5EA9A

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0130
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Exploring Trypanosoma cruzi Dihydroorotate Dehydrogenase Active Site Plasticity for the Discovery of Potent and Selective Inhibitors with Trypanocidal Activity
rcsb
source organism Trypanosoma cruzi strain cl brener
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 5ea9A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5ea9A01
2FB3A 1TB3A 4MLJA 3VI2A 3M44A 3O1NA 3UXAA 2A85A 2CW6A 3W73A 1YPFA 2CU0A 1FQ0A 3A9IA 4FXRA 2CZDA 3B04A 3WJSA 4UTTC 1XBYA 4O4WA 2ATMA 4KFPA 1OHLA 4JTFA 1W37A 3W2NA 1ME8A 2Y7FA 3NQ2A 4ZL1A 3BO9A 3KOFA 5D38A 1CI1A 3GK0A 4IXXA 1YADA 1VYPX 4MKNA 3EB2A 3N2MA 2V5BA 2VEMA 3QF0A 1FCBA 4XBKA 3O8AA 1TPUA 3M43A 3IVTA 5C6MA 1JUKA 1K8YA 4JEQA 5D2WA 3M47A 3NQFA 4NJIA 1MSSA 4MJMA 5K4ZA 3GR7A 2HSAA 3MI6A 5F4SA 2VELA 1AW5A 1XFBA 3PWAA 5BNKA 4JR5A 4JIQA 2Y85A 3UWYA 1WA3A 3MMTA 5CZJA 2V5LA 2C18A 3LI1A 4UFIA 5LKYA 5E0KA 5K7JA 2V2HA 3PB2A 3CHVA 4ZQRA 4OGZA 2R91A 3W2JA 3GZ3A 2JKAA 1GQNA 2GUUA 1W3IA 4PH6A 1TMHA 4TX9A 5HQEA 1FWTA 2Z6IA 4YCOA 1TTQA 4JTLA 1SFJA 3H54A 3P82A 3L5AA 4DF2A 3TC6A 3SGZA 3SIZA 3W75A 1LBFA 4HT3A 1VRDA 1CW2A 4DELA 3W1LA 3OVPA 4JYEA 3QYQA 3LRLA 4A29A 3W1AA 5J5RA 2PCQA 2C6QA 3OG3A 1OVDA 4HN4A 1OJXA 3W83A 3RU6A 3G1SA 4HHPA 1A53A 3B03A 4NXKA 4O0ZA 1Y0EA 3QW3A 3M9YA 3HG2A 2O7SA 1GYLA 1LOSA 1H1ZA 1Z41A 4CQ9A 3W84A 2E6AA 3TAKA 2BLEA 1OX6A 3BG5A 3C2VA 1I2OA 4LNYA 3PB0A 1FY6A 4A3UA 4S2BA 1SZEA 1ZALA 3E9AA 4YLWA 3CQ0A 3W7RA 2O7QA 2NUYA 4WUIA 4FNUA 4IXHA 3W1XA 4XQ6A 5AHMA 3MJYA 5AC7A 1KW1A 2X1UA 2V30A 4UFLA 3MWAA 1JCJA 3BG9A 4GC4A 2C15A 3FKRA 2PRLA 1F74A 1G7VA 3LLDA 3WFAA 5CZTA 1PV8A 1BEUA 4JNMA 4JTHA 1GPWA 5D2YA 3MO7A 2XN0A 3BPWA 2Z6JA 3PAJA 1TPWA 3LLFA 2P0OA 1LROA 4G1KA 4BR1A 1ZNNA 1EP2A 3BVJA 3NAVA 4LT9A 4FO4A 3TU9A 1GTEA 1I2NA 1O4UA 1EA0A 3LBMA 7TIMA 2H90A 1SPQA 3DFTA 3G8EA 4O1AA 2ZDRA 3PUEA 1KTBA 1G4TA 3G0SA 5F2IA 1NEYA 1PS9A 5BMXA 6TIMA 3N2XA 3OEXA 1G7UA 4MYXA 2DU2A 3I7QA 4Z1CA 4EIVA 4MJZA 1KFJA 1PHWA 3M5XA 4ZMGA 4CCEA 3BGJA 1SSDA 4UTIA 3LHTA 1GVSA 3QQ0A 5TQLA 3I6RA 3P61A 3MI2A 1OFPA 2DZXA 3DENA 4JICA 5CGQA 4IWWA 1KBJA 3DFNA 4LY8A 3C3NA 3HGOA 3W7DA 2X2GA 1TIMA 2HTMA 4UFHA 2C3ZA 4ZZ9A 2R8WA 3GNNA 1LOLA 3PY2A 3W2LA 3KRSA 2RDWA 3NQGA 4DO4A 1VLIA 4N6FA 1EB3A 3E12A 1HTIA 3L0KA 5HR6A 3WK2A 3GKAA 1C8VA 5KZDA 5K9XA 3C2OA 2Z1BA 1F05A 4XBSA 1NF0A 3O6DA 3IEBA 3TNOA 2V82A 3NR0A 3PBYA 1F2JA 5HMSA 3W7JA 3W7PA 3FIGA 3BGGA 2RFGA 3BLIA 3KHJA 1LDCA 5F1VA 3OHIA 4LV9A 4GUJA 5HWMA 3R8RA 5K2ZA 1G4SA 3B4UA 3S6DA 5DXYA 2ZZ5A 4NZFA 3B0UX 3NVTA 4ORMA 1W5NA 5HUOA 4AWSA 4FB7A 4B5NA 4JTGA 1HUVA 1FWRA 2YX0A 1K02A 3ZR4A 5DXXA 1LP6A 3P8IA 3F4NA 4IMGA 4R34A 2A4AA 2YPIA 1YYAA 2BX7A 4AF0B 1JCMP 3L68A 2ABAA 1KM0A 5KINA 2CLKA 3L21A 3QFEA 4O1CA 1WQ5A 1PVNA 3HGRA 1SZNA 4UUIA 3AJXA 4O1BA 3LI0A 4RLIA 3LX9A 3C4UA 1LORA 2Z0IA 2C1HA 3P81A 1F7BA 5LNRA 3UZ5A 2CLEA 4YWIA 4O15A 4YMZA 3B0PA 4MY9A 5CSSA 3KXQA 3S5OA 3ZS4A 4IX2A 2WNZA 3CC1A 4HIBA 3BV4A 4H6KA 2FPVA 3RNDA 1XXXA 1DJNA 1W56A 3W2MA 2EAWA 1P0KA 4E38A 2A5HA 1XDLA 2X30A 1A5SA 3BLEA 3WJWA 1XL9A 3V75A 1JUEA 4JS3A 3W7CA 3QM3A 3QQ1A 2Q8ZA 3E02A 3MP4A 2A7PA 1HL2A 3TFCA 2NXIA 3ATYA 1VQTA 2QUVA 3RK8A 3QW4B 4ALDA 4BK9A 2FIQA 3CPRA 1KLZA 3ANYA 4LU0A 1W8SA 4HKPA 1XI3A 5F2LA 3DKJA 3FJ6A 4DPQA 1MEWA 1IXQA 4LVGA 3HO8A 1SZFA 5HWNA 3KVMA 2GVLA 4UNKA 1DV7A 3S5NA 3P7YA 4Q4KA 2BXVA 3K30A 1Q45A 3TMQA 3HJZA 3G1YA 2AGKA 3NO5A 4JX5A 1WBHA 3G1XA 3UPWA 1G67A 2ZCGA 4FHAA 2RHGA 3NA8A 2OMAA 3Q37A 4YL2A 3EWZA 3NQ6A 2G5WA 1N7KA 1KV5A 2ZBTA 3C6CA 1VZWA 1X1OA 5KITA 1S5TA 2ALDA 4I7UA 4KWVA 1IXPA 1P4CA 3TW6A 4OU1A 1AL7A 4K6AA 4PA8A 3WK0A 2C0AA 5F4WA 3NDOA 3LB0A 3PBVA 1OG0A 4RXGA 5LNUA 4O52A 4K39A 5G2WA 1LRNA 2ZRUA 1FBAA 4O1DA 1OK6A 1FX6A 2FJKA 3QRHA 4OHQA 1EEPA 1LZOA 2VENA 4O17A 3W1RA 2TSYA 1P0NA 2C14A 3C2EA 3QSRA 3NM3A 5FESA 2OT1A 2NV2A 3TDFA 1D3GA 1K7EA 3STGA 4JYFA 1HFBA 4KFNA 2DP3A 1I8JA 1HO1A 4NVTA 1ZAIA 2NUXA 4RJEA 1JCXA 1ADOA 1T99A 3RFAA 4GFSA 3W85A 3N34A 4QITA 3E49A 1VYSX 3GYEA 3LGEA 3L65A 1QMLA 5CZ0A 3IIZA 4JYDA 1GJPA 2CLHA 5LHEA 1ZY9A 3CLMA 4PL1A 3EWYA 1NSJA 3U6WA 1B57A 1EUNA 1MO0A 3TUUA 2GJLA 4UTLA 3LRMA 4IMFA 2WNQA 1QWGA 4UMAA 3LCIA 1QPNA 1DL3A 3QEZA 3SECA 1EWDA 3MYPA 4OT7A 4NZJA 4LWWA 3ABOA 4UC5A 5EPDA 4NNAA 4P61A 2NXGA 2QDGA 2WPBA 3G18A 1RZMA 4IPIA 1W5OA 1ICPA 2ZTKA 5HR7A 1K3UA 1OFQA 3DGRA 1LBMA 4O53A 2Q3RA 1IIGA 2Y61A 3GXNA 3T55A 3ZWSA 1SO5A 1TTIA 4N4QA 2VFFA 3VE9A 3G3MA 2V2DA 2CLLA 5C55A 3DFOA 2J9YA 2JBMA 3DXIA 2WOQA 4YXGA 4WQ6A 2I1OA 3G22A 3SFKA 1KFEA 3HPZA 1VCGA 1GG0A 3LCWA 2E09A 3W1MA 3W1TA 2E6DA 1SW3A 2Y88A 2DJLA 1IGSA 2JGYA 3Q2DA 5D09A 3FFSA 4QQ3A 1B3OA 3VCRA 4XZ9A 3S5ZA 2TMDA 3S5YA 5EYWA 2QAPA 2J9ZA 2NWSA 4XWUA 1WAUA 3N19B 4FX8A 5DBTA 3EWUA 3LHWA 3NQAA 3JS3A 3SZ8A 2CWNA 3O05A 3P8JA 3C2FA 4RZ5A 4O19A 4NT0A 3PC0A 4X9SA 1OF6A 1WOBA 4HNUA 5ABTA 5I3HA 3R12A 4GUHA 2GJNA 3PG9A 1TQJA 1FCUA 4N9BA 4IPJA 3BLFA 5FF4A 3G3DA 1C29A 5AHIA 3G24A 4JTTA 3S0CA 1QPOA 3TSDA 1Q3NA 2VKZG 4OQVA 1B4EA 5IM51 