5EAIA

Crystal structure of nad(p)h dehydrogenase, quinone 1 complexed with a chemotherapeutic naphthoquinone e6a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
RRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H dehydrogenase [quinone] 1
publication title A direct interaction between NQO1 and a chemotherapeutic dimeric naphthoquinone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 270
sequence length 270
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5eaiA00
1F4PA 2FX2A 4QODA 2GSWA 3W7AA 2X2OA 3K1YA 4PTZA 1XYVA 1AZLA 4HEQA 3F6SA 2MOKA 2ZKIA 1QR2A 1OFVA 5LJIA 1QRDA 4FGKA 4R81A 4C14A 2QX8A 3N3BC 4C0WA 1RLJA 2HPVA 2B3DA 1TLLA 3NFRA 1FLNA 4QOIA 4QOFA 1SG0A 2D5IA 2OYSA 3B6KA 2OHHA 5LVAA 1CZOA 3NHPA 5ULLA 4LTNA 4DIKA 4YAFA 2QR2A 4QOGA 2M6RA 1J9ZA 4Y7CA 3RPEA 3OX3A 2Q62A 2RG1A 4GR9A 1YRHA 4NULA 1FTGA 1FLVA 2MWMA 3NHRA 4QOEA 2BPOA 1JA0A 2BZSA 1CZHA 2R97A 2FCRA 3GFQA 1H66A 2A5LA 2FZVA 2OHJA 2XODA 3TZBA 3ZHOA 3LCMA 3NLLA 5LJLA 3NHLA 3F2VA 3KAQA 4YAWA 5F51A 3L9XA 3N3AC 3U7IA 1AKWA 1FX1A 3QFCA 5JROA 4PU0A 1RLIA 3QFRA 4Y9RA 5BUCA 3K20A 1D04A 5LBTA 3HR4A 2BMVA 4N82A 1GG5A 3FW1A 3NHUA 3ESZA 5LBUA 2MT9A 4Y9UA 3R6WA 1DXOA 1XYYA 5FUQA 3NHWA 3P0RA 4ICIA 1CZUA 3TE7A 3F6RA 4DILA 3UXHA 4FGJA 4PTYA 5A4KA 4YAOA 2F1OA 2W5UA 1WSBA 1RCFA 2M6SA 4XDHA 4H2DA 1CZLA 2BF4A 4GQIA 3KLBA 3FX2A 3FJOA 2X2PA 1V4BA 3B6JA 3ES9A 3UXEA 4CF6A 2KLBA 4U7FA 1DXQA 5EA2A 1AHNA 1YDGA 1QHEA 1C7EA 2FVXA 3W78A 3OX2A 1YOBA 4CETA 3QE2A 1KBQA 1FLAA 4QOJA 2HNBA 4LA4A 1AMOA 1T0IA 4ZVMA 3KEGA 2Z9DA 1OBVA 4U7GA 4LAFA 3W77A 3EDOA 3OJWA 3FNIA 4YQEA 3NHFA 5LMCA 3SVLA 4LTMA 1FLDA 4F8YA 1FUEA 2V5VA 1QBGA 3B6MA 1NNI1 2Z9CA 3LT5A 2FZ5A 3ESXA 1FVXA 1H69A 2XOEA 4LTDA 2AMJA 2Z98A 1DX9A 1SQSA 1ZX1A 3W79A 1CZKA 3JSXA 4FGLA 5F4BA 1I1OA 1AKQA 4ZVNA 1ZWLA 3KAPA 4H6PA 4YALA 4N9QA 4ESEA 2Q9UA 1T5BA 4U7HA 3O73A 5LLDA 3U7RA 3EYWA 1AKVA 3N39C 4D02A 1J8QA 4BMPB 1YCGA 3HA2A 5F12A 2QX9A 2N1MA 3NHYA 1OBOA 1CZRA 4BMOB 1D4AA 1XI2A 1AKRA 5NULA 1XT6A 4NLLA 2QWXA 1YKGA 4ZVKA 1WSWA 1JA1A 2Z9BA 3GAMA 5B3KA 3FVWA 4J8PA 1BVYF 2QX6A 1B1CA 2FAXA 2BN4A 3S2YA 3GFRA 1RTTA 3O2NA 4M0CA 5B3LA 2QX4A 4C0XA 4OXXA 1J9GA 3OJXA 3F90A 2HNAA 2QMYA 4XDGA 2ARKA 4HS4A 5EMNA 1D03A 4FX2A 5FA6A 4ZVLA 2V9CA 1C7FA 4C76A 3OWHA 2FDXA 3D7NA 6NULA 1ZWKA 1X77A 5FX2A 1TIKA 4S24A 2KQUA 1BU5A 1CZNA 3TEMA 5TGZA 1AKUA 2FOXA 3NHKA 2FLVA 3OWXA 5NLLA 1E5DA 4YAUA 2QMZA 3HLYA 3L9WA 3B6IA 1AG9A 4GI5A 1VMEA 2R96A 3NHSA 4QOHA 4DY4A 2OHIA 3OVMA 3GFSA 3G5MA 3ESYA 3OX1A 1YCFA 1YCHA 3NHJA 5EAIA 1KBOA 4N65A 2V5UA 1AKTA 2WC1A 2MTBA 1J9EA
chains in the Genus database with same CATH superfamily
5A3RA 4CHGA 2BD0A 2O8FA 1RJGA 1IRXA 2XCLA 3IQXA 3PFNA 4HDKB 5CFLA 2GS9A 1NZJA 2HCFA 4AECA 4REQA 2F8MA 3FFBA 3BFPA 1G98A 4FXPA 2QM7A 1MOSA 4D57A 1H2WA 4CDRA 4RD1A 1GFIA 1ZSNA 3DOFA 3R7WB 4RD2A 4N4AA 2OG1A 1Z4LA 2HFJA 4XM0A 1IMOA 3EZ2A 3VHXB 1TCUA 1SCIA 1NBMD 1V4NA 4LGVA 1PEYA 2XGOA 4HDNA 2RE8A 5BR7A 4BGUA 1Z63A 2Q7OE 4MKFA 2W98A 2VJAA 3WGHA 3DW1X 3IYLW 4N7MA 1WVGA 1ZD3A 4UARA 4YP7A 1XXHB 2JLSA 2J3QA 3F3YA 5E4FA 5TGTA 4BFWA 3E2IA 3BBPA 1QH1B 2NOAA 3V55A 3ZTWA 4AJIA 2O2YA 3KQPA 1NHGA 3W3AH 2RGGA 3CLHA 4AY5A 2I1WA 4UXJA 1D2NA 1S7GA 2XVYA 4ZDIA 2REXB 1UK6A 3PXBA 1QGUA 5LU9A 1C8LA 2EQBA 3LUGA 1FJXA 2G67A 3NDRA 3T0IA 3ZIUA 4FSXA 4XQCA 3ETNA 5AM0A 4D9HA 3COSA 3GO4A 2CF6A 4YJHB 3UJBA 5DE3A 3UMVA 1YZUA 1E2HA 1JFVA 2W0SA 5AM4A 5KAMA 1J7JA 4L5CA 4HBGA 1VKHA 3FGPA 4Y6GB 4WBNB 1LTQA 1Z73A 4M7RA 2C9YA 4IJUA 1ZKMA 3JZIA 1IAQA 5HEKA 1JAYA 4FS8A 4EJ0A 2QEQA 1LZKA 3DOCA 3V7NA 4EPVA 1U98A 4KDCA 1N6IA 4HV4A 5CFPA 5I4KA 2BDTA 1RNLA 5EVCA 1Z5ZA 1NBMA 3BD8A 3ULKA 4OBBA 1N3LA 4QASA 2QA5A 4PYOA 1GNRA 5HS6A 1J06A 1V96A 3IBSA 1A9YA 1C1HA 1Z88A 4CODB 5IWCA 1R50A 1XCJA 4F0JA 4J1QA 3ZDAA 4EI9A 4AO8A 5FBZA 4G4GA 4HQOA 2FMHA 4XQEA 2J67A 4PN7A 1M5TA 2FP4A 3AJDA 4GG1A 3WGZA 4ZAZA 3ABZA 3KQYA 5LM3A 5FO1A 3MMXA 4XW2A 3CV3A 2PGOA 1WB6A 2WUDA 4YP6A 4MCJA 2EFCB 3CY6A 2QRVA 3KWJA 2VNAA 2OCXA 3N1UA 3LUHA 2EC5A 2R25B 3KJXA 3NHRA 4KDRA 1S8NA 2P8SA 1VKNA 2IV2X 1SUAA 3AM4A 5KOHB 1JA0A 4JR2A 4X3CA 2ZB2A 3GHYA 1KORA 4ZZ0A 4MQMA 2IBSA 4R2MA 4KOEC 3W3ZB 2EQAA 2Z30A 4ZVUA 1KYIA 2FB9A 5C35A 3TQRA 2WOOA 3HR8A 3T4PA 2A5FA 5MFZA 1QIFA 1LPSA 5T4EA 2NO9A 2JS7A 3OU7A 3U48A 3FROA 4DC1A 1KXZA 4ENQA 4XYGA 1U2DC 5K8JB 1W7AA 1KEEA 1OMOA 4X66B 3LS2A 4FQ8A 4UFNA 3IAHA 5CGZA 1QG0A 4MYCA 3WICA 4DPLA 4ARCA 1UT6A 1VSTA 1XMIA 5JJBA 1BDMA 2XIJA 3IPCA 3LDUA 2ZE8A 4W82A 4EUKA 3G0GA 3K2QA 1DC7A 4E12A 4XGIA 4MKGA 2CXTA 3PQ8A 3TRKA 5B64A 5BVGA 1F2UA 1FYDA 4DSTA 4KPFC 4QUBA 5FYQA 4AW9A 1WEHA 1P9RA 5K0JA 5LOVF 4TV8A 5E0OA 2O8FB 1V9SA 4YCLA 3RVPA 4UPDA 2RHTA 3C5HA 4JL8A 1M73E 4REQB 4E1AA 2G1KA 4CHTA 3BM5A 5DXAA 4D6XA 4OJYA 3UW1A 3F9RA 4RMIA 3FDIA 2L0XA 1DZIA 4MVJH 4W1RA 3R7FA 3WMGA 3X1MA 4DRYA 4RTKA 5LBTA 1X13A 1YS2X 2F6RA 4QUIA 5EZYF 3I6YA 4ZO7A 4JB8A 2IYAA 2YTZA 2YV4A 1JQBA 3OLQA 5JATA 4L3VA 1G63A 3CUVA 4HDNB 1FFYA 3KAJA 4JJ4A 4KPUA 4TKVB 4H7JA 1TEZA 1FXWA 3RW9A 2EBUA 4S0ZA 5LDHA 1IHDA 1Y82A 2LNDA 3TFOA 4HFJA 2B8JA 4MWBA 