A 4GKTA 4IIEA 3JR2A 7ODCA 4HK5A 4NX0A 5I3DA 1HW6A 3WBEA 1QVBA 1QI4A 4S38A 4UUIA 1XC4A 2ZXDA 4EP8C 3AYTA 4TV6A 4A3RA 3CPGA 3CNYA 3QQ0A 2EPLX 4DHGA 4GZEA 1TB3A 3L23A 1JUKA 5K9XA 1HJQA 1UWQA 4GQ0A 1FWCC 4NQ1A 2Z7GA 3STEA 1XLLA 2ON3A 1US0A 3VIPA 1SQ7A 3USZA 3MDWA 4FA3A 2F2KA 3NOYA 1NOUA 3SUUA 5CQ1A 1M53A 3C86A 2HS6A 1VZWA 4H9VA 1GUVA 3V5CA 4MKNA 5C9UA 3QN3A 4XIAA 2Z6IA 2YIHA 1WZMA 3IIXA 1B57A 3WDJA 1T99A 3TN3A 3KOWA 3TJXA 1IQ8A 3DC8A 4ZMGA 2E0PA 3HG5A 2DSZA 3W7JA 2W91A 2OSWA 4R53A 5HMDA 4YTSA 1ENUA 3AU6A 3S2NA 3G1XA 1ZBCA 2ISSA 3H2NA 4PCPA 1SJBA 4PMOA 3GIQA 4XKYB 3NZPA 2ZXBA 2E68A 3EBVA 4GO8A 1EUAA 3CB8A 5EMUA 4LF2A 3T40A 3HPXA 3GU1A 1E6ZA 5LZLA 4IH3A 1LOLA 2ACUA 4GIAA 4CNPA 2VEIA 4G1KA 3W7GA 5I00A 1FWIC 4A2RA 1XYFA 4AHPA 2WCAA 1VYRA 1TSIA 1CGYA 2JGQA 2Z26A 2WPGA 1XIEA 4MY1A 2CCRA 3W70A 3AMKA 1BVWA 1Q8JA 2B7OA 2ZUWA 1JZ6A 4UNIA 4LVDA 3WENA 4Q7IA 1VB9A 4J5NA 3TTSA 3U2EA 1RBAA 4PUMA 3T0BA 3OLIA 3AHTA 2PC8A 3W1PA 3N2OA 1P7TB 4EK7A 4I6VA 3LU2A 4CN4A 5D4YA 2J27A 4PA8A 4BZYA 4JTJA 3MI3A 1KC7A 2PDQA 1KR1A 3OZYA 4CEXC 3I4EA 3N4FA 3O7UA 1XPGA 1TPDA 1ADDA 3FYPA 3OU8A 2QT3A 4IIFA 4XQ6A 1BXNA 5BRBA 2PRHA 1L0PA 4PZVA 4L80A 1A4MA 4XZMX 3KP1A 1WE5A 3N19B 3UPMA 3P5YA 3ARRA 2VENA 2Z1VA 4LVAA 1W9XA 3TJLA 1QI3A 5ABHA 1NWSA 2PGRA 3CH9A 1IIGA 2X41A 2WC7A 5F7UA 4UOZA 3T0DA 2BGQA 2BVWA 1RALA 3B97A 3WF2A 3SADA 4A8LA 1QNRA 3RNDA 1ECQA 3T0CA 3STGA 4WDWA 4DUOA 4LALA 4HGXA 4ZOBA 2YL9A 3BL3A 1W31A 3WMBA 4WRHA 4UXDA 3A23A 4JNMA 3H4XA 1ZCOA 3CTLA 3Q4DA 4KWSA 1RCOB 3UNTA 3BLPX 5FJIA 3L4WA 4BCEA 5FIPA 3FDGA 3BW4A 4TVDA 3GYEA 1MNSA 1JAEA 1RK5A 3B04A 1QW8A 4Z1YA 3PB0A 2ANUA 1V6WA 2X09A 1I6NA 4AZHA 4J3VA 1UIPA 1YKWA 1LWJA 3GTHA 3GZAA 1XKJA 3BCJA 1O5QA 3PWGA 3ES7A 4MUZA 2OZTA 1X6NA 3CASA 3UWUA 3HQNA 5CCZA 3LUTA 1ISZA 2BFGA 1P6BA 2RFGA 3U6WA 3DKLA 1C93A 5EPDA 1W2PA 5E09A 4L6HA 4GFSA 1N2VA 4FMVA 3DDMA 3AI0A 1EJWC 1N82A 3TU9A 1UG6A 2FVLA 5CC7A 4CVUA 3OQ8A 4DJED 1J6OA 1XINA 3CQ0A 4ZR8A 2C18A 1HO1A 3AIVA 2G3NA 4NL1A 1JPDX 4MZYA 4DJDD 4AVFA 3CAVA 1DKWA 2E6YA 1ZJAA 3M6DA 3AXMA 3PPCA 2YCJA 3H7UA 4MWAA 4ZB2A 4V15A 2O0TA 2E6FA 1SO3A 4IFRA 1QI2A 3PAOA 1Q7QA 5E5CA 4YTTA 4HOWA 4AFYA 1N8WA 1XBXA 4H01A 5T9BG 2ZA1A 4POCA 3ABZA 3NO1A 3N9RA 3HG2A 4HTBA 3L7RA 4WUIA 1MRAA 4C1KA 1G7UA 4CCCA 3GK0A 3MW7A 1THFD 2YX0A 3B40A 1LWIA 2V3FA 1EDTA 3EWWA 1UBSA 1MEIA 4OBRA 1E1EA 4TV5A 2PDLA 4NYYA 3C4UA 3PUGA 4LUSB 4MB3A 1Z3NA 3WDIA 3PZVA 3QV9A 3WLJA 3SEPA 1ZCCA 3DESA 4W93A 3UJEA 2GK1B 3WJWA 1EZ2A 3WUEA 4N2YA 3WO8A 3WSUA 2J88A 3LRMA 3OGVA 3OVQA 4RDWA 3MT1A 3BG9A 2V2DA 1J8VA 4GYPA 2WJZA 1JFHA 2VDGA 3IVUA 3WDHA 3UQNA 4KFOA 2YB4A 2GJLA 3GG8A 4UTWA 3QV8A 2ZZ1A 1R9XA 4I9AA 1TO3A 4AXNA 2V2CA 1FWGC 1QOXA 1MUWA 3HBLA 3JW7A 1F07A 3KTSA 3GDLA 1KXQA 5BOEA 3NSXA 3W7IA 4ZOEA 1PWLA 1EFZA 1Z8AA 3GW3A 5HMFA 2OFJA 4JQ3A 4YU1A 3UW6A 3L2LA 5MF5A 2ZADA 4IOTA 2EBNA 5DRCA 5U7SA 1FVPA 2YW4A 5KITA 1KFBA 2E28A 2WNNA 4WXYA 3KBNA 4R27A 1BPLB 3R43A 4B5SA 4UQEA 3VOGA 