3H53A 5DLCA 5C2XA 1WV2A 5D04C 1WBJA 1A5AA 3LCGA 1HG3A 5CG7A 4I7VA 1SO4A 5L9FA 4DQWA 3AO0A 3N9SA 2B7OA 3IIVA 4GRSA 5CKSA 4PFMA 4NQ1A 2E5BA 2X1SA 5TBOA 2EPHA 2YW4A 1Q6LA 4N9DA 5D2TA 3W7LA 2Y89A 4NX0A 3P5YA 5AFDA 4O28A 3TROA 1OFAA 4O13A 1K8XA 2CZEA 3HGSA 4LS1A 2QAFA 3NGJA 1T0OA 3BK0A 4ML9A 4M7TA 3S8HA 5LSMA 1M6JA 4N9EA 5HWJA 1OYCA 3O6YX 4RR4A 2V2CA 3UD6A 4JTIA 5I3IA 5AHNA 4AMAA 1TV8A 1WDWA 4PC8A 4ONVA 3TMLA 4ADSA 2QCDB 5DCDA 2ISVA 1GVQA 5EA9A 2ZA2A 4H4IA 1IF2A 5LZLA 4M7SA 4QM1A 4FX7A 5AHLA 4UR8A 3MBFA 3T4CA 4EOUA 1G69A 1N8FA 4M6QA 3HMJG 1VLWA 1QO2A 3W86A 2VEPA 3CWNA 3TW7A 4S1FA 2I14A 3B8DA 5DY3A 4GJ1A 1O60A 5D30A 1O5KA 4CNNA 1A50A 1W0MA 4NJHA 4FIQA 3CWOX 2QCLA 1KFKA 3DHFA 3A24A 3W7HA 3M1ZA 4NU7A 5G1TA 4AB4A 3W22A 3IIPA 3L5MA 3B05A 5DCEA 2OX1A 3L5LA 3MI3A 5I3JA 1LLWA 1OYBA 3GAYA 4R33A 3D0CA 1C9DA 3I65A 3IGXA 1XDMA 4UXDA 4XTIA 1H7PA 2C16A 2OCZA 4WXYA 5F2MA 2YGYA 3LCHA 3O06A 1JCLA 1VH7A 1ZJIA 1H61A 1OABA 1H63A 4AF0A 1W5MA 4BI6A 4Y8FA 3TXZA 4A21A 1ME7A 3RLVA 1TPC1 3G1HA 3PUOA 5H2ZA 3RMJA 1EWEA 2D73A 3LHVA 5SWUA 4H3DA 4JIPA 3UNDA 3TQ0A 4JDBA 5D33A 2PURA 1PCKA 4O10A 1SR9A 3M5ZA 3HB9A 2B7NA 4WD0A 5AN7A 5DBUA 2E5DA 2NUWA 4FNQA 2QJHA 1FWNA 1TV5A 3EX2A 4UNLA 3L0NA 2E68A 5C5YA 1H5YA 1NAL1 5FF0A 3SY5A 4E0CA 3W88A 2VFDA 3W87A 2CZ5A 3ATZA 1QOPA 3GIYA 3LCLA 1S5WA 4N4PA 3VFLA 3C8FA 3N14A 1DORA 1RQEA 4L4MA 1DOSA 2TRSA 3S1UA 3TX9A 1DVJA 1S5VA 2WSQA 4AVFA 4C1LA 2H3BA 1YPIA 2I9EA 4JXCA 4I7WA 1FXPA 1G6CA 3HF3A 3HPXA 5KZEA 3T7VA 1R47A 1XUZA 4TO8A 3L2IA 3T40A 4RZ6A 2QCEA 1ALDA 1PE1A 2DJXA 4AAJA 1JULA 1TPEA 3IV3A 4K36A 3LXAA 4IUOA 4NJJA 4LVDA 3LHZA 2GVGA 5FF2A 3LOTA 4UTKA 1I45A 4CQAA 2NZLA 3TE9A 2ZZ7A 3FLUA 3WK1A 3LHYA 4I9AA 1GG1A 1JR1A 5CPNA 4BI7A 4LRTA 4WJEA 2R14A 1TJPA 5KZMA 3W1UA 1J4EA 1XCFA 2ZYFA 4CCCA 4MUZA 2B7QA 3BW3A 3NQCA 3LERA 3CEPA 2OT0A 3GDRA 3QC3A 3A22A 5LGZA 1R2RA 3A21A 4DBEA 5FEWA 1VCVA 5FF7A 4IQLA 3GLCA 1M7PA 2H3DA 3NNTA 2HS8A 2QR6A 3EXTA 2W6RA 3CIXA 5GVJA 1ZAHA 4Z08A 2A6LA 4O11A 3BARA 4RKAA 3V1PA 2E6FA 3UY7A 1KM3A 1VC4A 1X6UA 2QDHA 1X7FA 1AMKA 4ORIA 1EP3A 3NL6A 3SGUA 3CIWA 1V5XA 2QUTA 3W2KA 1MEIA 4HNNA 2VOMA 4ZVJA 2Y62A 1H7OA 4HNTA 1H7XA 3OBKA 1XBZA 1LLZA 5G4EA 2Y63A 3YPIA 5LNWA 2VEIA 2FFCA 3M0ZA 4GE8A 3FKKA 3IGUA 2A1YA 2ZRWA 3Q94A 1SZGA 5KSWA 2X16A 3W9ZA 1Z48A 3GAKA 3TCEA 4JX4A 1F5ZA 3ABRA 3TQVA 3UWVA 3PBWA 2ZZ2A 4FNSA 4X3ZA 5AYXA 2E77A 2RKXA 1UJPA 1Q6OA 2HS6A 4LS2A 3STEA 1THFD 2YFNA 3MBDA 5EL1A 4R53A 1KTCA 2YCEA 1XC4A 3ABQA 1JQXA 4IJBA 2RDUA 4IX0A 1GYNA 3LTSA 4ZQPA 1KM1A 3W7GA 3KVKA 3INPA 3HG4A 4MPQA 3UWZA 3TQKA 2V9DA 1OFOA 3UWWA 1TCDA 1VJIA 3W07A 3W74A 3A5VA 4AHOA 4WY0F 5AYZA 3ZWTA 1UUOA 3TK7A 1YLVA 1YDNA 2YXGA 4WXZA 4JDYA 1DJQA 5MHBA 2AQWA 2PC4A 2DZSA 3PSWA 3W1NA 3NL5A 2DZVA 5AC8A 3UWQA 4QJ1A 3OIXA 3TIMA 3R13A 3ABSA 3GNDA 5LGXA 4CQ8A 5EKYA 1TQXA 1LRTA 4X2RA 5I3GA 4IGHA 4EVZA 1IXNA 3G1AA 3RLUA 1LCOA 1SQ7A 1MEHA 3OVQA 1NF7A 2EKCA 3M41A 4MY8A 4L4LA 4JN6A 4BFAA 1H7WA 1LTDA 1W31A 1FDYA 2QCGA 4LTSA 2FTPA 2PE4A 4Y9AA 1K7FA 1S3HA 1DBTA 1GOXA 1KM6A 2BSLA 4Z1AA 2VEKA 4QAIA 3LV6A 1V7YA 3LV5A 3WJZA 4MFEA 3NQ8A 5DCBA 3USBA 3O15A 5CZSA 2YW3A 4Q33A 3LXBA 2ZRZA 4GBUA 4LUIA 1GWJA 4JY8A 4ZQCA 2WO5A 2Y7GA 4JX6A 1TRIA 1GZGA 2ZQ0A 1VHCA 1GVFA 3NG3A 5A8GA 1W1ZA 4O4VA 3QJAA 4O54A 3S1XA 3E0IA 1LYXA 3QH2A 3MW7A 5U7SA 3GX9A 5G4WA 1QNVA 3RF9A 4TIMA 1SO3A 1VS1A 3EX6A 4Y96A 1WOAA 5DELA 3GKFA 1QPQA 2ZRVA 4K7YA 3W23A 5G2IA 3S1WA 3S9YA 3O6CA 2V0TA 1F6PA 1OF8A 4OV9A 2GPTA 5H91A 3EKLA 1Q6QA 4MZ8A 3GVGA 2JK2A 5U4NA 3DKLA 2Z2UA 2Y70A 3UYCA 1VCFA 4S2CA 5AHEA 5K9CA 4EWND 3L9CA 3QZEA 3CT7A 3LXCA 2CFFA 3T44A 3HGJA 3FA5A 3E96A 2H8ZA 5AOUA 3N9RA 5D2VA 1UB3A 1OFDA 2QCDA 3KVJA 1K8ZA 3W7MA 2IQTA 2CZFA 5AC6A 4GXMA 3UZJA 2Y7DA 1FCQA 2NX3A 1L9WA 3TJXA 1I2RA 3FYPA 3P60A 3SI9A 2BWGA 1M5WA 1KLYA 2BZNA 1B4KA 4UTWA 1OX4B 3PSVA 4U4MA 5EMUA 4IOTA 3W70A 1ML1A 1LOQA 5CPLA 2PRHA 4AWUA 3G1VA 4FF7A 4FXSA 4KKXA 2QCMA 4JTEA 1KBIA 1TTPA 1FCVA 3NPUA 4JTKA 2YFOA 2JGQA 2OZ0A 3W7NA 4K8EA 1D3HA 3TH6A 3G0UA 5D05A 4ADUA 1AK5A 1SSGA 1I2PA 1SO6A 4UTWC 4R7JA 3HIJA 2QF7A 3LTPA 4NUWA 5G5IA 3KRZA 3S1VA 3DU0A 4WZHA 2DZWA 2NX1A 3C2RA 1EP1A 1TTJA 2Y7EA 1SUXA 3HBLA 2G96A 5I3FA 1W54A 2ZA3A 1QPRA 2YR1A 3EWXA 1TPH1 3NQVA 5LNSA 3DI1A 4K38A 1TPB1 4WOZA 4JD4A 1QDSA 1BKSA 1F6KA 5I3KA 1E51A 3GDLA 2WSRA 3OA3A 3O63A 1SFLA 2H8XA 3ELFA 4O50A 2A7NA 4UIOA 3NQDA 2A21A 2JKPA 2ATSA 1YTDA 4DEFA 4HPXA 4LW7A 5BMWA 4AXKA 3U2OA 4PODA 4KFOA 1OFEA 2NLIA 4RXFA 4UTJA 3DZ1A 4OE7A 5LNVA 2B4GA 4UFMA 5DN1A 1I4NA 1W5QA 3W7OA 3MYOA 1EIXA 4DXVA 2FPYA 3ZFHA 4CNPA 3CB8A 3L67A 4O8RA 3JRKA 4UMBA 1KFBA 1R2SA 2FPTA 5D03A 2WV8A 5F2GA 3STCA 3G0XA 3S42A 4KWWA 3NEVA 4WOQA 1QR7A 1FUYA 3FOKA 3NPXA 3IIXA 3GXPA 4NJGA 5FI8A 1YDOA 2G95A 4RCXA 4DF1A 3KVLA 3VE7A 1KFCA 1F73A 4QNWA 3IVSA 2A7RA 5BOOA 1NFBA 2GOUA 2KZHA 4GUGA 3TKFA 2GQAA 2B7PA 4FIRA 5FEXA 1SW0A 2OJPA 4MYAA 5CPOA 1RD5A 1BWKA 3P80A 4BWLA 5K3VA 2TPSA 3LDVA 3G1FA 5D37A 4UTHA 1W3TA 1LBLA 4AH7A 3M7WA 1AG1O 4O14A 1JRCA 4M6PA 2QCNA 2ZTJA 3LCXA 3QMRA 4JTSA 3GR8A 4UCGA 1PCWA 3C61A 3JR2A 5BRBA 