2JVKA 1DKNA 1IHUA 4Q9LA 1N34B 1YA4A 1AH2A 3FW1A 3NHUA 1G4HA 4C0JA 5U1PA 4Q0MA 2GYUA 4FDTA 2VI5A 3QUBA 1U28A 1DQRA 1W46A 2JC3A 1QGUB 1US8A 4FDUA 4C6RA 2C5BA 5LUBA 1KEWA 4BO0A 5LA6B 4IO0A 2IBTA 2RK4A 2W2NA 1U2GA 1ENPA 3ERCA 4XUDA 2M6LA 1SPBS 4IIVA 4FB4A 3IMGA 1V8BA 2VJMA 4BTVA 4JJAA 1XD8A 3BWVA 2IXFA 3U4DA 1OE0A 5FOVA 4UU8A 2Q3HA 2F43B 5JZ9A 2FR0A 4C4TA 1LI5A 1ZU4A 3JQDA 1AK1A 1QIDA 3FHJA 1RJ9A 3ZJYA 4P36A 2ADMA 3PYLA 4CQLA 5FPPA 3PFKA 4B6OA 4D8VA 5KYNA 3QKWA 2F1OA 2J1LA 1AQYA 1EINA 1TYCA 4KTTE 1YZGA 1HDOA 2JGKA 2OM6A 2QLLA 1C9KA 2C4HA 3EQZA 4NZOA 5JE8A 2Q4RA 4ARSA 4DCSA 4ZEOA 4EJFA 2Q3EA 2WG2A 1Q0RA 1UOPA 1DAMA 3CNNA 3D7MA 4R31A 1J2UA 2QN2A 3EGXA 3C14C 4NOKA 2GUGA 4FC6A 1G42A 1UBSB 3HNOA 1B26A 2XEXA 1E0JA 4RD3A 4Y0NA 1RYHA 1Z8FA 1PVVA 3PFWO 1V0JA 4ZI7F 4O0LA 3WSTA 5D1NA 1I3MA 2D7JA 2YHBA 3GT3A 2FMFA 3INRA 4GL2A 1UZNA 3NBMA 2IQIA 3NOVA 1K86A 3NNNA 2BHNA 2X0RA 5FAXA 3OZDA 3S70A 1QTIA 2QRVB 4LYHA 1L5WA 1PR6A 3CEPB 3C1TA 4IFBA 1YRAA 1BMFD 1CDZA 1YR1A 2BFEB 2EW2A 2HO5A 3F5MA 3GRYA 2PH7A 3ZLJA 4WGFA 1KERA 1DEKA 1Y5RA 4RGQA 5F3DA 3SIRA 3NHMA 3STVA 4EFDA 1Y6GA 2BVNA 3T3DA 1QPBA 2PANA 5F23A 3VV3A 4Q93A 5LWHA 3DHYA 4IWXA 2FMIA 3B70A 1JNXX 1T8SA 4EAAA 2NXJA 5E3JA 3CJQA 1SKMA 1YDGA 2ZBGA 4BRWA 4H16A 5JRDS 3G9TA 3PFCA 4TYWA 3T8YA 3NEAA 3LCRA 5KQPA 1WCIA 3U3DA 4PLVA 4IGIA 1TM5E 1I13A 1YZNA 2VHZA 3FYTA 3O4HA 3Q2IA 1HNWB 4Q3CA 4YASA 1KEEB 2AK3A 4XEUA 4U8HA 3EW9A 3WRYC 1RAAA 1MU0A 2IYWA 2AI3A 4W9MC 1KY4A 3JZAA 3IXLA 4ZQIA 1TK9A 3M6LA 1TUBA 4F38A 4YRIA 2IYSA 3IP9A 2GZ1A 4X97A 2ZQYA 2YW2A 5BVGB 1F2UB 2XGJA 1L4KA 3VU0A 3M70A 4KV7A 1N5KA 2DM6A 1SQ0A 2AOTA 1ESZA 2ZSUA 3LLVA 1BC5A 2AN4A 1Q17A 1T0IA 3BTVA 2Q45A 1XA4A 4M86A 1BMFA 2BV3A 3B1ZA 3UAVA 3UMCA 2WDPA 3I2FA 1ONBA 2G9QA 4TRJA 3QX3A 4X92A 2BKXA 1BG6A 3IIMA 2JJMA 2IBMA 1NR7A 3W77A 5ICEA 2XE8A 4Q3BA 2EWMA 3OJWA 3P45A 3PLNA 3ZHTA 6GPBA 1BDIA 2VJDA 3SVTA 3Q8LA 4MVCA 2OEPA 4RF2A 3PL5A 5A9TA 1AZWA 3WYFA 4EFLA 2P6MA 1IN5A 3CSUA 3H97A 4NECA 4QTYA 4Z3KA 5KTKA 4HVTA 3BTUA 2BR3A 1YV9A 1ZJ5A 3L6RA 2XRYA 1Z29A 4N5DA 1O97D 1P61B 4M0KA 3V8NA 3H5VA 3OM8A 2ISQA 3MJ4A 1OWPA 2Z04A 3GFVA 4M0LA 3WK4A 2N9UA 4HQ6A 1US8B 2Q6OA 4POAA 1VHDA 4Q82A 5FADA 5C32A 3TIXB 3TLEA 2BI4A 4OGLA 1E2EA 4RVFA 2XE7A 3HNRA 3LQ4A 4PBRA 3OTIA 1N3YA 2QP4A 2ZTVA 2VJMB 3AKDA 3M9LA 2ZZKA 2UAGA 2IOHA 3OZFA 1N5RA 2WUVA 4PQGA 1DBPA 3JD1A 3IOMA 3N6XA 3IR5A 1SIOA 2B20A 3CLSD 4DR2B 1RJ9B 5DNAA 1N92A 5ENVA 1XMQB 1H9CA 3X44A 1NOKA 5L6LB 1S2OA 1CYDA 4M60A 3H7IA 1YQ9A 4O4LA 1NAHA 5TVKA 1RXIA 4EO9A 4F2PA 5I7WA 3IKTA 1FPQA 2VPZA 1TC1A 4JD5A 4KK4A 3TBHA 4BWGA 3EPLA 3FSGA 2AS0A 5A03A 4JB0A 4F6CA 3EGXB 1EMDA 3OCVA 1J8FA 1RVDA 2RAPA 5EHQA 4L3WA 3IMKA 3TTVA 1AKQA 1G21A 3F6PA 4L9WA 1JHAA 1FYEA 1G7SA 3T7IA 1FBNA 1I2AA 2C96A 1RAHA 3H87A 3OETA 1E2UA 4UNSA 4OH1A 5KHAA 2D5AA 3QOXA 1A88A 3TLMA 3MPOA 5L7YA 1AO0A 3HCNA 4IDPA 3T94A 5C7OO 4NYMR 1MAHA 4PEVA 1X74A 3RSCA 4DMFA 5THKA 3QW2A 2VK1A 4R1QA 2XSZD 3H8VA 3EPJA 3S68A 3UJCA 3L0DA 4CL3A 4FYPA 2IP1A 3PVSA 3BZWA 5F78A 4NWIA 4ROTA 1ZUWA 4BRSA 3L4KA 4FWTA 3WNZA 3OCJA 3SEZA 1D7AA 4KQ2A 1YF3A 1MQ8B 2JLQA 4MMYB 4DAOA 2JBHA 2PTGA 5HZMA 2P9GA 3HMKA 1WCIB 1CP3A 2NV6A 1GZDA 2BGNA 1XRLA 1Z68A 5DM4A 4BJ3A 4NMWA 2GCNA 4QJ5A 3RYTC 1SBYA 1E1CB 2J3MA 2QTTA 4GZ5A 1ECFA 1U63A 4XGNA 5LWQA 5AUQA 3WYDA 3CVJA 1KEZA 3DZBA 4I6EA 4DXAA 3TF5A 4JC0A 4YFYA 4PFKA 4WCDA 1EK1A 4HYEA 5CIWA 4NG5A 2A33A 1YRBA 1QG4A 3P9RA 3RCBA 3RJMA 1DT3A 1I9CA 1YB1A 5LQJA 2XRZA 3D6MA 1NN5A 2OESA 1IPFA 1YWGO 3N0TA 3A3KA 1WU8A 1ZRNA 4GI7A 5CVEA 4MLDA 5E7QA 5AW7A 2PT7A 2XSZA 2JFNA 3AG5A 1BA2A 4RDCA 2P6UA 1EBBA 1UOOA 1K2WA 1CF2O 3DR5A 5E1DA 3ICOA 2TMGA 4YUYA 3TG2A 1LSSA 4L22A 4DBZA 3OY2A 2GZ3A 3EQ8A 3UMMA 1DO8A 2QMOA 3C1UA 3EHEA 4XSGA 1JDUA 4EPYA 4J8PA 1R9JA 3HV2A 3ROQA 3TNJA 3PUZA 4O2BA 1NIPA 1WCWA 3D7KA 2VLIA 1B1CA 2ZYSA 3GH1A 5IPFA 5F9MA 1JHOA 5KYYA 1PR2A 4L2IB 3OC6A 2G7MC 1NQ5A 4OJTA 4PGAA 1NV8A 3KYBA 2X9NA 1P3Y1 5CXXA 1X8JA 3AUUA 3C3EA 3IC5A 5IMSA 4MA4A 1EUDA 2X8WA 1P7PA 2DC1A 2XV1A 3A1EA 4M46A 5KHLB 1GTRA 1UPFA 1OFIA 2ZRIA 3M5WA 1LLCA 3M83A 2PN1A 1DXHA 3FI9A 3GFFA 4RO0A 4F4UA 1Y0BA 4J6EA 2WK1A 1QOPB 2XNJA 2H65A 2A86A 2G83A 1J5PA 1E63A 3V2IA 4CM6A 1JZQA 4DZTA 2W11A 4JASB 4HN9A 4H35A 2HKIA 5DNCA 5AKGA 2XCRB 1MHTA 4WKCA 1BEZA 1HFEL 3QF4A 4TT8A 1R37A 3QG5A 2JHFA 3I6IA 2LBPA 4ZQBA 3RVMA 3GP5A 3OFJA 4NU5A 1GDHA 3PUHA 4EW2A 3EH1A 3MJRA 5C1OA 2CFRA 1CRQA 2NVWA 2OFXA 2RHCA 4ZAFA 5HOQA 5LYJB 5K51A 1TAGA 4RELA 3L4SO 1W9HA 1D4FA 2YCBA 1KJWA 1JN0A 1LPAB 2GZHA 3ELYA 4G6ZA 3P32A 4H6WA 3ILHA 2XB4A 1I7LA 4G1FA 1U9YA 1BKDR 5CK4A 1L3BA 1E3WA 3SQNA 1XZLA 2VJLA 1NUSA 1RWNA 3LHFA 4R9VA 5BUZA 4JA2A 1CSEE 2FOXA 3QRWA 4B6QA 1QNLA 5KQSA 2NZUG 3CMCO 5AHXA 5CB0A 1JHXA 1OZGA 3AV3A 3G59A 1BNCA 3MINB 3MGGA 1A9TA 1P5JA 4M89A 2RAFA 7AT1A 1CP2A 4W5TA 3UAWA 1X7GA 1SBHA 3M1AA 1NFFA 1O57A 1JILA 5FA5A 3EXEA 4NMHA 2R96A 4X8OA 1FVHA 4ZQCB 2NZJA 3IDSA 1N36B 1QIMA 5IEJA 4JP3A 2FF7A 1Y4AE 2A9JA 1GTL1 2V7QA 1CULC 1ODKA 4Z6KA 4A2CA 1KVUA 3Q3HA 3FTPA 4CCSA 4JC4A 4QC2A 4NXNB 1P2DA 3L7JA 1SBZA 2XMPA 2OZLA 