1WZKA 5HQMA 3QM3A 4XAGA 4WDXA 1ZALA 1CTNA 3HZ3A 2GGEA 2PCQA 3H53A 1HT6A 1WA3A 7TAAA 4QJ4B 1OGSA 3WLNA 3CWNA 2Q01A 1W3NA 3BH4A 4H04A 4E2OA 2FGLA 4D6IA 1K7XA 5JH2A 6TAAA 2PD9A 1W1B1 3U2OA 1EP3A 3TFXA 1TRDA 3EX4A 4EF8A 3VMNA 2PLJA 3N4AA 4O4WA 1ZBKA 3LENA 4HNLA 3ZLFA 2MANA 3WNPA 5DN1A 2D69A 3B8IA 2QJNA 4EWJA 3STFA 3Q65A 3KLKA 3WQOA 1W1ZA 3KCJA 3KS5A 2D2HA 2Y85A 3BAYA 4XK2A 2O9TA 4Z0JA 1F05A 1KTCA 4S1FA 1SR9A 3RLGA 1H1NA 3R89A 3N2XA 2J9XA 4G2DA 3W74A 4ZODA 4Q7BA 3KOZA 4A35A 4P7OA 5KSWA 4W85A 3S6DA 4ZBCA 4XSLA 3R7MA 3QY6A 1L2UA 4G5DA 4JQ4A 4C65A 1J01A 2VZVA 2BV9A 3K1DA 5BXPA 4O11A 2VURA 4UFKA 3MI2A 1LT8A 2ZZ3A 2TAAA 4GVHA 2VEGA 3M5ZA 3VOIA 3BLFA 3NVDA 2HEJA 4OE7A 2C15A 4DJDC 4PCFA 2HVNA 5GQBA 1LBFA 4O19A 3UETA 3C0JA 3OG2A 4KCTA 3KRBA 1GORA 3IK2A 2CKRA 5A6LA 4ROQA 2O7SA 3VXGA 2A0NA 3EPMA 3AOFA 3R25A 4NZ1A 4JDYA 3RRAA 1KXVA 2F84A 1BYBA 5I77A 4L61A 4Z2GA 1IZKA 1DP0A 1YBQB 4NT0A 3WLPA 1GGOA 3URBA 2VFHA 3UG4A 1LTDA 2D73A 1BVNP 1NSJA 2FPYA 2VZUA 4MDOA 4BK9A 3CPUA 3WK1A 4Z0SA 1XSJA 1GVQA 2G3FA 2DVTA 1JFXA 3QYSA 2E9BA 1PO9A 2DDXA 1HGYA 2PFHA 3U9IA 1OBAA 1TV8A 4FB7A 2CLEA 2PA6A 3B0VC 1L6FA 1TPUA 3B8SA 1UH2A 4JKKA 5D37A 1ZJHA 2Z1KA 1JZ3A 5H8UA 1TTPA 4EPDC 1JYWA 1GVSA 2PWVA 2X7VA 1PUDA 1LROA 2HVMA 5E93A 2QJHA 1QOPA 1L6GA 4OU1A 3VOHA 2R9RA 1FCVA 5BU6A 3NEHA 3LCIA 4PYSA 1F3TA 3OIHA 3MTWA 2VX4A 1TUFA 3O0KA 3HG4A 3WL1A 2W92A 3E2RA 1EYEA 1TVNA 3TLQA 4N7QA 1PHWA 4ICMA 5ABEA 2P3ZA 4YHEA 1EH9A 2PTZA 3ALFA 2WOQA 4FLRA 3OHIA 2WC4A 3N13A 4WVXA 4FNSA 1R6WA 3LN3A 3EDFA 1D7KA 3TW6A 1JZ5A 3WH8A 3B9NA 4OV9A 2FHBA 1KCLA 2IXVA 2I16A 4CN6A 4JTEA 3KBWA 1EC9A 5TQLA 2DZVA 2WJDA 4H9MA 3MCOA 3AZSA 1PL9A 3W71A 3H2FA 4MOZA 2GWNA 2AOSA 3VNJA 5ABFB 1XD1A 1TJPA 1HF6A 3TTQA 4CCZA 1PZ2A 1JQXA 3AS3A 3W1MA 3DFPA 4X22A 4XAFA 3LNMA 3LQGA 3H2MA 4OOZA 5A2AA 1ISYA 4DWSC 3GB6A 4N9CA 4EXAA 3QMSA 4X61A 5U4NA 4AZGA 4C6QA 2OSXA 4ICCX 1X1OA 1TR9A 2ZZ2A 2WK2A 6XIAA 5LNUA 3WELA 4WSKA 1CI1A 2DV0A 2NWSA 1KGUA 2F6KA 4WHBA 3OLGA 1XUZA 1TA3B 4IQEA 1G4EA 3IGUA 1QFEA 4CNOA 2DZUA 3P60A 4DELA 1K9EA 4REQB 1K3UA 5HOSA 3NVTA 1D8WA 3ATZA 3KOXA 1BWKA 3NQBA 1GONA 4DIAA 4DO6A 3URQA 1WPCA 4WR3A 3T6CA 3PBYA 2J6XA 3U5YA 4JD4A 3EMCA 3VTRA 5M03A 1A50A 1EGZA 2CZEA 1AJ0A 1W1IE 2DJLA 3IACA 2D2OA 3W29A 3IGHX 2LLEA 3IJ8A 1RBOB 4AY8A 1WKDA 2OGYA 1EP2A 3FJNA 2V5DA 1JF5A 1O1ZA 2GVEA 2PDFA 4X2PA 1NP2A 4O1CA 4P7RA 4ZO6A 3WH9A 2PRLA 9RUBA 1EA9C 3TN6A 1LWHA 4GI8A 1XYCA 3KE0A 4ERGA 4MTVA 3WQ8A 2ZVIA 2E77A 4N02A 3DBNA 3EOEA 4YWIA 5LNRA 3W7OA 2CBVA 1LG1A 4U33A 1ICSA 2OU4A 1KM1A 1P7TA 3UJSA 3KBMA 4DXKA 4F2TA 3CM4A 3GU2A 5JUVA 4F0LA 1QPKA 2PDNA 1SSGA 1WOBA 3XIMA 4LXFA 2OO6A 2DIEA 1BEUA 1D9EA 4UIOA 1XL9A 3NQFA 3F4CA 4NJKA 2WC3A 3MHUA 4PBFA 3TJIA 4XWUA 3BV7A 3S47A 4WSHA 2AL2A 2VGFA 3CH0A 5LSMA 3ARVA 4E2BA 1ICQA 1IT0A 3TYBA 1FDJA 3CUXA 1O1HA 3DIPA 3GX9A 3GG0A 3WD3A 5FJRA 3NURA 3C8FA 3FSUA 1FY6A 3N2BA 1CECA 4H2CA 4YCOA 1J79A 5AHNA 3NOEA 3NZRA 5LYRA 2WJEA 2HWGA 2J78A 