5EAAA

Aspartate aminotransferase from e. coli, c191s mutation
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The role of residues outside the active site: structural basis for function of C191 mutants of Escherichia coli aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 127
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1998-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5eaaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5eaaA01
4BQ0A 1TPLA 3ZRPA 2R2NA 3MAUA 2BI5A 1IAXA 1EQBA 4ITGA 1OATA 1OXPA 4ATPA 2ZSLA 1YJSA 2VMXA 3RCHB 3QN6A 1CQ8A 1GC2A 2W7KA 5E5IA 2BKWA 3EUCA 1YIZA 4F4EA 4F5LA 1CZCA 2BWNA 3VOMA 1W3UA 1C7GA 4PIWA 1ECXA 3GWPA 1IUGA 2ZUKA 2CTZA 3H7FA 3F0HA 1MDZA 4WYFA 4AZKA 3N5MA 4P7YA 1UU2A 2D66A 4NOGA 4W5KA 1JF9A 1ORDA 2W8TA 2FM1A 5G2PA 2PB0A 5I92A 5J8QA 3WKSA 2JJHA 4AO4A 1MLYA 3ZZKA 2EH6A 1I48A 3AOWA 2WK7A 3QBOA 1S09A 3OKSA 4RIZA 2VYCA 4A0HA 3KKIA 2VMPA 1LW4A 3GETA 1UU1A 5M4DA 4WB0B 3R9AA 4B9BA 4WP0A 1I29A 4ADBA 4JE5A 5EQCA 4UQVA 4GE9A 1E5FA 1AIBA 3BCAA 3BS8A 5LH9A 1GBNA 3GBXA 1VJOA 1LC8A 3A9YA 4XJMA 2QA3A 4A0FA 1B5PA 2E7JA 2W7HA 2AATA 4E3RA 4F5HA 3B1CA 3EZ1A 5C6UA 5M4BA 4WYCA 3WKRA 2NMPA 1CL2A 1BJWA 5M46A 5IWQA 2BI9A 4OT8A 3JU7A 1MAQA 1YJYA 1ASAA 1CJ0A 3E9KA 1AJSB 1LK9A 1M0OA 3COGA 3K28A 3T32A 4AOAA 4L0OA 5EUDA 5F9SA 4H51A 1D2FA 1VEFA 1O62A 2C81A 3DXVA 1PFFA 3BCXA 4OCAA 4A6UA 1RVYA 4CVQA 4JEWA 4BA4A 4W1WA 2W7EA 5LHAA 1DJUA 1SVVA 3FQ7A 3Q8NA 3FDBA 3MC6A 4P3MA 1D7UA 1PMOA 1DGDA 3AEMA 2XH1A 2VGUA 4BA5A 1ARTA 1SFFA 2JG2A 5EAVA 4J8LA 4B98A 3EI7A 1KL2A 4MY5A 2YHKA 4LNMA 2JJEA 3NUIA 4UOYA 3UWCA 1JG8A 1FC4A 1KKJA 4ZM3A 2ZY3A 5HXXA 3A8UX 2JGTA 3EI9A 3I4JA 4O6ZA 3WZFA 3QHXA 5FT4A 3EI8A 3PDBB 4IXSA 1D7SA 5D5SA 5E4ZA 1UU0A 1TARA 4F5GA 1D7RA 1SZSA 4EFFA 1ZC9A 3LY1A 2W7LA 1QGNA 1UKJA 2O1BA 4KYOA 1ARHA 2EGYA 3H14A 4EB7A 3NYTA 1IBJA 4OC9A 4F5IA 2AY3A 2CB1A 3FFRA 4Y0DA 1ASMA 1DGEA 2VMZA 5AX8A 4DQ6A 1QJ3A 1LKCA 2DGMA 4FFCA 4LNJA 3AEPA 3N0LA 1GDEA 1WKHA 3W1JA 3PPLA 2BWPA 1AKBA 3FZ8A 2CANA 1BJ4A 2FNIA 2W7MA 2E54A 1QIRA 3L44A 4W1XA 4EB5A 4MKKA 1T3IA 3HMUA 2CH2A 3E2ZA 2WK8A 3AENA 3L8AA 2FQ6A 1GEWA 1M4NA 4RJYA 5DB5A 3DRDA 3LV2A 1C9CA 3ZRQA 2ORDA 1ELQA 1JS6A 2E7IA 2PO3A 3ECDA 3USFA 2VMYA 3ELPA 1C7OA 3PDBA 4IXOA 4A6TA 2VMWA 2GB3A 4AZJA 2VGWA 1GC0A 3ELEA 4ZDLA 1S07A 3OP7A 3GJUA 5G4IA 5HHYA 3LVLB 4LNLA 5FT8A 5E3KA 2Z9UA 3FCRA 3I5TA 1RVUA 2HOYA 2GMUA 2R5CA 1MDXA 1TOJA 4KAMA 4RKCA 2ZY2A 2VI8A 1J04A 4CBSA 2Z1YA 3PGYA 4FL0A 4ZDOA 1AHYA 2Z67A 1M0QA 2YKVA 4F5MA 2BIGA 1DJEA 4WYDA 3HQTA 3I16A 3BWNA 2C44A 4ADCA 2Z20A 3MADA 1G4VA 4Y0HA 3MBBA 4OTLA 3A2BA 3RI6A 4RM1A 4A0RA 4MQPA 4IY7A 2W7JA 3EI5A 4IXZA 2HZPA 1BT4A 2VMSA 3NRAA 5G09A 1DKAA 2CFBA 3E6GA 2CSTA 3A9XA 2ZP7A 3CAIA 1GC4A 1AMRA 1RV4A 2D5YA 3B46A 4W91A 3VK4A 1FG3A 4DBCA 5DJ9A 2F8JA 1E5EA 1S08A 1AY5A 3RQ1A 3UE8A 3KGWA 2D7YA 1AX4A 1SPAA 1P3WA 2X5FA 3FZ6A 3HDOA 2HUUA 2VLFA 4WXFA 3K7YA 4AH3A 1AMSA 2AY9A 4ITXA 4XJPA 5K8BA 4U1TA 1EJIA 3FVSA 2OKKA 5BJ4A 2VIAA 1CZEA 1GEYA 3CQ5A 3PD6A 1MLZA 1AICA 1SZKA 1MGVA 2VMOA 3ASBA 4IYOA 4ZLVA 4ZDPA 3BN1A 3JTXA 4HVKA 1IX7A 2BWOA 1XI9A 1AKAA 2O0RA 3NU7A 1CS1A 1M0NA 1TATA 2YCPA 5FT5A 4GE7A 4GDYA 1GCKA 1Y4IA 4M2JA 1CQ7A 4E3QA 1QITA 2YKYA 3ZZJA 3HBXA 1C0NA 1AY4A 1X28A 2FNUA 2TPLA 3FZ7A 2VLHA 1KMJA 2EO5A 3GZDC 4UHOA 4RITA 2DGLA 1CQ6A 2GSAA 2V1PA 4MKJA 1AHGA 1IAYA 1BJOA 2QLRA 3DR4A 2ZC0A 4UHNA 2BYJA 2W8VA 1TOGA 3JWAA 5F8VA 1B5OA 1V2FA 2VMVA 4WXBA 5EIGA 5EUNA 3RBLA 2W8JA 1X2AA 3FQAA 2Q7WA 2JJFA 2OGEA 4GE4A 1WYUA 4HF8A 2HUFA 3DODA 3PIUA 2EZ1A 1I43A 2VGZA 1ARSA 1V72A 4LW4A 4XQ2A 1WYTA 3E2ZB 2WKAA 2XBNA 3AENB 2DKJA 2RFVA 3AEJA 1IX8A 4N0BA 3BV0A 1DJ9A 4R2NA 1B8GA 1SZUA 2HP2A 2GQNA 1G7XA 1ASLA 4JF0A 3W1IA 4E1OA 3FRKA 4ZAHA 4K2IA 4WLJA 4WBTA 4BHDA 4ZM4A 1MDOA 4M2MA 2AY1A 3ASAA 1B9IA 2ZSMA 1VP4A 4IW7A 1OXOA 3FFHA 4F5KA 1ZODA 2YRRA 2R5CB 1AKCA 4RJ0A 3TFTA 1OHWA 4Q6RA 1EG5A 2AY5A 2D7ZA 2VMQA 3FVXA 4MSOA 4TV7A 5G4JA 4A6RA 2D64A 2DR1A 2HUIA 1O69A 1ASGA 1S06A 2VMNA 2CJHA 1YIYA 4R8DA 1O61A 3DZZA 3FD0A 3VK3A 3VK2A 4ADDA 2E7UA 4ISYA 3ISLA 4XJOA 2VI9A 1WKGA 2BI3A 1C4KA 3TFUA 2W8UA 3P1TA 4W8IA 4JEVA 1ASBA 4ZWMA 4WLHA 4A00A 1CL1A 3CQ6A 4M2KA 4PFNA 3KE3A 1V2DA 2EZ2A 1GD9A 3A9ZA 4PVFA 1AAWA 4Y0IA 4F5JA 1IJIA 2Z9VA 2VMUA 2W7IA 4RKDA 5M49A 1SF2A 1I41A 2CJGA 4LW2A 3MEBA 4Q76A 3GZCA 1KL1A 2OATA 5EAAA 5EFSA 4KXKA 4WYEA 3GSBA 4OBUA 4F5FA 1G4XA 2Z61A 1W7LA 3BWOA 3JZLA 3PD6B 3DR7A 4IYOB 3JW9A 5EUEA 4JE5D 3AEMC 3M5UA 2ZY4A 2HOZA 2AEUA 1N8PA 4A72A 4ADEA 1MAPA 1WSTA 3FKDA 4EU1A 3G8MA 2YCTA 1PG8A 2D61A 1ARGA 3MAFA 2QB2A 3NDNA 1LC7A 1RV3A 3DYDA 3IF2A 2BI1A 2JISA 1DFOA 2BI2A 1C7NA 3WLXA 1YJZA 2Z9XA 1BJOB 2VGSA 3GR9A 4OMAA 4OYTA 2AY6A 2YKXA 1ASEA 3MKJA 3EZSA 2HORA 3PJ0A 1B4XA 3RUYA 3VP6A 1PMMA 5EIGB 2PB2A 2OKJA 4TN4A 2QMAA 4N0WA 2WK9A 3II0A 1WYUB 1KMKA 1H0CA 3RBFA 4JEYA 2ZYJA 4LC3A 2BYLA 4OBVA 1BKGA 3B1EA 1WYTB 1GC3A 2R0TA 1TOEA 1Z3ZA 1TOIA 1WYVA 2VGTA 3ATHA 2X5DA 1BW0A 4XJLA 3TCMA 1AMAA 4CXRA 2QB3A 1ASDA 9AATA 4R5ZA 1DTYA 2OQXA 3E2FA 1KKPA 3CBFA 3UAKA 3QPGA 4IX8A 3WCNA 4ZSYA 3F9TA 3WX9A 3E77A 1ASFA 4GRXA 4MQRA 1OHVA 1AHEA 4JEZA 2VGVA 4JF1A 3QM2A 4GEBA 3LVMA 3G7QA 5D95A 3W1HA 4UHMA 4GSAA 2W7GA 5DJ1A 1AIAA 2DOUA 4ZSWA 4A0GA 3IHJA 4PFFA 2FYFA 1W7MA 1LC5A 1M6SA 2BIEA 3K40A 1AMQA 4R5FA 4TMRA 2CINA 2W7DA 1M7YA 2EPJA 3D6KA 1U08A 2YKUA 3LWSA 2JJGA 3NTJA 3QGUA 3RCHA 3TQXA 4QGRA 2ZJGA 3ZRRA 2AY7A 5DX5A 2D63A 2HP1A 2HOXA 3NYSA 5BJ3A 2X3LA 1AJRA 4BMKA 4WYAA 3NUBA 1ZOBA 2YCNA 3PAAA 3BWNC 3B8XA 4JEXA 4WYGA 4XAUA 2YRIA 3LVJA 2OGAA 3EI6A 4WXGA 4CBRA 4Q31A 3CQ4A 4DGTA 5HDMA 4E77A 3ACZA 3NYUA 1BQDA 3DC1A 2AY8A 1AY8A 2C7TA 3AEOA 4W1VA 3EIBA 2YOBA 2G6WA 1W23A 3G0TA 1N2TA 3F6TA 1QZ9A 4K2MA 4EMYA 1J32A 1ASNA 1ASCA 1LW5A 2AY2A 2QBTA 3EIAA 3HT4A 3HVYA 4RAEA 1M32A 3NU8A 4J5UA 1ELUA 4WB0A 3FDDA 4AO9A 4MQQA 2ZY5A 1IVRA 4XEWA 1FG7A 5G0AA 2W8WA 3BCBA 1YOOA 5FT6A 2GMSA 1YAAA 2O7CA 3B1DA 3PDXA 1H1CA 4XK1A 3WGCA 2V0YA 2BIAA 1O4SA 3N75A 3AELA 1AAMA 4Q75A 1AHXA 2CY8A 3AATA 3QI6A 3AOVA 4ZASA 2R5EA 3TATA 1BJNA 1JS3A 1OHYA 2BHXA 3NX3A 1AJSA 2CH1A 2VMRA 3AV7A 2CJDA 3MAFB 3WGBA 3PA9A 1XEYA 2AY4A 4MGRA 3BC8A 3NNKA 2FN6A 7AATA 1S0AA 1M0PA 2Z9WA 3KGXA 2VMTA 3VAXA 4U2HA 3FQ8A 1LS3A 1BQAA 3DXWA 1D7VA 3FVUA 4RLGA 3HL2A 1B9HA 3R4TA 2VIBA 4ATQA 5JAYA 1ARIA 1GEXA 1TOKA 8AATA 4I8AA 3GZDA 4WD2A 1IX6A 1QJ5A 1AHFA 1Z7DA 1X29A 3JWBA 1WYVB 3HLMA 3MC6C 2D65A 5TF5A 3WCOA 4CXQA 1BS0A 3LG0A 1N31A 3BB8A 3FSLA 1YNUA 4ZWVA 4K2BA 3LVKA 2DGKA 2AEVA 2Z1ZA 1QISA 3DU4A 1X0MA 2X8UA 3E2YA 3FTBA 1V2EA 2DKBA 3P6KA 3AEJC 1TASA 1W7NA 2W7FA 5G2QA 2C0RA 1G7WA 3WY7A
