5EARA

Crystal structure of human wdr5 in complex with compound 9d
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
301
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLINPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription / transcription inhibitor
molecule keywords WD repeat-containing protein 5
total genus 104
structure length 301
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5earA00
4CY3A 1NEXB 4PC0A 4TZ4A 5I5JA 3PVWB 4GM8A 4ERZA 4E5ZA 4FAND 2HKRA 3F3PA 4GGCA 3GFCA 2H9PA 4JSVC 2GC4A 3I7OA 4Y5RD 3JPXA 5C9ZB 4L3HD 4GGAA 4J0WA 4J78A 3K26A 1B9YA 1SQJA 3VA6A 4PBZA 3PE7A 4JT5C 3DSMA 3CFVA 3V5WB 3C75H 3PXSD 4AEZA 3OKWA 1JMZB 4EWRA 1VYHC 4A2MA 1R5MA 2CE8A 2BBKH 1U2VC 4ZOVA 4A0BB 3I7LA 2XL2A 3W15A 3MZLA 3UVLA 1JMXB 3JZNA 5CYKA 5EALA 5FKRA 2IUPA 3SVWD 1P22A 2PM7B 4J86A 2I0RA 4JD2C 1JJUB 3NVNA 2XL3A 4U1EI 4FWWA 4FA4D 5HE3B 2P9KC 5EMJB 4LGNA 3EI4A 2PM9B 1XHMA 2CNXA 5CYKB 5EMKB 2OJYA 3I7KA 3L4MD 3DM0A 5C2WB 3EMHA 3SBRA 4CZXA 4J8BA 5TEFA 3IJ0A 3PSCB 2AQ5A 1PEVA 4J77A 5TDHB 3CIKB 2AGWA 2CN2A 3BG1A 3ULEC 4J87A 4J81A 3MKQA 1B9XA 3BWSA 2Z2PA 1U4CA 5HE1B 5FA5B 2HXCA 5TF2A 4PSXB 3I8EA 2YNPA 1GXRA 2H13A 3JB9L 1A0RB 5CXBB 3UVOA 4J79A 3AH8B 4BUJC 5KDOB 3EI1A 2PM9A 4D0KA 2IWFA 3ZWLB 4JSPC 1NR0A 4OZUA 5TEEA 4FAVD 2IURA 3KRWB 4FA9D 3SCYA 3AL8B 5AFU3 3DXMC 3EG6A 1YFQA 4N14A 4J0XA 2H3XA 3C5MA 3OKTA 5SXMA 3V7DB 5A2Qg 2QC5A 3RSEC 3AL9A 3EU7A 2HYEA 4A7JA 3IKOA 5I5IA 3J81g 3IJ1A 2MTAH 1PI6A 4X60B 2P9NC 3EI1B 4K3JB 4E5ZB 2HKMA 4O3UB 2IAAA 3DXKC 2TRCB 4A08A 4ERYA 3C99A 4XYIA 3SFZA 5EAMA 5B4WA 5I5MA 3L4OD 2UZXB 3JZHA 2OK4A 2P9PC 2OVRB 3OW8A 1N6FA 4A09B 3IIYA 3B7FA 2YNOA 3NVQA 2H68A 2B5MA 2Z2NA 3PSLA 3SLED 4L3GD 2H9LA 4K3ID 4FB1D 2UZYB 4GGDA 4JXMA 4ZOZA 4X3EA 4JSXC 4H5JA 4MK0B 3DWLC 