4DBUA 1M03A 2Y7EA 4GK8A 3AYSA 2VFEA 4IFOA 2V5BA 4UFMA 4LH8A 3N2CA 2PDMA 2KAUC 4V27A 2BHZA 4AF0B 1KCZA 3ITCA 1XW8A 3M0JA 1GTHA 1XLGA 3CWOX 3G18A 1HP5A 5HNTA 1AW1A 3GXTA 2QZRA 1A49A 1LBMA 1CT5A 7PTDA 1REQA 1HN1A 1SW0A 1QWKA 3HMJG 2B7QA 3A6OA 3QQWA 2QGYA 3GXPA 3QF0A 4EE9A 4TMBA 1A5KC 1FP9A 4HZ6A 1T96A 3RMEA 2E4TA 1A47A 4GI6A 4IMDA 3O16A 1AMKA 3CIVA 3ZLHA 5I6SA 1IT8A 1W9VA 2FZBA 5HWMA 4RXFA 1FWFC 2CXEA 2D2JA 2V8ZA 1OX4B 2CXGA 4AD5A 4I6KA 4MB5A 3VIGA 2TODA 4ILSA 4O1AA 1EJ7L 1DQWA 1UD8A 3SW6A 3SCRA 5BRQA 4KETA 1CLKA 4O52A 1BKSA 2FLIA 4LUIA 1UW9A 4ZQPA 3R8RA 1CGXA 2YBVA 4AISA 3AWNA 2VCAA 3LRKA 3MKVA 4RE4A 1Q4WA 3IRSA 5AC8A 3VNDA 1GVYA 3Q67A 2Z28A 1HKMA 5K4XA 1TWSA 3NIYA 1OZQA 4JCMA 2ZYFA 5TD4A 2J7DA 2OMAA 3G1HA 1SZFA 2NQJA 1EP1A 3CC1A 4YPJA 3HPSA 4L1GA 1R86A 3AMDA 4D2JA 2XSAA 1FDYA 3NQ7A 1A5BA 1ICPA 1ZAJA 3N17A 1O5KA 3IAPA 2A3CA 3QR1A 4HU4A 2GDUA 3ONBA 4A29A 1KO0A 1DIOA 3M0LA 3UWWA 4QE4A 1IEWA 1UOKA 4LVFA 2J9YA 3NXLA 1L9WA 3UP8A 4DVOA 1S3TC 1QDSA 1QNSA 5D32A 3NEVA 3WN6A 3C52A 3L4ZA 1G67A 3W1XA 4JFSA 3QOMA 2X05A 2OG9A 4OECA 2WSPA 3TWAA 1WKYA 3T55A 1F6PA 2RAGA 1AK5A 3WQWA 1U30A 2J7CA 1NAL1 5FF2A 2PLKA 3N4EA 2A6LA 5EFDA 4MWAD 5T26A 5TF0A 3G6MA 4DZ5A 2Y7FA 2BDQA 4AU0A 1LUCA 1FWBC 1V6TA 3IS4A 3AROA 3PR2A 1UZDA 4NU7A 3UR5A 1WV2A 3MMUA 4DLMA 3W9ZA 2YB1A 2VELA 1GQNA 3NR0A 2QCFA 3GBEA 1KLZA 3INPA 4E4UA 1UJPA 4IX2A 3SQMA 3FGCA 4WQ6A 4UMCA 5H8MA 2CC0A 3CV1A 1XFCA 4FXJA 2Z2BA 2CKSA 4XZBA 2CWXA 3IGSA 3ENLA 4GACA 1E4MM 4X2RA 3SUWA 3ZSTA 2POZA 5DCBA 3VCCA 4YXGA 4LX4A 4QG9A 4ACYA 5CGTA 3GXFA 5FI8A 4UZSA 3W25A 3BLKA 1CXIA 2OLHA 4P8VA 1NARA 1VCGA 3FJ4A 2QS8A 4DN1A 2E8YA 4XZLX 3H8AA 1LLOA 1OT2A 5FAJA 4IXXA 5G4WA 1A5SA 5XIAA 4ORIA 3W7EA 3PPHA 1H51A 3HIJA 3BICA 3W2NA 2CHRA 5FESA 1AQ0A 2H90A 1K9FA 4UTIA 3TMQA 5D2WA 4Z17A 1VYSX 2WLZA 1BXBA 3BAIA 3VD4A 1PCWA 1AJ2A 2WMJA 4DB7A 4MSSA 2QR6A 1E0VA 1X98A 4KEVA 2ZWYA 3CLMA 2W4XA 3C6CA 3WLHA 1V0MA 4PUWA 2YL6A 1QW9A 3VOJA 5J5RA 3WQVA 4D6EA 1H0GA 3NDOA 4AX6A 1K02A 1VYPX 4Y9PA 5CEWA 2DT3A 2BVDA 1QOQA 1TZ7A 1IZCA 3NL3A 3PZQA 3DYMA 4O17A 1IEXA 4I9JA 5JMUA 1F3WA 3CHFA 2C0AA 1IIHA 4PSPA 1CGWA 4U2ZA 4ZSTA 1VF8A 2A7PA 2VM8A 4KBXA 4Y9AA 1XLBA 3VE9A 1ISXA 3TN5A 3GLCA 5G1MA 3BOFA 1BG4A 4GQGA 3KXQA 1W91A 3RAOA 3H55A 2PDHA 4HP5A 3NDYA 5AC5A 3UCDA 3HPFA 3CV7A 4MNMA 1AG1O 4LV4A 3B9AA 2WZTA 3O8AA 2EG8A 3VZYA 3VKCA 3B8UA 1G6CA 1S2CA 2Z24A 1R3TA 1R5YA 4MIMA 1S39A 4UOJA 4GCXA 5EFFA 4NUWA 2R94A 4LB3A 3ZJ8A 1PKMA 3GDKA 3TKFA 2BG5A 5A8GA 1UR9A 5E0FA 4E6MA 5BNKA 2ZX6A 3E0FA 2PPGA 5BZAA 1ODUA 4YWSA 1V0NA 2GQ3A 3R12A 1CENA 1J18A 2O9OA 2C13A 2YA2A 4H8HA 4UFJA 1JZ7A 3W82A 2OSYA 4LWWA 4DF1A 3GWQA 4UFIA 5H2ZA 3SGGA 1UWUA 1ZNNA 1AD1A 2XH7A 1RR2A 4RPQA 4PMNA 4LY8A 1SR0A 5M5DA 1TTJA 3FLUA 2BXYA 3GUGA 4MG4A 3W7DA 5MHBA 4AIBA 3ZT5A 1Q6OA 3RRXA 3V18A 5DY3A 2WSKA 2HS8A 2ZE0A 5KZDA 1SMDA 4ZB0A 1S46A 3CIXA 4LUTA 4XKMA 2VC7A 1X1NA 1K77A 3UNDA 1CB7B 1TIWA 3TYZA 1NY1A 1WXZA 2WWCA 1KFWA 1TPWA 1XLHA 