chains in the Genus database with same CATH superfamily
4BQ0A 1TPLA 3ZRPA 2R2NA 3MAUA 2BI5A 1IAXA 1EQBA 4ITGA 1OATA 1OXPA 4ATPA 2ZSLA 1YJSA 2VMXA 3RCHB 3QN6A 1CQ8A 1GC2A 2W7KA 5E5IA 2BKWA 3EUCA 1YIZA 4F4EA 4F5LA 1CZCA 2BWNA 3VOMA 1W3UA 1C7GA 4PIWA 1ECXA 3GWPA 1IUGA 2ZUKA 2CTZA 3H7FA 3F0HA 1MDZA 4WYFA 4AZKA 3N5MA 4P7YA 1UU2A 2D66A 4NOGA 4W5KA 1JF9A 1ORDA 2W8TA 2FM1A 5G2PA 2PB0A 5I92A 5J8QA 3WKSA 2JJHA 4AO4A 1MLYA 3ZZKA 2EH6A 1I48A 3AOWA 2WK7A 3QBOA 1S09A 3OKSA 4RIZA 2VYCA 4A0HA 3KKIA 2VMPA 1LW4A 3GETA 1UU1A 5M4DA 4WB0B 3R9AA 4B9BA 4WP0A 1I29A 4ADBA 4JE5A 5EQCA 4UQVA 4GE9A 1E5FA 1AIBA 3BCAA 3BS8A 5LH9A 1GBNA 3GBXA 1VJOA 1LC8A 3A9YA 4XJMA 2QA3A 4A0FA 1B5PA 2E7JA 2W7HA 2AATA 4E3RA 4F5HA 3B1CA 3EZ1A 5C6UA 5M4BA 4WYCA 3WKRA 2FKIA 2NMPA 1CL2A 1BJWA 5M46A 5IWQA 2BI9A 4OT8A 3JU7A 1MAQA 1YJYA 1ASAA 1CJ0A 3E9KA 1AJSB 1LK9A 1M0OA 3COGA 3K28A 3T32A 4AOAA 4L0OA 5EUDA 5F9SA 4H51A 1D2FA 1VEFA 1O62A 2C81A 3DXVA 1PFFA 3BCXA 4OCAA 4A6UA 1RVYA 4CVQA 4JEWA 4BA4A 4W1WA 2W7EA 5LHAA 1DJUA 1SVVA 3FQ7A 3Q8NA 3FDBA 3MC6A 4P3MA 1D7UA 1PMOA 1DGDA 3AEMA 2XH1A 2VGUA 4BA5A 1ARTA 1SFFA 2JG2A 5EAVA 4J8LA 4B98A 3EI7A 1KL2A 4MY5A 2YHKA 4LNMA 2JJEA 3NUIA 4UOYA 3UWCA 1JG8A 1FC4A 1KKJA 4ZM3A 2ZY3A 5HXXA 3A8UX 2JGTA 3EI9A 3I4JA 4O6ZA 3WZFA 3QHXA 5FT4A 3EI8A 3PDBB 4IXSA 1D7SA 5D5SA 5E4ZA 1UU0A 1TARA 4F5GA 1KAFA 1D7RA 1SZSA 4EFFA 1ZC9A 3LY1A 2W7LA 1QGNA 1UKJA 2O1BA 4KYOA 1ARHA 2EGYA 3H14A 4EB7A 3NYTA 1IBJA 4OC9A 4F5IA 2AY3A 2CB1A 3FFRA 4Y0DA 1ASMA 1DGEA 2VMZA 5AX8A 4DQ6A 1QJ3A 1LKCA 2DGMA 4FFCA 4LNJA 3AEPA 3N0LA 1GDEA 1WKHA 3W1JA 3PPLA 2BWPA 1AKBA 3FZ8A 2CANA 1BJ4A 2FNIA 2W7MA 2E54A 1QIRA 3L44A 4W1XA 4EB5A 4MKKA 1T3IA 3HMUA 2CH2A 3E2ZA 2WK8A 3AENA 3L8AA 2FQ6A 1GEWA 1M4NA 4RJYA 5DB5A 3DRDA 3LV2A 1C9CA 3ZRQA 2ORDA 1ELQA 1JS6A 2E7IA 2PO3A 3ECDA 3USFA 2VMYA 3ELPA 1C7OA 3PDBA 4IXOA 4A6TA 2VMWA 2GB3A 4AZJA 2VGWA 1GC0A 3ELEA 4ZDLA 1S07A 3OP7A 3GJUA 5G4IA 5HHYA 3LVLB 4LNLA 5FT8A 5E3KA 2Z9UA 3FCRA 3I5TA 1RVUA 2HOYA 2GMUA 2R5CA 1MDXA 1TOJA 4KAMA 4RKCA 2ZY2A 2VI8A 1J04A 4CBSA 2Z1YA 3PGYA 4FL0A 4ZDOA 1AHYA 2Z67A 1M0QA 2YKVA 4F5MA 2BIGA 3N7NA 1DJEA 4WYDA 3HQTA 3I16A 3BWNA 2C44A 4ADCA 2Z20A 3MADA 1G4VA 4Y0HA 3MBBA 4OTLA 3A2BA 3RI6A 4RM1A 4A0RA 4MQPA 4IY7A 2W7JA 3EI5A 4IXZA 2HZPA 1BT4A 2VMSA 3NRAA 5G09A 1DKAA 2CFBA 3E6GA 2CSTA 3A9XA 2ZP7A 3CAIA 1GC4A 1AMRA 1RV4A 2D5YA 3B46A 4W91A 3VK4A 1FG3A 4DBCA 5DJ9A 2F8JA 1E5EA 1S08A 1AY5A 3RQ1A 3UE8A 3KGWA 2D7YA 1AX4A 1SPAA 1P3WA 2X5FA 3FZ6A 3HDOA 2HUUA 2VLFA 4WXFA 3K7YA 4AH3A 1AMSA 5KTBA 2AY9A 4ITXA 4XJPA 5K8BA 4U1TA 1EJIA 3FVSA 2OKKA 5BJ4A 2VIAA 1CZEA 1GEYA 3CQ5A 3PD6A 1MLZA 1AICA 1SZKA 1MGVA 2VMOA 3ASBA 4IYOA 4ZLVA 4ZDPA 3BN1A 3JTXA 4HVKA 1IX7A 2BWOA 1XI9A 1AKAA 2O0RA 3NU7A 1CS1A 1M0NA 1TATA 2YCPA 5FT5A 4GE7A 4GDYA 1GCKA 1Y4IA 4M2JA 1CQ7A 4E3QA 1QITA 2YKYA 3ZZJA 3HBXA 1C0NA 1AY4A 1X28A 2FNUA 2TPLA 3FZ7A 2VLHA 1KMJA 2EO5A 3GZDC 4UHOA 4RITA 2DGLA 1CQ6A 2GSAA 2V1PA 4MKJA 1AHGA 1IAYA 1BJOA 2QLRA 3DR4A 2ZC0A 4UHNA 2WB6A 2BYJA 2W8VA 1TOGA 3JWAA 5F8VA 1B5OA 1V2FA 2VMVA 4WXBA 5EIGA 5EUNA 3RBLA 2W8JA 1X2AA 3FQAA 2Q7WA 2JJFA 2OGEA 4GE4A 1WYUA 4HF8A 2HUFA 3DODA 3PIUA 2EZ1A 1I43A 2VGZA 1ARSA 1V72A 4LW4A 4XQ2A 1WYTA 3E2ZB 2WKAA 2XBNA 3AENB 2DKJA 2RFVA 3AEJA 1IX8A 4N0BA 3BV0A 4H63Q 1DJ9A 4R2NA 1B8GA 1SZUA 2HP2A 2GQNA 1G7XA 1ASLA 4JF0A 3W1IA 4E1OA 3FRKA 4ZAHA 4K2IA 4WLJA 4WBTA 4BHDA 4ZM4A 1MDOA 4M2MA 2AY1A 3ASAA 1B9IA 2ZSMA 1VP4A 4IW7A 1OXOA 3FFHA 4F5KA 1ZODA 2YRRA 2R5CB 1AKCA 4RJ0A 3TFTA 1OHWA 4Q6RA 1EG5A 2AY5A 2D7ZA 2VMQA 3FVXA 4MSOA 4TV7A 5G4JA 3N4RA 4A6RA 2D64A 2DR1A 2HUIA 1O69A 1ASGA 1S06A 2VMNA 2CJHA 1YIYA 4R8DA 1O61A 3DZZA 3FD0A 3VK3A 3VK2A 4ADDA 2E7UA 4ISYA 3ISLA 4XJOA 2VI9A 1WKGA 2BI3A 1C4KA 3TFUA 2W8UA 3P1TA 4W8IA 4JEVA 1ASBA 4ZWMA 4WLHA 4A00A 1CL1A 3CQ6A 4M2KA 4PFNA 3KE3A 1V2DA 2EZ2A 1GD9A 3A9ZA 4PVFA 1AAWA 4Y0IA 4F5JA 1IJIA 2Z9VA 2VMUA 2W7IA 4RKDA 5M49A 1SF2A 1I41A 2CJGA 4LW2A 3MEBA 4Q76A 3GZCA 1KL1A 2OATA 5EAAA 5EFSA 4KXKA 4WYEA 3GSBA 4OBUA 4F5FA 1G4XA 2Z61A 1W7LA 3BWOA 3JZLA 3PD6B 3DR7A 4IYOB 3JW9A 5EUEA 4JE5D 3AEMC 3M5UA 2ZY4A 2HOZA 2AEUA 1N8PA 4A72A 4ADEA 1MAPA 1WSTA 3FKDA 4EU1A 3G8MA 2YCTA 1PG8A 2D61A 1ARGA 3MAFA 2QB2A 3NDNA 1LC7A 1RV3A 3DYDA 3IF2A 2BI1A 2JISA 1DFOA 2BI2A 1C7NA 3WLXA 1YJZA 2Z9XA 1BJOB 2VGSA 3GR9A 4OMAA 4OYTA 2AY6A 2YKXA 1ASEA 3MKJA 3EZSA 2HORA 3PJ0A 1B4XA 3RUYA 3VP6A 1PMMA 5EIGB 4K05A 2PB2A 2OKJA 4TN4A 2QMAA 4N0WA 2WK9A 3II0A 1WYUB 1KMKA 1H0CA 3RBFA 3N4SA 4JEYA 2ZYJA 4LC3A 2BYLA 4OBVA 1BKGA 3B1EA 1WYTB 1GC3A 2R0TA 1TOEA 1Z3ZA 1TOIA 1WYVA 2VGTA 3ATHA 2X5DA 1BW0A 4XJLA 3TCMA 1AMAA 4CXRA 2QB3A 1ASDA 9AATA 4R5ZA 1DTYA 2OQXA 3E2FA 1KKPA 3CBFA 3UAKA 3QPGA 4IX8A 3WCNA 4ZSYA 3F9TA 3WX9A 3E77A 1ASFA 4GRXA 4MQRA 1OHVA 1AHEA 4JEZA 2VGVA 4JF1A 3QM2A 4GEBA 3LVMA 3G7QA 5D95A 3W1HA 4UHMA 4GSAA 2W7GA 5DJ1A 1AIAA 2EYQA 2DOUA 4ZSWA 4A0GA 3IHJA 4PFFA 2FYFA 1W7MA 1LC5A 1M6SA 2BIEA 2A1VA 3K40A 1AMQA 4R5FA 4TMRA 2CINA 2W7DA 1M7YA 2EPJA 3D6KA 1U08A 2YKUA 3LWSA 2JJGA 3NTJA 3QGUA 3RCHA 3TQXA 4QGRA 2ZJGA 3ZRRA 2G7JA 2AY7A 5DX5A 2D63A 2HP1A 2HOXA 3NYSA 5BJ3A 2X3LA 1AJRA 4BMKA 4WYAA 3NUBA 1ZOBA 2YCNA 3PAAA 3BWNC 3B8XA 4JEXA 4WYGA 4XAUA 2YRIA 3LVJA 