5C2VB 4G56B 5GMKn 2YBAA 2HESX 3MKSB 3ORVD 5EAPA 2AH1A 4CZVA 4A08B 4J8GA 3N0EA 2W18A 5EMLB 3OL2B 4BL0A 1L0QA 4PSWB 4CI2A 1GP2B 4ZOYA 2J56H 1SHYB 3OKYA 3SBPA 3A0FA 2H14A 4ERQA 2H9MA 4CY2A 4X63B 4HDJA 5IJ8E 1MDAH 2OIZA 4CY5A 4CI1A 3I2NA 4GQBB 4ESGA 3MZKA 1OMWB 2PBIB 3GREA 5HQGA 4QQEA 3RMZD 4O1QD 2IUQA 2YMUA 3AFCA 4A0AB 3P4FA 3OKYB 4IMMA 2AGYA 3J80g 4J73A 1GOTB 4LG8A 4L9OA 5AJAA 3SXTD 2YB8B 3UKRC 3UR4A 3IIWA 4ES0A 3OL2A 3EI3B 3F3FA 4CZYA 5EM2A 4CI8A 2H9NA 1K8KC 3SMRA 2G99A 3KRXB 4A2LA 4PXWA 4A0AA 4XEIC 2H6KA 2AGZA 2CN3A 4GM3A 2HJBA 5JWZA 3UVKA 2I0TA 3F3GA 1TYQC 4QT8A 4CC9A 5K19A 2J57G 4JT6C 5FKSA 3ODTA 1PBYB 3UVMA 3UKUC 2I3TA 4AOWA 5EARA 3V9FA 2P9UC 2XU7A 3EI2A 3RN0D 4GM9A 4ZN4A 4J84A 5FQDA 2I3SA 5IJ7E 4BH6A 5CXCB 2CE9A 3FM0A 4QL1A 3FRXA 3RN1D 3JAMg 3BG0A 5AMSA 3K27A 1OLZA 5FLXg 1XIPA 2IUVA 4E54A 3SWSD 4QRJA 5GSAA 3I89A 5CXBA 2BCJB 3EI2B 5K1CC 3RFHA 2CO0A 2H6QA 4NSXA 2Z2OA 4KFMB 5HE0B 5FKTA 3C9CA 5GXHA 4FA1D 1SQ9A 4A0BA 2GC7A 5IGQA 2YNNA 3PXWD 3I8CA 2G9AA 4YVDA 4FHLA 5IT9g 3SBQA 4R7AB 5CXCA 4X61B 3JRPA 1S4UX 2B5NA 5THAA 4O3TB 1RI6A 2QXVA 2GNQA 3EI3A 3SJLD 4I79A 2OVPB 3UVNA 2CO0C 2B5LA 5GXIA 1N6EA 4CI3A 1JOFA 5HE2B 1QNIA 3VH0A 3HFQA 2XYIA 4U7AA 2P9SC 4CY1A 1ERJA 4Y7RA 2IWKA 3SN6B 2OVQB 3NVXA 2AGLA 3CFSB 3N0DA 3PVUB 1Q47A 4LG9A 5HYNB 1XKSA 4A11A 3MMYA 3SHFA 3EI4B 4FA5D 5EM2B 4OWRA 3AL8A 1TBGA 2EBSA 1MG2A 3I7NA 1K32A 2H47A 3JZGA 4GQ2P 3E0CA 2I0SA 4J82A 4A11B 2J55H 3U4YA 3RRMC 2OK6A 4H5IA 1GG2B 4UI9R 3MXXA 4ZOXA 2AGXA 5IC7A 1N6DA 2PM6B 3VGZA 4D6VA 3I7PA 5H17A 5H14A 1FWXA 4JSNC 2Q7QA 1MG3A 3JROA 1PGUA 2HJ4A 3EWEA 4Z8LA 2B4EA 3I7HA 3PXTD 4PNKB 5FKQA 3RFGA 4A09A 2P9LC 4IA9A 3IJCA 5IGOA 3RLMD 3OTTA 4PBYA 4GQ1A 4O9DA 2H6NA 5EMMB 4L1QD 2O9KA 4O45A 3FGBA 5FXYA 2AH0A 5H1MA 4GMBA 2P9IC 4XYHA 4GZ8A 4E54B