2VGIA 5D09A 3CHCA 3EX1A 7REQB 3TNBA 3IRDA 2Z29A 1SUXA 1ZHAA 3FV9A 1CEOA 3B9EA 4AXKA 3O06A 4AYGA 1FA2A 4GX9A 4W8LA 3JZUA 4HPGA 3SO7A 1WUEA 3KWSA 1UASA 1KFLA 4GISA 2BGNE 4HYVA 1EJTC 4Q8VA 1KQZA 4IPPA 3LDVA 4C7FA 1WKFA 1RUSA 2WHJA 4LS1A 3REQA 1Q63A 2NQLA 3MSDA 2Y61A 4AX7A 3UXLA 1KM2A 3OYZA 3VMPA 3D46A 5G2WA 4R88A 3B0UX 3KVLA 3PBGA 5HBFA 4RCXA 1GPFA 2YA0A 1KM6A 4PMVA 4K8HA 3DENA 4M24A 3XISA 5I3HA 1J0JA 2ZIDA 1UD6A 1OY0A 2C79A 1ONXA 2H9AB 4JN7A 4HA4A 3QSRA 1E71M 3SSJA 2G5WA 3CYJA 3ABXA 4N9BA 4CQ8A 3T44A 4IGSA 4H19A 3ANUA 5CPNA 3IJDA 2D24A 1JRCA 3URAA 1AA1B 2F61A 3HM7A 4FNUA 4XTDA 1BKHA 1R3WA 3BAWA 4NNCA 1KXTA 2ABBA 2QYGA 3KBVA 4CD8A 2EPOA 1QJWA 5BXTA 4L9YA 2DSWA 2Y62A 3HB9A 3UU0A 4ROPA 4DLFA 5SWUA 3AXHA 1JYNA 2WZMA 1VRXA 3PBVA 1QATA 4W87A 3NQ8A 4NF7A 1CXLA 3ELFA 3N6JA 2B31A 1Q85A 3MHGA 4RJEA 2O55A 3VUSA 1XI3A 2P8BA 5CBIA 3W7NA 1UYQA 1I9CB 1G9HA 5FF7A 3G8RA 5CJNA 3PP7A 4UTTA 4K1GA 3A12A 1GZGA 1E6NA 1ZRQA 4AD1A 3V75A 2PWEA 2OYKA 4IG2B 2J79A 1X1ZA 4Q32A 3E2QA 1HFBA 3GXMA 3PWIA 5AN7A 2W27A 3AUOA 4MJZA 4I5XA 1FDZA 1JD7A 1SJAA 4TVCA 1GW1A 2XN2A 3TA6A 4HNVA 1XDMA 4DXXA 3UWZA 1GVFA 3BAJA 3C2RA 1V6VA 3RGTA 1IV8A 4EANA 1VPQA 1B1YA 1FWDC 4JN6A 3H2CA 1A0EA 4KRUA 4PODA 3GC2A 2R1KA 2Q3RA 1RK6A 1V3JA 1IXQA 1HKVA 3F4NA 1AW5A 1EOKA 2WMHA 2VEFA 4YYFA 4Q8PA 3PUDA 1LT7A 4FNTA 1H1YA 3TROA 4HCLA 3WBWA 4H9UA 4DJEA 4Q8TA 5TNVA 3W72A 4MADA 4PMYA 1GVIA 3EMQA 3EWDA 4QS6A 3AS1A 3VC6A 3M4HA 1BYAA 3BOLA 1DXEA 3ANVA 5BXRA 1FH7A 1ZY9A 2R1PA 3C2VA 2GDVA 1UR3M 4DO4A 1WKEA 3TP4A 5AECA 5GPRA 3TYEA 1EUNA 1U2YA 5FACA 2RUSA 5G4EA 3VKAA 3EOLA 3OOQA 2BODX 2DGAA 2ZOXA 4BY3A 1UD5A 3G6LA 3UG5A 4ZZ9A 4W7UA 4AHOA 2W61A 2ISDA 2FB2A 1XLIA 1MVYA 3GS6A 1QO2A 2PDJA 3FA4A 5JBFA 3ICJA 4JDBA 1DXFA 2DW6A 3KDOA 3DFYA 1EGVA 4DAIA 1DEDA 3IPWA 2QJJA 4KERA 4DUXA 3LTPA 4Z42C 3MVTA 3W7CA 4W7WA 1YE4A 2W67A 1JQVA 1E3XA 1TX2A 4Q6JA 3EXTA 2QUVA 3OTRA 1QNPA 3BLOA 2WB5A 1BYDA 4GUIA 1XD0A 2YDQA 3G1SA 4IICA 1XCXA 4MYXA 2JIEA 3SRKA 2OZ3A 3GH5A 2Z2UA 3ZWTA 1PKNA 3DYOA 2YW3A 4YVXA 2X1RA 4UC5A 3WF1A 3SY8A 1FP8A 3R79A 4XD5A 1XLFA 4RX0A 3FOKA 4FX6M 4RDZA 2ZX8A 3NZ1A 1E9LA 1P6WA 4H9ZA 1E4LA 3C8NA 4MZ1A 3V5OA 1RD5A 4DJDA 4O54A 1SO6A 1TPB1 1T0OA 4AEEA 1O68A 3TZNA 1OYBA 3LYEA 2EJ1A 1TV3A 3UY7A 5CPSA 3MCMA 3KVMA 2XGIA 1EJVC 4J4KA 4IQDA 1F3XA 2TPSA 2Y7GA 3CL6A 4IUGA 1QI5A 1W8GA 2CETA 3OPSA 2ALRA 2CZDA 2DW7A 4L5ZA 1BQCA 3CMFA 2Y88A 3WLKX 2WNZA 3NQDA 5JH1A 1OC6A 3QC0A 5HJLA 3IIPA 4DUWA 4LBUA 1O12A 3WQCA 1KTBA 2QMKA 3RJYA 1P0NA 4GIYA 1Z7AA 5GJMA 2F6UA 5HJXA 1GEQA 2Y2WA 1Q5MA 3WK2A 3CZ8A 4DPPA 5I09A 2CFFA 3CZJA 5LKYA 1B3YA 4HNNA 4K8EA 3WH6A 1H7OA 2YL8A 1V3MA 4N4QA 4HB7A 1N7KA 1IXPA 3ITVA 1TPH1 3SCSA 1EB3A 1EJSC 2JKEA 4D6JA 5CAHA 1ODZA 3M47A 1XIJA 3B8VA 1Z42A 3B06A 4W8BA 4PTDA 3WQDA 5TIMA 4U5IA 5D8WA 1ONRA 4ZXLA 1ALDA 1T7LA 4H7VA 5AHIA 2ZZ6A 1OGBA 1HGWA 1HVQA 3A9IA 1CGVA 1XDJA 4X60A 3S3GA 3TONA 2YZRA 2V30A 2Z6JA 2FPVA 1FRBA 4K1WA 2XUCA 1UKTA 3G77A 3U8GA 