4ZQNA 2DORA 1RQHA 5EBUA 4JTJA 5LHFA 4PL2A 2QEZA 1TYGA 2DZPA 1WYIA 4UFKA 1QFEA 4O18A 5D02A 4M5PA 4UFJA 4LC6A 4RV8A 3PM6A 5KMYA 5FEPA 1Z44A 4BWLC 1PIIA 1QOQA 2P10A 4Z0SA 1LM1A 4MVAA 2FB2A 3W7KA 3HG3A 3I68A 3TFXA 2EGZA 1R2TA 4MOZA 3DH7A 4CLMA 1JRBA 4NXSA 4HNVA 3FYOA 1GT8A 5D32A 4TMCA 2E6YA 4N6EA 4DO5A 3WK3A 4JY9A 2LLEA 2CLMA 4MZYA 4NNCA 3I7SA 4N02A 1H60A 5C54A 4CCDA 3UY8A 2WNNA 1W5PA 3DHDA 5DY2A 2WQPA 1H7RA 3DFQA 1EPXA 2PRMA 3LBCA 1OX5A 4FEZA 2Y6ZA 3STFA 4IMEA 2R94A 4TR9A 3HPSA 2X1TA 3HQ1A 3P62A 2WJZA 4C1KA 3NXFA 4DO6A 1ME9A 6ALDA 4HSNA 4JTUA 4AHPA 1SU5A 4OBTA 1YXDA 3EKZA 4LRSA 3CTLA 4LVBA 1AL8A 4RX0A 1X1ZA 4IMCA 3T78A 3Q58A 4Z0JA 3VNDA 1JQVA 2W0UA 3UWUA 3N3MA 4J9JA 4QSHA 1BTMA 3CEUA 1FWSA 1WX0A 2J88A 1EX5A 2J6XA 1QCWA 3IGSA 1BWLA 5CPMA 2GQ9A 3LCFA 1VPXA 1T96A 4DPPA 4LOCA 1OK4A 2J9XA 3HOJA 2VFEA 1EUAA 1VHNA 3PBUA 1MZHA 1WXJA 3M6YA 3W76A 4A2RA 1KM5A 2ABBA 1UUMA 3NQ7A 3C52A 3L0GA 4XTDA 2RH9A 1OFRA 4QIUA 1T8XA 2ZFAA 2F7FA 3KRUA 8TIMA 3B0VC 2HMCA 3R5EA 1ONRA 3CU2A 3F4WA 1VGAA 2E1DA 1ZFJA 4OV4A 3PS7A 1J2WA 2EF9A 3W1QA 3TR2A 1DKWA 1TV7A 3TSMA 4UTMA 4FX6M 2YDAA 3P84A 3TJLA 1G4PA 5E93A 4HPJA 1TPVA 1G4EA 3TC7A 1KFLA 1VYRA 3EXRA 3R2GA 1XUUA 4NX5A 3P5ZA 3BW4A 3EXSA 4PTNA 4TMBA 3G1DA 2QJIA 3EWWA 4PCFA 4LVAA 3PUDA 4MFDA 3HG5A 2C13A 1KA9F 2P1FA 2QJGA 2ZZ3A 3TA6A 4AHQA 2XN1A 1JCYA 4UR7A 2XFWA 3DBPA 3FJLA 3QMSA 3W3OA 3W7EA 5L6UA 4NNBA 1PL9A 4M19A 3WJXA 5FF3A 4K7VA 1HO4A 3LRKA 2WSYA 2A6NA 3EX4A 4X22A 3MHUA 4O12A 1YDVA 2W79A 5A5WA 2GVJA 4HSOA 4D2JA 1XKYA 1TSIA 1P5BA 2NWRA 3GDKA 3LM7A 3FS2A 2JKEA 1VR6A 3UXDA 3U8GA 4EF8A 5G1YA 4MLRA 1N55A 1U83A 2AAMA 3C0JA 3QSTA 2DZUA 1B9BA 3EEGA 3THAA 4LUJA 1H7NA 3FEMA 4A22A 1K03A 1O94A 3NQMA 3WJYA 1FDJA 3W1PA 2VXNA 3OVRA 3DAQA 3F03K 3UQNA 1KM4A 1OYAA 4GUIA 3W6YA 1CX9A 4GWEA 1AW1A 3B06A 3NL3A 2ZRXA 1NVMA 1FDZA 2G97A 1A5BA 4UMCA 3NZ1A 4Z1BA 1PHQA 1ZCOA 3QPYA 4XUGA 2J24A 5HULA 3A23A 1I2QA 2DZTA 5HNRA 1KV8A 2A2IA 5FEZA 2VFIA 4ADTA 4RK8A 1TJRA 2QKFA 4LC8A 1MXSA 4ICNA 5HINA 1JCNA 3KFTA 1IXOA 3MUXA 5F1UA 2FLIA 4O16A 4M6VA 5G2HA 2ZZ6A 4Y6GA 2UV8G 4CNOA 3GDTA 3NZRA 1TREA 1L6YA 2ZA1A 1Z42A 2F84A 3NPVA 3GXTA 3BG3A 1JVNA 3PULA 4IMDA 2WKJA 2VFHA 1XBVA 1OX4A 4LS0A 4BF9A 2RDTA 3N73A 4JGDA 4Z1DA 1UBSA 1Q6RA 4E2BA 4GUFA 3H55A 2Q3OA 3I7RA 5J5DA 1ICSA 5F4XA 2XN2A 1H50A 1J5TA 1FWWA 2B0MA 1JUBA 2YSWA 4GNJA 2CLOA 5E1QA 4WX2A 3SR7A 4WY0A 3DFSA 4XKYA 3TV8A 2J27A 3EX3A 1GTHA 3EX1A 1YTEA 3PVFA 4RZ4A 2GQ8A 1R46A 1UCWA 2FQIA 3GDMA 4POCA 1K7XA 4DBDA 1DHPA 4AEOA 3PR2A 4O57A 5BW6A 2V8ZA 2CLFA 1W3NA 3VKJA 2V81A 4DF0A 2X1RA 1DQXA 3MP3A 3NQEA 1H51A 2QCHA 1H62A 1GEQA 4MZ1A 4EF9A 2VC6A 3GB6A 2A0NA 1OFBA 1RV8A 2YZRA 3W72A 3LTYA 2CLIA 4LV4A 4ZQMA 4UTUA 5EY5A 1TO3A 2ISWA 4N9CA 3UPBA 3QMTA 4W9TA 3KAOA 2BTMA 3NM1A 2YYUA 1SW7A 1KTNA 5T26A 1O95A 2NXHA 4OWGA 3P74A 3F1QA 3O16A 1YXYA 5D2XA 3W71A 2NV1A 1AW2A 1IIHA 3IIOA 5IBXA 5K9DA 1P1XA 4NJKA 5TIMA 4QNEA 1DQWA 4ZQOA 4N2YA 1L6SA 1RPXA 2E5CA 1M7OA 3SJ3A 1ZENA 1D9EA 1GVRA 4FNTA 4FNRA 3EWBX 5HUPA 3W2UA 4FNPA 3LHUA 5CSRA 5IBXC 1QO5A 4A2SA 3TSBA 3CM4A 3M5YA 3M5VA 2VFGA 1RVGA 5AB3A 3MHFA 3MHGA 3PG8A 4K8HA 4Y90A 2QCFA 3MP5A 2TYSA 1TPFA 3DFPA 1RQBA 5KTLA 2QUUA 1QAPA 3M16A 3C56A 3O07A 4MIMA 1O5XA 2YYTA 3DI0A 3W7IA 1H1YA 1R30A 2QCCA 4O0KA 1XM3A 3BW2A 2C19A 1L2UA 1GVOA 1RR2A 3THQA 1TRDA 5AHFA 1U5JA 5HJLA 4BI5A 3NL2A 2ZZ4A 3W7QA 2ZRYA 3NOEA 3P67A 1KM2A 2ZZ1A 4AWTA 4Q32A 1YTKA 3R89A 3L66A 1ZAJA 1X8FA 2FDSA 1ICQA 5K4XA 2ISSA 2Q8LA 3NPWA 1TPDA 4LVFA 4K37A 1A5CA 1F76A 3SW6A 2H6RA 1UASA 4WY0B 4XKYB 4TU1A 3A5FA 4MY1A 1LRQA 1JJKA 4UTTA 3SSJA 3IRDA 4PEKA 3IVUA 1YXCA 5AYYA 1L6WA 4P2VA 3KX6A 3TXVA 1XBXA 3TAOA 4U28A 3NYZA 1FXQA 4E2DA 2NX9A 3PF3A 1ZHAA 3QPZA 2EHHA 4YCPA 4QISA 3G8RA
chains in the Genus database with same CATH superfamily
3BAIA 4IL2A 1TB3A 3VI2A 3O1NA 1V7AA 2A85A 1YPFA 2I9UA 3PJTA 3W53A 3TONA 4YJ5A 3UVAA 5A6AA 1JPMA 4JTFA 4HZ6A 4C6BA 1ME8A 4ZL1A 3KOFA 1CI1A 1HZYA 1VYPX 3N2MA 1H5VA 2ZADA 1FCBA 1XFCA 2PAJA 3O8AA 2VX4A 1JZ2A 3KRBA 3ARSA 1DJZA 2FGZA 3FA4A 3IVTA 3TEVA 2HEJA 1K8YA 4JEQA 5D2WA 3NQFA 3A47A 1Q63A 4NJIA 3I4KA 3JZUA 1R9YA 1MSSA 2RAGA 1PIGA 3MI6A 1M1BA 1PKMA 3OBEA 4C6IA 3B9OA 1IEWA 3K13A 4DXXA 4DWSB 3UXIA 4R3UA 1W32A 5CC5A 1Q7MA 3EOSA 4W7WA 3T2QA 3WBEA 1DJHA 1GOQA 2OR2A 4R88A 2JKAA 3S2CA 1GQNA 2GUUA 3SUVA 4QLKA 2OU4A 3GVVA 4UR9A 1Q6GA 5HQEA 4EPEC 4JTLA 3C86A 3NSXA 4V15A 3N9KA 1D8CA 2YKKA 2R6OA 4W4QA 1LBFA 1OGBA 4HT3A 4F0HA 4DELA 1LWIA 1XG4A 1TFVA 3A4WA 4L80A 2PCQA 2F61A 4JZ5A 1U1UA 6PTDA 3AMGA 4NYUA 3N18A 1OVDA 4HN4A 4CEUC 4LYRA 3QW3A 5CLWA 3HG2A 2O7SA 1LOSA 1QNPA 3DFHA 1XP3A 3BCDA 1UPMB 3BG5A 1MNZA 4LSBA 2G3NA 3HPFA 3W38A 1SZEA 4S38A 4ZGYA 5CAHA 5HJYA 4HOWA 4DZ5A 1SJAA 4BQ3A 4YTQA 4IXHA 4H6RA 3CB3A 4J40A 3AUJA 1WNOA 3SN0A 4U33A 5C71A 2QHAA 4QJ3B 3BG9A 3FKRA 1G7VA 2XH4A 5DMNA 1JD9A 4Q22A 5GPRA 3TR9A 1GPWA 1V0NA 2WVVA 1A4MA 3UZYA 1TPWA 1RUSA 4D8AA 4A3QA 1GTEA 2D2OA 1EA0A 3CUJA 3LBMA 3T2OA 1SPQA 3DFTA 3G8EA 4O1AA 3M0MA 1G4TA 1UJQA 1NEYA 2DW6A 5BMXA 4ZOEA 7REQA 2VWSA 4G5DA 1JDFA 3NVDA 1G7UA 4HB7A 4Z1CA 