2OGAA 3EI6A 4WXGA 4CBRA 2KFPA 4Q31A 3CQ4A 4DGTA 5HDMA 4E77A 3ACZA 3NYUA 1BQDA 3DC1A 2AY8A 1AY8A 2C7TA 3AEOA 4W1VA 3EIBA 2YOBA 2G6WA 1W23A 3G0TA 1N2TA 3F6TA 1QZ9A 4K2MA 4EMYA 1J32A 1ASNA 1ASCA 1LW5A 2AY2A 2QBTA 3EIAA 3HT4A 3HVYA 4RAEA 1M32A 3NU8A 4J5UA 1ELUA 4WB0A 3FDDA 4AO9A 4MQQA 2ZY5A 1IVRA 4XEWA 1FG7A 5G0AA 2W8WA 3BCBA 1YOOA 5FT6A 2GMSA 1YAAA 2O7CA 3B1DA 3PDXA 1H1CA 4XK1A 3WGCA 2V0YA 2BIAA 1O4SA 3N75A 3AELA 1AAMA 4Q75A 1AHXA 2CY8A 3AATA 3QI6A 3AOVA 4ZASA 2R5EA 3TATA 1BJNA 1JS3A 1OHYA 2BHXA 2QSRA 3NX3A 1AJSA 2CH1A 2VMRA 3AV7A 2CJDA 3MAFB 3WGBA 3PA9A 1XEYA 2AY4A 4MGRA 3BC8A 3NNKA 2FN6A 7AATA 1S0AA 1M0PA 2Z9WA 3KGXA 2VMTA 3VAXA 3N4XA 4U2HA 3FQ8A 1LS3A 1BQAA 3DXWA 1D7VA 3FVUA 4RLGA 3HL2A 1B9HA 3R4TA 2VIBA 4ATQA 5JAYA 1ARIA 1GEXA 1TOKA 8AATA 4I8AA 3GZDA 4WD2A 1IX6A 1QJ5A 1AHFA 1Z7DA 1X29A 3JWBA 1WYVB 3HLMA 3MC6C 2D65A 5TF5A 3WCOA 4CXQA 1BS0A 3LG0A 1N31A 3BB8A 3FSLA 1YNUA 4ZWVA 4K2BA 3LVKA 2DGKA 2AEVA 2Z1ZA 1QISA 3DU4A 1X0MA 2X8UA 3H9XA 3E2YA 3FTBA 1V2EA 2DKBA 3P6KA 3AEJC 1TASA 1W7NA 2W7FA 5G2QA 2C0RA 1G7WA 3WY7A
chains in the Genus database with same CATH topology
4BQ0A 1TPLA 3ZRPA 2R2NA 3MAUA 2BI5A 1IAXA 1EQBA 4ITGA 1OATA 1OXPA 4ATPA 2ZSLA 1YJSA 2VMXA 3RCHB 3QN6A 1CQ8A 1GC2A 2W7KA 5E5IA 2BKWA 3EUCA 1YIZA 4F4EA 4F5LA 1CZCA 2BWNA 3VOMA 1W3UA 1C7GA 4PIWA 1ECXA 3GWPA 1IUGA 2ZUKA 2CTZA 3H7FA 3F0HA 1MDZA 4WYFA 4AZKA 3N5MA 4P7YA 1UU2A 2D66A 4NOGA 4W5KA 1JF9A 1ORDA 2W8TA 2FM1A 5G2PA 2PB0A 5I92A 5J8QA 3WKSA 2JJHA 4AO4A 1MLYA 3ZZKA 2EH6A 1I48A 3AOWA 2WK7A 3QBOA 1S09A 3OKSA 4RIZA 2VYCA 4A0HA 3KKIA 2VMPA 1LW4A 3GETA 1UU1A 5M4DA 4WB0B 3R9AA 4B9BA 4WP0A 1I29A 4ADBA 4JE5A 5EQCA 4UQVA 4GE9A 1E5FA 1AIBA 3BCAA 3BS8A 5LH9A 1GBNA 3GBXA 1VJOA 1LC8A 3A9YA 4XJMA 2QA3A 4A0FA 1B5PA 2E7JA 2W7HA 2AATA 4E3RA 4F5HA 3B1CA 3EZ1A 5C6UA 5M4BA 4WYCA 3WKRA 2FKIA 2NMPA 1CL2A 1BJWA 5M46A 5IWQA 2BI9A 4OT8A 3JU7A 1MAQA 1YJYA 1ASAA 1CJ0A 3E9KA 1AJSB 1LK9A 1M0OA 3COGA 3K28A 3T32A 4AOAA 4L0OA 5EUDA 5F9SA 4H51A 1D2FA 1VEFA 1O62A 2C81A 3DXVA 1PFFA 3BCXA 4OCAA 4A6UA 1RVYA 4CVQA 4JEWA 4BA4A 4W1WA 2W7EA 5LHAA 1DJUA 1SVVA 3FQ7A 3Q8NA 3FDBA 3MC6A 4P3MA 1D7UA 1PMOA 1DGDA 3AEMA 2XH1A 2VGUA 4BA5A 1ARTA 1SFFA 2JG2A 5EAVA 4J8LA 4B98A 3EI7A 1KL2A 4MY5A 2YHKA 4LNMA 2JJEA 3NUIA 4UOYA 3UWCA 1JG8A 1FC4A 1KKJA 4ZM3A 2ZY3A 5HXXA 3A8UX 2JGTA 3EI9A 3I4JA 4O6ZA 3WZFA 3QHXA 5FT4A 3EI8A 3PDBB 4IXSA 1D7SA 5D5SA 5E4ZA 1UU0A 1TARA 4F5GA 1D7RA 1SZSA 4EFFA 1ZC9A 3LY1A 2W7LA 1QGNA 1UKJA 2O1BA 4KYOA 1ARHA 2EGYA 3H14A 4EB7A 3NYTA 1IBJA 4OC9A 4F5IA 2AY3A 2CB1A 3FFRA 4Y0DA 1ASMA 1DGEA 2VMZA 5AX8A 4DQ6A 1QJ3A 1LKCA 2DGMA 4FFCA 4LNJA 3AEPA 3N0LA 1GDEA 1WKHA 3W1JA 3PPLA 2BWPA 1AKBA 3FZ8A 2CANA 1BJ4A 2FNIA 2W7MA 2E54A 1QIRA 3L44A 4W1XA 4EB5A 4MKKA 1T3IA 3HMUA 2CH2A 3E2ZA 2WK8A 3AENA 3L8AA 2FQ6A 1GEWA 1M4NA 4RJYA 5DB5A 3DRDA 3LV2A 1C9CA 3ZRQA 2ORDA 1ELQA 1JS6A 2E7IA 2PO3A 3ECDA 3USFA 2VMYA 3ELPA 1C7OA 3PDBA 4IXOA 4A6TA 2VMWA 2GB3A 4AZJA 2VGWA 1GC0A 3ELEA 4ZDLA 1S07A 3OP7A 3GJUA 5G4IA 5HHYA 3LVLB 4LNLA 5FT8A 5E3KA 2Z9UA 3FCRA 3I5TA 1RVUA 2HOYA 2GMUA 2R5CA 1MDXA 1TOJA 4KAMA 4RKCA 2ZY2A 2VI8A 1J04A 4CBSA 2Z1YA 3PGYA 4FL0A 4ZDOA 1AHYA 2Z67A 1M0QA 2YKVA 4F5MA 2BIGA 3N7NA 1DJEA 4WYDA 3HQTA 3I16A 3BWNA 2C44A 4ADCA 2Z20A 3MADA 1G4VA 4Y0HA 3MBBA 4OTLA 3A2BA 3RI6A 4RM1A 4A0RA 4MQPA 4IY7A 2W7JA 3EI5A 4IXZA 2HZPA 1BT4A 2VMSA 3NRAA 5G09A 1DKAA 2CFBA 3E6GA 2CSTA 3A9XA 2ZP7A 3CAIA 1GC4A 1AMRA 1RV4A 2D5YA 3B46A 4W91A 3VK4A 1FG3A 4DBCA 5DJ9A 2F8JA 1E5EA 1S08A 1AY5A 3RQ1A 3UE8A 3KGWA 2D7YA 1AX4A 1SPAA 1P3WA 2X5FA 3FZ6A 3HDOA 2HUUA 2VLFA 4WXFA 3K7YA 4AH3A 1AMSA 5KTBA 2AY9A 4ITXA 4XJPA 5K8BA 4U1TA 1EJIA 3FVSA 2OKKA 5BJ4A 2VIAA 1CZEA 1GEYA 3CQ5A 3PD6A 1MLZA 1AICA 1SZKA 1MGVA 2VMOA 3ASBA 4IYOA 4ZLVA 4ZDPA 3BN1A 3JTXA 4HVKA 1IX7A 2BWOA 1XI9A 1AKAA 2O0RA 3NU7A 1CS1A 1M0NA 1TATA 2YCPA 5FT5A 4GE7A 4GDYA 1GCKA 1Y4IA 4M2JA 1CQ7A 4E3QA 1QITA 2YKYA 3ZZJA 3HBXA 1C0NA 1AY4A 1X28A 2FNUA 2TPLA 3FZ7A 2VLHA 1KMJA 2EO5A 3GZDC 4UHOA 4RITA 2DGLA 1CQ6A 2GSAA 2V1PA 4MKJA 1AHGA 1IAYA 1BJOA 2QLRA 3DR4A 2ZC0A 4UHNA 2WB6A 2BYJA 2W8VA 1TOGA 3JWAA 5F8VA 1B5OA 1V2FA 2VMVA 4WXBA 5EIGA 5EUNA 3RBLA 2W8JA 1X2AA 3FQAA 2Q7WA 2JJFA 2OGEA 4GE4A 1WYUA 4HF8A 2HUFA 3DODA 3PIUA 2EZ1A 1I43A 2VGZA 1ARSA 1V72A 4LW4A 4XQ2A 1WYTA 3E2ZB 2WKAA 2XBNA 3AENB 2DKJA 2RFVA 3AEJA 1IX8A 4N0BA 3BV0A 4H63Q 1DJ9A 4R2NA 1B8GA 1SZUA 2HP2A 2GQNA 1G7XA 1ASLA 4JF0A 3W1IA 4E1OA 3FRKA 4ZAHA 4K2IA 4WLJA 4WBTA 4BHDA 4ZM4A 1MDOA 4M2MA 2AY1A 3ASAA 1B9IA 2ZSMA 1VP4A 4IW7A 1OXOA 3FFHA 4F5KA 1ZODA 2YRRA 2R5CB 1AKCA 4RJ0A 3TFTA 1OHWA 4Q6RA 1EG5A 2AY5A 2D7ZA 2VMQA 3FVXA 4MSOA 4TV7A 5G4JA 3N4RA 4A6RA 2D64A 2DR1A 2HUIA 1O69A 1ASGA 1S06A 2VMNA 2CJHA 1YIYA 4R8DA 1O61A 3DZZA 3FD0A 3VK3A 3VK2A 4ADDA 2E7UA 4ISYA 3ISLA 4XJOA 2VI9A 1WKGA 2BI3A 1C4KA 3TFUA 2W8UA 3P1TA 4W8IA 4JEVA 1ASBA 4ZWMA 4WLHA 4A00A 1CL1A 3CQ6A 4M2KA 4PFNA 3KE3A 1V2DA 2EZ2A 1GD9A 3A9ZA 4PVFA 1AAWA 4Y0IA 4F5JA 1IJIA 2Z9VA 2VMUA 2W7IA 4RKDA 5M49A 1SF2A 1I41A 2CJGA 4LW2A 3MEBA 4Q76A 3GZCA 1KL1A 2OATA 5EAAA 5EFSA 4KXKA 4WYEA 3GSBA 4OBUA 4F5FA 1G4XA 2Z61A 1W7LA 3BWOA 3JZLA 3PD6B 3DR7A 4IYOB 3JW9A 5EUEA 4JE5D 3AEMC 3M5UA 2ZY4A 2HOZA 2AEUA 1N8PA 4A72A 4ADEA 1MAPA 1WSTA 3FKDA 4EU1A 3G8MA 2YCTA 1PG8A 2D61A 1ARGA 3MAFA 2QB2A 3NDNA 1LC7A 1RV3A 3DYDA 3IF2A 2BI1A 2JISA 1DFOA 2BI2A 1C7NA 3WLXA 1YJZA 2Z9XA 1BJOB 2VGSA 3GR9A 4OMAA 4OYTA 2AY6A 2YKXA 1ASEA 3MKJA 3EZSA 2HORA 3PJ0A 1B4XA 3RUYA 3VP6A 1PMMA 5EIGB 4K05A 2PB2A 2OKJA 4TN4A 2QMAA 4N0WA 2WK9A 3II0A 1WYUB 1KMKA 1H0CA 3RBFA 3N4SA 4JEYA 2ZYJA 4LC3A 2BYLA 4OBVA 1BKGA 3B1EA 1WYTB 1GC3A 2R0TA 1TOEA 1Z3ZA 1TOIA 1WYVA 2VGTA 3ATHA 2X5DA 1BW0A 4XJLA 3TCMA 1AMAA 4CXRA 2QB3A 1ASDA 9AATA 4R5ZA 1DTYA 2OQXA 3E2FA 1KKPA 3CBFA 3UAKA 3QPGA 4IX8A 3WCNA 4ZSYA 3F9TA 3WX9A 3E77A 1ASFA 4GRXA 4MQRA 1OHVA 1AHEA 4JEZA 2VGVA 4JF1A 3QM2A 4GEBA 3LVMA 3G7QA 5D95A 3W1HA 4UHMA 4GSAA 