1KV5A 2DSVA 4U5KA 1ZUAX 3UVAA 1TTQA 4GQBA 2P88A 3JU2A 4BEQA 3RXZA 1PIFA 5DO8A 4W86A 3L5LA 4JY8A 2EG7A 1FTXA 3IVSA 3P2VA 1FWTA 4JTIA 1P0BA 4JYDA 3NO5A 1HZYA 2NXIA 5C7VA 2QDEA 4PBGA 4D8LA 4M6PA 3DFQA 3NGJA 4RE0A 3S5SA 2QXWA 2PWFA 4HHLA 3EB2A 3WJSA 1DWIM 3WQPA 1TJRA 5I3FA 4FR6A 1F7BA 3KZSA 2Z1XA 5DRIA 1GJWA 1RJRA 1EWDA 3LRLA 3B8TA 3BDKA 3IV3A 3JZEA 3KAOA 3UWYA 3PN8A 2X0HA 3DUGA 3I3BA 1ELSA 3T7VA 2NQZA 3VUPA 4ERIA 1UA3A 4X63A 1S5VA 1WAWA 1LLZA 4FF7A 1QO5A 3I10A 1G4TA 1RLDA 4F9DA 3W7KA 3NJ3A 2O4MA 3SIZA 4IZGA 4KEMA 3GH4A 1YIXA 4XAYA 4Q22A 3QZEA 3VOCA 4XZIA 4LAZA 1Q4NX 3W28A 1EGMA 3UT0A 2ESCA 1C8QA 3FA3A 2JFEX 3GQYA 3LI1A 4Z08A 1RV8A 3SUSA 4WKHA 1SZRA 1F8MA 3RITA 1TJ1A 1IF2A 1BF2A 1RZMA 1ADSA 1UUQA 2VZSA 3RMJA 5I24A 1S2WA 4JIRA 2CLKA 2CBJA 4HA0A 4HSOA 3WL0A 1I2QA 3KS6A 1Q45A 4D1JA 3VIOA 3OA3A 4JTFA 1E51A 4B9ZA 1IEVA 3S8HA 4MMWA 1M5WA 3M0MA 4FIRA 3M6YA 4LYPA 1NDWA 1PVNA 4Z1DA 1SO5A 4IXHA 1IT7A 2IKHA 4FOKA 5CAKA 3HU7A 3KM8A 4GKLA 4A3UA 4NI8A 3VX1A 1UD2A 4QE5A 2D2GA 1MXDA 4U28A 2GFTA 3T9PA 3NM3A 1XS2A 3TR2A 4HHMA 2PC4A 3PAJA 1GQLA 1I2NA 2WNWA 3VKDA 1JPIA 1QBAA 2NX9A 1QCWA 3GHRA 2G50A 3T2QA 1D3GA 4HKPA 3HTWA 3FYOA 1HL2A 1RQEA 4C6OA 4YN5A 4OBSA 1UB3A 2QNEA 4FAMA 4N9EA 4LAMA 2R1MA 4OUEA 7XIMA 3PJUA 2QCHA 5CH9A 3LBCA 3R58A 4R3UA 1BSIA 4LYQA 4WDUA 3R4IA 4LS0A 1OD0A 1ISVA 1ZL1A 1J12A 1VIZA 4CCDA 3N1AA 3UJ2A 3DC0A 3MWCA 1SSDA 2XSXA 1O6IA 8RUCA 1XQLA 5CC3A 1HQTA 2IXUA 2HDJA 3AIUA 3GY1A 3W7QA 1UWSA 4UR9A 4OKDA 4M7TA 2B7PA 4LY4A 5HMEA 1E6XM 3S1XA 5CPMA 4YMZA 5A2CA 3RM8A 2E3ZA 1KGWA 3DKJA 3RHGA 4CUCA 1QNQA 5KEZA 4TIMA 3D3FA 3ZT7A 5M2FX 5EL1A 3OLDA 4QXIA 4ML9A 2A7RA 3P6LA 1FH9A 1FKWA 2ABAA 3SN0A 1B30A 3M0KA 3GNOA 3SUTA 5AYBA 4BF5A 4GABA 1U1UA 4EX4A 2VGGA 3OIXA 3TXZA 3F5LA 1H1ZA 2NT0A 2HQAA 2UY2A 4D9PA 1MZHA 3VE7A 3WH5A 1UOZA 1E9ZB 3OP2A 5CLTA 5DCDA 4W7VA 4WDTA 2ZTJA 4BF7A 5DLCA 3HGSA 1IYXA 2J74A 3QSTA 3E9AA 2XM1A 3DERA 3VGFA 4WJXA 4LRTA 3OODA 3EEZA 5EBUA 4LUJA 1PS9A 1PPIA 1L8PA 1PYFA 2GVGA 1R30A 1YDNA 3ZVHA 4FXSA 3LSBA 2PEVA 4IG2A 3SCPA 1JCJA 2OZ8A 4FOUA 1H62A 4YJ5A 4ZE4A 2BP1A 1AODA 2WYSA 4F79A 2W79A 2NSXA 2D22A 5D30A 4ATWA 1ME8A 4B4HA 3WDRA 3RCNA 3UWQA 1R47A 4RNJA 3GXDA 2VUYA 1YTDA 1GEHA 1Q2RA 2VO5A 2GGJA 4GVIA 3TOPA 3VGDA 3S1WA 4MZ8A 3G1RA 5F4XA 3P0WA 3W1TA 3OG3A 1C9WA 3RN6A 1E6SM 3VI2A 2UV8G 4IJCA 3N2MA 3TYDA 3N3TA 1UR1A 1TV7A 5HUPA 2EAWA 1XJBA 1H41A 3OZMA 1YADA 2WHKA 5D9MA 3UGVA 5D2XA 5BWAA 5FCZA 5I3IA 4IPNB 4H3DA 2XIOA 4XZWA 1K8YA 4WGHA 2EKCA 1EX5A 2VJXA 3M16A 3V5FA 4NRRA 1W37A 4PCTA 4RDYA 3VCRA 3PG9A 3TAKA 1XBVA 4ZE5A 4DEFA 4GC3A 1F6YA 2QJMA 2A3EA 3SN4A 1K6AA 4E4PA 3WUFA 4PBEA 1P1XA 2X1TA 1NF7A 2HBXA 3J7HA 3H6OA 3IIOA 3A9BA 4KESA 2YDAA 2CHNA 4KCVA 1JXJA 4MDPA 5TAOA 5PTDA 5LHEA 3V7PA 4ZL1A 3EDDA 4ZB5A 1XIMA 3PZMA 2BLEA 4RPPA 1H7PA 1BQGA 5FF4A 2I9EA 3LI0A 1EXPA 3M44A 4A6GA 1FWHC 5I02A 3TYCA 1W54A 3BLIA 3W85A 5CZ0A 4BKNA 4PUNA 1UR2A 3NCOA 7TIMA 3LLXA 4ZFCA 4HTYA 1M9HA 2WQDA 3ZQ9A 4ATDA 