4EIVA 5C8BB 3ALGA 4KEVA 1HF6A 1TWIA 4FAMA 4CCEA 4AEFA 2PDUA 2W5FA 4J3VA 5ABEA 3LHTA 3P61A 3H21A 1OFPA 2WZHA 1JNDA 3CQJA 4RDVA 1I6NA 4L1GA 2CITA 3VMPA 4Q7IA 3AHYA 1I1WA 1JG9A 2TODA 3VFCA 1AVAA 2BGSA 3C3NA 3HGOA 1CLXA 5DMLA 2A3AA 2HTMA 4UFHA 1ZZMA 3TOYA 2HPMA 5A6KA 1LOLA 3CTTA 3KRSA 1W1VA 3NQGA 1Q2RA 4DO4A 2NLYA 4N6FA 2DT0A 1EB3A 3U7VA 4RUBA 3COTA 3W25A 3VMNA 1UD5A 2CWXA 3GKAA 3HPAA 2Z1BA 4GD0A 1C3FA 3ALFA 1FP8A 2WLYA 2V82A 2PDGA 3DCPA 4WK9A 1OGSA 4FP1A 1JZ7A 9XIAA 4YU1A 3PZOA 3RITA 3DN5A 1UIPA 1TZZA 3THDA 4ZO9A 4GPNA 2YCLA 1G4SA 1R7OA 3B0UX 2VZVA 3GFYA 1OCNA 3WLKX 1V3LA 1LP6A 1I75A 3F4NA 2W27A 2A4AA 2YPIA 3V3WA 4GHRA 4E4PA 3RO8A 2ABAA 1KM0A 5KINA 4KIRA 3QFEA 4U5KA 4O1CA 1XIGA 1XS2A 1PVNA 2F2HA 4LY4A 3VZXA 2CHNA 1UWIA 1LORA 3LG3A 2JIEA 3P81A 1F7BA 1A4LA 1LL7A 4QCEA 2ANUA 1NTHA 4YWIA 4O15A 1E0TA 3TN5A 3BDKA 4C6NA 5CSSA 3CC1A 3PUGA 4OTKA 2FPVA 3W2MA 4DAFA 1P0KA 3KBWA 1XDLA 3GH4A 1XL9A 3GH7A 1S46A 2XGIA 3E02A 1MFVA 1HL2A 5HNNA 4XD6A 3TFCA 2NXIA 3ATYA 3MY9A 3QW4B 1QW8A 4E4UA 3TYAA 1KLZA 3AJ7A 1UZ1A 5GJMA 1MEWA 4LVGA 2F9RA 2YBUA 1EJRC 5HWNA 4GQRA 1F3TA 4PUKA 4Q4KA 3ID7A 4JTQA 1DJIA 3GHSA 3LPGA 3HJZA 3H24A 1CIUA 3NO5A 1EO5A 3LK6A 1WBHA 3SGGA 3UPWA 1G67A 3K1GA 2VUYA 4FSAA 5BWFA 3OZMA 4E3VA 3SUUA 3EWZA 4TVCA 2WMFA 1X98A 1KV5A 1AQ0A 1AODA 5ABFB 4MPKA 1H41A 5IOBA 1TA3B 2OPJA 1B3VA 3CZLA 1U33A 1J10A 1P4CA 1CECA 1KGUA 4GYFA 1AL7A 2GGGA 4PA8A 3ZVHA 4MAVA 4GX8A 3SRKA 4DJEC 2PGWA 2F8QA 4LB4A 4RXGA 4O52A 5G2WA 1XIJA 1LRNA 1SM9A 3QRHA 4OHQA 1YNQA 2IS7A 1UA3A 5FJOA 2C14A 3OO2A 1D3GA 1K7EA 3VNZA 2NSXA 1HFBA 1ZUAX 2DP3A 3FDGA 4NVTA 5M2FX 4V2XA 1A5MC 1ZAIA 1S2WA 1ADOA 3HN3A 1T99A 3O2LA 3N34A 3I10A 2ZDSA 1VYSX 5I24A 4AEEA 4DB7A 2IQDA 3L65A 1QMLA 1ZGDA 4TTUA 3QKZA 1US2A 1R3RA 2DUXA 2ZX9A 4FOJA 2CLHA 4K3ZA 1DWJM 3RGTA 1EGZA 1NSJA 2FVMA 2GSJA 3ZQ9A 1KRBC 1U30A 3LCIA 3QR3A 1DL3A 4B5TA 4B9ZA 1FWIC 2FZMA 4Y8EA 1RA0A 3P3BA 4P61A 2NXGA 2FZBA 1B0IA 1O6IA 3IJ8A 1W5OA 3OHMB 5BOFA 3VGGA 2W4XA 3T55A 1SO5A 1TTIA 3D3FA 1I60A 1GQJA 1B3XA 3G3MA 1VEOA 5C55A 3DXIA 4YXGA 2I1OA 2QJNA 3G22A 2PF8A 5HQLA 4W85A 4IP4A 3PFRA 3W1MA 3W1TA 2OYKA 3BZJA 1SW3A 2R1KA 1VJSA 4IPLA 4LBUA 2R1LA 3Q2DA 5D09A 1QUMA 2J77A 5IXEA 1EJWC 4LUTA 4XZ9A 1LLOA 1NY1A 2J9ZA 1C91A 1XLDA 2NWSA 5DBTA 3N19B 4MWAC 3SUWA 3EWUA 2PDPA 3JS3A 3SZ8A 1GCYA 1POKA 2PP1A 3THUA 4GUHA 2GJNA 1YMYA 4N9BA 4IPJA 3CPUA 1XH1A 2QVNA 3PZMA 1XLMA 3CT2A 1C29A 3G24A 4AWEA 1LWHA 2HE5A 3TSDA 1Q3NA 1B4EA 5DLCA 2QZRA 3LCGA 1HG3A 3RO6A 4NZ1A 1B3ZA 4I6VA 1SO4A 4AC7C 3BTNA 5L9FA 1XLIA 3IIVA 3BURA 3UG5A 4CD7A 4NQ1A 5TBOA 2YW4A 3NZGA 3W7LA 4ZR8A 3OP2A 4X61A 5AFDA 4G7EA 5CPQA 1AZ1A 3CAWA 1KQYA 1EEXA 1J11A 8RUCA 3BK0A 4F9DA 1QI2A 7PTDA 3GUGA 3F7JA 1KRMA 4N9EA 3MJMA 5I78A 1EXPA 2EPLX 4CNUA 5JBEA 3UD6A 5I3IA 4M24A 1TV8A 4PC8A 4ADSA 2PDXA 4Y9MA 5DCDA 3HQNA 1OADA 2J25A 1X39A 4H4IA 4GI9A 2W91A 3T4CA 3IAPA 4M6QA 4BF5A 3HMJG 1VLWA 5XIAA 2JEPA 2MANA 2IKHA 4MB5A 2DQXA 5FL1A 2I14A 1RP9A 2Z7KA 3B8DA 5A6BA 3SJNA 5A95A 2AAAA 4MWAB 3CWOX 1OC6A 3W7HA 3M1ZA 4EXQA 2G3IA 3TN6A 3BOLA 4INFA 4F66A 1POJA 4H7ZA 3USZA 4UWMA 4LNCA 4R33A 1W9UA 4H9VA 1XDMA 2OGJA 1V0MA 4DM1A 2MNRA 3LCHA 1JCLA 1ZJIA 1OABA 4BQ2A 4AZ6A 1H63A 3BMWA 4AF0A 2QPXA 3UJRA 4WEVX 4OVXA 3TXZA 4A21A 3RLVA 1BSIA 1Q7QA 3VD5A 3BOFA 4H3DA 4JIPA 5FACA 1E9IA 1UBPC 3G5EA 2YDQA 5DO8A 4O10A 4DHGA 4H6QA 2DW7A 1UZHA 3GXDA 2NT0A 4DI8A 5DBUA 1JDCA 2E5DA 1YNPA 3LQLA 1XDJA 4FNQA 1TV5A 2EQDA 2XVPA 1NJJA 4A05A 3VNJA 5DRCA 2WJDA 1H5YA 1NAL1 1V3MA 3SY8A 5FF0A 2VVSA 5DEZA 4E0CA 1E6SM 3ATZA 1QOPA 3GIYA 3LCLA 1JGIA 2HWGA 3OZPA 3N14A 3TX9A 3KBSA 1DIDA 2H3BA 3R11A 1VD6A 4WRHA 4C6QA 4KS0A 1FXPA 1G6CA 4CU8A 3HF3A 3T7VA 4DJFC 4GO8A 4RZ6A 2QCEA 3B0YA 1PE1A 1UD2A 5ECVA 3BQ5A 3IV3A 1XLBA 5BZAA 3TYDA 4QS5A 4NJJA 4LVDA 3R94A 2GVGA 1ISXA 3LOTA 4UTKA 1I45A 5A6BD 3LZ3A 2DH2A 1FWAC 3OOQA 3UW6A 1M7JA 3TE9A 4L6DA 5A6TC 2PU0A 2V5CA 4B5SA 1OD0A 2H9AB 5TD4A 4M80A 3R25A 2QUNA 2OWXA 1J4EA 4CCCA 2GVEA 1YBQA 4FS9A 2CEQA 3LERA 3UJSA 3CEPA 3GDRA 2J7HA 2CPUA 5LGZA 4DBEA 5FEWA 4IQLA 2PDNA 1K8CA 1M7PA 3IAQA 3IWPA 3SCTA 1QBAA 1GQKA 4XG1A 4AVNA 3B97A 1CTNA 2E6FA 1KM3A 1TR9A 5I2UA 1V5XA 5A94A 2VOMA 2Y62A 1H7XA 2ZUWA 4H9UA 3EAUA 1F61A 3H2OA 5G4EA 2Y63A 5LNWA 1E6XM 2VEIA 3VOIA 2J78A 1AQMA 3M0ZA 3UU0A 1HW6A 4IPPA 1FWFC 3UGVA 2I16A 4F0SA 3W9ZA 1Z48A 3GAKA 4GXPA 1M68A 4WLCA 2PGRA 3FXGA 3PBWA 3WD1A 1PTDA 3ANUA 2YFNA 3P2VA 1ZU8A 1KTCA 3URNA 3V1HA 1XC4A 1UH4A 4IJBA 2RDUA 3NO3A 1GYNA 4N7QA 3LTSA 4LAUA 3KVKA 3W29A 2ON3A 4ACZB 1JDDA 2UY3A 2V6AA 3WNPA 1OFOA 4Q8MA 1TCDA 2IXUA 1PAMA 3W07A 3IRSA 3W74A 3QBUA 4MHBA 3ZWTA 3WQVA 4FPSA 4OOZA 4DVOA 4MNKA 1YLVA 1YDNA 4KPLA 4PFHA 2PC4A 2DZSA 2NT1A 3W1NA 3NL5A 5AC8A 4JTRA 4QJ1A 3IJ9A 3OIXA 2WC3A 1ZL1A 5HXMA 3ABSA 2G0WA 4LCRA 1NOUA 5LGXA 4CQ8A 3ZLGA 2BY1A 3GU1A 5I3GA 1IXNA 2IPJA 1AJZA 1MEHA 1UKSA 4FMVA 2EKCA 5FD0A 5IFTA 4PMQA 2WBGA 1H7WA 4W89A 3DERA 3IPWA 1DBTA 1VIZA 4QAIA 1E55A 2O4MA 1E1FA 3LV5A 5T9BG 3WJZA 3EOEA 5DCBA 4DZIA 5J04A 9CGTA 3LXBA 1PZ3A 3VTRA 2VRQA 1BYDA 4GBUA 2Y7GA 1TRIA 1JF5A 2YA1A 4HQVA 4FOUA 2AQVA 