1LFDB 1KR2A 4H7PA 4GZ6A 2FPLA 1IQPA 4LNUB 5EJGA 2QSZA 5HFAA 1NW5A 4FNMA 3A9CA 2GGSA 5JSYA 1ES9A 3QBEA 2OV1A 5B3JC 4C88A 1ODFA 1UBGA 2MTBA 1GKIA 1K7XB 1QHHB 1R88A 2D1TA 2RHOA 4HWPA 4UXIA 2C7RA 2MJLA 3E7XA 5B6IA 5TMDA 2EU8A 1FSSA 1NUTA 4DADA 3TL2A 1SNYA 4DL9A 5DNWA 1RHJA 5IABA 2XWPA 3KQHA 4FLFA 4WESB 4L1KA 1AT1A 4IKOA 3UWOA 5L9AA 3DE0X 3GW8A 3PR2B 5A5DA 2B4YA 2FEOA 3F6SA 4HQRA 5H4GA 3VC1A 1GDDA 4RV9A 4LZLA 4GUDA 5CA0F 1GAWA 4UM7A 4IV8A 4HX9A 2PRSA 1JXAA 3PC8A 3L8ZA 2IUSA 3IQHX 1E7SA 2BSXA 3ZR4B 4C3UA 3ADOA 3OQHA 4JBGA 1KYQA 2P69A 1PG5A 4LOHA 4OB7A 3RFVA 4G1EB 3HXOA 4N76A 4IM7A 1SU6A 1YQGA 3TK1A 4JUFA 5IM4A 1QIJA 1T5DX 4WCFB 1EJBA 2EZ4A 1HMYA 2X7XA 3QVJA 1QVWA 1F4VA 2AJCA 4FN5A 4ZALA 5IN5A 3QE9Y 3I30X 3LQ2A 2C07A 1EUDB 1JU3A 3CLKA 3D5TA 3ZXYA 1PT5A 1D2EA 4Q9IA 2AC4A 2UYYA 5KOIA 3OU6A 5FTWA 3ZTTA 2YWFA 4W4TA 4LPKA 4RZQA 3KYDA 3SVZA 3W5CA 2AXNA 4E2XA 3V80A 5G0UA 1QUEA 3V6LA 1HTWA 4KIJA 5C5CA 2I4MA 1UBKS 2YFQA 1X19A 3QF4B 4WTOA 1GL7A 4EEZA 3CM0A 1XZHA 2IITA 3F5SA 3FUCA 4NH4A 3TCXB 1SUFA 4FR0A 4GP9A 2XGGA 3C3DA 3P9XA 4TV9A 3I2KA 2ZGVA 1THGA 3R0VA 2AOVA 2QLTA 3Q7IA 2VDRB 1IN7A 4JS0A 4TTJA 3KJGA 1M75A 1JB1A 1HA3A 1IJBA 5GWXA 1K68A 2V3VA 2JFFA 2VKQA 1E2LA 1OT3A 5DP2A 2BGUA 1OTHA 1GKYA 5ELLA 2AT1A 1KI4A 1E3WB 4IEFB 4JXXA 1KRXA 1JSXA 3PNOA 5E95A 3C8HA 1TCCA 3D7LA 4QUDA 4M8KA 1V2GA 1WMBA 2UZ0A 3SHOA 3CCFA 4HJXA 3U09A 4U6SA 3TL6A 3S44A 2Q62A 3JQ8A 3MWGA 4NCNA 2OMEA 4WH0A 4XYLA 3U19A 3ASUA 3L8YA 1KAHA 3NHBA 4HNTA 3QVGA 1XZGA 3BKXA 4WNIA 4V0RA 3SKXA 3GDGA 3SP1A 2J5XA 1P62B 5E2AA 1QIKA 5EMHA 1JZSA 1SHZA 3WC4A 1XVUA 4E94A 2W2PA 5IRCD 1TZCA 1QFZA 1KZGB 2BZSA 1RHMA 3HWSA 3R0QA 2K5UA 3WRVA 3ZXXA 1T5HX 4PCUA 4OXRA 4OLFA 3H5OA 3FNEA 1UXOA 1E18A 1TO1E 2NPFA 4V1CI 2ZSIA 4LC9A 4R8LA 1XTQA 1U0NA 5K3DA 3K0BA 1TD1A 2QSUA 3KV1A 4INAA 2IXAA 2Y0CA 4L7QA 4E03A 4D25A 2BJWA 1ULTA 4GWLA 4LSMA 1YZYA 2NW6A 3L0ZA 3OP4A 2IS6A 3H0KA 1GTJ1 3MXOA 3GG2A 3ONNA 4YRPA 2C82A 3RUHA 4Z53A 4EO4A 5FWYA 2I2WA 4E11A 4UUOA 2GKGA 4WOBA 3SYLA 2B99A 2GPWA 2HLPA 1G2QA 3EJWA 2O6HA 1B76A 2GLXA 2PKEA 2DP4E 4BP8A 3V4VB 4L08A 4DPMA 3H2ZA 1UMCB 2XX3A 2C1XA 4YNBA 4D8YA 4XDZA 4EKEA 2ZCJA 2Q46A 5KSOA 5U4QA 2ZYWX 4YMIA 4RQAA 1UP6A 1ID8A 3UGQA 1FS4A 4Q16A 2OENG 4MR8A 1LLFA 2C0PA 4IMRA 3IUEA 4C21A 1TCAA 3VPDA 3TTYA 2C59A 4C0AC 1MFZA 3W5SA 3MJSA 1II0A 2R0QC 2PY6A 3UH1A 4C4RA 5IT5A 1IN1A 2I80A 3DPUA 2Y2UA 1Q91A 2ODAA 5AXCA 5TV2A 1VJDA 2DCUA 4Y98A 4RK5A 1S89A 3L6DA 3URKA 3V8RA 1ZD4A 1SKUA 1ZGJA 5FNVA 1DGQA 3UUWA 1EQUA 2W71A 2HA0A 3D9QX 3QTBA 2HEIA 4AKSA 5ALFA 2OXTA 3W7VA 1ZN9A 3I5YA 1JS1X 3OFVA 4U2EA 3CQ9A 3CCBA 2QBYA 3OEHD 4RNDB 1MMFB 1T4MA 2Z3VA 2VSNA 3QVLA 3OE7A 2OCGA 3A70A 1DXOA 3NIWA 3PB3A 5BRJA 3AY6A 2WVJA 1KPIA 2CB0A 2IYUA 2A0UA 2JIZD 3NRCA 3ND5A 1QYCA 3U7EB 1XCPA 4FZ5A 2PUGA 3KYDB 2DUNA 1ATZA 1DJLA 3HDJA 2PGNA 3IR7A 4OHKA 3K9LA 1ISMA 5IYZF 3ZWAA 5K8CA 1ZKDA 4KQKA 4EYEA 4ZZ2A 1KFKB 3DWGA 2FW0A 2NSHA 5K8IA 4LYYA 1VLHA 1EXDA 2O8DA 2H0RA 2JGDB 3HB9A 2WW8A 3L7MA 3WVNA 1E1NA 3JRXA 1YDHA 2IP4A 3P26A 2P6RA 1FSPA 5EZYB 4H4CA 2VCYA 1IM5A 1ZI9A 4MVWA 1MA3A 4GKJB 5DLDA 1UOQA 4TV9B 5JH7F 2WHRA 4AB1A 2IHNA 5AW8A 3RH0A 2H2WA 2ETXA 4NBRA 2MSLA 4ENSA 4ZYZA 2C78A 3OD1A 5F2EA 3VZQA 1LRKA 5CA1A 2J3JA 3DWEX 1WF6A 4E4YA 1RXWA 3UTCA 2P2NA 4Q7MB 4EM6A 3W9UA 2WAOA 3FPHA 1GSAA 2E9SA 3AU8A 2IZ7A 3OEHA 1ZIDA 4LNHA 1QC5A 4WA7A 3WHPA 4EFKA 2H1SA 1YVEI 2CSUA 3L0PA 4X1IB 4CM1A 3CLTD 1PT7A 2O7QA 1QQTA 5KAPA 2VYCA 2XXAA 1OILA 1SZPA 2CFTA 2CL0X 3T1QA 3K94A 4K03A 4PX2A 2P9JA 3VYVA 3KLOA 1A9SA 1YMQA 3GN2A 3PHIA 4E32A 5A0FA 1KC3A 2WTAA 1AK9A 1AQUA 2ZUDA 3KUKA 4GAEA 1EG2A 2ECKA 5TPWB 2ECQA 2C3PA 4G0QA 2FKNA 5A3QA 1ZOOA 1T0PA 3DE5X 3B60A 1QRUA 4JROA 2XOXA 1F0YA 2QMEA 3BIXA 3DD1A 1S8FA 2XPCA 3ZHVA 4EUFA 1JEOA 2P11A 2I62A 2ZTHA 5B7QA 2RB5A 3DNPA 2VDVE 1BIFA 3PUWA 5A4DA 1BVUA 2JFUA 2YMPA 4MLZA 4K05A 4ADSG 5CRIA 3SN6A 3TS1A 2O8EA 5JXWA 3OCYA 4KQEA 2B2XA 4FB5A 1R8XA 2VWHA 2Z6AA 3QVWA 2XNDD 4NBSA 3MGBA 5HUJA 3WHIA 1H3EA 4QXOA 3BZUA 1VBNA 2WTMA 4JDPA 4P31A 2WZCA 1GIAA 5IF3A 4JUIA 1WBJB 1QONA 3HWX1 3INGA 5EGSA 1UCFA 3IVXA 4KODA 3ABIA 2JD1A 1EFTA 3O8DA 3QQ5A 1EESA 2KBEA 3WMRA 3DQZA 4N01A 8ADHA 1ZJ4A 2P2SA 3ZWWA 4BCCA 4FMPA 3M1LA 2FW6A 4RXUA 6Q21A 2GMWA 2XKAA 4FDLA 3M4NA 1UZAA 2WNSA 1J20A 5KNBD 1TGVA 3U3RA 5FNVB 4QPNA 3VQTA 1U3TA 3L7LA 4IHKA 3BGSA 2IHUA 3FDZA 3NONA 1MHPA 4JEMA 2CV1A 2ZDHA 1UK9A 3AI3A 3MRTA 3VDRA 2CB9A 2PL1A 1AIPA 5HG0A 9ABPA 2QBYB 2VP0A 3SC2A 4RL6A 1KVRA 1R10A 2IHZA 4KQGA 4IQ0A 4QJIA 3AVXA 1J1IA 1MO2A 1ZNQO 5JI2E 4CEHA 5KSYA 4YQFA 3CZCA 2C2KA 4LHVA 5JRJA 4L95C 2WHEA 3T35A 3QPBA 1G2PA 3K32A 4XSHA 5ELMA 4YCMA 1NUQA 3D0OA 1FVOA 4EG1A 2HSDA 5AUOB 3GNLA 4DRXB 2NGRA 1QPGA 3EYAA 4GI1A 3G2OA 2W6QA 1F2DA 1R5OA 1U2EA 3EARA 2QNIA 4L5JA 2O8DB 1E20A 2COKA 1KAMA 3I2YX 1GYPA 4JC5A 3RF7A 1JMKC 3ITDA 4MLCA 4DA9A 2R85A 4WUTA 3R7BA 3C5CA 3S27A 3GGGA 1USWA 3V4LA 1S3SA 2EDCA 1Z4PX 2QVLA 4OQNA 4BMSA 1NT4A 2JLZA 1HETA 5J2TA 4G8JA 1IDOA 2GEVA 4YRLA 2PLAA 3NG1A 2BCJQ 3M6XA 1V5WA 2X8AA 2M1XA 2ZRKA 4ZV4A 1QV7A 2IV7A 1KH3A 4JJGA 3GEIA 4MUYA 1AUOA 