3CZKA 4R33A 1XWYA 3GR4A 3WLQA 2RGMA 4GYKA 1SPQA 3VD7A 3SN1A 2BNJA 4GINA 4L64A 1W9BM 1KNWA 4M1BA 1BAGA 3JVAA 4S3JA 3VD9A 2CWNA 4LUTB 1XIDA 1R0MA 2P50A 2XVPA 4BQ5A 3MDUA 4Y96A 3CXOA 2XINA 3VCNA 4AEOA 2QGHA 3AAMA 4B5NA 1XYAA 2GGIA 1HJXA 4U31A 3N15A 1PJ9A 2PP0A 3P80A 4B3LA 1QPOA 5D03A 3W23A 1R3QA 3OBKA 1XH1A 3RFAA 2PTDA 4OHQA 4O0QA 3K4AA 3SURA 4UTJA 5AFDA 2YLAA 3V3WA 2YCLB 4IIDA 3TV8A 4GE8A 3LHVA 3GVRA 4JNZA 1HJVA 5ABFA 4OV4A 1S2UA 3DGRA 4IPLA 4AWTA 2A1YA 5C2XA 4R7WA 3RM4A 1XSKA 4GO9A 1LRNA 4ES4A 4GVFA 4C6PA 3M7WA 3STCA 1VLWA 2PRMA 2JBMA 1YX1A 4AG0A 4NSBA 4LU0A 2P5NA 2VR2A 2Y0FA 1F4AA 2QVHA 3BMVA 3L4YA 3QH2A 1X6LA 1SW7A 3GTNA 2XSBA 1KA9F 4JN8A 4PUJA 3ABQA 1RA0A 1JPHA 4Z1CA 1TCMA 1HL8A 1LRTA 2OT1A 1WP6A 2PDWA 5C7HA 4G6CA 2ZZ5A 1PZ1A 4HOXA 1Q6DA 3CL8A 1Z69A 3WD1A 1OEPA 4IPIA 3QMRA 4JAWA 2E5DA 5HMSA 3TMLA 4MFDA 3QTPA 2Y5SA 4PFHA 2VOTA 2VT0A 2A5HA 1B9BA 4HIBA 2DZWA 1OVDA 3GDMA 5HNRA 4NZJA 1H7NA 5LXEA 2UWFA 1OX5A 2EGZA 1GKPA 4B5TA 2PGEA 3UG8A 1F61A 4FNRA 1UPMB 4JQ2A 4KWOA 1E72M 1MSSA 3G1VA 4QIUA 3ZVHB 5CJ5A 4A8IA 4LRSA 4ML4A 5L9FA 8A3HA 4LAOA 4ATLA 4O15A 3WQ6A 3MUCA 2D1ZA 1WNOA 4MLJA 1TCDA 1FWRA 2NQ5A 1T6MA 3WLOA 1ZP4A 3L68A 3MUY1 4QDMA 1AMYA 2OCZA 4E2VA 4B90A 5I3GA 4UNLA 2I1OA 2CPUA 1PTDA 4LCRA 2EPMX 3S9IA 3CUFA 1U83A 1UMLA 5C2GA 1DJXA 2NUXA 3O6DA 3W7PA 1UKPA 1QU4A 1DXIA 2J62A 4QG8A 5CBBA 1OX6A 3CQJA 4AWEA 2A6NA 3L66A 1DYSA 1WDDA 3H2EA 1O95A 3VIJA 3F1QA 1GOKA 3ZVIA 3KX6A 5C55A 1EXBA 3HF3A 4O53A 3KDNA 3NTYA 4M1RA 5AYIA 2XGZA 3NA8A 3W6LA 4AD3A 1WDPA 4M0XA 1MYRA 3LHZA 4B9YA 3BSGA 3IEBA 3ABRA 1KBLA 1EHNA 1DE5A 3WLLA 4HMNA 4GZIA 2GL5A 3ZSSA 1UZ4A 1EQPA 2PURA 1POKA 4HN8A 1OCNA 2EO7A 4HSHA 1TTIA 4K2SA 2NUWA 3A24A 3TEVA 4OQVA 2PE4A 2FH6A 3NQVA 1XIBA 1VFFA 1LUCB 2PS2A 5DX7A 1PTAA 3EKZA 1JG9A 1P0DA 4UMAA 2E7FA 4UCGA 2YFNA 5B7YA 1TELA 2QIWA 2VVNA 3FSTA 2ZUTA 2A3HA 1TKKA 2BXVA 3GC4A 4DM2A 3UR2A 1P43A 1BD0A 5K3VA 1ZPTA 2OGJA 2XFFA 2VC5A 4PUDA 1HUVA 1WDRA 2OWWA 1VFLA 1GOQA 4UTLA 3AIRA 1BGAA 2BB0A 3L0NA 4WKAA 2VUNA 4F9JA 4NAFA 4B92A 5C9XA 4BFAA 5DXXA 5H91A 1EO7A 1XM3A 2VWTA 4RDVA 1CBGA 4P8UA 3WMSA 2CLHA 1ZU8A 1XYBA 3C0QA 2CZFA 4MUPA 1A5CA 3C5QA 3UZXA 1RQBA 3ZZ1A 3LMYA 4H9YA 2ZC8A 4B2DD 3HA1A 4MB1A 1J0IA 4TX8A 2TYSA 3DU0A 3TQPA 3WY1A 2AQVA 5F1VA 3ZWSA 1UWTA 1YMYA 1I2RA 5HPCA 1VEOA 3LGGA 3LK6A 1LOQA 3FHAA 2R91A 1YQ2A 4JCLA 1AD4A 2ZKMX 1NJJA 4FSAA 4MB4A 2QDGA 2E9MA 3WQFA 4C6EA 4UTHA 4C7GA 2X2YA 3QR3A 3UY8A 4DZHA 1DWJM 1ZQ5A 2DU2A 2X40A 3N11A 1Y5WA 2PWDA 1RSCA 2F9RA 2G97A 3NXFA 3PNUA 4QQ3A 1SZGA 2PLCA 3LOTA 3TTOA 5JVLA 3O07A 1KM4A 4GXPA 1EIBA 3M5XA 4BR1A 4LFYA 1HKJA 2Z1WA 1UD3A 3W7MA 2PTWA 1NFPA 2XH2A 1VBRA 4M82A 3W2MA 4O1EA 1D3HA 3RU6A 3SR7A 3BLDA 4QLLA 1W3IA 3STPA 1MWOA 1K70A 4YNGA 4I8YA 1NOFA 3A64A 1N8IA 3CHVA 4C6LA 3N9SA 2X1UA 4XVEA 1VJIA 3SFKA 6TIMA 3ERPA 1HP4A 3A4JA 2DY3A 1XCWA 4N9DA 2WVVA 1K9DA 4XAZA 2Z2AA 4LT9A 3SCQA 2AAAA 5KTLA 3LNPA 4WSJA 4H6EA 3P61A 4AUBA 1R7AA 1GOIA 2VRKA 1SMAA 