chains in the Genus database with same CATH superfamily
4CY3A 1NEXB 4PC0A 4TZ4A 4G1MA 3PVWB 5I5JA 4NAAA 4O02A 4GM8A 2VDRA 4ERZA 4E5ZA 4FAND 2HKRA 3F3PA 4GGCA 3GFCA 3IUQA 2H9PA 4JSVC 1C9LA 2GC4A 3EQ9A 3I7OA 4Y5RD 3JPXA 5C9ZB 4L3HD 4O2WA 4GGAA 4J0WA 4J78A 3K26A 1B9YA 1SQJA 3VA6A 4PBZA 3PE7A 4JT5C 3DSMA 3CFVA 3V5WB 3C75H 3PXSD 4AEZA 3OKWA 1JMZB 4EWRA 1VYHC 4A2MA 1UOOA 1R5MA 2CE8A 2BBKH 1M1XA 3K72A 2XZGA 1U2VC 4ZOVA 4A0BB 3I7LA 2XL2A 1JTDB 5E6SA 5FFOA 3W15A 3MZLA 3UVLA 1JMXB 3JZNA 3QI0A 5CYKA 5EALA 1GOHA 5FKRA 2IUPA 3SVWD 1P22A 2PM7B 4J86A 5E6RA 4G1EA 4BP9A 2I0RA 4JD2C 1JJUB 3NVNA 2XL3A 4U1EI 4FWWA 5M61A 4G55A 1VZ2A 4FA4D 5HE3B 2P9KC 5EMJB 1I2MB 4LGNA 3EI4A 3O4GA 4BCDA 2PM9B 1XHMA 2CNXA 5CYKB 4MMYA 5EMKB 2OJYA 3I7KA 3L4MD 3DM0A 5C2WB 2VDPA 3EMHA 3SBRA 2QR5A 4CZXA 4J8BA 5TEFA 3IJ0A 3PSCB 3ZE1A 2AQ5A 4Z7OA 1PEVA 4J77A 5TDHB 3CIKB 2AGWA 2CN2A 3BG1A 3ULEC 4J87A 4J81A 3V4VA 3MKQA 1B9XA 3BWSA 2Z2PA 1U4CA 5HE1B 5FA5B 2HXCA 3O4IA 2VZ1A 5TF2A 4PSXB 3I8EA 4NENA 2YNPA 1GXRA 2H13A 2QZPA 3JB9L 1A0RB 5CXBB 3UVOA 4J79A 3T3MA 3KCIA 2HU7A 2VC2A 3AH8B 4BUJC 5KDOB 3EI1A 2PM9A 3ZDZA 4D0KA 4DNUA 2IWFA 3O4JA 3ZWLB 4JSPC 1NR0A 4OZUA 5TEEA 4FAVD 2IURA 3KRWB 4FA9D 3SCYA 3AL8B 5AFU3 3DXMC 3EG6A 1YFQA 4N14A 4J0XA 2H3XA 1UOPA 3C5MA 3ZE0A 3OKTA 5SXMA 4UM9A 3V7DB 5A2Qg 2QC5A 1VE6A 3RSEC 3AL9A 3EU7A 4QAMA 2HYEA 4A7JA 3IKOA 2JKXA 1E5TA 4AMZA 5I5IA 3J81g 4WK2A 4NC4A 3IJ1A 2MTAH 1PI6A 4X60B 1O6GA 3K6SA 2P9NC 3EI1B 4K3JB 3IVMA 4DNWA 4E5ZB 2HKMA 4O3UB 2IAAA 3DXKC 3OF7A 3VI4A 2TRCB 4A08A 4AN1A 2VZ3A 4ERYA 3C99A 4XYIA 3SFZA 5EAMA 5B4WA 1U8CA 5I5MA 3L4OD 2UZXB 3JZHA 2OK4A 2P9PC 2OVRB 3OW8A 1JV2A 1BPOA 1N6FA 2VDNA 3IIYA 3B7FA 2YNOA 3NVQA 4A09B 2H68A 2B5MA 4BP8A 2Z2NA 3PSLA 2HU8A 3SLED 4L3GD 2H9LA 4K3ID 4FB1D 2UZYB 