1LJUA 1W8DA 1WA5A 3DDWA 2B7BA 3M5CA 4GVPA 4CCWA 4YPVA 1QC5B 4ACBA 1ESNA 5JXGA 5KJ1A 3CIOA 5EXXA 3ZPXA 4LY3A 2CT8A 1DIAA 1DC5A 4IMJB 5MN6A 1KSHA 1VZ2A 1GJRA 3EIUA 1K63A 2FSIA 2XR1A 3IODA 4G5RA 4GSYA 2YINC 3CX6A 2XXAB 3I01A 3HI6A 4KR6A 3JYNA 3EC2A 1IIRA 1I0LA 1PJZA 4D9JA 4Z51A 5KX5B 1F9EA 1X15A 4EHFA 2ALJA 2J4DA 4H59A 1Z56C 4TX1A 1IN8A 1BH2A 3GJRA 3NV7A 2EZ8A 1U0BB 1ENOA 1YFKA 2QN1A 4ISBA 3T54A 3QBVA 2DSNA 2BISA 3D4LA 4CUKA 1U0GA 1E3JA 3TNLA 2PX5A 3AUXA 1GO2A 2Q49A 3DZIA 3AY3A 2VDPB 3ORYA 1WDTA 1T2UA 1SG9A 2JFXA 2FW7A 4RY0A 2C3OA 2YHIA 4UNIA 2HDNB 3KOYA 3EXIB 4DG5A 4EHDA 4C5AA 5EIAA 3IUMA 5JR3A 2FZWA 2YICA 4V0ME 1C0IA 4X95A 1WAMA 1CIVA 2DPYA 5JXHA 4FHGA 4B0PA 3K1AB 4BLSA 4UTNA 3MXTA 1AHIA 1Y1RA 2HF7A 5E7IA 3WYBA 5EJ5A 1SK9A 2O8EB 1F4LA 4Q9AA 5I7SA 3OY7A 3IT1A 4O4JA 4D98A 4ZRNA 4DJFC 1D9XA 2R8XA 3U37A 4A8HA 3CVWA 5AM5A 2JFBA 2YWEA 4O4IB 2BFOA 3WAKA 3W6NA 5DN9A 3MBIA 5CDSA 3NHYA 3VR6H 1AD2A 2YMQA 3QFFA 3ZUPA 4UMFA 4D0SA 4BBJA 1TIBA 1S2MA 1U31A 3U80A 4BMOB 3W2FA 5K0SA 3RRZA 3KB6A 3KG2A 2DBRA 4Q4LA 3VVMA 2P5UA 2JI8A 4N54A 1RVV1 2V7TA 1J21A 3G8DA 1D09A 1KFCB 2HK7A 4JAVC 3TQOA 1XI2A 4V1CA 1ZC4A 1L4MA 5EP4A 3GZJA 1FRFS 3PR3A 5DT2A 2FVYA 4HGOA 4KAAA 2Z4TA 2WIJA 3DDOA 3U1BA 3NR2A 4NLLA 2GZ2A 3NHZA 1JALA 5CVVA 3GUZA 1IM8A 2ACVA 1DEHA 2HF9A 5IAEA 3SMVA 2GYWA 3DKRA 1QYVA 4LI3X 4YECA 4LGCA 3UG6A 2D13A 1C3EA 2N75A 1QZTA 5HVNA 3AVPA 5IUNC 1CQZA 5T8KA 3UO8B 3KQOA 5MGBA 3SC2B 1VGVA 4RKWA 3AKEA 1DIBA 4DDVA 2GF2A 3L8FA 4PFSA 1RTTA 1LF0A 1VHTA 1XLTC 1IB6A 1XZKA 2RHMA 2YVKA 1EFRD 5F5XA 4HAZA 1G2IA 3GOHA 1SU7A 2HSJA 4BS9A 1S2DA 2CK3D 3N2ZB 4UDOA 4AICA 1IVYA 4QX6A 1R6VA 3C6BA 2DFKB 5EE3A 2VTBA 4LV6A 1PSDA 2VF4X 3BOSA 2FYTA 4AIIA 1ND5A 5DLPA 1G20A 3BG5A 4H7FA 3KZKA 4K9PA 5B30A 2QD2A 2QSJA 2QTBA 2V7UA 1O1YA 3CUWA 3DMPA 4QGHA 2HHAA 4HS4A 3FOZA 1Q16A 4MVJI 1WULS 1GRCA 2E6KA 2IVFA 1ETUA 2FPOA 3AR4A 1EX6A 1Q1NA 2FPXA 3HFJA 3GPBA 2XZPA 3U81A 1O5TA 1P1CA 2R8EA 4FD3A 3LKDA 4WEOA 3UF0A 2L17A 1MXHA 1P77A 2ZSFA 3D6UA 2R8BA 4GW3A 3ZWQA 1SU8A 5J2TB 3MVEA 1D0VA 1BMDA 1FQWA 1XHEA 3ANMA 3X43A 2EL7A 2FK7A 4DV4B 3STYA 3DVAB 4I7EA 4ZD6A 4AJOA 1GVHA 1N6HA 2AFHA 1CF4A 1F2TB 1M6HA 2QD3A 2R9VA 1CQIA 2SICE 4QJBA 2E18A 4N8EA 2NWQA 1ML4A 1DKLA 1T8YA 1WP9A 1N0IA 2P27A 3L07A 3CSSA 4KGZA 3FUTA 2RJ3A 1H5UA 2F00A 3KVOA 1OFTA 2CK3A 3JYOA 3NQ41 4ND7A 2EHJA 5NLLA 2I54A 3NB0A 3ZZUA 5A1JA 1ND6A 2FR8A 2NXEA 4GWGA 1TK2A 1OAOC 4JBNA 4F85A 1RKBA 4BFVA 5GQSA 2FEWB 2QMZA 3RVLA 3B8EA 3T38A 1Q0TA 3IESA 4BPBA 1GGFA 1YD7A 3HU3A 1YB6A 2VPPA 4DR6B 2YJ5A 1FRNA 2BMFA 2W6PA 1LS1A 1EB9A 3MTAA 3GGSA 3GDFA 1U9ZA 2YHIB 1MEEA 4OQQA 4ABYA 2DQKA 1JAZA 1Z37A 2FRDA 2Y1DA 3HWRA 3N6RA 1M2KA 4MRNA 5U9CA 2GF9A 3E9NA 3WBKA 1JSCA 4CLRA 3FOAA 5GP1A 3M6FA 3WB1A 5KQGA 4ZYVA 2UYGA 1YZ3A 3BCSA 3WFIA 1L4BA 4O4JB 2YQZA 5ICMA 3O8CA 2ZUCA 5LIPA 1QR6A 4AY6A 1P1JA 3RT9A 3UT5A 2BUCA 1QUFA 2PUTA 3EWSA 1M33A 4ROSA 4B79A 5LQMA 5CAEA 4HAWA 2UUOA 1SUSA 3LLUA 3R6DA 3UPUA 2W0MA 3WOHA 1Z4QA 3JU3A 1XCGB 1JVSA 3OQPA 4DLAA 3CRZA 4I5IA 3ZWPA 3DDZX 1S2NA 4QGGA 4V1CB 1I0IA 4EPTA 1N6OA 3Q12A 3A4LA 5GZ1A 5ALQA 3A2LA 3SHFA 3AINA 4OXQA 1D1SA 4CLDA 3EVGA 4IIDA 4ETMA 1G3RA 3IBCA 2CLSA 2DHDA 2Y8EA 3HBJA 3VSEA 4TV8F 2X7HA 1BE0A 1P4HA 2VDKB 1BKSB 1QR2A 4O59O 5HIJA 3WLPA 5CB6A 3QPCA 5BURA 4ANFA 3VC7A 3H9BA 5AVTA 1AQNA 1I14A 2NXNA 3ZY5A 1YS9A 3FLAA 1O95D 3K8OE 1WLYA 4B0OA 4BKQA 4C4SA 4HAIA 1IY2A 5IC5A 1WZ2A 1KAQA 2E3JA 1XLUA 4ER5A 4IZOA 4K3VA 3U7QA 4DMGA 4OFZA 3OO1A 4EB0A 3MCUA 1Y8AA 3UOGA 1TA0A 1MF7A 4COOA 2C7PA 1FXWF 4N5LA 3SYNA 4QVIA 3PWZA 1DAKA 1IG0A 2ZB4A 4AO7A 5BSMA 4S1NA 4OAQA 2G9RA 2I7XA 3N07A 2I4OA 4I6JA 3QY0A 1JEDA 2GEKA 3WGKA 1SG0A 3C7TA 1AK2A 4Z7QB 1G4UR 3HCAA 1P7YA 3PHJA 2C2BA 2GQ0A 2XEDA 2RHBA 4YJGA 2C4TA 4BP1A 1E9DA 2OHHA 3I1IA 3HRIA 4K9LA 4FHZA 4LJ7A 2IE8A 3EDYA 2F3SA 3L7IA 1VYVA 1Z5OA 2WMYA 4R8KA 1RRGA 3RV4A 3ZDRA 2CLIB 4EGQA 1ZA2A 4JJ7A 3W3AD 4Z7JA 1CUEA 3OF2A 1GNLA 1UM9A 1B6SA 1IXRC 1DC8A 2AJLI 4B48A 1P0QA 3HXTA 5E1BA 1PZHA 1Z15A 1E2DA 2R48A 2WSLA 3EDMA 3GFOA 3UV6A 2Z6QA 3RLIA 4F71A 2AFHB 5BV2P 1OC4A 2Q8QA 4MCAA 5JTUA 1K4YA 4KSCA 1CQIB 2VP2A 4EG6A 1QANA 3N0XA 3T3EA 1MQAA 3U3JA 4AZ0B 2PCJA 4KXUA 1RMQA 1UBFA 5JLJA 1KDPA 2RGYA 3OX3A 1MXFA 3ZW9A 5FLYA 2XKJE 4QOSA 3R6LA 1F8FA 1FU4A 2UXCB 2A14A 2AKEA 3H2JA 5H80A 4FP9A 1NMYA 5TQ2A 1YRHA 4JX8A 1L5QA 4UVEA 2IDKA 1OWNA 3HDVA 2PZJA 2YXLA 1EVKA 1W0CA 3O9VA 2BPOA 1U3UA 3QFSA 3BRQA 4LMRA 5GVSA 4HADA 4QM7A 1ESCA 4WOCA 3AR2A 1M1UA 2BHRA 1IUNA 2HQ1A 3LCVB 5COBA 3W3AA 2FV8A 2EEZA 4PSAA 3J7TA 4LQDA 2PNJA 1DKOA 2GYVA 3LCMA 3NLLA 4RK1A 4Z99A 1JV2B 3UZUA 4A0HA 2DPXA 4GOJA 1ZH8A 3LUFA 4AF8A 1LNQA 2VP5A 1GL6A 2TECE 3ACBA 4JJ8A 3ROFA 2F8TA 4N3BA 2B4KA 5DYTA 3O03A 4YDSA 1VL8A 5B1DA 1J00A 4EI8A 3L7YA 3BXXA 4YRNA 1TRHA 1CS4C 1Y1QA 2R1TB 3N3AC 3SIWA 1SB8A 2WABA 3UT5B 3WDSA 5KC9A 2O8VA 4IOLA 4G97A 2AUTA 5CAEB 2JFHA 1TGYA 5KB3A 5AW0A 4TVOA 1R1DA 3EPRA 3G2HA 4KZKA 2XHZA 4MS1B 1YRYE 2JAHA 2H7VA 5ALUA 5JROA 1X1TA 3DUFA 3G8AA 3QXGA 4IRUB 4G2TA 2WWTA 3WLFA 1Z33A 1RJWA 1S6YA 4KLZA 1MZPA 3F46A 4O2AF 1EA7A 2BAGA 