3C0SA 4O54A 8CGTA 4Q6JA 1XGDA 4C60A 3QH2A 4HHHA 3GX9A 3QV8A 2C0HA 3EX6A 1ZLPA 4FLRA 4MB4A 4JCMA 1WOAA 2INFA 5DELA 3GKFA 1CCWB 3II1A 3KOWA 3SFWA 4LQ1A 3O6CA 2V0TA 4DUXA 4HPHA 4P8UA 1E6NA 1UR3M 4UQCA 1KCZA 4HCLA 3GVGA 5U4NA 1H09A 4Z2JA 2XVLA 2E8YA 3UYCA 4AISA 4S2CA 3H2MA 1TMLA 2X0YA 1V03A 4YYCA 2CFFA 1I0BA 5RUBA 4LXFA 3ZVIA 2H8ZA 2V3FA 4H7VA 3N13A 3BCJA 1ECQA 1E9ZB 2QCDA 6XIAA 1BYAA 2FVKA 1Y5VA 1XYMA 2PUZA 4HPNA 3KL5A 5I79A 3N17A 4PTDA 1WZMA 2ZC1A 3VVGA 2BWGA 1W1IE 1M5WA 3OU8A 2PLJA 1AZ2A 3S5SA 1B3WA 4CQDA 1JXJA 4FF7A 3VCCA 3KDNA 1FCVA 3VOFA 4FALA 4ADUA 5ENLA 1IZKA 4S3FA 3WLTA 1AK5A 1SSGA 1U5VA 4UTWC 3SURA 4R7JA 1UR1A 2QF7A 3CAKA 1R9ZA 4E2OA 4JQ1A 4LFYA 4WZHA 3UF9A 1KRCC 3TYZA 1EP1A 3HZ3A 1NQKA 3GRIA 2YL5A 1H4PA 2BOFX 1IWBA 1W54A 1NP0A 3U4AA 3VXGA 4A8RA 1SJDA 3DI1A 1RLCL 4K38A 4WOZA 4WGXA 4HNCA 2D23A 1BKSA 1E51A 3M64A 4C6EA 3DECA 2H8XA 3EOUA 4XIMA 4D6CA 2A7NA 1KXTA 2A21A 1RAKA 3Q65A 5J8LA 1XIFA 4Q8QA 3U2OA 1WDQA 4RXFA 2ISDA 1UKOA 3DZ1A 3C2YA 2YDSA 4UFMA 2NVAA 1I4NA 2E28A 4IIEA 4NILA 2E1WA 3ZFHA 3CZJA 4GNVA 4CN1A 5D03A 1KFBA 1R2SA 3L4XA 2WV8A 1V6YA 4WCJA 3NTYA 1F3WA 4KWWA 2NVDA 3FOKA 1XRSA 4DWDA 2G95A 2HISA 2DIEA 5I06A 4B91A 4UOZA 1NFBA 2J66A 4F2BA 4I8YA 3WENA 2GJXB 4GUGA 3VK5A 3W00A 1WKFA 2B7PA 4MYAA 1RA5A 1UROA 2ZUSA 5CPOA 2QIIA 3RXZA 3P80A 4BWLA 3L7RA 2TPSA 3G1FA 1XLHA 2VUNA 4JIRA 3V0TA 3M7WA 1AG1O 3B8UA 5BU9A 1V4YA 2ZTJA 3QMRA 4JTSA 4KQNA 1VRXA 2GDUA 1S1PA 5BRBA 5IHRA 4HPGA 3GTHA 1RQHA 5EBUA 5LHFA 1AQHA 3E0LA 4UFKA 5BRPA 8XIMA 2WNWA 4M5PA 1U22A 1P48A 4JFWA 4PB5A 5DRIA 1PIIA 4MVAA 3I68A 5EB8A 3PJWA 4TMCA 3WK3A 2WK2A 3BUVA 4NNCA 5DMYA 3I7SA 5JQ9A 3O3RA 3T0AA 3DHDA 1NDWA 2WZIA 3VKAA 1H7RA 3VGHA 3LBCA 1E3ZA 1W3LA 1M7XA 4WSKA 4XK2A 1WB0A 3BWWA 4IMEA 3QR1A 2PP0A 4JIIX 4C1NB 3HPSA 3LPOA 4NZ3A 3RRAA 3SCSA 1ZSXA 3P62A 4C1KA 2FHBA 5FL0A 6ALDA 4US6A 4CU7A 4AHPA 1SU5A 4OBTA 2XG9A 1S2TA 3HFYA 4LVBA 3L4WA 3C3UA 1AL8A 1UP0A 4RX0A 1BRLA 3BAXA 2P3ZA 2ZIDA 1V3IA 3BANA 4DUOA 2W0UA 3U0HA 1DWFM 4J2MA 4NZCA 2J88A 1EX5A 3G1RA 5HOSA 4CGTA 1BWLA 2OLSA 3LCFA 4GYKA 4AZCB 3TZNA 5C70A 2ALRA 5DT5A 4AZGA 2Y1HA 4DPPA 1OK4A 4GISA 2J9XA 3T0BA 4J3XA 2WSKA 2BHZA 5FJPA 1KR0A 1VHNA 2EG6A 2PGEA 3U7BA 5ECUA 1WXJA 3M6YA 3WF0A 2E9BA 1EH9A 4XTDA 2VDHA 3MT1A 1KKRA 4H8VA 2HMCA 3R5EA 3CU2A 3F4WA 1X1NA 1ZFJA 4XAPA 4DY1A 2EF9A 3W1QA 4RDYA 1UC4A 3TSMA 2YDAA 4N0RA 2WMHA 2ASHA 1TPVA 1KFLA 1UOZA 1XH2A 1NWSA 3RAOA 4CCZA 3LU2A 4NX5A 1MXDA 1R3YA 3PTDA 4HOXA 3EXSA 4BJHA 3PJUA 4Z1YA 4L6HA 4G1NA 3EWWA 4LVAA 3PUDA 1YDYA 3HG5A 3L23A 5E09A 4XUYA 3ZOAA 4H1ZA 9RUBA 2ZXQA 3TA6A 2PPGA 4AHQA 4NSBA 3UJEA 5I02A 4HGXA 3S1GA 4LAZA 4NI3A 2QXWA 4AX6A 3QHMA 2HCVA 3DYOA 3GQYA 3T2PA 3LENA 4GX9A 1EQPA 2WSYA 4X60A 2A6NA 1WKEA 4X22A 5A5WA 2YXOA 4H8NA 1TSIA 3IK2A 5JVLA 1VB9A 2OLHA 3WD3A 1VR6A 1EHAA 3H2AA 2EBNA 4YWSA 3KUMA 3UR5A 2AAMA 3GWQA 2DZUA 1B9BA 3THAA 1AH4A 4XO7A 2ACSA 4FA3A 4DNHA 4C6FA 4JTDA 4GLEA 3ZSSA 3VDGA 3F03K 2BDQA 1KM4A 1OYAA 4AY8A 5M17A 3B06A 1XHGA 2ZUVA 4S3DA 2ZRXA 3CYJA 1R85A 1A5BA 4UMCA 4TOQA 4XKMA 1DQUA 3U5YA 1TELA 4KEZA 2J24A 4PUMA 4WKAA 4XUGA 4CN6A 5FEZA 4ADTA 2QKFA 4KT2A 3DC8A 4ICNA 2J7EA 9XIMA 3REQB 1R7AA 1UWRA 4ROQA 4RE3A 1IXOA 1N8IA 1UG6A 2FLIA 3T05A 1L8NA 5G2HA 4V1YA 5DF0A 1WAWA 1GVIA 2F84A 3CYVA 3NPVA 1B9ZA 2WKJA 4HMCA 5PTDA 3AC0A 3N73A 1NARA 2VT0A 6REQB 4OKDA 1FWGC 1H1NA 1R0MA 4XD3A 5F4XA 2J74A 1CWYA 3QKEA 1J5TA 1FWWA 3LN3A 1K9EA 1OEPA 3WL0A 2CLOA 4XAZA 3EMCA 1MQQA 2I57A 1LF1A 4WX2A 1E72M 5E1QA 4WY0A 4HJFA 4NASA 3FGCA 2PTZA 4LH8A 4WDXA 1YTEA 3PVFA 3RX2A 3QLDA 2ZVRA 1UCWA 1K7XA 3UEQA 3VUSA 3P6LA 5FSEC 1PB0A 2J6VA 2YOCA 2DUZA 4MZ1A 5D9OA 5E9AA 3GB6A 1RBOB 3W72A 2PWGA 3UYIA 4ZQMA 4AUBA 3WNNA 3QTPA 4X2PA 4N9CA 3UPBA 3QMTA 2FZ8A 4W9TA 1SFTA 5BXTA 2BTMA 4H6EA 1BD0A 3NM1A 2YYUA 4GIYA 4C6KA 5CH9A 2HDJA 3MVTA 3MWCA 3W71A 3PBMA 2NV1A 1AW2A 1IIHA 4S39A 3AIUA 5K9DA 1P1XA 3GNOA 1DQWA 1KXQA 5HDRA 1L6SA 3VIMA 1IWAA 4QSFA 5AECA 1BYCA 3JZEA 3MTWA 4EPKA 4ASTA 4FNRA 2YA0A 4Q8PA 2XM2A 5HUPA 2WHJA 3LHUA 4I5XA 5CSRA 5IBXC 1FRBA 4D6JA 3TSBA 3UERA 3OYZA 4Q4PA 4R7WA 2VFGA 3MHFA 3MHGA 3PG8A 4AVOA 1HGYA 3CZEA 2PDWA 3SO7A 2INZA 2QCFA 3MP5A 2RGMA 1UKQA 2QUUA 1OB0A 3ITOA 3C56A 4Q8OA 4MIMA 3W7IA 1R30A 2ZX8A 4O0KA 4GK8A 3CV6A 3BW2A 1Y5XA 1L2UA 3VGBA 1U5JA 2Y8KA 3NL2A 4AWTA 4S3CA 4Q4RA 2DSUA 3WFLA 4B3ZA 2W67A 4DYKA 3GFXA 3UG3A 4WDWA 5K4XA 2PD5A 1E1EA 3SCRA 2Q8LA 2PDJA 3NPWA 4LVFA 1S38A 3POCA 1UASA 2QMKA 4YVXA 3RU8X 4TU1A 4S3KA 4MY1A 1QK2A 1UKPA 1XSKA 5T91A 4PEKA 3IVUA 1Y5WA 4MF4A 4JKKA 4AY1A 1H49A 4ZOBA 3TAOA 5LIKX 4B3LA 2NX9A 1ZHAA 3N2OA 4YCPA 4QISA 3PN8A 3AICA 2FB3A 4MLJA 1GOIA 3NOYA 3W73A 5M03A 4FXRA 1XBYA 2XVKA 2ATMA 4KFPA 3ZMRA 3NQ2A 4FZIA 3BO9A 4BQ4A 1YADA 2GYIA 2VEMA 1EL3A 1TJ1A 2FYMA 2YB1A 3M43A 4XIAA 3ARVA 3FJ4A 4HNOA 2DUAA 3VGDA 2CKSA 3T8LA 3M47A 4UQDA 3R6IA 4KCTA 3HTWA 3LEPA 3WEOA 3RDKA 4JIQA 1WA3A 5CZJA 3LI1A 3WQDA 2EO7A 3EKGA 4TX8A 4Z2KA 3ARRA 3GU2A 2UY5A 5H1WA 3W2JA 4IMAA 4XZHA 3TTEA 1XYAA 1W3IA 3DBNA 3ABXA 4HCHA 1FWTA 3ITGA 1JZ8A 3MCNA 2Z6IA 4LUSA 1E9LA 4YCOA 1RSCA 1SFJA 3H54A 