2W7GA 5DJ1A 1AIAA 2EYQA 2DOUA 4ZSWA 4A0GA 3IHJA 4PFFA 2FYFA 1W7MA 1LC5A 1M6SA 2BIEA 2A1VA 3K40A 1AMQA 4R5FA 4TMRA 2CINA 2W7DA 1M7YA 2EPJA 3D6KA 1U08A 2YKUA 3LWSA 2JJGA 3NTJA 3QGUA 3RCHA 3TQXA 4QGRA 2ZJGA 3ZRRA 2G7JA 2AY7A 5DX5A 2D63A 2HP1A 2HOXA 3NYSA 5BJ3A 2X3LA 1AJRA 4BMKA 4WYAA 3NUBA 1ZOBA 2YCNA 3PAAA 3BWNC 3B8XA 4JEXA 4WYGA 4XAUA 2YRIA 3LVJA 2OGAA 3EI6A 4WXGA 4CBRA 2KFPA 4Q31A 3CQ4A 4DGTA 5HDMA 4E77A 3ACZA 3NYUA 1BQDA 3DC1A 2AY8A 1AY8A 2C7TA 3AEOA 4W1VA 3EIBA 2YOBA 2G6WA 1W23A 3G0TA 1N2TA 3F6TA 1QZ9A 4K2MA 4EMYA 1J32A 1ASNA 1ASCA 1LW5A 2AY2A 2QBTA 3EIAA 3HT4A 3HVYA 4RAEA 1M32A 3NU8A 4J5UA 1ELUA 4WB0A 3FDDA 4AO9A 4MQQA 2ZY5A 1IVRA 4XEWA 1FG7A 5G0AA 2W8WA 3BCBA 1YOOA 5FT6A 2GMSA 1YAAA 2O7CA 3B1DA 3PDXA 1H1CA 4XK1A 3WGCA 2V0YA 2BIAA 1O4SA 3N75A 3AELA 1AAMA 4Q75A 1AHXA 2CY8A 3AATA 3QI6A 3AOVA 4ZASA 2R5EA 3TATA 1BJNA 1JS3A 1OHYA 2BHXA 2QSRA 3NX3A 1AJSA 2CH1A 2VMRA 3AV7A 2CJDA 3MAFB 3WGBA 3PA9A 1XEYA 2AY4A 4MGRA 3BC8A 3NNKA 2FN6A 7AATA 1S0AA 1M0PA 2Z9WA 3KGXA 2VMTA 3VAXA 3N4XA 4U2HA 3FQ8A 1LS3A 1BQAA 3DXWA 1D7VA 3FVUA 4RLGA 3HL2A 1B9HA 3R4TA 2VIBA 4ATQA 5JAYA 1ARIA 1GEXA 1TOKA 8AATA 4I8AA 3GZDA 4WD2A 1IX6A 1QJ5A 1AHFA 1Z7DA 1X29A 3JWBA 1WYVB 3HLMA 3MC6C 2D65A 5TF5A 3WCOA 4CXQA 1BS0A 3LG0A 1N31A 3BB8A 3FSLA 1YNUA 4ZWVA 4K2BA 3LVKA 2DGKA 2AEVA 2Z1ZA 1QISA 3DU4A 1X0MA 2X8UA 3H9XA 3E2YA 3FTBA 1V2EA 2DKBA 3P6KA 3AEJC 1TASA 1W7NA 2W7FA 5G2QA 2C0RA 1G7WA 3WY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQ0 A;  1TPL A;  3ZRP A;  2R2N A;  3MAU A;  2BI5 A;  1IAX A;  1EQB A;  4ITG A;  1OAT A;  1OXP A;  4ATP A;  2ZSL A;  1YJS A;  2VMX A;  3RCH B;  3QN6 A;  1CQ8 A;  1GC2 A;  2W7K A;  5E5I A;  2BKW A;  3EUC A;  1YIZ A;  4F4E A;  4F5L A;  1CZC A;  2BWN A;  3VOM A;  1W3U A;  1C7G A;  4PIW A;  1ECX A;  3GWP A;  1IUG A;  2ZUK A;  2CTZ A;  3H7F A;  3F0H A;  1MDZ A;  4WYF A;  4AZK A;  3N5M A;  4P7Y A;  1UU2 A;  2D66 A;  4NOG A;  4W5K A;  1JF9 A;  1ORD A;  2W8T A;  2FM1 A;  5G2P A;  2PB0 A;  5I92 A;  5J8Q A;  3WKS A;  2JJH A;  4AO4 A;  1MLY A;  3ZZK A;  2EH6 A;  1I48 A;  3AOW A;  2WK7 A;  3QBO A;  1S09 A;  3OKS A;  4RIZ A;  2VYC A;  4A0H A;  3KKI A;  2VMP A;  1LW4 A;  3GET A;  1UU1 A;  5M4D A;  4WB0 B;  3R9A A;  4B9B A;  4WP0 A;  1I29 A;  4ADB A;  4JE5 A;  5EQC A;  4UQV A;  4GE9 A;  1E5F A;  1AIB A;  3BCA A;  3BS8 A;  5LH9 A;  1GBN A;  3GBX A;  1VJO A;  1LC8 A;  3A9Y A;  4XJM A;  2QA3 A;  4A0F A;  1B5P A;  2E7J A;  2W7H A;  2AAT A;  4E3R A;  4F5H A;  3B1C A;  3EZ1 A;  5C6U A;  5M4B A;  4WYC A;  3WKR A;  2NMP A;  1CL2 A;  1BJW A;  5M46 A;  5IWQ A;  2BI9 A;  4OT8 A;  3JU7 A;  1MAQ A;  1YJY A;  1ASA A;  1CJ0 A;  3E9K A;  1AJS B;  1LK9 A;  1M0O A;  3COG A;  3K28 A;  3T32 A;  4AOA A;  4L0O A;  5EUD A;  5F9S A;  4H51 A;  1D2F A;  1VEF A;  1O62 A;  2C81 A;  3DXV A;  1PFF A;  3BCX A;  4OCA A;  4A6U A;  1RVY A;  4CVQ A;  4JEW A;  4BA4 A;  4W1W A;  2W7E A;  5LHA A;  1DJU A;  1SVV A;  3FQ7 A;  3Q8N A;  3FDB A;  3MC6 A;  4P3M A;  1D7U A;  1PMO A;  1DGD A;  3AEM A;  2XH1 A;  2VGU A;  4BA5 A;  1ART A;  1SFF A;  2JG2 A;  5EAV A;  4J8L A;  4B98 A;  3EI7 A;  1KL2 A;  4MY5 A;  2YHK A;  4LNM A;  2JJE A;  3NUI A;  4UOY A;  3UWC A;  1JG8 A;  1FC4 A;  1KKJ A;  4ZM3 A;  2ZY3 A;  5HXX A;  3A8U X;  2JGT A;  3EI9 A;  3I4J A;  4O6Z A;  3WZF A;  3QHX A;  5FT4 A;  3EI8 A;  3PDB B;  4IXS A;  1D7S A;  5D5S A;  5E4Z A;  1UU0 A;  1TAR A;  4F5G A;  1D7R A;  1SZS A;  4EFF A;  1ZC9 A;  3LY1 A;  2W7L A;  1QGN A;  1UKJ A;  2O1B A;  4KYO A;  1ARH A;  2EGY A;  3H14 A;  4EB7 A;  3NYT A;  1IBJ A;  4OC9 A;  4F5I A;  2AY3 A;  2CB1 A;  3FFR A;  4Y0D A;  1ASM A;  1DGE A;  2VMZ A;  5AX8 A;  4DQ6 A;  1QJ3 A;  1LKC A;  2DGM A;  4FFC A;  4LNJ A;  3AEP A;  3N0L A;  1GDE A;  1WKH A;  3W1J A;  3PPL A;  2BWP A;  1AKB A;  3FZ8 A;  2CAN A;  1BJ4 A;  2FNI A;  2W7M A;  2E54 A;  1QIR A;  3L44 A;  4W1X A;  4EB5 A;  4MKK A;  1T3I A;  3HMU A;  2CH2 A;  3E2Z A;  2WK8 A;  3AEN A;  3L8A A;  2FQ6 A;  1GEW A;  1M4N A;  4RJY A;  5DB5 A;  3DRD A;  3LV2 A;  1C9C A;  3ZRQ A;  2ORD A;  1ELQ A;  1JS6 A;  2E7I A;  2PO3 A;  3ECD A;  3USF A;  2VMY A;  3ELP A;  1C7O A;  3PDB A;  4IXO A;  4A6T A;  2VMW A;  2GB3 A;  4AZJ A;  2VGW A;  1GC0 A;  3ELE A;  4ZDL A;  1S07 A;  3OP7 A;  3GJU A;  5G4I A;  5HHY A;  3LVL B;  4LNL A;  5FT8 A;  5E3K A;  2Z9U A;  3FCR A;  3I5T A;  1RVU A;  2HOY A;  2GMU A;  2R5C A;  1MDX A;  1TOJ A;  4KAM A;  4RKC A;  2ZY2 A;  2VI8 A;  1J04 A;  4CBS A;  2Z1Y A;  3PGY A;  4FL0 A;  4ZDO A;  1AHY A;  2Z67 A;  1M0Q A;  2YKV A;  4F5M A;  2BIG A;  1DJE A;  4WYD A;  3HQT A;  3I16 A;  3BWN A;  2C44 A;  4ADC A;  2Z20 A;  3MAD A;  1G4V A;  4Y0H A;  3MBB A;  4OTL A;  3A2B A;  3RI6 A;  4RM1 A;  4A0R A;  4MQP A;  4IY7 A;  2W7J A;  3EI5 A;  4IXZ A;  2HZP A;  1BT4 A;  2VMS A;  3NRA A;  5G09 A;  1DKA A;  2CFB A;  3E6G A;  2CST A;  3A9X A;  2ZP7 A;  3CAI A;  1GC4 A;  1AMR A;  1RV4 A;  2D5Y A;  3B46 A;  4W91 A;  3VK4 A;  1FG3 A;  4DBC A;  5DJ9 A;  2F8J A;  1E5E A;  1S08 A;  1AY5 A;  3RQ1 A;  3UE8 A;  3KGW A;  2D7Y A;  1AX4 A;  1SPA A;  1P3W A;  2X5F A;  3FZ6 A;  3HDO A;  2HUU A;  2VLF A;  4WXF A;  3K7Y A;  4AH3 A;  1AMS A;  2AY9 A;  4ITX A;  4XJP A;  5K8B A;  4U1T A;  1EJI A;  3FVS A;  2OKK A;  5BJ4 A;  2VIA A;  1CZE A;  1GEY A;  3CQ5 A;  3PD6 A;  1MLZ A;  1AIC A;  1SZK A;  1MGV A;  2VMO A;  3ASB A;  4IYO A;  4ZLV A;  4ZDP A;  3BN1 A;  3JTX A;  4HVK A;  1IX7 A;  2BWO A;  1XI9 A;  1AKA A;  2O0R A;  3NU7 A;  1CS1 A;  1M0N A;  1TAT A;  2YCP A;  5FT5 A;  4GE7 A;  4GDY A;  1GCK A;  1Y4I A;  4M2J A;  1CQ7 A;  4E3Q A;  1QIT A;  2YKY A;  3ZZJ A;  3HBX A;  1C0N A;  1AY4 A;  1X28 A;  2FNU A;  2TPL A;  3FZ7 A;  2VLH A;  1KMJ A;  2EO5 A;  3GZD C;  4UHO A;  4RIT A;  2DGL A;  1CQ6 A;  2GSA A;  2V1P A;  4MKJ A;  1AHG A;  1IAY A;  1BJO A;  2QLR A;  3DR4 A;  2ZC0 A;  4UHN A;  2BYJ A;  