4AJJA 1TEVA 3L06A 1DJPA 2P78A 4RABA 2OXRA 5COQA 1I2BA 2QMQA 2ZJ3A 5C18A 3EB9A 1MAAA 2XJ9A 3NP9A 3WO0A 1UANA 1A3CA 1GU1A 1PFQA 4JGGA 1QK4A 3BN3A 1SD2A 4D9CA 1IUOA 4XLZA 2WP8J 3CKKA 3KYJB 3PTZA 4IIJF 4KUGA 4W6ZA 1ORWA 5B5SA 3HB1A 4N39A 4P3OA 4GIBA 3KOZA 4Z0PA 2BGJA 5EUCA 1NPYA 3IAFA 4ONEA 4Q1VA 3TQCA 4YS6A 3U7QB 3OTQA 2ADOA 2AYZA 5EUMA 3TD2A 4YUVA 4OBXA 2H7XA 4MVJD 1Z07A 5DHFA 4ZVTA 3ZBPA 2WF9A 1E1RD 3CHYA 1Z5WA 2I6UA 2BKEA 4WFQA 5D01A 4A0QA 1GGNA 1O08A 1S9HA 1SVNA 2V7XA 4IXNA 1GPJA 2TMKA 1RPAA 5K4AA 3ZDCA 1GTVA 3ONVA 2EKZA 2ASEA 5FNZA 4KACA 2WJVA 3IQIX 1IXSB 3F5DA 1N2IA 5BQ5A 3V7UA 1T1EA 2P9YA 4YJGB 1U3DA 1WO8A 2NSLA 5BORA 2IXGA 1E69A 2FPPA 4IUDS 2YZ2A 1UAYA 3EXHC 4FKBA 3V33A 2NZVG 4DTCA 4RTPA 4H31A 3PQCA 5EIEA 2YRXA 1HSOA 1N6LA 1UM9B 3ETEA 1V7ZA 2BFDA 1YHZA 3G2PA 1T2CA 5JASA 2DT5A 1JDPA 1HORA 4Y1GA 4CFYA 1Y8CA 2WE8A 3DLCA 3M0EA 1ZHOA 1YKSA 2PS9A 2BOVA 1BMQA 2YQ5A 4MYSA 1P1RA 2OHXA 1A9PA 1K0FA 2PGLA 1CEYA 1W47A 5K0BA 1I7SB 2G8NA 2NTJA 4MWSA 3FX2A 5AKLA 3N7UA 1HLDA 3WLIA 4X7MA 3FKJA 4MVJA 1J8YF 2GH1A 3O4IA 5JQGA 1X42A 3FYUA 2QAIA 4UBMA 2HXYA 5TQ2B 1BZYA 4HYYA 3TPZA 2EG9A 4EEXA 3DCNA 4M1SA 3BF8A 4PR0A 3DFKA 4FNAA 4MUKA 4PO1A 3KK0A 4A1OA 3NTLA 1NOIA 1YUBA 1X9GA 4FI3F 4RLQA 4FU0A 2QVYX 4L8GA 4UULA 4EA8A 5KBYA 4NXMB 2A5JA 4KWIA 1W4ZA 3TW6A 4BIMA 1AKEA 2W2OA 2BDUA 3FG9A 4HLQB 3EEFA 3MRSA 2FMXA 3NBAA 5KHOC 2HK9A 3GP8A 1K98A 3MCAA 2EX4A 2YXNA 5CLIA 1YT5A 3ESRA 1Z0FA 3HU5A 4W8OA 4A2QA 3BXEA 4WPGA 3FCSB 3BWBA 4X94A 2GR9A 2J0EA 1PJ3A 1U6IA 4XUGB 3R5XA 2IUUA 2ZBUA 3F3KA 1D3AA 2YV5A 4W1QA 4JLJA 1UM8A 4OKNA 1NULA 3TJZA 2KYRA 1ODLA 3V2HA 4K6OA 1UBLS 2FK8A 4OK3A 1JEYA 4ZV9A 3C2QA 4LA4A 5AVYA 2ZRLA 1SC9A 1QDEA 4ZCQA 5K09A 4J1NA 4DLKA 2I2AA 1XQYA 2ILVA 1ACMA 3E3AA 4OHCA 5CT9A 4JCCA 3URMA 2QE7A 3F97A 3DUFB 3K4QA 1VKRA 4BCDA 4DIUA 1KYZA 4G07A 4UVGA 5JDIC 3P0HA 1YFJA 1D1QA 1VGQA 5TY0A 1R0CA 1WXGA 2WHPA 3EZ6A 4R7ZA 1ZBQA 3T5CA 5K45A 3I52A 2FGKA 2PG3A 4XRRA 4BNJA 1GGHA 3DCYA 1A9QA 4P93A 3X1WA 4ATNA 4ZU3A 1JEJA 1VPEA 1IPEA 4G1VA 4BNZA 2AQIA 3UGKA 1CETA 3DTTA 1E7QA 2VT7A 2XMDA 5AJVB 3EXG2 1SM4A 3MOGA 2IEIA 4ZU6X 2O0JA 3V2GA 4PCLA 3DKIA 4PNPA 2PJUA 1FUEA 2PU5A 3SLKA 4F2DA 2IIQA 2X6TA 4JMLA 4LCBA 5H82A 4MCIA 1PR5A 2V6FA 4OMDA 2FCAA 2X1MA 4C5CA 3OZGA 2EVWX 1ZR4A 2B1JA 4OXIA 4U7WA 4DZRA 4D43A 1TAQA 1U1EA 1T8TA 2GCPA 1B14A 5K99A 2FUG6 3GGDA 4JOQA 1UKZA 4UVHA 4KXMA 3U4MA 3ESXA 5BV1A 2X76A 1UWVA 3AIOA 3MWDA 4MQBA 1XB2A 3THYA 3MQ4A 3DL2A 4I3GA 4O2BF 3V8MA 3ZZNA 4MPTA 3V8BA 5BPFA 2B4RO 3ED1A 3UC9A 1ZOIA 1T6NA 3NIGB 4O4HF 3TIIA 2ATVA 1DAHA 2Q5HA 3JR3A 3JQBC 2FPPB 2P79A 3UJHA 1I7QB 1XZIA 1ZO8A 2QD1A 3ZIDA 2OGSA 2PAFA 3GVCA 3VC2A 3W4KA 2QRUA 1HF3A 4F2GA 1Z7EA 2FSUA 3P2EA 4J0HA 2F1KA 2W7TA 3JQGA 2BFDB 4NARA 1H6AA 4JT4A 5HF6A 1J1ZA 2ONCA 3T9AA 1N32B 1MNQA 2AKAB 1HOXA 2C54A 2FHSA 3ABQB 3CB2A 4KSBA 4B3CA 1FBTA 1JJ7A 3RYIA 5F4BA 3ROKA 1CU1A 3TQTA 5FL3A 3H3JA 2EZUA 1AUXA 2YDXA 3BRCA 1W5FA 1UP4A 3HUEA 4FGSA 2HMSA 2V1XA 2YL2A 4LQ4A 4ZVNA 5P8WA 1NG9A 1E60A 1ZC3A 4HWTA 4E08A 1UBMS 2HHJA 3QJYA 1M1NA 4D46A 1OAAA 2B8NA 2C84A 4D6PA 2VQDA 4KLCA 4EY4A 1Z0ZA 3CH7A 2PXXA 5TJHA 2MMCA 2RONA 3ZY2A 5JQGB 5ERGB 4NG4A 1IBRA 1T5BA 4RQTA 2ZSAA 4I1SA 3AESA 4RZ3A 4QHTA 3AVTA 3A36A 2JIBA 3T3PB 1LV7A 4F4DA 4QBIA 1C9YA 5KPJA 3RS7A 4PTLA 3P52A 1OW3B 5BY2A 2F17A 3PQFA 1HL7A 4CQNA 3COZA 3MJHA 4H7KA 4H77A 4Z86A 5A7GA 4HX2A 3P0IA 4O1IA 3E8SA 3N39C 3FY4A 2H3HA 4OBWA 4WT7A 2AWOA 4Q24A 5K3CA 2HJGA 1M2VB 2ZVQX 5HBGA 2ZYRA 3MTEA 4D02A 2IFTA 1YI1A 4DT1A 2O5VA 2J32A 4F45A 5DPMA 1KP2A 2GOYA 4L9SA 3TSCA 2WWIA 4BV8A 1S8AA 4DMKA 1K75A 3PRKE 3NATA 4X8MA 4TRMA 3D4IA 3UPDA 1TMYA 2R8RA 3GLHA 3COWA 2C99A 4K6MA 2GWRA 2VXOA 1QFMA 4BZPA 1BS9A 2DAPA 2HMYB 2XCQA 3KELA 2XRFA 4S0XA 1AGNA 1U7ZA 2X4DA 3HCOA 3A4IA 2NTEA 3AF1A 1IZYA 2LGJA 3Q5GA 1MVLA 1SBQA 3T3IA 4C0QC 1JXOA 1QJCA 4YMLA 5KTRA 4H7DA 2IU6A 2A3RA 4DCCA 5J23A 4BN4A 3O1JC 1A8QA 2GZRA 4J7AA 4LX0A 3DEAA 3V4SA 4YAGA 3Q6IA 2H2AA 3LGSA 1T9HA 1HC7A 2QRKA 1HMPA 2OHVA 2Y1OA 1H2YA 3EGVA 1YKGA 3OZ7A 4LDPA 2NYRA 3RBXA 5CVTA 2CBGA 3NPAA 4I9HA 1FTWA 3Q5EA 1YNOA 1Y81A 3I09A 5MN5A 4BX0A 5DN6A 1MO4A 2X0EA 3ZI0A 3HFRA 5GIOE 5HJEA 4MIYA 2PZMA 3FNHA 1DRVA 3GUHA 5CDFA 1U6KA 1TD9A 4HSEA 1ZIOA 1VPDA 2XZDA 3SYKA 3UNXA 1QH8A 4K46A 1VIMA 1U5AA 1ID1A 4HDRA 3INYA 1YQXA 4LYJA 3EHDA 3K05A 4MTLA 5FWXA 3ZHUA 4DOMA 2QY9A 4MYRA 2W6JD 2CXXA 4PWYA 4AKHA 4B40A 1A7KA 1XTTA 2OO5C 4ZXFA 4YP0A 1H22A 4OU5A 2VRWA 3B7GA 3UXYA 3FSEA 3TQSA 2CDBA 3SBDA 1DPFA 2H08A 5KMGB 1QHIA 2R8OA 2W4QA 3HPRA 4QZVA 2V6GA 2ARKA 4RTOA 1SCQA 2JEYA 3QYPA 4L5AA 2WYUA 2HFKA 1CJUC 2Y0DA 5DHTA 2FPUA 4EQZA 1M5RA 1OCEA 1XRNA 4WFKA 5C8DA 3EZGA 4JQOA 1I4LD 1Z26A 5J63A 1HE8B 4D26A 1SXGA 1N7JA 3I64A 3JQGB 1JHPA 4JX9A 1TZ2A 1IOZA 3M82A 3ODGA 1OLSB 4PGGA 2Q3LA 2AC2A 5IBRA 1FDRA 5AUPB 3RYIB 5LQKA 2DSTA 3Q40A 2PD3A 3ZC3A 2NYUA 3MWFA 3G68A 2JGFA 1CUAA 1N2ZA 3MUOA 2JLXA 2D2XA 3NX4A 5EWLA 2KPOA 5SYAA 1ZK2A 4Q00A 1M1NB 4BVGA 2OCBA 2Z2KA 2RGRA 4LZNA 5EUQB 4HZIA 2IYOA 1AKUA 1LQUA 3N8DA 1W34A 3IB6A 4WOJA 2DG2A 4ALKA 1RZRD 2FFHA 3TOSA 3LQFA 2GHTA 