3P82A 4GGBA 3SIZA 3MSDA 4KF1A 3W1LA 2PWDA 3OVPA 4JYEA 3LRLA 1XLEA 1PDYA 5GNZA 3PHAA 1NDYA 2EPNA 4P5UA 1OJXA 3RU6A 1J2BA 1A53A 3B03A 1DWAM 4HU8A 4XD5A 4PCNA 2XZ7A 4CQ9A 5M3WA 4V33A 2BLEA 1OX6A 3R79A 1JCTA 3CS2A 4P7RA 3PB0A 2OSYA 4A3UA 3SCWA 1ZTVA 3WLPA 1VFFA 3CQ0A 3RJXA 2O7QA 5HQMA 3WMLA 2XH2A 4JFSA 3QOKA 3MJYA 3WUFA 5CAKA 2X1UA 3UG8A 4A8NA 1Q7ZA 3MWAA 4XO6A 2C15A 2PRLA 1F74A 1UP2A 3WFAA 1G9HA 3LQGA 1V51A 3QV7A 3B4YA 1Z9AA 3UNTA 2Z6JA 1NWTA 4ZO7A 1LROA 3GR4A 1EP2A 3NAVA 3K4AA 3OPSA 3N04A 4HSHA 1I2NA 4HD5A 1O4UA 2OYLA 1UPPA 7TIMA 2GUYA 1E0VA 1TVNA 2AMXA 1VIWA 5EGRA 2W66A 3KTCA 3OZYA 4RZBA 3G0SA 2WHKA 6TIMA 3N6QA 1UUQA 1UD6A 3VC6A 2BVDA 2R82A 4ZMGA 4YPJA 1V79A 3KTXA 2OYMA 3MVIA 5TQLA 1GVSA 4KRZA 2PMQA 3MI2A 4U10A 1W1PA 4JICA 3VIJA 5CJ5A 1RBLA 4LY8A 3VYLA 2P53A 3TA9A 3W7DA 4ZZ9A 4GGHA 3OQ8A 1KBKA 3PY2A 3ZM8A 1Z3NA 1WUEA 1UR0A 3MU7A 3AMCA 4AD4A 1WDRA 3B9EA 3VNKA 1E9YB 1FHVA 1HTIA 1LQ2A 2OODA 5K9XA 2E7FA 5D9PA 3MUZ1 1T5AA 1ELSA 3HJEA 4GYJA 3W6LA 2D3NA 3IEBA 3TNOA 1HKWA 3S3GA 3PBYA 1TG7A 1ISYA 1MDLA 5HMSA 3W7JA 5I0DA 3FIGA 3BLIA 4TUFA 1LDCA 4CEXC 3OHIA 1O68A 3BH4A 3T1GA 5K2ZA 3S6DA 3WO8A 5C9RA 1UH3A 1W5NA 1FWRA 1JDAA 1K02A 4GACA 3VPLA 8A3HA 2XIIA 4Z17A 4AD0A 1HJSA 4WGHA 1XLCA 2CLKA 4IIBA 1MMFA 2WVVB 3LI0A 4RLIA 3VD9A 3C4UA 4DXKA 4QTGA 1ZJBA 1KWGA 4ZB0A 1P43A 4QDMA 1JZ6A 1G1YA 4D6FA 3UA4A 5LNRA 3UZ5A 2CLEA 1B3YA 1TX0A 2EXOA 3B0PA 3CUXA 3APGA 1AJ2A 4PN2A 4GY7A 3EOLA 3ZS4A 4IX2A 2WNZA 4HIBA 4F8XA 3MV11 7REQB 1XXXA 1DJNA 1W56A 2EAWA 3ZJ7A 2JF6A 5C2GA 3LGGA 2Y8VA 3WJWA 3W81A 1R87A 4HHMA 1WXYA 3QM3A 3WQCA 3QQ1A 1VQTA 2QUMA 4NIRA 3BC9A 3RK8A 1PDZA 1TWDA 3ANYA 3A3WA 1F4AA 4LEQA 1W8SA 3BJSA 4YTUA 4DPQA 3FJ6A 3AXXA 3RR4A 1SZFA 2OZ3A 2BGQA 1WKDA 3U9IA 5CC3A 4GOAA 3S5NA 3P7YA 1UWTA 3CPGA 3K30A 4EKJA 3TYBA 3KHDA 4Q7BA 1KGXA 1Q45A 3W82A 3G1YA 1J9YA 2AGKA 3URBA 3FHAA 3CO8A 3BQ6A 3O9NA 2ZCGA 4ZEPA 2RHGA 3NA8A 2E9LA 2OMAA 3ARPA 1N7KA 3C6CA 1VZWA 3WQ8A 4P7QA 1KGWA 3O6AA 4PTWA 1IXPA 3WK0A 3VGFA 1V0LA 4GIRA 3PBVA 4QQUA 3GVWA 3FJNA 4CD8A 5D8ZA 2YCLB 5A3HA 3F5LA 3TWBA 4TV6A 2WKLA 2OWCA 1OK6A 3PP7A 4UBPC 2FGLA 2XIJA 2P50A 3W1RA 1P0NA 3QSRA 3NM3A 4GZIA 2XGZA 1TE1A 2OT1A 3I4EA 4L9YA 3TDFA 1ZQ5A 2DV0A 4JYFA 1GONA 1EPVA 1HO1A 3ZT7A 2VURA 2NUXA 4RJEA 2WCAA 3P14A 2HXUA 4BZYA 3E49A 4B16A 3LGEA 1MYRA 3S47A 4DWSA 3IIZA 1OIFA 1E1CA 4Q8WA 4GQQA 3EWYA 3UXLA 1EFZA 4LB3A 3U6WA 3SCUA 1B57A 1EUNA 3NUKA 2GJLA 2ACUA 4IMFA 3RG6A 4IIGA 2O0TA 2DEPA 1WDSA 3MYPA 3CMJA 4LWWA 3UZZA 4LUYA 5DFAA 4UC5A 1LJYA 2UZ9A 1JYXA 2WPBA 1US3A 1TWWA 4RE0A 1OQFA 4ICMA 1K3UA 1OFQA 2XFFA 1LBMA 4O53A 3QYSA 2Y61A 3ZWSA 5BCAA 2VFFA 3VE9A 4DZAA 4M1BA 2J9YA 4F79A 1XPYA 4CU6A 1VCGA 4W88A 3ZT5A 5CSYA 3THCA 2W63A 2E09A 4GY0A 4C6LA 1IGSA 2P8BA 4O8AA 1IEVA 3FFSA 4QQ3A 2FH8A 1B3OA 3VCRA 3S5ZA 1UWAA 2TMDA 2YLLA 3V7PA 3ZVHB 1F3XA 3WNOA 2QAPA 2PDQA 4BA0A 1WAUA 4FX8A 4F3HA 4PBFA 3PZQA 4I5RA 4NT0A 3PC0A 4KRUA 1DXEA 5AVHA 1GYMA 4LEFA 3OYXA 3BLFA 4LF1A 1DWHM 4I3GA 3G3DA 4JTTA 4JL1A 3S0CA 2WHMA 3OTRA 3T4WA 1O1ZA 5IM51 3RIKA 1WBJA 1A5AA 1CEOA 4QG9A 1F3EA 1GK8A 4PMJA 1Z69A 3N9SA 2QYGA 4DWSD 4PFMA 1P7TB 2E5BA 1R3WA 3TW9A 4N9DA 2Y89A 5CJNA 2O55A 1OFAA 5I3DA 4AIEA 1ADSA 1T0OA 4AZ7A 2X0HA 4YHGA 2UY2A 2W61A 4ATLA 2OWWA 4RR4A 4RNFA 4HMEA 2V2CA 1IZCA 4JTIA 2HNHA 3R8GA 4OOUA 2OQLA 2P5NA 3WY1A 4O1EA 1CDGA 5LA0A 5EA9A 2ZA2A 4RDZA 2E9MA 2Y2WA 4M7SA 4QG8A 3V0SA 4QM1A 4ZE4A 4C91A 2J79A 3TC3A 4GABA 4L9XA 1N8FA 2WMJA 1NIUA 4HA0A 3W86A 3RN6A 3S2LA 5D30A 3GNRA 1O5KA 2FFIA 4CNNA 1A50A 3EMZA 2WWDA 4NU7A 2OELA 3NJ3A 3IJQA 3IIPA 4YVPA 2OX1A 1HJVA 3VZYA 3QZ6A 3E6EA 1OYBA 2A3BA 2UWFA 4XVEA 4LUTB 3VAVA 4P7LA 1C9DA 2C7FA 4XTIA 5D9MA 4NRRA 2C16A 5F2MA 3PZVA 3MMDA 5C9WA 3O06A 1JAKA 4B9YA 3WMBA 3ITVA 1XYFA 4C6MA 3ONCA 4DUWA 2E3ZA 3DG3A 2DVUA 1KBLA 3UPMA 1ME7A 2DSZA 3G1HA 5H8UA 3PUOA 2D73A 5SWUA 1QASA 3UNDA 2WHLA 3SY1A 3TQ0A 5D33A 2PURA 3RCYA 1A3HA 1SR9A 4MJ2A 2B7NA 4IUGA 3WEMA 4R9XA 4QRNA 3OODA 4JKMA 4R85A 1EJUC 3EX2A 5KEZA 4R7OA 3L0NA 4HTBA 2E68A 4M3PA 2CXGA 5C5YA 2E40A 4JHOA 3PAOA 2X1IA 5HMFA 1L0PA 4HZMA 3W88A 4G7EB 3IUDA 4JFTA 4L4MA 2TRSA 1J01A 6A3HA 1EYWA 3GE7A 1DVJA 3QZAA 3AXIA 1YPIA 1CB7B 4K1GA 4I7WA 1GOMA 1KC7A 1R38A 3HPXA 3UR2A 4TTGA 4Q4MA 4TO8A 3T40A 1JL8A 2D1ZA 1TMQA 3WNKA 3QTGA 1L6FA 1CPUA 2CBUA 3CHCA 2OB3A 3QN3A 6CGTA 2QPSA 2ZZ7A 3FLUA 3FAWA 1K1DA 3G2GA 3WK1A 3LHYA 4I9AA 1GG1A 5ABFA 1JR1A 3H7RA 4BI7A 3WF2A 4LRTA 2YIHA 3QLLA 4R9OA 5KZMA 4M8UA 3H4GA 3Q4DA 1XCFA 2WPGA 3CL6A 1VFMA 2PTDA 2PDKA 3A22A 1VCVA 5FF7A 3GLCA 3EBVA 2QR6A 4YHEA 2GZXA 3EXTA 2PDIA 4BS0A 4JTCA 1ZAHA 3IV8A 1AD1A 4AFYA 3BAKA 4Z08A 4I5UA 4WJXA 2A6LA 3UY7A 1LG2A 2I5IA 1MEIA 3L4UA 3ZLFA 4HNNA 1JIBA 4LYKA 2EPOA 3OBKA 1NQ6A 1M41A 1LLZA 2V3EA 2A1YA 3MKKA 3WQGA 3PWIA 5HAOA 2PSNA 1XLLA 1ZRQA 4ZA0A 4E3TA 3GVRA 3UWVA 3HQPA 4FNSA 5AYXA 2WJEA 2RKXA 1UJPA 3OJGA 1R8LA 2F38A 5EL1A 4X0VA 3EA1A 2PWHA 1JQXA 1B5TA 4IX0A 2YB4A 2XWEA 1RVKA 3WLIA 3TQKA 2V9DA 3UWWA 3I3DA 4GO9A 3GXMA 3S2JA 2OEMA 3F2BA 3TK7A 4MNMA 2VGFA 2OZTA 1CNVA 3WNMA 1LT8A 3MC5A 3SDOA 3PSWA 5CBIA 3R13A 4L61A 5LYRA 