2W8V A;  1TOG A;  3JWA A;  5F8V A;  1B5O A;  1V2F A;  2VMV A;  4WXB A;  5EIG A;  5EUN A;  3RBL A;  2W8J A;  1X2A A;  3FQA A;  2Q7W A;  2JJF A;  2OGE A;  4GE4 A;  1WYU A;  4HF8 A;  2HUF A;  3DOD A;  3PIU A;  2EZ1 A;  1I43 A;  2VGZ A;  1ARS A;  1V72 A;  4LW4 A;  4XQ2 A;  1WYT A;  3E2Z B;  2WKA A;  2XBN A;  3AEN B;  2DKJ A;  2RFV A;  3AEJ A;  1IX8 A;  4N0B A;  3BV0 A;  1DJ9 A;  4R2N A;  1B8G A;  1SZU A;  2HP2 A;  2GQN A;  1G7X A;  1ASL A;  4JF0 A;  3W1I A;  4E1O A;  3FRK A;  4ZAH A;  4K2I A;  4WLJ A;  4WBT A;  4BHD A;  4ZM4 A;  1MDO A;  4M2M A;  2AY1 A;  3ASA A;  1B9I A;  2ZSM A;  1VP4 A;  4IW7 A;  1OXO A;  3FFH A;  4F5K A;  1ZOD A;  2YRR A;  2R5C B;  1AKC A;  4RJ0 A;  3TFT A;  1OHW A;  4Q6R A;  1EG5 A;  2AY5 A;  2D7Z A;  2VMQ A;  3FVX A;  4MSO A;  4TV7 A;  5G4J A;  4A6R A;  2D64 A;  2DR1 A;  2HUI A;  1O69 A;  1ASG A;  1S06 A;  2VMN A;  2CJH A;  1YIY A;  4R8D A;  1O61 A;  3DZZ A;  3FD0 A;  3VK3 A;  3VK2 A;  4ADD A;  2E7U A;  4ISY A;  3ISL A;  4XJO A;  2VI9 A;  1WKG A;  2BI3 A;  1C4K A;  3TFU A;  2W8U A;  3P1T A;  4W8I A;  4JEV A;  1ASB A;  4ZWM A;  4WLH A;  4A00 A;  1CL1 A;  3CQ6 A;  4M2K A;  4PFN A;  3KE3 A;  1V2D A;  2EZ2 A;  1GD9 A;  3A9Z A;  4PVF A;  1AAW A;  4Y0I A;  4F5J A;  1IJI A;  2Z9V A;  2VMU A;  2W7I A;  4RKD A;  5M49 A;  1SF2 A;  1I41 A;  2CJG A;  4LW2 A;  3MEB A;  4Q76 A;  3GZC A;  1KL1 A;  2OAT A;  5EAA A;  5EFS A;  4KXK A;  4WYE A;  3GSB A;  4OBU A;  4F5F A;  1G4X A;  2Z61 A;  1W7L A;  3BWO A;  3JZL A;  3PD6 B;  3DR7 A;  4IYO B;  3JW9 A;  5EUE A;  4JE5 D;  3AEM C;  3M5U A;  2ZY4 A;  2HOZ A;  2AEU A;  1N8P A;  4A72 A;  4ADE A;  1MAP A;  1WST A;  3FKD A;  4EU1 A;  3G8M A;  2YCT A;  1PG8 A;  2D61 A;  1ARG A;  3MAF A;  2QB2 A;  3NDN A;  1LC7 A;  1RV3 A;  3DYD A;  3IF2 A;  2BI1 A;  2JIS A;  1DFO A;  2BI2 A;  1C7N A;  3WLX A;  1YJZ A;  2Z9X A;  1BJO B;  2VGS A;  3GR9 A;  4OMA A;  4OYT A;  2AY6 A;  2YKX A;  1ASE A;  3MKJ A;  3EZS A;  2HOR A;  3PJ0 A;  1B4X A;  3RUY A;  3VP6 A;  1PMM A;  5EIG B;  2PB2 A;  2OKJ A;  4TN4 A;  2QMA A;  4N0W A;  2WK9 A;  3II0 A;  1WYU B;  1KMK A;  1H0C A;  3RBF A;  4JEY A;  2ZYJ A;  4LC3 A;  2BYL A;  4OBV A;  1BKG A;  3B1E A;  1WYT B;  1GC3 A;  2R0T A;  1TOE A;  1Z3Z A;  1TOI A;  1WYV A;  2VGT A;  3ATH A;  2X5D A;  1BW0 A;  4XJL A;  3TCM A;  1AMA A;  4CXR A;  2QB3 A;  1ASD A;  9AAT A;  4R5Z A;  1DTY A;  2OQX A;  3E2F A;  1KKP A;  3CBF A;  3UAK A;  3QPG A;  4IX8 A;  3WCN A;  4ZSY A;  3F9T A;  3WX9 A;  3E77 A;  1ASF A;  4GRX A;  4MQR A;  1OHV A;  1AHE A;  4JEZ A;  2VGV A;  4JF1 A;  3QM2 A;  4GEB A;  3LVM A;  3G7Q A;  5D95 A;  3W1H A;  4UHM A;  4GSA A;  2W7G A;  5DJ1 A;  1AIA A;  2DOU A;  4ZSW A;  4A0G A;  3IHJ A;  4PFF A;  2FYF A;  1W7M A;  1LC5 A;  1M6S A;  2BIE A;  3K40 A;  1AMQ A;  4R5F A;  4TMR A;  2CIN A;  2W7D A;  1M7Y A;  2EPJ A;  3D6K A;  1U08 A;  2YKU A;  3LWS A;  2JJG A;  3NTJ A;  3QGU A;  3RCH A;  3TQX A;  4QGR A;  2ZJG A;  3ZRR A;  2AY7 A;  5DX5 A;  2D63 A;  2HP1 A;  2HOX A;  3NYS A;  5BJ3 A;  2X3L A;  1AJR A;  4BMK A;  4WYA A;  3NUB A;  1ZOB A;  2YCN A;  3PAA A;  3BWN C;  3B8X A;  4JEX A;  4WYG A;  4XAU A;  2YRI A;  3LVJ A;  2OGA A;  3EI6 A;  4WXG A;  4CBR A;  4Q31 A;  3CQ4 A;  4DGT A;  5HDM A;  4E77 A;  3ACZ A;  3NYU A;  1BQD A;  3DC1 A;  2AY8 A;  1AY8 A;  2C7T A;  3AEO A;  4W1V A;  3EIB A;  2YOB A;  2G6W A;  1W23 A;  3G0T A;  1N2T A;  3F6T A;  1QZ9 A;  4K2M A;  4EMY A;  1J32 A;  1ASN A;  1ASC A;  1LW5 A;  2AY2 A;  2QBT A;  3EIA A;  3HT4 A;  3HVY A;  4RAE A;  1M32 A;  3NU8 A;  4J5U A;  1ELU A;  4WB0 A;  3FDD A;  4AO9 A;  4MQQ A;  2ZY5 A;  1IVR A;  4XEW A;  1FG7 A;  5G0A A;  2W8W A;  3BCB A;  1YOO A;  5FT6 A;  2GMS A;  1YAA A;  2O7C A;  3B1D A;  3PDX A;  1H1C A;  4XK1 A;  3WGC A;  2V0Y A;  2BIA A;  1O4S A;  3N75 A;  3AEL A;  1AAM A;  4Q75 A;  1AHX A;  2CY8 A;  3AAT A;  3QI6 A;  3AOV A;  4ZAS A;  2R5E A;  3TAT A;  1BJN A;  1JS3 A;  1OHY A;  2BHX A;  3NX3 A;  1AJS A;  2CH1 A;  2VMR A;  3AV7 A;  2CJD A;  3MAF B;  3WGB A;  3PA9 A;  1XEY A;  2AY4 A;  4MGR A;  3BC8 A;  3NNK A;  2FN6 A;  7AAT A;  1S0A A;  1M0P A;  2Z9W A;  3KGX A;  2VMT A;  3VAX A;  4U2H A;  3FQ8 A;  1LS3 A;  1BQA A;  3DXW A;  1D7V A;  3FVU A;  4RLG A;  3HL2 A;  1B9H A;  3R4T A;  2VIB A;  4ATQ A;  5JAY A;  1ARI A;  1GEX A;  1TOK A;  8AAT A;  4I8A A;  3GZD A;  4WD2 A;  1IX6 A;  1QJ5 A;  1AHF A;  1Z7D A;  1X29 A;  3JWB A;  1WYV B;  3HLM A;  3MC6 C;  2D65 A;  5TF5 A;  3WCO A;  4CXQ A;  1BS0 A;  3LG0 A;  1N31 A;  3BB8 A;  3FSL A;  1YNU A;  4ZWV A;  4K2B A;  3LVK A;  2DGK A;  2AEV A;  2Z1Z A;  1QIS A;  3DU4 A;  1X0M A;  2X8U A;  3E2Y A;  3FTB A;  1V2E A;  2DKB A;  3P6K A;  3AEJ C;  1TAS A;  1W7N A;  2W7F A;  5G2Q A;  2C0R A;  1G7W A;  3WY7 A; 
#chains in the Genus database with same CATH topology
 4BQ0 A;  1TPL A;  3ZRP A;  2R2N A;  3MAU A;  2BI5 A;  1IAX A;  1EQB A;  4ITG A;  1OAT A;  1OXP A;  4ATP A;  2ZSL A;  1YJS A;  2VMX A;  3RCH B;  3QN6 A;  1CQ8 A;  1GC2 A;  2W7K A;  5E5I A;  2BKW A;  3EUC A;  1YIZ A;  4F4E A;  4F5L A;  1CZC A;  2BWN A;  3VOM A;  1W3U A;  1C7G A;  4PIW A;  1ECX A;  3GWP A;  1IUG A;  2ZUK A;  2CTZ A;  3H7F A;  3F0H A;  1MDZ A;  4WYF A;  4AZK A;  3N5M A;  4P7Y A;  1UU2 A;  2D66 A;  4NOG A;  4W5K A;  1JF9 A;  1ORD A;  2W8T A;  2FM1 A;  5G2P A;  2PB0 A;  5I92 A;  5J8Q A;  3WKS A;  2JJH A;  4AO4 A;  1MLY A;  3ZZK A;  2EH6 A;  1I48 A;  3AOW A;  2WK7 A;  3QBO A;  1S09 A;  3OKS A;  4RIZ A;  2VYC A;  4A0H A;  3KKI A;  2VMP A;  1LW4 A;  3GET A;  1UU1 A;  5M4D A;  4WB0 B;  3R9A A;  4B9B A;  4WP0 A;  1I29 A;  4ADB A;  4JE5 A;  5EQC A;  4UQV A;  4GE9 A;  1E5F A;  1AIB A;  3BCA A;  3BS8 A;  5LH9 A;  1GBN A;  3GBX A;  1VJO A;  1LC8 A;  3A9Y A;  4XJM A;  2QA3 A;  4A0F A;  1B5P A;  2E7J A;  2W7H A;  2AAT A;  4E3R A;  4F5H A;  3B1C A;  3EZ1 A;  5C6U A;  5M4B A;  4WYC A;  3WKR