3HUUA 3LF1A 1DHRA 1UC9A 1U99A 3F7OA 5G40A 1KI8A 2GCEA 4ZHQA 4BDSA 3HLKA 4GH5A 1THMA 5IC6A 3BD6A 1AG9A 1V25A 5H16A 1LV8A 3O9ZA 3CVVA 1ZNWA 4EEKA 1XF9A 3G5LA 1HE5A 3OCZA 5TF4A 1TB4A 4NPHA 1KR5A 4QOHA 5IJ0A 4LHEA 5F64A 3ICWA 3QU7A 3CRVA 2IXBA 2HREA 3MWKA 3M6VA 2NPIA 3UJNA 4L6AA 3WGOA 1R4NA 1QGDA 1SA0B 2XUPA 3NCTA 4MHOA 2JW5A 1U5BA 1AO3A 2ANCA 1KU0A 2PCLA 4LYGA 3O31A 2R7MA 4AD8A 2C5FA 4INJA 1MTOA 1ULBA 1K97A 5KYTA 3FN4A 1PV2A 2VC2B 4GRAA 1TQDA 2REBA 2WIFA 4QPCA 1L4UA 1QMGA 4Q6BA 2EJBA 3HWWA 4Z4HA 1P1KA 1X7WA 5IT9A 1N6RA 2VP3A 2Q5QA 3HMQA 1RZRA 1H6BA 4B81A 4GPZA 2IDZA 1QMPA 5GADl 1ADGA 2PX3A 2WJJA 2YZNA 3KT0A 1UQRA 1CXZA 4XARA 4XVRA 4EDFA 4EQ6B 3C1OA 5CM9C 3OQBA 1RKXA 2H1HA 2Y9PB 2QV7A 2ACEA 1FX0A 1NR5A 2DX7A 3O91A 3PGVA 4PHTA 2CKMA 4KR9A 1A5TA 5EE1A 1DI0A 3AUFA 3TSYA 1PV4A 3BMQA 5G0WA 2OOSA 3D3NA 3OIFA 2GD1O 1NW6A 3ZLTA 4TMVA 4QTZA 4XWOA 4A82A 1FMFA 4KVGA 5T67A 5C5IA 1R5BA 2UZ3A 4BGVA 1QP4A 3ND6A 2AQ8A 2HDHA 5JAHA 3EMBA 2IYXA 2IYVA 2K6GA 5KWEA 4P54A 2P9TA 2WRZA 3FB4A 3U49A 2HRZA 3EODA 3Q98A 3TTXA 3VHRA 2BHSA 3E23A 3IH5A 1A97A 3C3XA 3V48A 1QH8B 4F92B 4J4BA 1G55A 2P5YA 1G1MA 4KO2S 1WXDA 4V0KA 3LYUA 4HDRB 3AI7A 1YVPA 2JDID 1EKXA 3E9CA 1NI5A 3K6KA 3KE9A 3TE6A 4MKXA 3RVBA 1I01A 3NV9A 3T5MA 5K03A 3MTBA 2QG6A 1FNNA 1U2GC 2DQZA 1JTVA 3VNBA 1SU4A 4IF6A 1VPTA 3RG8A 1E9VA 1UP7A 5M29A 2P4HX 3LP5A 3WTBA 1N8NA 1C9JA 1PUIA 3I9JA 2ZTUA 4B4DA 4QQFA 1PWEA 4B4OA 5JNWA 1X39A 2CJFA 4LDZA 3KTAA 4ID3A 4A0FA 2LWIA 2P30A 4JVNA 4MITA 4D3ZA 4DLBA 5BNZA 4IV5A 4ESHA 1JKMA 1A9ZA 1JU4A 2FR1A 3OHMA 3KVYA 5JUWA 3OBBA 1MB4A 4N9WA 3HADA 3LC1O 4P0PB 4KVZA 4EOGA 1BWRA 3F4KA 2AR7A 3D6NB 4DM4A 3BL5A 4LYFA 5EWLB 4F7DA 1E2FA 1OI2A 2WD9A 3PHBE 4CI9A 3PU6A 1I3NA 5KNCD 3Q5DA 1U1FA 3NW9A 4B32A 1DS6A 1EHCA 1X92A 4IXTA 3RJ5A 3LHSA 3QUQA 5C4MA 2UVPA 2CYAA 2ZYVX 5FOQA 5JSUA 4JJKA 1UAGA 4LVNA 1FTGA 1HTTA 1DO0A 1JKIA 1KZ6A 3FKQA 3G13A 3DBHA 4PYLA 3OJCA 2H18A 1JJBA 1RRMA 3AQIA 3T06B 4BU0A 5B2FA 2DWQA 3CRMA 5CB8A 2X7JA 1IN4A 3K9HA 5FO0A 2C8JA 3QV2A 3ZGXA 2GPJA 5ALTA 4XSVA 5DO9A 5D3QA 5IJ0B 3GFQA 4FIZA 1Y8QA 3VI3B 1H66A 2Z5LA 2FG7C 2LE0A 3MHTA 3NJRA 3SBEA 1UJ4A 4GXQA 1CVRA 2I7VA 2OHJA 2Z4RA 1G8JA 2CVFA 3BF7A 5AIAA 1R4NB 1U5BB 5D1HA 1QP7A 4KBFA 4WY5A 4NNPA 3ROXA 4EMBA 5IXJA 3KZ1E 4OHZA 4M38A 2PUJA 5BW5A 3PHGA 1YZTA 3QWFA 1DDGA 5D7NA 5SICE 1SCNE 2Z5GA 4DV1B 5HFNA 4RACA 1DOZA 1R0RE 1YBAA 1XFAA 1AGRA 3GI1A 4IOKA 4R9UC 1T1RA 3SHWA 5K7SA 3LNTA 3OZAA 4QQKA 4RDIA 1ZM4A 4GT1A 3PEVA 2B21A 3PWTA 1YB2A 4D44A 5KSWB 5HZGA 1J0CA 4BX2A 3KVRA 4D9IA 1XCBA 2RI1A 1SXHA 4PGHA 3U9LA 1V37A 2LR0A 1L7XA 4B8YA 1THTA 3BMQB 4NOMA 5FV7A 10MHA 2W8ZA 2ERYA 2I6GA 4MA5A 2IZ1A 2PH1A 5DGIA 1W0KD 1BGXT 4A6PA 4C2BA 1YGPA 2UUCB 1HQKA 1N4AA 5ER6A 3L46A 3MOIA 1SRQA 3MBKA 3IOBA 3NDJA 1JF8A 2G07A 1EVLA 1HH4A 2VJKA 3A6DA 2L82A 3DEJA 4PC2A 3HTXA 4RSMA 4YVFA 1ADFA 1SUIA 1DP4A 1W4BA 1FU8A 2Q3FA 2Y1WA 3BDIA 4JNCA 1I3CA 5DIZA 4D45A 5IDYA 4D56A 5EEHA 3LT1A 2CHQA 2HHCA 4KNYA 2HW8A 4U2BA 4UDXX 3KQMA 1WM1A 1EEHA 3NKLA 5K05A 1Q7CA 4IS2A 1USIA 5AQ1A 4PM4A 5AJUA 3AFNA 1XN4A 4AK9A 1L7VC 4OJMX 1R0LA 5FUQA 1E0SA 2CL5A 3NHWA 2F9LA 2IX3A 4FYYA 5CDHA 5BWMA 4ZZ1A 1N2HA 3HCCA 1OPXA 4YJ2F 4KP7A 1WNFA 4ITVA 4AC9A 1DT5A 3CZAA 4LN1A 1FQOA 2PQ0A 1M2JA 2C97A 3RC1A 4WBXC 4B83A 1NE7A 4FS3A 2C7BA 1W52X 5BWLA 1W0KA 1EK0A 2PR2A 3GRRA 1E89A 2PXAA 2A88A 3GWGA 1GPLA 3A58B 2NUTA 3C6KA 3V8EA 1Y8RA 4GNRA 2CHEA 1X87A 3K09A 1JSRA 1KMHA 2B2NA 3KPWA 2HO4A 4IIJB 4ER6A 4QFMA 3A1NA 4QNMA 7ABPA 5K0ZA 1XL0A 1GGKA 4HWOA 2GCOA 4OIMA 3ZH9B 1PJ4A 5LQSA 3VVLA 1SUEA 4X41A 5DTEA 3E82A 3IQGX 4YRCA 4LDRA 4I4TA 3L6OO 1YIAA 2Y1FA 5TEVA 4YRMA 3AI2A 2GRUA 5JCZA 5AWFC 1IBKB 3LQYA 3CEJA 1OZ0A 5G4LA 3HP7A 2UVPB 2QTAA 3FETA 4HUTA 3B6JA 1V8OA 4H15A 1L7PA 1V9CA 4J76A 3C70A 1R9MA 4TROA 3DBHB 5TT1A 1C30B 3GRUA 3PNMA 2H2IA 2PIAA 2QAGA 3FVQA 4HNHA 4ZPJA 1RWXA 4DZZA 1DXYA 3T5GA 2NZWA 5EA2A 5EE5B 3ZDEA 2HTEA 5LQNA 1GGEA 3SXPA 2OA0A 2VZLA 2OCDA 1KA9H 3CLSC 1XRMA 1OV6A 1R6BX 1HDGO 3ONWA 4EPWA 5J4LA 3AWDA 2HF2A 4ABTA 3OCCA 4L0QA 4RLFA 1C0EA 4AMZA 1GZSA 3O82A 1CUSA 4PHFA 1ZNZA 1IJKA 4FYKA 4QNRA 4X7PA 4NPCA 2CVOA 3LUPA 2GB4A 3ABSB 3IAM1 1DLIA 3O4GA 4HXYA 4M21A 1L9KA 1NUUA 2FTKE 1BOOA 1RWWA 3NTUA 1EFVA 1G9XA 4PX3A 2MMGA 2P2YA 3ECCA 3WDLA 4BQFA 4TYPA 3N7AA 3QM1A 4OQPA 5IC4A 2UDPA 3ECAA 2CJWA 1O6BA 2VYNA 4FFDA 1W8IA 1TM1E 2HCBA 4C30A 1RWKA 5T4FA 4PIMA 5GV8A 1XU9A 3OQIA 5T5QA 3UJ7A 3DH0A 3SJBA 3EZNA 4XPZA 5F3RA 4G1UC 2J3IA 1L3CA 3NTQA 5CT8A 3V4FA 3HUDA 4JJ6A 3ILVA 1RYNA 5LMCA 3ZVKA 2ZIAA 1AQLA 1GY8A 1WJGA 1JA9A 1U0OC 1RPZA 2R84A 1Z3IX 2R6FA 4JT2A 4WXEA 3HGTA 4HJRA 1Y33E 1WBBA 4TVSA 1QO0A 1KJYA 2NT3A 3MUFA 5DNYB 5ALKA 4FUTA 1B7GO 1QJ4A 1A5ZA 1WU7A 3HZHA 3G7SA 2XCUA 4MWTA 5JISA 1JB9A 4F3YA 2B7LA 3MILA 3X1DA 2C5AA 4MNTA 4BO7A 5HW0A 2H1OA 5ICGA 3RANA 3LT5A 5IKEA 4JBHA 4M4SA 5D87A 4D4LA 4GR4A 2FZ5A 1UEJA 5BMVA 3OEWA 4RH1A 1CRZA 2Q1SA 3KETA 6LDHA 3NEYA 3IQFA 1LA2A 4JWTA 3MS4A 1CYEA 2ODQA 1I80A 1HQYE 3CZ4A 3CYFA 2YYYA 4M36A 3U2QA 3NGLA 3AYZB 2V74B 4RV4A 4C7MA 3RADC 5CLQA 4ZT4A 3F4BA 1Q1QA 3CCCA 1JDVA 