4F2TA 3VMOA 4X9YA 1Q65A 4IGHA 4M6UA 3RLUA 1HN1A 3M6DA 5LXXA 1XC6A 4MY8A 1S1RA 4L4LA 4PMOA 4IICA 1LTDA 1MRQA 1FDYA 2QCGA 4LTSA 2FTPA 1GOXA 1KM6A 2E25A 5G1MA 2YL6A 4Z1AA 1IE7C 3WUEA 4MFEA 1E73M 1FH9A 3TYCA 5CXPA 3AIWA 4QFUA 4XX6A 1Q6CA 2ZRZA 3VU2A 4J5NA 4LUIA 3PZ9A 1UR2A 4JX6A 1DE5A 1GZGA 2ZQ0A 2KX9A 2WB5A 1S3TC 3NG3A 1W1ZA 4O4VA 2VI0A 4QP0A 1DTNA 1EKOA 3S1XA 3DGBA 1XRTA 3N6HA 2XH0A 4Y96A 3TNBA 1E71M 4QDWA 1H2JA 4XSLA 3WLMA 1QPQA 2BOGX 5D4YA 1F6PA 1OF8A 4AMCA 1BQCA 3QVQA 5FOOA 3H22A 1PJ9A 1J0IA 1QI5A 2JK2A 4QAWA 3DKLA 2Y70A 3AZTA 4EPBC 3AXMA 1FWBC 1PKYA 3N29A 3FA5A 4D9PA 3HMCA 3M0VA 3N9RA 5CCZA 4ILSA 3V0UA 1B30A 4C6OA 2ZICA 3PNUA 4XBJA 1XYCA 3SN1A 2XFRA 3W7MA 4RW5A 2IQTA 4GXMA 1GKPA 1FCQA 1L9WA 1C90A 1B54A 3TJXA 1W9DM 2OOFA 2W62A 3FYPA 3SI9A 4LAOA 3E2SA 3ISIX 4ECLA 2DY3A 4ZTYA 3W28A 4D6DA 1OX4B 1XINA 2WC4A 1LOQA 5CPLA 4AC1X 3VIKA 1OIMA 1XCWA 4FXSA 4KKXA 2QCMA 1QI0A 2W3ZA 1XF0A 4HYRA 4JTKA 3WLSA 2JGQA 4K8EA 1K9DA 2WANA 1D3HA 4OJYA 3QFWA 5CPSA 3N4FA 2YL9A 1I2PA 3H26A 4W93A 1GJWA 4W7UA 1MW2A 1PEZA 3FEQA 1UWQA 4HBKA 2A79A 3SRDA 3ARYA 4MGGA 2NX1A 3WQOA 2JFEX 3R58A 1XJBA 1XG3A 2V3GA 4BEUA 1QPRA 3RPDA 2FDMA 2BG5A 2FTYA 1XYBA 3NQVA 5LIXX 4MWAE 1XWYA 1FFQA 1TPB1 2VCBA 4EWJA 3PANA 3EPOA 4JD4A 1QDSA 2WSRA 2BB0A 3P93A 4PUNA 1WDPA 1RJQA 4UIOA 2ATSA 3AFBA 4AD3A 1GKRA 4KFOA 1OFEA 1Q8AA 1C7TA 2O9RA 4OE7A 2O92A 4NAFA 5LNVA 3CMGA 3UZWA 2Q01A 2PBOA 3MYOA 2Q71A 1DIEA 3WD4A 2FPYA 3CB8A 3L67A 4O8RA 4B2DA 2PWUA 1O66A 4WOQA 3NEVA 4ML4A 5FCZA 2V5KA 2VZSA 4J7RA 5FI8A 1Q8JA 1YDOA 4RCXA 3VE7A 3RJYA 5LIUX 1F73A 4QNWA 3MUIA 5BOOA 4B4FA 2GOUA 2NVCA 4UZUA 1OGGA 1EGMA 1OT2A 1NM9A 1S2AA 4DBWA 3E38A 4NL1A 3UR8A 2HRWA 1M03A 2J75A 1BWKA 2HK1A 2D0FA 5K3VA 4IG2A 5D37A 4AH7A 3M0YA 4UCGA 4E6MA 2VVNA 3C61A 3JR2A 4U3AA 1UMLA 1DEDA 1TWZA 4Y9NA 1RP8A 2QEZA 5D02A 1XLGA 3EGJA 1E70M 3OB8A 5FEPA 2VR5A 1V08A 1Z44A 4BWLC 4C7GA 1LM1A 2QV4A 1RK5A 3OQEA 2C91A 4YS1A 1R2TA 2VEGA 3NDZA 1MUMA 4D8ZA 1JRBA 2R1MA 2Z29A 4N6EA 4DO5A 4H7CA 2QF8A 3RLGA 4JY9A 1IEQA 3L4YA 2CLMA 4MZYA 4DI9A 4N02A 1H60A 3KTSA 3C0LA 1UYQA 3F2DA 4QCFA 1P0EA 3DFQA 2X05A 3ITCA 2Y6ZA 3STFA 1H11A 4TR9A 1WPCA 2WJZA 3N15A 3NXFA 4DO6A 1ME9A 4D71A 3WDHA 3R0UA 3MA8A 4IF2A 1B31A 3OVGA 3H2CA 3KL0A 1X1ZA 2ZUTA 3T78A 3Q58A 4Z0JA 3WD2A 5C9UA 1JYNA 3UWUA 3N3MA 5FJUA 4QSHA 4L65A 4XD4A 1BTMA 1WX0A 4GYPA 2J6XA 2GJPA 1V6UA 3IGSA 4DLFA 2GQ9A 4B2DD 1FA2A 2ZUMA 2PDYA 3HOJA 2VFEA 1VFOA 4MB3A 2DFAA 1XCXA 7A3HA 1J6OA 2EPMX 2P88A 3PBUA 2ZX7A 4A2RA 3VOHA 3V4BA 2VX6A 1UUMA 3HURA 3C52A 1ECEA 4QIUA 2QULA 1T8XA 1YIXA 1J12A 1OG6A 3KRUA 1BWVA 3E0WA 3LMYA 3N2BA 2Z1XA 1MI3A 4OV4A 1J2WA 1A49A 5AC4A 2ZWZA 1DKWA 1TV7A 1BPLB 3P84A 4ZOCA 1WZAA 4PSPA 4AQLA 2J62A 3DESA 1VYRA 3N12A 4JTAA 1XUUA 1HX0A 2VD9A 3BAYA 2QJIA 3I6EA 3WLHA 3UBPC 3OW1A 4PCFA 1QW7A 3TLQA 5JIWA 4D1IA 1AJ0A 3B8TA 1LQ0A 3FW6A 4D6HA 1MDRA 2Y5SA 4WSJA 4Z2IA 1JCYA 3URQA 4WDUA 2XFWA 3DBPA 3FJLA 3W3OA 1GQIA 3EOOA 4NZ5A 4M19A 3KBMA 2Z7GA 3LRKA 5GJNA 4AD1A 4O12A 1BFNA 1VFTA 2W79A 3CZ8A 3BLPX 3VDHA 3EDKA 1VFSA 3WF4A 7CGTA 4DBUA 3VGEA 4EF8A 4M81A 1N55A 1U83A 3C0JA 1E4IA 3STPA 1OZMA 3T07A 3ZSTA 3QY7A 3EEGA 1BGGA 2EG7A 4XB3A 2WYSA 4ENLA 1H7NA 3GFZA 5XINA 3R7MA 3H2NA 4AX7A 3WJYA 1JPHA 1MW3A 1FDJA 3W1PA 1NDVA 3KP0A 4CN4A 3SUTA 4K68A 1BRLB 4GUIA 3EWCA 3W6YA 1AW1A 1XSIA 1A0DA 4V28A 1UQZA 4QLJA 1GZJA 3GBDA 1CXEA 4FLOA 1ZCOA 3QPYA 4QE1A 5HULA 2DZTA 5HNRA 1KV8A 4GCAA 5HA7A 4RK8A 3WBAA 1TJRA 4LC8A 3WG6A 2GGIA 1X38A 1JCNA 5FJRA 1S5NA 5FA5A 3MUXA 5F1UA 2CETA 5A2AA 1RXOB 4H8UA 4HZ7A 4GJJA 4GNKB 2UV8G 2OTDA 4CNOA 3V35A 4PMZA 3GDTA 1A3XA 2ZA1A 3DYPA 2INEA 3CUIA 4W8BA 1JVNA 2VFHA 4IIFA 1XBVA 4DAIA 5A2CA 4LS0A 2R1NA 3R8HA 2ACRA 3VIPA 2GOKA 4JGDA 4BY3A 4Z1DA 1P6BA 1UBSA 1V3HA 4OECA 1NWRA 3H55A 4O1FA 2B31A 2BV9A 3EMQA 1SR0A 2B0MA 5LXEA 4JN7A 2YSWA 1FKWA 1PWMA 3BJFA 4A3RA 3TTOA 2A3EA 1HL8A 3VCNA 3SR7A 1U5HA 3DFSA 3NSNA 3GG1A 2FJUB 4RZ4A 4PTVA 5I23A 2GQ8A 4POCA 4MMWA 5BRQA 1DHPA 3WQ6A 1BLIA 3PR2A 2VX7A 2POTA 5AVNA 2CLFA 3AZSA 2V81A 4DF0A 1T6MA 1DQXA 3MP3A 1H51A 1JDEA 3G6LA 3CUZA 2BXYA 3FVMA 1GEQA 4AZIA 2XIMA 1UZDA 1OFBA 3LTYA 4LV4A 4UTUA 1DHKA 3VX1A 1TO3A 2ISWA 3CH9A 4GFIA 2EKGA 3FY1A 1J8VA 1SW7A 1C9WA 1EBHA 5T26A 4OWGA 3TCSA 1D7FA 2YL8A 3UETA 1X6NA 3K2GA 2KAUC 2PC8A 2E67A 3L12A 1MFUA 1NU5A 1XX1A 4UNIA 2XWDA 1PO9A 1RCOB 1XSJA 3SJ3A 4AW7A 3UCCA 1ZENA 3ITXA 2Z2BA 2O56A 3AYRA 1G0CA 3W2UA 4RPQA 5IFPA 2FZ9A 3N3TA 3MO4A 1QO5A 1GOKA 3VC5A 3F5KA 2J47A 1EJTC 2D2HA 5AB3A 2F6UA 4GJIA 4Y90A 1XLAA 1KRAC 4OIFA 5KTLA 1QAPA 3CQHA 1K4HA 4C7FA 1O5XA 1TJ0A 2QCCA 3THQA 1TRDA 3OBAA 2ZRYA 1QATA 3P67A 1EDQA 1V3KA 2XIBA 2ISFA 4Q32A 2D2GA 1ZP3A 1YTKA 3R89A 4PB3A 3HV8A 1ZAJA 1X8FA 3OGVA 4LCQA 3D6NA 3GNPA 1IYXA 1TPDA 2QLYA 1Y7VA 4K37A 1P6WA 3VNMA 1A5CA 3AIEA 4UOQA 4W7VA 4WY0B 3FGCB 1E43A 3W24A 4O0QA 1LRQA 5I07A 1JJKA 4UTTA 3SSJA 3H4XA 4XZMX 5AYYA 1L6WA 3UR7A 5HNUA 4AYGA 1XBXA 3NYZA 1ZJAA 8XIAA 4J35A 3QPZA 1OY0A 2WW5A 2FMNA 3M44A 4L64A 5CC6A 3K4WA 4HMDA 3UXAA 2CW6A 1RPKA 2CU0A 1FQ0A 3A9IA 2CZDA 1OC5A 2V5JA 3HU7A 4O4WA 4HYVA 3BLOA 