A;  2FKI A;  2NMP A;  1CL2 A;  1BJW A;  5M46 A;  5IWQ A;  2BI9 A;  4OT8 A;  3JU7 A;  1MAQ A;  1YJY A;  1ASA A;  1CJ0 A;  3E9K A;  1AJS B;  1LK9 A;  1M0O A;  3COG A;  3K28 A;  3T32 A;  4AOA A;  4L0O A;  5EUD A;  5F9S A;  4H51 A;  1D2F A;  1VEF A;  1O62 A;  2C81 A;  3DXV A;  1PFF A;  3BCX A;  4OCA A;  4A6U A;  1RVY A;  4CVQ A;  4JEW A;  4BA4 A;  4W1W A;  2W7E A;  5LHA A;  1DJU A;  1SVV A;  3FQ7 A;  3Q8N A;  3FDB A;  3MC6 A;  4P3M A;  1D7U A;  1PMO A;  1DGD A;  3AEM A;  2XH1 A;  2VGU A;  4BA5 A;  1ART A;  1SFF A;  2JG2 A;  5EAV A;  4J8L A;  4B98 A;  3EI7 A;  1KL2 A;  4MY5 A;  2YHK A;  4LNM A;  2JJE A;  3NUI A;  4UOY A;  3UWC A;  1JG8 A;  1FC4 A;  1KKJ A;  4ZM3 A;  2ZY3 A;  5HXX A;  3A8U X;  2JGT A;  3EI9 A;  3I4J A;  4O6Z A;  3WZF A;  3QHX A;  5FT4 A;  3EI8 A;  3PDB B;  4IXS A;  1D7S A;  5D5S A;  5E4Z A;  1UU0 A;  1TAR A;  4F5G A;  1KAF A;  1D7R A;  1SZS A;  4EFF A;  1ZC9 A;  3LY1 A;  2W7L A;  1QGN A;  1UKJ A;  2O1B A;  4KYO A;  1ARH A;  2EGY A;  3H14 A;  4EB7 A;  3NYT A;  1IBJ A;  4OC9 A;  4F5I A;  2AY3 A;  2CB1 A;  3FFR A;  4Y0D A;  1ASM A;  1DGE A;  2VMZ A;  5AX8 A;  4DQ6 A;  1QJ3 A;  1LKC A;  2DGM A;  4FFC A;  4LNJ A;  3AEP A;  3N0L A;  1GDE A;  1WKH A;  3W1J A;  3PPL A;  2BWP A;  1AKB A;  3FZ8 A;  2CAN A;  1BJ4 A;  2FNI A;  2W7M A;  2E54 A;  1QIR A;  3L44 A;  4W1X A;  4EB5 A;  4MKK A;  1T3I A;  3HMU A;  2CH2 A;  3E2Z A;  2WK8 A;  3AEN A;  3L8A A;  2FQ6 A;  1GEW A;  1M4N A;  4RJY A;  5DB5 A;  3DRD A;  3LV2 A;  1C9C A;  3ZRQ A;  2ORD A;  1ELQ A;  1JS6 A;  2E7I A;  2PO3 A;  3ECD A;  3USF A;  2VMY A;  3ELP A;  1C7O A;  3PDB A;  4IXO A;  4A6T A;  2VMW A;  2GB3 A;  4AZJ A;  2VGW A;  1GC0 A;  3ELE A;  4ZDL A;  1S07 A;  3OP7 A;  3GJU A;  5G4I A;  5HHY A;  3LVL B;  4LNL A;  5FT8 A;  5E3K A;  2Z9U A;  3FCR A;  3I5T A;  1RVU A;  2HOY A;  2GMU A;  2R5C A;  1MDX A;  1TOJ A;  4KAM A;  4RKC A;  2ZY2 A;  2VI8 A;  1J04 A;  4CBS A;  2Z1Y A;  3PGY A;  4FL0 A;  4ZDO A;  1AHY A;  2Z67 A;  1M0Q A;  2YKV A;  4F5M A;  2BIG A;  3N7N A;  1DJE A;  4WYD A;  3HQT A;  3I16 A;  3BWN A;  2C44 A;  4ADC A;  2Z20 A;  3MAD A;  1G4V A;  4Y0H A;  3MBB A;  4OTL A;  3A2B A;  3RI6 A;  4RM1 A;  4A0R A;  4MQP A;  4IY7 A;  2W7J A;  3EI5 A;  4IXZ A;  2HZP A;  1BT4 A;  2VMS A;  3NRA A;  5G09 A;  1DKA A;  2CFB A;  3E6G A;  2CST A;  3A9X A;  2ZP7 A;  3CAI A;  1GC4 A;  1AMR A;  1RV4 A;  2D5Y A;  3B46 A;  4W91 A;  3VK4 A;  1FG3 A;  4DBC A;  5DJ9 A;  2F8J A;  1E5E A;  1S08 A;  1AY5 A;  3RQ1 A;  3UE8 A;  3KGW A;  2D7Y A;  1AX4 A;  1SPA A;  1P3W A;  2X5F A;  3FZ6 A;  3HDO A;  2HUU A;  2VLF A;  4WXF A;  3K7Y A;  4AH3 A;  1AMS A;  5KTB A;  2AY9 A;  4ITX A;  4XJP A;  5K8B A;  4U1T A;  1EJI A;  3FVS A;  2OKK A;  5BJ4 A;  2VIA A;  1CZE A;  1GEY A;  3CQ5 A;  3PD6 A;  1MLZ A;  1AIC A;  1SZK A;  1MGV A;  2VMO A;  3ASB A;  4IYO A;  4ZLV A;  4ZDP A;  3BN1 A;  3JTX A;  4HVK A;  1IX7 A;  2BWO A;  1XI9 A;  1AKA A;  2O0R A;  3NU7 A;  1CS1 A;  1M0N A;  1TAT A;  2YCP A;  5FT5 A;  4GE7 A;  4GDY A;  1GCK A;  1Y4I A;  4M2J A;  1CQ7 A;  4E3Q A;  1QIT A;  2YKY A;  3ZZJ A;  3HBX A;  1C0N A;  1AY4 A;  1X28 A;  2FNU A;  2TPL A;  3FZ7 A;  2VLH A;  1KMJ A;  2EO5 A;  3GZD C;  4UHO A;  4RIT A;  2DGL A;  1CQ6 A;  2GSA A;  2V1P A;  4MKJ A;  1AHG A;  1IAY A;  1BJO A;  2QLR A;  3DR4 A;  2ZC0 A;  4UHN A;  2WB6 A;  2BYJ A;  2W8V A;  1TOG A;  3JWA A;  5F8V A;  1B5O A;  1V2F A;  2VMV A;  4WXB A;  5EIG A;  5EUN A;  3RBL A;  2W8J A;  1X2A A;  3FQA A;  2Q7W A;  2JJF A;  2OGE A;  4GE4 A;  1WYU A;  4HF8 A;  2HUF A;  3DOD A;  3PIU A;  2EZ1 A;  1I43 A;  2VGZ A;  1ARS A;  1V72 A;  4LW4 A;  4XQ2 A;  1WYT A;  3E2Z B;  2WKA A;  2XBN A;  3AEN B;  2DKJ A;  2RFV A;  3AEJ A;  1IX8 A;  4N0B A;  3BV0 A;  4H63 Q;  1DJ9 A;  4R2N A;  1B8G A;  1SZU A;  2HP2 A;  2GQN A;  1G7X A;  1ASL A;  4JF0 A;  3W1I A;  4E1O A;  3FRK A;  4ZAH A;  4K2I A;  4WLJ A;  4WBT A;  4BHD A;  4ZM4 A;  1MDO A;  4M2M A;  2AY1 A;  3ASA A;  1B9I A;  2ZSM A;  1VP4 A;  4IW7 A;  1OXO A;  3FFH A;  4F5K A;  1ZOD A;  2YRR A;  2R5C B;  1AKC A;  4RJ0 A;  3TFT A;  1OHW A;  4Q6R A;  1EG5 A;  2AY5 A;  2D7Z A;  2VMQ A;  3FVX A;  4MSO A;  4TV7 A;  5G4J A;  3N4R A;  4A6R A;  2D64 A;  2DR1 A;  2HUI A;  1O69 A;  1ASG A;  1S06 A;  2VMN A;  2CJH A;  1YIY A;  4R8D A;  1O61 A;  3DZZ A;  3FD0 A;  3VK3 A;  3VK2 A;  4ADD A;  2E7U A;  4ISY A;  3ISL A;  4XJO A;  2VI9 A;  1WKG A;  2BI3 A;  1C4K A;  3TFU A;  2W8U A;  3P1T A;  4W8I A;  4JEV A;  1ASB A;  4ZWM A;  4WLH A;  4A00 A;  1CL1 A;  3CQ6 A;  4M2K A;  4PFN A;  3KE3 A;  1V2D A;  2EZ2 A;  1GD9 A;  3A9Z A;  4PVF A;  1AAW A;  4Y0I A;  4F5J A;  1IJI A;  2Z9V A;  2VMU A;  2W7I A;  4RKD A;  5M49 A;  1SF2 A;  1I41 A;  2CJG A;  4LW2 A;  3MEB A;  4Q76 A;  3GZC A;  1KL1 A;  2OAT A;  5EAA A;  5EFS A;  4KXK A;  4WYE A;  3GSB A;  4OBU A;  4F5F A;  1G4X A;  2Z61 A;  1W7L A;  3BWO A;  3JZL A;  3PD6 B;  3DR7 A;  4IYO B;  3JW9 A;  5EUE A;  4JE5 D;  3AEM C;  3M5U A;  2ZY4 A;  2HOZ A;  2AEU A;  1N8P A;  4A72 A;  4ADE A;  1MAP A;  1WST A;  3FKD A;  4EU1 A;  3G8M A;  2YCT A;  1PG8 A;  2D61 A;  1ARG A;  3MAF A;  2QB2 A;  3NDN A;  1LC7 A;  1RV3 A;  3DYD A;  3IF2 A;  2BI1 A;  2JIS A;  1DFO A;  2BI2 A;  1C7N A;  3WLX A;  1YJZ A;  2Z9X A;  1BJO B;  2VGS A;  3GR9 A;  4OMA A;  4OYT A;  2AY6 A;  2YKX A;  1ASE A;  3MKJ A;  3EZS A;  2HOR A;  3PJ0 A;  1B4X A;  3RUY A;  3VP6 A;  1PMM A;  5EIG B;  4K05 A;  2PB2 A;  2OKJ A;  4TN4 A;  2QMA A;  4N0W A;  2WK9 A;  3II0 A;  1WYU B;  1KMK A;  1H0C A;  3RBF A;  3N4S A;  4JEY A;  2ZYJ A;  4LC3 A;  2BYL A;  4OBV A;  1BKG A;  3B1E A;  1WYT B;  1GC3 A;  2R0T A;  1TOE A;  1Z3Z A;  1TOI A;  1WYV A;  2VGT A;  3ATH A;  2X5D A;  1BW0 A;  4XJL A;  3TCM A;  1AMA A;  4CXR A;  2QB3 A;  1ASD A;  9AAT A;  4R5Z A;  1DTY A;  2OQX A;  3E2F A;  1KKP A;  3CBF A;  3UAK A;  3QPG A;  4IX8 A;  3WCN A;  