1Y9DA 1Q15A 3F3SA 4RC9A 2QZ9A 4OHOA 3SICE 3S4YA 2Q3JA 5J4VA 4JEIA 5L6MB 4CLEA 3IDAA 5BRNA 4A6EA 1M7BA 4EGAA 1KEVA 2NSJA 1Y8RB 1GCUA 2XBUA 3C4VA 4TS1A 1U8FO 4FGLA 5J47A 4W7HA 1KMHB 4Q1DA 4JLKA 3KZMA 3I61A 3RO7A 3WV4A 2GCOB 3KQUA 1OHHD 1FVFA 3NS7A 1NRXA 1W88A 2P9FA 4I4TB 3W6ZA 1MV5A 2EFHB 2P91A 2PKQO 3F7MA 4O6VA 1UFVA 4JBWA 1DCMA 4D4HA 4EI2A 3SHVA 1NNEA 1BGVA 1QKIA 1YONA 3MIZA 1EPUA 3GT0A 1V8FA 4B3DA 2Q5IA 1LPBB 2EARA 1KFJB 1GKKA 3B1KA 4YRTA 2A9RA 5IDWA 2OKCA 3WL3A 1E5QA 4FYIA 4NYIQ 4GUAA 2W2QA 4UHJA 1WCXA 1ZRHA 1XRSB 3LQRA 1O6GA 3O73A 2QAGB 4HXGA 1QWSA 5BQ3A 3D8RA 2A0WA 4ILKA 1DJNA 1CQWA 1HLFA 1M2GA 1V6SA 1VCHA 3NP7A 1WHTA 2QRQA 2XLCA 3EWNA 3U7RA 3W8EA 3W8NA 3GLTA 3WHLA 4CU2A 1E3QA 4P58A 2V97A 4OYRA 4WWHA 1FUYB 3QKSA 3W2TA 1PK8A 3PE4A 1B6TA 1C3XA 1QBKC 3IUYA 3OM0A 1JKFA 3MHPA 4P4TA 1H2EA 4JXJA 3QJGA 2VXCA 2WEKA 2ZXEA 1UDCA 3AEQA 2CGEA 2QX9A 2NM0A 4WKPA 3ETLA 3THXA 5F21A 3AVYA 4UOQA 5CFQA 4MJLA 2CJWB 4QJ4A 1OTYA 2AXPA 2Q5CA 3AW9A 4DGQA 1G3QA 2GVNA 2ZAGA 3TZCA 3NORA 4AVYA 2UXBB 3T99A 2W9XA 2R5NA 3SY8A 4C0SA 3DV0B 5DTRA 3RUPA 1PF7E 3T9FA 4KHZA 3DFFA 2W42A 2VYFA 3LBHA 2RH9B 1LCIA 2JCXA 5TMEA 3LBYA 5K0TA 2H0AA 1E9EA 5AVKA 4M1ZA 4W9NA 1FQKA 1BDBA 1ML3A 2PFSA 3BJEA 4RA6B 2AR0A 2K4MA 4GMFA 4HEA6 2Z9BA 4G5FA 1O54A 4M6WA 1OPRA 3O92A 1XE3A 2PL9A 2QR3A 1WVMA 3KKLA 4IG9A 1F1BA 4A2WA 4AX8A 1F7UA 3RM3A 2O3SA 4IHAA 1IG3A 3AIKA 4AF7A 3IL2A 4EUHA 1EYZA 3VDNB 3IP1A 4PX5A 2GDJA 3H1BA 1RJEA 4R1TA 4BP3A 1BEUB 3IQWA 3W2GA 1O96A 3K2EA 2QX4A 5KVAA 4KAJA 4XB1A 3Q9NA 1ZYUA 1TEHA 2P2DA 3AVVA 4WNAA 2Z2IA 1JR3E 4W5HA 3C1AA 4AP9A 3O2SB 2QMUA 1OY1A 3OKFA 5JLAA 1OV4A 4FHDA 4D0LB 2IXTA 1XTBA 4FSHA 5LC1A 4ZOLF 2V3CC 3MB8A 4U2CA 2GAOA 2IKSA 2EJTA 2Q4DA 4TVBA 3RAEC 4JJIA 3Q2OA 1BCSB 4PQYA 2Z08A 4RDXA 4B3XA 3DL7A 2XYVA 2OCIA 4KW7A 5DHAA 3HUFA 4OHXA 5C3UA 1QVAA 1H8ED 1Q2XA 3T12A 1XWFA 4M55A 3I42A 5CLJA 4FCWA 5MDHA 4OX9Y 2IYEA 1G3IA 3NBFA 2ZBRA 2B37A 2EJCA 5HKBA 1RC1A 5ALXA 1G6OA 4TMTA 4FKZA 1I30A 3Q7TA 1GZ4A 4XLTA 3LDGA 3VR6A 1R66A 1DFGA 2BBOA 3FVVA 3P9YA 4G1BA 4PQRA 4MYTA 5G0VA 2D1YA 2ZWIA 2J0VA 3IPRA 1N2CE 1U3GA 2A0KA 3BVPA 3FLBA 5PGMA 3H6GA 4TMXA 4XFDA 2B5OA 1G64A 1ISRA 4DDKA 5KVSA 1IFXA 3KJZA 4CUZA 4DYDA 1XPOA 3LRTA 3L1UA 3U7GA 3CURA 2C2WA 3A7DA 4TL6A 4CL0A 3EGCA 1IE3A 1PL7A 1SG6A 4ZOEA 2NN3C 3G7UA 3ORFA 2HD4A 4GQAA 1XKLA 3JQ7A 2OFOA 2RI6A 2WB4A 4EP1A 1OA1A 4CR7A 1PR0A 3F6BX 5HRCA 1N6PA 3GAZA 5CJPA 5C8ZA 1MG0A 1T1JA 1WHTB 2BFBB 3ELDA 4E88A 1O03A 2XNSA 1H8EA 3G0IA 5G02A 2BZGA 3GFSA 3QXHA 4KGDA 3QKSB 1ZXXA 4R0MA 3SZRA 4ECAA 4OLAA 1Q77A 3TECE 5LZ5A 1QRSA 4G0WA 1V16A 1WEKA 3T3HA 1VG9B 2F3QA 3X2FA 2V5UA 1DNPA 1XJQA 1D5WA 3FZQA 1KSJA 1OWLA 4CMEA 1AKTA 2ZJ7A 3AEQB 1S4QA 1U8CB 4F5ZA 1E7YA 2OQ2A 1PFVA 2DR2A 3GEPA 1XD2A 4CIBA 1XMXA 2WV7A 1ISPA 5F2KA 1M8GA 2PMBA 1H1TA 3OPNA 4QODA 2J31A 3TZHA 5L40A 1E6EA 4BFTA 2GAFA 1NBWB 2I8LA 2X2OA 2ZSDA 2VTEA 3QU4A 2ECPA 1V7CA 2PPVA 2EHDA 1XYVA 2H4XA 3EX7C 1QVZA 3FSRA 3FIJA 3R09A 5KTPA 2NPOA 3WLOA 3LW7A 3L0IB 1IJEA 4QUAA 1R0WA 4CTKA 5FWNA 2ZT7A 3T1TA 3L0SA 3WJAA 4M6WB 2BHLA 4RTLA 2H9IA 5E38A 2R44A 5HKKA 4RAOA 3L8GA 2B8WA 2Y6VA 1HKUA 3SI7A 4R81A 3R3ZA 4C14A 2VPTA 3VZDA 2VDQB 4CL2A 3WA7A 2FZGA 4G8BA 5FHQA 1L8XA 1O96B 2WAYA 3HCRA 4JI8B 1CB0A 5I9LA 2PD6A 3QSYA 3AETA 2H1IA 1C7ZA 3ZVNA 3TNDA 4R1SA 1RZVA 2J0UA 1J6UA 3R24A 4QRIA 5A5VA 2OYSA 5CB4A 5D84A 2REQA 1RU3A 3B6KA 2J5BA 2UV8A 3HH8A 1KOLA 3LKBA 2P41A 2ZWAA 3Q9SA 1AUPA 4Y6OA 3TUJC 4YPOA 1KJIA 3DZ8A 4TTAA 3E5HA 3RQSA 1VSUA 1H2RS 1OREA 1QLWA 3OESA 1YVDA 4NI5A 2UUPA 5FLEX 5BR4A 2H4HA 3GHHA 4NK4A 2CF5A 5CP8A 4PHCA 5C2JB 1E1QA 1XLWA 2QQ0A 3OQ6A 2CNBA 3GFBA 5EP2A 3TQHA 2ZVJA 4PS0A 5CX1A 2HA6A 5K5EA 3FNRA 2X0KA 4YHBA 1B3RA 5KWIA 3DONA 1T24A 3QX8A 1PHRA 1BU8A 4XJVA 1XO1A 2BKUA 1IATA 5DISB 3U39A 4C7KA 3CW9A 3M2TA 3U0BA 5L7TA 3W4JA 3X0DA 2VHUA 4HGRA 4PY2A 3T1OA 2YFHA 2RG1A 3MWYW 1ST2A 1XC7A 4HLCA 4TZTA 1N2CB 3NTVA 5BN3A 1P3DA 1SKBA 2WVGA 3EG9A 2ERXA 4YWHA 5JXJA 1Z22A 3JQ7B 1D2MA 4MK4A 1GZ7A 4EHIA 1YGYA 5FYDA 3FFAA 2PSJA 2R97A 5D51S 3UHJA 1K6XA 4ZRDA 4IOJA 3TDMA 4A9AA 5EHZA 4E6EA 3A6ZA 1NQOA 1YC2A 3LE8A 3NUZA 3GZTB 3FPEA 1SVWA 3HVJA 3RHSA 4JOBA 4L8WB 1GQ2A 1JDBB 1C14A 1YUMA 1MAWA 2GTPA 3CJTA 1UBCA 4MW0A 3ZHOA 3K0FA 1E3SA 2Y4NA 1JPVA 3TZEA 2GF0A 4CZ2A 4OXKA 1V16B 4KIWA 2PT6A 4FVTA 3GU3A 4O0MA 1QH9A 4NH0A 2V98A 2H2FA 3G49A 1ATIA 5JVDA 1G5TA 1G8AA 1XD2B 4WADA 2FWNA 3PZRA 3QUCA 4OQLA 3ZKWB 4QM6A 2IPXA 1MW8X 5FI5A 4L74A 3SFZA 5LCXA 1TKCA 2HYDA 1BXZA 2D06A 4QXRA 2NUBA 5I9BA 2C2XA 2FN4A 1JTFA 4WN9A 3K20A 1K2VN 2R62A 5I9SA 4ZTZB 2UYQA 1H4VB 1BTOA 1KAGA 3USCS 1J24A 2WWWA 3M2PA 1KO5A 1ECPA 1SQFA 4KJXA 2WSYB 3HXMA 3CUKA 3ADPA 1RWBA 4LRUA 3W7BA 2DTXA 4YV7A 4NNOA 1II8B 1I4TD 1MB3A 1NQUA 1PFGA 4LY6A 1KDYA 4KYVA 4DV0B 1X1EA 1SK8A 2VNJA 2J9FA 4PNEA 1NNUA 4RY2A 3RSHA 2VNHA 4F3CA 1WG8A 3JPWA 2FZ4A 3ANSA 4Z1MD 4KQIA 2MR6A 4DA4A 3ICVA 3WP1B 1AXGA 4MUBA 1LBTA 4NCIA 5TDHA 4MJXA 5BYJA 3SIPA 3B38A 2J87A 3DNMA 4LXGA 4NJEB 3H9CA 4NRDA 3UWDA 3GRCA 1RD4A 4NBWA 2CN1A 4AUNA 2DQYA 2VQFB 5CNJA 3I92A 1NY6A 2KS6A 4QO8A 4OQ4A 