3R1ZA 4AZCA 3M0VA 1BF6A 4LANA 4L65A 3EXSA 4BJHA 3ARUA 1X38A 4IJRA 3NPVA 4MPQA 4RE2A 3AZTA 5I06A 4GD0A 5JQ9A 2C8NA 4JTKA 3V0TA 3RPTA 3WCZA 1E9IA 1KGXA 1QNOA 3LHYA 1OD8A 3DHPA 4MAZA 4G7EB 3MMWA 4GWEA 2QJGA 1BG9A 2AL1A 3K8KA 3GTFA 3WDPP 2V68A 4DRSA 4DWSB 5AOUA 3UERA 4J3TA 3AHZA 3LCXA 4WY0A 1GCYA 3V1PA 3HFYA 5FJOA 2BOGX 2Z00A 4PMUA 2ALDA 3II1A 4S3BA 3TJ4A 1J0HA 5BW6A 1S2AA 2QUMA 4WF7A 1M01A 1BHGA 2GJNA 1DWGM 4ONVA 1KW1A 3C3NA 2GVJA 2OZ0A 3NL6A 1SFSA 1AFSA 1OCJA 2NLYA 2QF7A 4IM4A 3QLLA 2VZOA 5JXQA 1BTCA 3IGXA 4BA0A 1IWAA 3BG3A 1XLKA 1X39A 3HG3A 3V0SA 5LNSA 4PTNA 2XVKA 2XVGA 2BY3A 5E9AA 5HNUA 1V7YA 3VIMA 1C29A 1UD4A 1NEYA 2YL5A 2X30A 5CZTA 1W1PA 4AD2A 3GDBA 3VILA 2QULA 4D72A 2OKTA 3IVTA 4HCDA 7ENLA 4K37A 4AMAA 2AAMA 1A3WA 5F2GA 4TUFA 2VFFA 4NZ5A 1ZGDA 2WKGA 3L2IA 3EPNA 3B0XA 2R1NA 4MJ4A 3WLSA 2AQOA 4C6IA 4KEZA 4I5UA 1SYTA 4NX5A 1DWHM 4Q8NA 3WFLA 3SCOA 1B3VA 3EWXA 1CLXA 4V1XA 5FEZA 2P3EA 4N4PA 4IQJA 1TE1A 1F4HA 1OABA 3UXIA 4WJ8A 1US3A 1RLCL 4GZJA 4LPCA 4NAEB 3W1NA 3DG7A 4PR4A 4ENLA 3OW1A 2HNEA 4QRNA 2PU0A 2XIQA 3P74A 2WPBA 3WUGA 3LGDA 3CL7A 3N18A 5GNZA 3T2OA 2XH4A 2F38A 4IP4A 1JCMP 3R13A 5DBTA 3K5XA 1BWVA 4AZIA 1R9YA 4Z1BA 1SW3A 1OFPA 4OJYA 3AHYA 4A21A 3WF0A 1XPYA 4NAFB 1XQKA 2WZIA 5CKSA 1A0CA 3MCNA 4UQBA 2PI6A 5EMKA 2VC6A 4LF1A 4RR4A 5AHLA 1IWBA 4XBSA 3ZFHA 1ESWA 3LCGA 5DT5A 3CIWA 1JZ4A 2Z1BA 3WKZA 3ZJ7A 1TR1A 4O18A 3MSGA 3I7QA 4J2PA 3E02A 3BJFA 2QDDA 3VIFA 5HANA 2ZX9A 6REQA 4DF0A 3QGAC 3W1RA 2NZLA 2E9LA 1LL6A 4GYJA 5A2BA 3BCDA 1E73M 2XIBA 1WOAA 4AIEA 1GYMA 4GIEA 4JHOA 5EMJA 5IBXA 1EF3A 1VPXA 1J11A 1PB0A 2TRSA 2XWDA 4D6HA 1SFLA 4LYKA 3LA4A 5FEWA 2IPJA 1K6WA 3RG6A 1CCWB 3B9OA 4Z2HA 1KFKA 1XUUA 3HO8A 1E4IA 1ZBVA 3S1UA 4NIRA 3DXIA 5AVHA 4FX8A 4XZNX 1IE7C 1P0EA 2BVYA 3BWWA 3GKAA 1WDQA 5A6MA 1M3UA 2NVAA 2DIJA 2YZ5A 4M3PA 3TK7A 2EXOA 5AZ0A 3IIVA 3SY5A 1TPC1 1UJQA 3CQIA 4F0SA 2Z25A 3QV7A 2WSRA 3QV6A 2WBGA 4Z1AA 1G5AA 1KRMA 2INEA 3N73A 4QCFA 2E25A 1J93A 4LQ1A 1H5YA 4RUBA 2J24A 4TU1A 4Q8OA 3HJEA 3S46A 1FHVA 1V08A 4WXZA 4XVDA 1Q2SA 4PTVA 3PS7A 4S39A 4JHMA 3EA2A 3EWBX 1F3EA 1V3LA 2ZQ0A 3L0KA 3FHQA 2GOKA 1V6YA 3E12A 1W8SA 4R9XA 1MW3A 3RU8X 2GOUA 4QQUA 3TCEA 2Y7DA 4Z2JA 5CSSA 2GYIA 3M0YA 5D9OA 1FFQA 1AH3A 4Y6GA 3CK5A 5HQLA 3G1DA 1OFAA 1VH7A 4ZOAA 4NZFA 4GXMA 2HROA 1R46A 4ZQMA 3BOXA 3I7SA 1JCLA 2WANA 3K30A 3GNNA 3WJYA 5HJYA 1IXOA 3EWUA 3TSBA 2WBKA 4LUYA 3QJAA 3W86A 4C1NA 3SDOA 2QCCA 1J2WA 1DQXA 4XIMA 4Q8QA 1TQXA 4H41A 4LYRA 3U4AA 4PRWA 2P8CA 1EJXC 1A5OC 1O4UA 1YXDA 2PUZA 2WLYA 4QP0A 4CQDA 2GVLA 2JKPA 2Q8ZA 4EOUA 1C9DA 4JTUA 3AIWA 3PTMA 4AQLA 4AH7A 4PMRA 1V6UA 3PBMA 4OTKA 2CEQA 3I6RA 1DHKA 3R10A 3ITTA 1LQ0A 1TWDA 2BZNA 2QCMA 3CU2A 3MZNA 4LBRA 2CNCA 3L4XA 3QXBA 4PTMA 4I7UA 2YXXA 3HURA 2G4JA 2Y24A 1OYCA 1XIGA 2JKAA 4TTUA 3ABOA 4QTGA 3LEPA 1I75A 5KMYA 3B0YA 2UZ9A 5D33A 4CGTA 2HISA 1BYCA 4WOQA 1ZLPA 3CEPA 1I2OA 1MDRA 2AQWA 1LORA 1TZZA 1W3LA 5LNVA 4N6FA 1UIOA 1DTUA 1ZJIA 3UXDA 5H8PA 4GOAA 