4ZSY A;  3F9T A;  3WX9 A;  3E77 A;  1ASF A;  4GRX A;  4MQR A;  1OHV A;  1AHE A;  4JEZ A;  2VGV A;  4JF1 A;  3QM2 A;  4GEB A;  3LVM A;  3G7Q A;  5D95 A;  3W1H A;  4UHM A;  4GSA A;  2W7G A;  5DJ1 A;  1AIA A;  2EYQ A;  2DOU A;  4ZSW A;  4A0G A;  3IHJ A;  4PFF A;  2FYF A;  1W7M A;  1LC5 A;  1M6S A;  2BIE A;  2A1V A;  3K40 A;  1AMQ A;  4R5F A;  4TMR A;  2CIN A;  2W7D A;  1M7Y A;  2EPJ A;  3D6K A;  1U08 A;  2YKU A;  3LWS A;  2JJG A;  3NTJ A;  3QGU A;  3RCH A;  3TQX A;  4QGR A;  2ZJG A;  3ZRR A;  2G7J A;  2AY7 A;  5DX5 A;  2D63 A;  2HP1 A;  2HOX A;  3NYS A;  5BJ3 A;  2X3L A;  1AJR A;  4BMK A;  4WYA A;  3NUB A;  1ZOB A;  2YCN A;  3PAA A;  3BWN C;  3B8X A;  4JEX A;  4WYG A;  4XAU A;  2YRI A;  3LVJ A;  2OGA A;  3EI6 A;  4WXG A;  4CBR A;  2KFP A;  4Q31 A;  3CQ4 A;  4DGT A;  5HDM A;  4E77 A;  3ACZ A;  3NYU A;  1BQD A;  3DC1 A;  2AY8 A;  1AY8 A;  2C7T A;  3AEO A;  4W1V A;  3EIB A;  2YOB A;  2G6W A;  1W23 A;  3G0T A;  1N2T A;  3F6T A;  1QZ9 A;  4K2M A;  4EMY A;  1J32 A;  1ASN A;  1ASC A;  1LW5 A;  2AY2 A;  2QBT A;  3EIA A;  3HT4 A;  3HVY A;  4RAE A;  1M32 A;  3NU8 A;  4J5U A;  1ELU A;  4WB0 A;  3FDD A;  4AO9 A;  4MQQ A;  2ZY5 A;  1IVR A;  4XEW A;  1FG7 A;  5G0A A;  2W8W A;  3BCB A;  1YOO A;  5FT6 A;  2GMS A;  1YAA A;  2O7C A;  3B1D A;  3PDX A;  1H1C A;  4XK1 A;  3WGC A;  2V0Y A;  2BIA A;  1O4S A;  3N75 A;  3AEL A;  1AAM A;  4Q75 A;  1AHX A;  2CY8 A;  3AAT A;  3QI6 A;  3AOV A;  4ZAS A;  2R5E A;  3TAT A;  1BJN A;  1JS3 A;  1OHY A;  2BHX A;  2QSR A;  3NX3 A;  1AJS A;  2CH1 A;  2VMR A;  3AV7 A;  2CJD A;  3MAF B;  3WGB A;  3PA9 A;  1XEY A;  2AY4 A;  4MGR A;  3BC8 A;  3NNK A;  2FN6 A;  7AAT A;  1S0A A;  1M0P A;  2Z9W A;  3KGX A;  2VMT A;  3VAX A;  3N4X A;  4U2H A;  3FQ8 A;  1LS3 A;  1BQA A;  3DXW A;  1D7V A;  3FVU A;  4RLG A;  3HL2 A;  1B9H A;  3R4T A;  2VIB A;  4ATQ A;  5JAY A;  1ARI A;  1GEX A;  1TOK A;  8AAT A;  4I8A A;  3GZD A;  4WD2 A;  1IX6 A;  1QJ5 A;  1AHF A;  1Z7D A;  1X29 A;  3JWB A;  1WYV B;  3HLM A;  3MC6 C;  2D65 A;  5TF5 A;  3WCO A;  4CXQ A;  1BS0 A;  3LG0 A;  1N31 A;  3BB8 A;  3FSL A;  1YNU A;  4ZWV A;  4K2B A;  3LVK A;  2DGK A;  2AEV A;  2Z1Z A;  1QIS A;  3DU4 A;  1X0M A;  2X8U A;  3H9X A;  3E2Y A;  3FTB A;  1V2E A;  2DKB A;  3P6K A;  3AEJ C;  1TAS A;  1W7N A;  2W7F A;  5G2Q A;  2C0R A;  1G7W A;  3WY7 A; 
#chains in the Genus database with same CATH homology
 4BQ0 A;  1TPL A;  3ZRP A;  2R2N A;  3MAU A;  2BI5 A;  1IAX A;  1EQB A;  4ITG A;  1OAT A;  1OXP A;  4ATP A;  2ZSL A;  1YJS A;  2VMX A;  3RCH B;  3QN6 A;  1CQ8 A;  1GC2 A;  2W7K A;  5E5I A;  2BKW A;  3EUC A;  1YIZ A;  4F4E A;  4F5L A;  1CZC A;  2BWN A;  3VOM A;  1W3U A;  1C7G A;  4PIW A;  1ECX A;  3GWP A;  1IUG A;  2ZUK A;  2CTZ A;  3H7F A;  3F0H A;  1MDZ A;  4WYF A;  4AZK A;  3N5M A;  4P7Y A;  1UU2 A;  2D66 A;  4NOG A;  4W5K A;  1JF9 A;  1ORD A;  2W8T A;  2FM1 A;  5G2P A;  2PB0 A;  5I92 A;  5J8Q A;  3WKS A;  2JJH A;  4AO4 A;  1MLY A;  3ZZK A;  2EH6 A;  1I48 A;  3AOW A;  2WK7 A;  3QBO A;  1S09 A;  3OKS A;  4RIZ A;  2VYC A;  4A0H A;  3KKI A;  2VMP A;  1LW4 A;  3GET A;  1UU1 A;  5M4D A;  4WB0 B;  3R9A A;  4B9B A;  4WP0 A;  1I29 A;  4ADB A;  4JE5 A;  5EQC A;  4UQV A;  4GE9 A;  1E5F A;  1AIB A;  3BCA A;  3BS8 A;  5LH9 A;  1GBN A;  3GBX A;  1VJO A;  1LC8 A;  3A9Y A;  4XJM A;  2QA3 A;  4A0F A;  1B5P A;  2E7J A;  2W7H A;  2AAT A;  4E3R A;  4F5H A;  3B1C A;  3EZ1 A;  5C6U A;  5M4B A;  4WYC A;  3WKR A;  2FKI A;  2NMP A;  1CL2 A;  1BJW A;  5M46 A;  5IWQ A;  2BI9 A;  4OT8 A;  3JU7 A;  1MAQ A;  1YJY A;  1ASA A;  1CJ0 A;  3E9K A;  1AJS B;  1LK9 A;  1M0O A;  3COG A;  3K28 A;  3T32 A;  4AOA A;  4L0O A;  5EUD A;  5F9S A;  4H51 A;  1D2F A;  1VEF A;  1O62 A;  2C81 A;  3DXV A;  1PFF A;  3BCX A;  4OCA A;  4A6U A;  1RVY A;  4CVQ A;  4JEW A;  4BA4 A;  4W1W A;  2W7E A;  5LHA A;  1DJU A;  1SVV A;  3FQ7 A;  3Q8N A;  3FDB A;  3MC6 A;  4P3M A;  1D7U A;  1PMO A;  1DGD A;  3AEM A;  2XH1 A;  2VGU A;  4BA5 A;  1ART A;  1SFF A;  2JG2 A;  5EAV A;  4J8L A;  4B98 A;  3EI7 A;  1KL2 A;  4MY5 A;  2YHK A;  4LNM A;  2JJE A;  3NUI A;  4UOY A;  3UWC A;  1JG8 A;  1FC4 A;  1KKJ A;  4ZM3 A;  2ZY3 A;  5HXX A;  3A8U X;  2JGT A;  3EI9 A;  3I4J A;  4O6Z A;  3WZF A;  3QHX A;  5FT4 A;  3EI8 A;  3PDB B;  4IXS A;  1D7S A;  5D5S A;  5E4Z A;  1UU0 A;  1TAR A;  4F5G A;  1D7R A;  1SZS A;  4EFF A;  1ZC9 A;  3LY1 A;  2W7L A;  1QGN A;  1UKJ A;  2O1B A;  4KYO A;  1ARH A;  2EGY A;  3H14 A;  4EB7 A;  3NYT A;  1IBJ A;  4OC9 A;  4F5I A;  2AY3 A;  2CB1 A;  3FFR A;  4Y0D A;  1ASM A;  1DGE A;  2VMZ A;  5AX8 A;  4DQ6 A;  1QJ3 A;  1LKC A;  2DGM A;  4FFC A;  4LNJ A;  3AEP A;  3N0L A;  1GDE A;  1WKH A;  3W1J A;  3PPL A;  2BWP A;  1AKB A;  3FZ8 A;  2CAN A;  1BJ4 A;  2FNI A;  2W7M A;  2E54 A;  1QIR A;  3L44 A;  4W1X A;  4EB5 A;  4MKK A;  1T3I A;  3HMU A;  2CH2 A;  3E2Z A;  2WK8 A;  3AEN A;  3L8A A;  2FQ6 A;  1GEW A;  1M4N A;  4RJY A;  5DB5 A;  3DRD A;  3LV2 A;  1C9C A;  3ZRQ A;  2ORD A;  1ELQ A;  1JS6 A;  2E7I A;  2PO3 A;  3ECD A;  3USF A;  2VMY A;  3ELP A;  1C7O A;  3PDB A;  4IXO A;  4A6T A;  2VMW A;  2GB3 A;  4AZJ A;  2VGW A;  1GC0 A;  3ELE A;  4ZDL A;  1S07 A;  3OP7 A;  3GJU A;  5G4I A;  5HHY A;  3LVL B;  4LNL A;  5FT8 A;  5E3K A;  2Z9U A;  3FCR A;  3I5T A;  1RVU A;  2HOY A;  2GMU A;  2R5C A;  1MDX A;  1TOJ A;  4KAM A;  4RKC A;  2ZY2 A;  2VI8 A;  1J04 A;  4CBS A;  2Z1Y A;  3PGY A;  4FL0 A;  4ZDO A;  1AHY A;  2Z67 A;  1M0Q A;  2YKV A;  4F5M A;  2BIG A;  3N7N A;  1DJE A;  4WYD A;  3HQT A;  3I16 A;  3BWN A;  2C44 A;  4ADC A;  2Z20 A;  3MAD A;  1G4V A;  4Y0H A;  3MBB A;  4OTL A;  3A2B A;  3RI6 A;  4RM1 A;  4A0R A;  4MQP A;  4IY7 A;  2W7J A;  3EI5 A;  4IXZ A;  2HZP A;  1BT4 A;  2VMS A;  3NRA A;  5G09 A;  1DKA A;  2CFB A;  3E6G A;  2CST A;  3A9X A;  2ZP7 A;  3CAI A;  1GC4 A;  1AMR A;  1RV4 A;  2D5Y A;  