1UXJA 3NNDA 3CBGA 1PSZA 2PJZA 5EVJA 3LBAA 3A0UA 1YL5A 2J0UB 3TE7A 4B6FA 1HEUA 4LYEA 3FAKA 3HJHA 4IJQA 5CB4B 1TCVA 5CDTA 5EJ7A 2REQB 3JS5A 3LKZA 4XVHA 4EG5A 5HUHA 1U7UA 4YAOA 3W5BA 3OLCX 1EU1A 4DUZB 4B3MB 1SWWA 4RVHA 2PKYX 5AT1A 1GXSA 2R8PA 1XEXA 4EG8A 3FGNA 3RU2A 4EVRA 2HJ9A 1VG8A 1MX3A 4O8CA 1KQPA 1Y80A 2BZ0A 3ZD7A 3NOXA 1QYIA 5EPEA 2PT9A 3SJAA 4AMYA 2Q1WA 3GNQA 2XA2A 1LSOA 3IKVA 1C81A 3NJ4A 1HL3A 4GGMX 1NUAA 4Z1MA 2AHOA 5CX1B 3L2OB 4H3KB 4PG5A 2Q2QA 1T4CA 3UWPA 4GQIA 3UJPA 3X1JA 2LW7A 2TMDA 3BWXA 3R8XA 4GDMA 3ETDA 2HSZA 5CJJA 1H2BA 3WISA 1GCAA 1QVRA 4KR0A 3RVNA 4YO8A 4ESVA 3EGDA 4AJ1A 4F6LA 1UMBA 1DVRA 5BN3B 4US1R 1N6KA 2YHAA 3EG9B 3JQQA 3UB4A 3WKAA 1UDAA 1U0JA 4ENUA 3E8MA 1P7WA 4ZODA 4U7FA 4Z4GA 2YZKA 4YJ2B 3WGLA 4ERXA 2XDAA 3MTGA 1YAJA 1ZU5A 4U00A 4XM1A 3FGZA 2HK6A 3D6HA 5BN4B 5C7YA 3ZYCA 1XZDA 5FPKA 5C7IO 5FOXA 3OLXA 3QMVA 4KOAA 4CM7A 3HRKA 3JALA 2H29A 4GFDA 2Q2OA 1HG0A 3UUFA 2HJSA 3ZXIA 2BTQB 3K0FB 3ZWCA 2IIBA 1C7EA 2OUIA 5CT6A 2EBWA 1VP3A 1ZINA 3SC6A 3WLQA 3HYLA 5LIRA 4OLJA 4RQBA 3GZNA 4GO1A 5IDXA 4FFWA 1ECBA 1KK3A 3ME5A 4US2R 2Q29A 4LC1A 3K0CA 3ICEA 4NICA 5B12A 1VCMA 4FZRA 3H3XA 3MEQA 4Q1FA 3TR5A 3TGWA 1PK9A 1QF6A 2C31A 2ODPA 4ND3A 2RGXA 4DARA 4ASUD 2CNKA 1Z6PA 3A4YA 4O63O 4C7OB 5E8JA 1P73A 1SXJD 3GRFA 2DUMA 2YWBA 4L75A 5ER9A 3WI7A 3VU8A 5H9VA 4C04A 3PITA 1H93A 2PBLA 5KDOA 2R2AA 3DGEC 1RZ3A 2VPWA 1A8PA 4WN9B 2I22A 1DFIA 5EIBD 3RNLA 1I7PA 2AI2A 4R8VA 3S0JA 2PO7A 1K8QA 5FJIA 2WYWA 3PVCA 5FBKA 3FOWA 5LQCA 3FNIA 2JBAA 3B36A 4ND2A 4GX2A 2AF4C 3GAFA 2O2EA 3SVLA 4LTMA 3S2SA 1DCTA 1NBOA 4E5VA 1AVTA 2QTLA 4ALNA 4OFXA 4PRLA 3T7TA 3EFHA 1PJSA 5ARDA 2XQVA 1Q0LA 2J9FB 1UQUA 2EGGA 1PJTA 3O9MA 2M1ZA 3BH0A 3HP1A 3K9QO 1H2HA 2FPRA 2QW8A 5JBQA 2HZ7A 2QY6A 2ZIWB 4Y6RA 4KPGA 3CTMA 4C1BA 3B6MA 5LN1A 4S1TA 2C88A 3A6GA 1MDFA 1NNI1 4E15A 1J90A 5IAKA 2XMGA 1PWHA 1F51E 4WL0A 3FWZA 2Z5VA 2I8CA 4OM8A 3IAS6 4QL3A 3IVMA 4ASUA 1VJ1A 2J33A 2RJNA 1H69A 3R2JA 3A3YA 4GZLA 3QIVA 1UIRA 3IFSA 1HTBA 1SXJA 2XMZA 4F11A 2SCUB 5L4LA 5JSZA 4NCBA 1P6QA 4YX9A 3B12A 3LG2A 2PM8A 2PZAA 3IEIA 1IHPA 3B78A 5KCMA 4C6SA 1EHIA 2AVDA 2IDJA 1X8XA 2NV0A 4OI1A 3HO1A 3R40A 4OHFA 2WTXA 2D4HA 1NVGA 2ZPTX 3HBAA 2IEYA 3LV8A 3ZGLA 3AP2A 5K0EA 4NHOA 4Z4FA 3H1GA 1MT0A 1GXSB 2J5QA 4PX9A 1XEXB 5AQEA 2NSDA 4RM3A 3WWZA 3T6KA 3STWA 1PJRA 1YQWA 5HF9A 4EABA 1ADJA 3K6JA 5M34A 1DIGA 1XP5A 1WIWA 5J5VA 2R5WA 4O2LA 1Q1AA 1Z06A 4ZJYA 4EHAA 2VP4A 4PYKA 4QEDA 4B4KA 3K6SA 4MGZR 3ID6C 1MCZA 1G0OA 4N7BA 4EKDA 3AUAA 4HNUA 1RRPA 1CLEA 2GJAA 2YJ6A 2X3YA 2A5GA 2I2BA 2NV2B 3IDOA 3IV6A 3K5PA 4LE2A 4UBLA 4WW0A 1QCDA 4DSZA 1U2TA 3EUWA 1LQTA 3S8EA 2Q9UA 4X84A 5ILGA 2UZIR 3IJPA 2PKQP 1EFPA 3T3NA 1N5LA 3I0NA 4U7HA 5ADUS 1A0OA 1I5RA 4G4SO 2MSDB 2C3MA 4MQ6A 1AF4A 1B8PA 4Z9AA 4ARAA 2FR8C 2VCEA 2XDQA 3VR3D 2JAOA 4CCAA 2D1FA 4RGYA 1NOJA 4QATA 4X1YA 4F3NA 3T7JA 4X00A 5DNDA 3ZK7A 2BGTA 4A6DA 3GLRA 3EYWA 3H5LA 2QG9A 4MX8A 5H02A 4Z3DA 1U0SY 2OO3A 2YFYA 1BO6A 3HO8A 3IV9A 4HB0A 5FF9A 4J4TA 5DLYA 5L3QA 1ZGBA 3TB4A 1H2ZA 2HV9A 4ZHQF 4CGZA 3VHLB 2QUZA 2GVZC 4M7WA 3DHWC 3G17A 2QI9C 2HWYA 3GZNB 3THOA 3ZCTA 2G9UA 1SHTX 1XX6A 2FRDC 2Y4OA 4URUR 4A8PA 4RHFA 4KITB 1JHQA 3HBMA 5EEGA 2Q4BA 2O2GA 1V26A 4M1QA 4O08A 3A37A 3ZGYA 1W6RA 1XEAA 3FJYA 2COEA 3DAFA 3Q7EA 2GT1A 1QGYA 4Q01A 4X5OA 1ZJWA 4FW8A 5CNKA 1F7VA 1V7QA 1P9OA 3WE7A 2PUBA 2ZRCA 1JE0A 1XU4A 1MA0A 2D59A 3H04A 4JLSA 4MUIA 1AB5A 2A2ZA 3TAHA 3KZCA 4IRXA 3E3NA 4B35A 1C3VA 1U90A 1LU9A 5DU2A 3QNMA 3K8QA 3OF3A 4BYMA 4ZMSA 3LSTA 4PYMA 5KPDA 2JZCA 1N0WA 2PSHA 4M1WA 1D2CA 1EUCA 2B7CA 2GKSA 1WZCA 1IOVA 4JVOA 4RKFA 3OX4A 1VA5A 2DH5A 2FGJA 3IV7A 4MP8A 3Q87B 2OBLA 3RTDA 4CT0A 3GBSA 4P7BA 1G4AE 1WW8A 4NS4A 4NABA 4RPCA 4AKTA 5B3KA 1BVYF 1EFCA 1YI8A 4R0VA 1GSHA 3L8MA 4YJFB 2OOKA 2DKOA 3BULA 5DYWA 4H4EA 4WY8A 1P2GA 2FAXA 1YZLA 1VCIA 4PANA 1TRKA 2FWPA 3R3YA 2B35A 3RDPA 2XOKD 2ZS9A 4GP7A 4LOAA 1KC1A 2DU8A 3SDBA 3UW3A 5DMXA 2WQ7A 1YVUA 1DKRA 1DKPA 5DWDA 1A4XA 2ZB3A 1SXJB 3IBYA 2HBRA 3AL2A 3CB4A 3ENWA 4IDAA 3FTFA 1IXZA 2VXBA 1R3DA 1XTVA 1E3EA 4HVLA 1XTJA 3LVRE 3KSDO 3AF0A 5ALGA 1UJ5A 4JXKA 5CVJA 2ZAIA 3UYKA 4FR5A 2YVUA 4A0SA 1RPNA 5FTMA 2AJTA 4YYEA 1WL8A 3NEJA 4ZVLA 2XCOA 3PXAA 1ZHFA 1FC0A 2X4IA 2FDXA 4RZUA 3RODA 1WDMA 1BCRA 1JIXA 1SBTA 1K08A 3I9MA 3ZDXB 4L4UA 4MPDA 4BNLA 1V3TA 4DE5A 1WDKA 1G8MA 2B4QA 2BFWA 2NU6A 2V58A 3ILSA 4JLNA 4R9NA 4F2HA 1OH6A 2H5JA 4RF5A 5TSDA 4MQEB 1JH8A 1V6AA 2QYOA 4EHBA 2HA2A 3P20A 3UANA 4HSGA 4HNRA 4TMKA 3LXMA 4HBZA 1QLJA 2ZQ5A 4RVSA 3C3PA 4M9SA 3AF5A 3V8VA 2W83A 3RTAA 2Y3IA 3CIFA 1PYGA 2DTDA 5JEEA 1P5FA 3N8KA 4WZZA 5DW3A 2AG0A 1Z16A 5HPYB 3PDHA 3EPPA 5DBIA 3A4MA 1E1MA 3CG0A 4UCQA 1BJKA 5DCWA 1CFZA 4H1TA 2VKTA 1PQPA 2AN9A 4KN8A 4GPEA 2CCKA 4F1KA 5JYDA 2BELA 5EKXA 3IUQA 3WRXA 3RC3A 5EWMA 3TTTA 3D6TB 2G0NA 4RSGA 4H0NA 1H4TA 2OG2A 4XDYA 5CVCA 3QMWA 3G89A 1MGOA 5IFKA 3BRSA 2XDQB 2QL6A 4CLOA 1BRTA 4M22A 4X1YB 2ASVA 1WUHS 4C6TB 5ERYA 4W5RA 4XYMA 4JLDA 1DBVO 1E1KA 3U0VA 5HKAA 4NU6A 1RXCA 1PV1A 4HDOB 1QKJA 4MAAA 1AUQA 3KQVA 3IPAA 3JYPA 3FOFC 4DM3A 4E2YA 1TFUA 3G2QA 4PZ0A 1S4MA