4PFMA 1G94A 2ACRA 2ASHA 1P1MA 4XTIA 5FEPA 4I9TA 1I2PA 3NUKA 4ZO7A 1PKLA 3LMZA 1GTEA 3MYPA 1JZ8A 2QEZA 5BRPA 1DJIA 1FHUA 4XD6A 2DH3A 2XVLA 4JL1A 3PZOA 4CNUA 2OEJA 3W1QA 3LM7A 4GMEA 2HK0A 5G4HC 1I4NA 3W7HA 1XLAA 2E67A 1JDAA 3MJYA 1X7IA 1MRQA 2XFWA 2VHLA 1M7OA 5AZ1A 3LSCA 2CLPA 2IMRA 1GK8A 3P93A 5KZEA 4QCEA 5EU9A 1KRAC 1OG6A 3W75A 5G2HA 4D6DA 4QAWA 5D02A 4R7OA 4OGZA 4HU3A 4DO7A 4Q8WA 4MYAA 3NPUA 4OBTA 1FOBA 1NQ6A 3W38A 4ZGYA 3KRZA 1W5MA 3FFSA 4L7ZA 4L6DA 4DBEA 4NKCA 2IUZA 1O66A 2WAGA 3LV6A 3NQ2A 1D2KA 4P8XA 1LQ2A 4QSHA 1JF6A 5HR7A 3D3AA 2I57A 3TWBA 5EKYA 7A3HA 3MU7A 1K7FA 4IX0A 4YS1A 4DZAA 3QQ1A 4QROA 1MXGA 2J47A 4CVWA 5CSUA 3XINA 5D9NA 1PX4A 2YCIX 3PZNA 1XCFA 1YEYA 4GBUA 1UR8A 1XFBA 3DG6A 1JCNA 1OG0A 4CNSA 3UXKA 2Q8LA 4DF2A 2BX7A 3GC5A 4H8NA 2EHHA 1ZZMA 2CESA 1JRBA 2QIIA 1Z32X 3N29A 3MC5A 3PY2A 1LP6A 2H8XA 1EDGA 3SAZA 3TXVA 1Q6QA 3SIMA 1E56A 1H09A 5HWJA 4B5XA 1NOWA 3PULA 4TO8A 1W0MA 1M68A 3EOUA 1J2BA 7CGTA 3BSHA 3B4YA 3O6AA 2JALA 3POCA 4JTRA 1XG3A 3S2MA 3SGZA 2RHGA 4JQAA 3W27A 1J10A 1Q65A 4AVNA 1QPNA 4F0RA 4LBSA 3ARPA 3GNRA 5A6TC 2J7EA 3CPRA 3RYSA 1VEPA 2XM2A 4I90A 3SCNA 9XIAA 2A21A 2GJPA 3H7VA 4A3YA 3PSWA 1W5PA 4JPGA 4L4PA 1KQYA 4L9ZA 1FKXA 3TDFA 3WZ0E 5C9RA 4S3EA 1RY8A 3PTDA 3VNLA 2VXNA 2WXDM 4E8DA 2UBPC 5E70A 3PANA 5F2MA 1FFRA 1PEZA 4D6GA 1KBJA 4Y9MA 3WEOA 3KOFA 1EO5A 3D47A 4TQTA 4B4FA 1YDVA 4ZEPA 3G1AA 2YCEA 3HQOA 2GZXA 4C5ZA 4A05A 3V4BA 5A6SA 4GUFA 1H0IA 4MNLA 3A5FA 4GCAA 1HNYA 4K7VA 1BLIA 3T2PA 4PN2A 1MFUA 3ZJKA 1ZENA 1UPPA 4F0HA 1WAUA 1PX8A 3M5YA 3APGA 1YPIA 1CPUA 3N04A 2GWGA 2BY1A 3AMLA 1K4GA 1AUSL 2WMIA 1VJSA 1E40A 3M07A 1LM1A 2Q71A 3LX9A 1K1DA 4HZ7A 1O5XA 4KFNA 5CPQA 5M17A 2PP1A 4FEZA 1Y7VA 3NPXA 2DUAA 4RV8A 2HNHA 1OJXA 3QW3A 3TVAA 4JFVA 3CAWA 3BV4A 1GOMA 1CNVA 1F74A 3VKJA 4C6DA 2DPEA 5JBEA 1UP0A 3AS0A 1HX0A 3P5ZA 4H8UA 4I9MA 2RGLA 3UVIA 3I4KA 5I7GA 4Q3MA 4RZ4A 2XN1A 3LB0A 5JIWA 2ZUVA 5DFAA 2AKZA 1VC4A 2Y63A 1EPVA 1A5MC 1GOXA 1CIUA 3F7JA 1KM5A 2BS9A 3EDJA 3WNLA 3IANA 1QHPA 3G8EA 1A5AA 2DEPA 3OLEA 3UG3A 5FF0A 3WBXA 3TC6A 1XGZA 1OIFA 1AJZA 1Z6KA 2OODA 4GI4A 3EGJA 1VFSA 3BZJA 3DEQA 2A2IA 4S3CA 3L5MA 3PVFA 3W2KA 4FXRA 3TN4A 4O14A 1UWRA 4RZ5A 4GYPC 3M64A 4E8CA 4EACA 4RE3A 4KWWA 1POJA 2PAJA 3WG6A 1OFBA 5AHEA 1PCKA 1DL3A 3JS3A 1NWUA 1F9CA 3ANYA 3RK8A 2I14A 1YTEA 1W3JA 4D1IA 2CLFA 4Y2WA 3KRSA 3SCVA 3B4UA 4Q6XA 1OX4A 4DPQA 1RH9A 4DNMA 3DAQA 5G1TA 3EXRA 3PPGA 3U57A 3WBAA 2VR4A 2RDWA 4HJWA 3E1F1 3OZOA 1X97A 2X0YA 2FHCA 4F4RA 2B4GA 5CGMA 1PSCA 1L6YA 4B3ZA 3Q94A 4JYEA 1C8YA 5LA0A 3WMLA 3IUHA 3H2AA 1V0LA 4S3DA 2WMFA 1LQAA 3NQMA 1KKOA 4OT7A 3AYRA 3O15A 1NDVA 4DJFA 2WZEA 3JUGA 3SJNA 3RPMA 3LV5A 1YW1A 1M6JA 5CPLA 3BJSA 1ITCA 4I3GA 4HCHA 2ZX5A 4RLIA 1AZ1A 3W07A 3LPGA 1WO2A 3UWEA 1B54A 3PFRA 3AMCA 3DZ1A 3P62A 5CC6A 3VDBA 1L6SA 2HCVA 2YBUA 4X9YA 1KBKA 2R24A 3GHSA 2VYOA 5J5DA 3L5AA 2NVDA 3I7RA 3RLHA 3REQB 1CXKA 1B90A 1FWNA 2E1DA 3C56A 1EKOA 1DJQA 1MUMA 1ML1A 1PZ0A 3KOYA 4CN1A 4H7CA