3OLEA 4I8DA 2PLMA 3WF1A 3SQMA 2Y7FA 3M0KA 7ODCA 3FDKA 4IXXA 3S2NA 4LBSA 1R9XA 2CYGA 2V5BA 3QF0A 1E6ZA 1FFRA 1AH0A 1UWSA 4ZCWA 1KBBA 4MJMA 3UCQA 3GR7A 3BJTA 2HSAA 5F4SA 2VELA 1AW5A 1XFBA 3PWAA 3CXOA 4G8TA 5BNKA 2P8CA 3JW7A 4IFKA 4DJDA 1EZ2A 1C7SA 3UWYA 2V5LA 2C18A 3RYSA 4UFIA 1CGXA 1KKOA 2P76A 2V2HA 3CHVA 1TIWA 4ZQRA 2R91A 4M0XA 2EG8A 2QVHA 4PH6A 1TMHA 4TX9A 1KWKA 2AOSA 1PUDA 1P0DA 3AALA 4DF2A 3TC6A 1UZ4A 1PZ2A 3W75A 1VRDA 1CW2A 1JPDX 1CXHA 1Z89A 4MJ4A 1MZRA 2WXDM 3E0FA 3OG3A 3XISA 3G1SA 4HHPA 4NXKA 4O0ZA 2BFGA 3M9YA 1SJBA 3GO2A 3KLLA 4QHRA 1GYLA 1H1ZA 1Z41A 1HKVA 1JNEA 3W84A 3TAKA 3EYPA 3P0XA 1I2OA 4LNYA 1FY6A 4S2BA 2G8ZA 3E9AA 3MCMA 4X63A 3G77A 1PIFA 1WKYA 2GFTA 3W7RA 4ICCX 1M01A 2NUYA 3IUIA 4WUIA 2X09A 2V67A 3B9DA 4XQ6A 3EDDA 5AHMA 2O9TA 3IJ7A 4D72A 4F0MA 1KW1A 3OLIA 1BAGA 2YZ5A 2V30A 2DSWA 4PBEA 1K9FA 4GC4A 3LLDA 4HN8A 1PV8A 1BEUA 4GKTA 2F6KA 3MO7A 3OA5A 4MDOA 2XN0A 4RNHA 1UR4A 3BPWA 3PAJA 3CNYA 3LLFA 3ARZA 2P0OA 4G1KA 1XD1A 1ZNNA 3BVJA 4TV5A 4FO4A 3FHQA 5HMDA 1SYTA 3PUEA 1NOWA 3UT0A 1KTBA 4NHVA 1LQAA 4IH3A 4DJDD 4NZ4A 1PS9A 3SQSA 4V27A 4H04A 2VRKA 3N2XA 4MYXA 4JPGA 2DU2A 3I7QA 2PWVA 3GSMA 4MJZA 2I5QA 3BGJA 4GMEA 3GNXA 3I6RA 2WM1A 4LJ3A 1ONXA 5HK4A 2X7WA 3WQPA 2VL4A 3FN9A 1TV3A 3DG7A 4PTMA 4IWWA 2O9PA 4D6EA 1KBJA 2J7FA 4LUSB 1EQCA 5REQA 2C3ZA 1GUVA 2RDWA 1CXIA 3BL3A 4NAEA 4IFOA 1HKKA 3WLRA 2UY4A 3L0KA 1TUXA 5HR6A 3WK2A 1LL6A 1C8VA 5KZDA 1BXBA 4C6JA 5I6SA 4S3EA 4XBSA 3MB9A 1NF0A 1OCQA 1TCMA 3V5OA 3NR0A 4HA4A 4IPNB 3T0CA 5IRPA 2NQ9A 1JXKA 3BGGA 2XUCA 2RFGA 3QY6A 1E4NA 4KCVA 1HJXA 5F1VA 4LV9A 2Z26A 4GUJA 3R8RA 1CXLA 1P6CA 4XAYA 3B4UA 2Z1SA 3GYCA 3NVTA 4ORMA 4AWSA 4FB7A 3NQBA 3P8IA 3EA2A 4R34A 3K8KA 1SJCA 3L68A 1LT7A 4HU4A 1L2QA 1UR9A 3L21A 1WQ5A 1SZNA 2UBPC 4UUIA 2NQJA 4O1BA 3ZO9A 2VC9A 3FAXA 4TVDA 1CLVA 2DDXA 2Z0IA 2C1HA 3A4XA 2E8ZA 4YMZA 4MY9A 3ZJ8A 3KXQA 1EBGA 5H8PA 3BV4A 4GVHA 1P0BA 4H6KA 3RNDA 3KBNA 1BHGA 4IQJA 4E4FA 1KB3A 2X30A 3BLEA 2BHYA 3V75A 1JPKA 3DHPA 3W7CA 3UG4A 2A7PA 4IQDA 2QUVA 2Z2AA 2OEKA 4ALDA 4BK9A 3CPRA 4L6OA 2YJQA 4K1WA 4LU0A 1XI3A 5F2LA 5ABGA 3HO8A 1KO0A 4UNKA 3U48A 1MNSA 2VGBA 1J0ZA 1DV7A 2BXVA 3RX3A 3EB3A 3TMQA 3H8AA 1REQA 1UHVA 3B3DA 1UD4A 1O5QA 3G1XA 3WQFA 1LG1A 2PDMA 4W8AA 3NQ6A 1QHPA 2GLKA 3AQUA 5CGTA 4BEQA 2BMBA 2VGIA 1X1OA 1S5TA 2ALDA 4I7UA 4OBSA 3GC2A 2D24A 4GH1A 5A6SA 3GZAA 4JQAA 2GSEA 1FVPA 4E2VA 5DANA 4LANA 2VZTA 3LB0A 3BGAA 4Y9PA 1OG0A 5LNUA 4W5ZA 5GJPA 2PDHA 4K39A 1IHIA 2ZRUA 1VPYA 3SM0A 2FJKA 1US0A 3KW3A 1JFHA 1LZOA 2TSYA 2FZNA 3V18A 4QE5A 3C2EA 4Q8NA 2DPEA 3NDYA 1PBGA 2L5HA 3MCOA 4H9TA 4MSSA 2RDXA 3STGA 3PZUA 1J0JA 5A6MA 4QGCA 3AOFA 4DX3A 5XIMA 5C9ZA 2GDVA 1JCXA 1G94A 3CUGA 2VQUA 3RFAA 4CUCA 2Z24A 2XGBA 4US5A 3GYEA 1J0HA 3BMVA 1RHCA 3FV9A 3CGTA 1GJPA 5LHEA 4I9MA 1ZY9A 4WVXA 3CLMA 4PL1A 5AC5A 5GNYA 3AS3A 1FHLA 1C8XA 2ZOXA 4ERGA 3TUUA 4UTLA 3LRMA 2PTWA 2WNQA 4UMAA 1QPNA 3SECA 1EC8A 1EWDA 4OT7A 3VD7A 5A8QA 4Z2HA 1IEIA 3ABOA 5EPDA 1OZQA 4QE4A 3M0HA 3BLLA 3MMUA 4C90A 5HR7A 1YNYA 1DIKA 3DGRA 3TZFA 2Q3RA 4LX4A 3GXNA 4N4QA 4GIAA 1XIBA 3BE7A 2CLLA 2F6XA 3FNDA 2WOQA 1R3VA 1KFEA 3HPZA 2YCJA 4ZFMA 4V1XA 1TX2A 1GG0A 3EDJA 1JI2A 2GGEA 2DJLA 3RM8A 3A64A 2JEQA 2JGYA 1DJWA 1TV4A 2W9MA 2ONEA 4B4HA 4F4RA 4XWUA 3WN6A 1BXCA 3LHWA 3NQAA 1XIMA 2CWNA 4RZ5A 1K9TA 1V02E 1E6QM 1OF6A 4X9SA 4YNGA 4HCDA 5I3HA 3R12A 3UWEA 1TQJA 5CQ1A 3RILA 3TLLA 4D1JA 1V93A 5FF4A 2CBVA 2E0PA 5AHIA 4I6KA 4S3GA 1VFUA 4KWOA 3QHNA 3W0KA 4JHMA 2VKZG 4XZWA 3H53A 5C2XA 5D04C 1ZPTA 4RE2A 3AIQA 3E1F1 4US5D 3OZOA 4J4KA 4ERAA 4ZODA 4KWSA 1DE6A 3WBWA 1Q6LA 4Y9OA 3EZ4A 1W3KA 6ENLA 3DUGA 2OGYA 1VF8A 2OFJA 5D2TA 4NX0A 1KCLA 4WHBA 3P5YA 4RV3A 4LCSA 4O28A 3TROA 4O13A 2CZEA 3HGSA 4LS1A 2HV5A 3L4TA 5DMMA 3XIMA 2QAFA 3SBFA 3NGJA 1E1CB 4IL0A 4GZJA 2POZA 4M7TA 1XIHA 4Y7EA 4QJ5B 4S23A 5HWJA 4EXAA 1OYCA 4HHLA 4YTTA 3O6YX 5KETA 1IEXA 1I9CB 4JAWA 5AHNA 3WSUA 4ONVA 5BXSA 4C6DA 4PB4A 3ARWA 4NF7A 2PZ0A 3SRHA 2PD9A 5G4HC 1IF2A 2YDRA 3WQ5A 4GI6A 4UR8A 3MBFA 4EOUA 3A13A 1FWHC 1B90A 2G3JA 4RE4A 4IJRA 2VEPA 4A3YA 4S1FA 5DY3A 4GJ1A 1O60A 1T40A 4PSRA 1W0MA 4NJHA 4FIQA 2QCLA 3LLXA 4J27A 1KFKA 3DHFA 5G1TA 3SADA 3W22A 3L5MA 2GL5A 3B05A 3M07A 4W87A 3MI3A 1PZ1A 3RR1A 5I3JA 2OEJA 1QT1A 4XZLX 3VNLA 2DIKA 3GAYA 1PTGA 1IT8A 3D0CA 2VRJA 3IGXA 1H7PA 2OCZA 3BV7A 2GVYA 2YGYA 3GHUA 3SB0A 1VH7A 1Q66A 1CGWA 1NP2A 1HXJA 1PKNA 1V6WA 1J18A 4BI6A 1TV2A 1JD7A 2XPKA 2D3LA 4MKVA 1UOKA 5H2ZA 3RMJA 3LHVA 4L4OA 3W37A 5EMYA 3S6OA 4BKNA 4AZBA 1PCKA 3M5ZA 3OIHA 1FH7A 2J13A 2NUWA 2QJHA 3A3HA 3CWHA 2J8GA 2PTXA 2VJXA 3B8IA 2XDFA 5CSUA 4PMVA 3VDCA 3L4VA 4FXFA 4E5TA 5BWAA 2VDIA 4UZSA 5A8MA 2VO5A 2VFDA 2CZ5A 2VQTA 2ZXAA 4N4PA 5FIPA 1JFXA 1DOSA 3VM5A 1SMAA 1WZLA 2PB1A 2NQZA 1WXZA 2WSQA 2BVWA 4AVFA 4C1LA 2B81A 4JXCA 4H00A 1BSLA 1HJWA 1BG9A 2Y4SA 3GUWA 3L2IA 1ALDA 4URIA 2DJXA 1TKKA 5I5RA 1JULA 4B5WA 1CGUA 1E0XA 1TPEA 3WNLA 1OWQA 1DIOA 1HGWA 3LSBA 5FF2A 4UQ9A 1HNYA 4JQ3A 1FHDA 4AU0A 4CQAA 5E5CA 2OO6A 3GW0A 2NZLA 2W92A 3NXLA 3AHXA 3M0LA 5CZKA 1R3TA 1MWOA 1DJYA 2ZX6A 4WJEA 2R14A 3RRXA 4A6GA 3TQPA 1TWSA