3B46 A;  4W91 A;  3VK4 A;  1FG3 A;  4DBC A;  5DJ9 A;  2F8J A;  1E5E A;  1S08 A;  1AY5 A;  3RQ1 A;  3UE8 A;  3KGW A;  2D7Y A;  1AX4 A;  1SPA A;  1P3W A;  2X5F A;  3FZ6 A;  3HDO A;  2HUU A;  2VLF A;  4WXF A;  3K7Y A;  4AH3 A;  1AMS A;  5KTB A;  2AY9 A;  4ITX A;  4XJP A;  5K8B A;  4U1T A;  1EJI A;  3FVS A;  2OKK A;  5BJ4 A;  2VIA A;  1CZE A;  1GEY A;  3CQ5 A;  3PD6 A;  1MLZ A;  1AIC A;  1SZK A;  1MGV A;  2VMO A;  3ASB A;  4IYO A;  4ZLV A;  4ZDP A;  3BN1 A;  3JTX A;  4HVK A;  1IX7 A;  2BWO A;  1XI9 A;  1AKA A;  2O0R A;  3NU7 A;  1CS1 A;  1M0N A;  1TAT A;  2YCP A;  5FT5 A;  4GE7 A;  4GDY A;  1GCK A;  1Y4I A;  4M2J A;  1CQ7 A;  4E3Q A;  1QIT A;  2YKY A;  3ZZJ A;  3HBX A;  1C0N A;  1AY4 A;  1X28 A;  2FNU A;  2TPL A;  3FZ7 A;  2VLH A;  1KMJ A;  2EO5 A;  3GZD C;  4UHO A;  4RIT A;  2DGL A;  1CQ6 A;  2GSA A;  2V1P A;  4MKJ A;  1AHG A;  1IAY A;  1BJO A;  2QLR A;  3DR4 A;  2ZC0 A;  4UHN A;  2WB6 A;  2BYJ A;  2W8V A;  1TOG A;  3JWA A;  5F8V A;  1B5O A;  1V2F A;  2VMV A;  4WXB A;  5EIG A;  5EUN A;  3RBL A;  2W8J A;  1X2A A;  3FQA A;  2Q7W A;  2JJF A;  2OGE A;  4GE4 A;  1WYU A;  4HF8 A;  2HUF A;  3DOD A;  3PIU A;  2EZ1 A;  1I43 A;  2VGZ A;  1ARS A;  1V72 A;  4LW4 A;  4XQ2 A;  1WYT A;  3E2Z B;  2WKA A;  2XBN A;  3AEN B;  2DKJ A;  2RFV A;  3AEJ A;  1IX8 A;  4N0B A;  3BV0 A;  4H63 Q;  1DJ9 A;  4R2N A;  1B8G A;  1SZU A;  2HP2 A;  2GQN A;  1G7X A;  1ASL A;  4JF0 A;  3W1I A;  4E1O A;  3FRK A;  4ZAH A;  4K2I A;  4WLJ A;  4WBT A;  4BHD A;  4ZM4 A;  1MDO A;  4M2M A;  2AY1 A;  3ASA A;  1B9I A;  2ZSM A;  1VP4 A;  4IW7 A;  1OXO A;  3FFH A;  4F5K A;  1ZOD A;  2YRR A;  2R5C B;  1AKC A;  4RJ0 A;  3TFT A;  1OHW A;  4Q6R A;  1EG5 A;  2AY5 A;  2D7Z A;  2VMQ A;  3FVX A;  4MSO A;  4TV7 A;  5G4J A;  3N4R A;  4A6R A;  2D64 A;  2DR1 A;  2HUI A;  1O69 A;  1ASG A;  1S06 A;  2VMN A;  2CJH A;  1YIY A;  4R8D A;  1O61 A;  3DZZ A;  3FD0 A;  3VK3 A;  3VK2 A;  4ADD A;  2E7U A;  4ISY A;  3ISL A;  4XJO A;  2VI9 A;  1WKG A;  2BI3 A;  1C4K A;  3TFU A;  2W8U A;  3P1T A;  4W8I A;  4JEV A;  1ASB A;  4ZWM A;  4WLH A;  4A00 A;  1CL1 A;  3CQ6 A;  4M2K A;  4PFN A;  3KE3 A;  1V2D A;  2EZ2 A;  1GD9 A;  3A9Z A;  4PVF A;  1AAW A;  4Y0I A;  4F5J A;  1IJI A;  2Z9V A;  2VMU A;  2W7I A;  4RKD A;  5M49 A;  1SF2 A;  1I41 A;  2CJG A;  4LW2 A;  3MEB A;  4Q76 A;  3GZC A;  1KL1 A;  2OAT A;  5EAA A;  5EFS A;  4KXK A;  4WYE A;  3GSB A;  4OBU A;  4F5F A;  1G4X A;  2Z61 A;  1W7L A;  3BWO A;  3JZL A;  3PD6 B;  3DR7 A;  4IYO B;  3JW9 A;  5EUE A;  4JE5 D;  3AEM C;  3M5U A;  2ZY4 A;  2HOZ A;  2AEU A;  1N8P A;  4A72 A;  4ADE A;  1MAP A;  1WST A;  3FKD A;  4EU1 A;  3G8M A;  2YCT A;  1PG8 A;  2D61 A;  1ARG A;  3MAF A;  2QB2 A;  3NDN A;  1LC7 A;  1RV3 A;  3DYD A;  3IF2 A;  2BI1 A;  2JIS A;  1DFO A;  2BI2 A;  1C7N A;  3WLX A;  1YJZ A;  2Z9X A;  1BJO B;  2VGS A;  3GR9 A;  4OMA A;  4OYT A;  2AY6 A;  2YKX A;  1ASE A;  3MKJ A;  3EZS A;  2HOR A;  3PJ0 A;  1B4X A;  3RUY A;  3VP6 A;  1PMM A;  5EIG B;  4K05 A;  2PB2 A;  2OKJ A;  4TN4 A;  2QMA A;  4N0W A;  2WK9 A;  3II0 A;  1WYU B;  1KMK A;  1H0C A;  3RBF A;  3N4S A;  4JEY A;  2ZYJ A;  4LC3 A;  2BYL A;  4OBV A;  1BKG A;  3B1E A;  1WYT B;  1GC3 A;  2R0T A;  1TOE A;  1Z3Z A;  1TOI A;  1WYV A;  2VGT A;  3ATH A;  2X5D A;  1BW0 A;  4XJL A;  3TCM A;  1AMA A;  4CXR A;  2QB3 A;  1ASD A;  9AAT A;  4R5Z A;  1DTY A;  2OQX A;  3E2F A;  1KKP A;  3CBF A;  3UAK A;  3QPG A;  4IX8 A;  3WCN A;  4ZSY A;  3F9T A;  3WX9 A;  3E77 A;  1ASF A;  4GRX A;  4MQR A;  1OHV A;  1AHE A;  4JEZ A;  2VGV A;  4JF1 A;  3QM2 A;  4GEB A;  3LVM A;  3G7Q A;  5D95 A;  3W1H A;  4UHM A;  4GSA A;  2W7G A;  5DJ1 A;  1AIA A;  2EYQ A;  2DOU A;  4ZSW A;  4A0G A;  3IHJ A;  4PFF A;  2FYF A;  1W7M A;  1LC5 A;  1M6S A;  2BIE A;  2A1V A;  3K40 A;  1AMQ A;  4R5F A;  4TMR A;  2CIN A;  2W7D A;  1M7Y A;  2EPJ A;  3D6K A;  1U08 A;  2YKU A;  3LWS A;  2JJG A;  3NTJ A;  3QGU A;  3RCH A;  3TQX A;  4QGR A;  2ZJG A;  3ZRR A;  2G7J A;  2AY7 A;  5DX5 A;  2D63 A;  2HP1 A;  2HOX A;  3NYS A;  5BJ3 A;  2X3L A;  1AJR A;  4BMK A;  4WYA A;  3NUB A;  1ZOB A;  2YCN A;  3PAA A;  3BWN C;  3B8X A;  4JEX A;  4WYG A;  4XAU A;  2YRI A;  3LVJ A;  2OGA A;  3EI6 A;  4WXG A;  4CBR A;  2KFP A;  4Q31 A;  3CQ4 A;  4DGT A;  5HDM A;  4E77 A;  3ACZ A;  3NYU A;  1BQD A;  3DC1 A;  2AY8 A;  1AY8 A;  2C7T A;  3AEO A;  4W1V A;  3EIB A;  2YOB A;  2G6W A;  1W23 A;  3G0T A;  1N2T A;  3F6T A;  1QZ9 A;  4K2M A;  4EMY A;  1J32 A;  1ASN A;  1ASC A;  1LW5 A;  2AY2 A;  2QBT A;  3EIA A;  3HT4 A;  3HVY A;  4RAE A;  1M32 A;  3NU8 A;  4J5U A;  1ELU A;  4WB0 A;  3FDD A;  4AO9 A;  4MQQ A;  2ZY5 A;  1IVR A;  4XEW A;  1FG7 A;  5G0A A;  2W8W A;  3BCB A;  1YOO A;  5FT6 A;  2GMS A;  1YAA A;  2O7C A;  3B1D A;  3PDX A;  1H1C A;  4XK1 A;  3WGC A;  2V0Y A;  2BIA A;  1O4S A;  3N75 A;  3AEL A;  1AAM A;  4Q75 A;  1AHX A;  2CY8 A;  3AAT A;  3QI6 A;  3AOV A;  4ZAS A;  2R5E A;  3TAT A;  1BJN A;  1JS3 A;  1OHY A;  2BHX A;  2QSR A;  3NX3 A;  1AJS A;  2CH1 A;  2VMR A;  3AV7 A;  2CJD A;  3MAF B;  3WGB A;  3PA9 A;  1XEY A;  2AY4 A;  4MGR A;  3BC8 A;  3NNK A;  2FN6 A;  7AAT A;  1S0A A;  1M0P A;  2Z9W A;  3KGX A;  2VMT A;  3VAX A;  3N4X A;  4U2H A;  3FQ8 A;  1LS3 A;  1BQA A;  3DXW A;  1D7V A;  3FVU A;  4RLG A;  3HL2 A;  1B9H A;  3R4T A;  2VIB A;  4ATQ A;  5JAY A;  1ARI A;  1GEX A;  1TOK A;  8AAT A;  4I8A A;  3GZD A;  4WD2 A;  1IX6 A;  1QJ5 A;  1AHF A;  1Z7D A;  1X29 A;  3JWB A;  1WYV B;  3HLM A;  3MC6 C;  2D65 A;  5TF5 A;  3WCO A;  4CXQ A;  1BS0 A;  3LG0 A;  1N31 A;  3BB8 A;  3FSL A;  1YNU A;  4ZWV A;  4K2B A;  3LVK A;  2DGK A;  2AEV A;  2Z1Z A;  1QIS A;  3DU4 A;  1X0M A;  2X8U A;  3H9X A;  3E2Y A;  3FTB A;  1V2E A;  2DKB A;  3P6K A;  3AEJ C;  1TAS A;  1W7N A;  2W7F A;  5G2Q A;  2C0R A;  1G7W A;  3WY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...