4IRZA 4GGDA 4JXMA 4ZOZA 5E6UA 4X3EA 4JSXC 4H5JA 4MK0B 3DWLC 5C2VB 4G56B 5GMKn 2YBAA 2HESX 3MKSB 3O4HA 3ORVD 5EAPA 2AH1A 4CZVA 4A08B 4J8GA 3N0EA 2W18A 5EMLB 3OL2B 4BL0A 5M5UA 1L0QA 4PSWB 4MMZA 3IUJA 4CI2A 1GP2B 4ZOYA 2J56H 1SHYB 3OKYA 3SBPA 3IURA 3A0FA 2H14A 4ERQA 2H9MA 4CY2A 4X63B 4HDJA 5IJ8E 1MDAH 2OIZA 4CY5A 4CI1A 3I2NA 4GQBB 4ESGA 3MZKA 4WK0A 1OMWB 2PBIB 4BCCA 3GREA 5HQGA 4QQEA 3RMZD 4O1QD 2IUQA 2YMUA 3ZDXA 3AFCA 4A0AB 3P4FA 3OKYB 4IMMA 2AGYA 3J80g 4J73A 1GOTB 5M5TA 3FCSA 4L9OA 4LG8A 5AJAA 2YB8B 3SXTD 3UR4A 3IIWA 3UKRC 4ES0A 3OL2A 3EI3B 3F3FA 4CZYA 5EM2A 4CI8A 2H9NA 1K8KC 3SMRA 2G99A 3KRXB 3QHYB 4A2LA 4PXWA 3DDUA 4A0AA 4JHNA 4XEIC 2VDQA 2AGZA 2H6KA 2CN3A 4GM3A 1L5GA 2HJBA 5JWZA 3UVKA 2VDKA 2I0TA 3F3GA 1TYQC 4QT8A 4Z7QA 4CC9A 5K19A 2J57G 4JT6C 5FKSA 3IUMA 1E8MA 3ODTA 1PBYB 3UVMA 3UKUC 2I3TA 3ZE2A 4AOWA 5EARA 1TYEA 3V9FA 2P9UC 2XU7A 3EI2A 1H2WA 3RN0D 5FFGA 3NIGA 4GM9A 4ZN4A 4J84A 4WJKA 5FQDA 1UTCA 2EIBA 2I3SA 4D9SA 3MUOA 4WK4A 5IJ7E 4BH6A 5CXCB 2CE9A 3FM0A 4QL1A 3FRXA 3RN1D 3JAMg 3BG0A 5AMSA 1O6FA 3K27A 1OLZA 5FLXg 1XIPA 2IUVA 2VDLA 4E54A 3SWSD 4QRJA 5GSAA 3I89A 4JHPC 5CXBA 2BCJB 3EI2B 5K1CC 1VZ3A 3RFHA 2CO0A 2H6QA 4NSXA 2Z2OA 4KFMB 5HE0B 5FKTA 4AX4A 3C9CA 5GXHA 2BKLA 4FA1D 3FCUA 1SQ9A 4A0BA 3VI3A 3MVDK 2GC7A 2VDOA 1GOGA 4RE5A 5IGQA 2YNNA 3PXWD 3I8CA 2G9AA 4AMYA 4YVDA 3IUNA 4FHLA 5IT9g 1GOFA 2EIDA 3SBQA 4R7AB 5CXCA 4X61B 3JRPA 1S4UX 2B5NA 1C9IA 5THAA 1H2XA 1E8NA 4O3TB 1RI6A 5C92A 3NIDA 2QXVA 4L1MA 2GNQA 3EI3A 3SJLD 4I79A 3ZDYA 2OVPB 3UVNA 2CO0C 2B5LA 5GXIA 1N6EA 3IJEA 4CI3A 4RE6A 1JOFA 3V4PA 5HE2B 1QNIA 3VH0A 1QFSA 3HFQA 2XYIA 4U7AA 2P9SC 1QFMA 4CY1A 1ERJA 4Y7RA 2IWKA 2HU5A 3SN6B 1K3IA 3NVXA 2AGLA 3CFSB 2OVQB 3N0DA 4UM8A 3PVUB 1Q47A 5M5RA 4LG9A 5HYNB 1XKSA 4A11A 2XE4A 3MMYA 3SHFA 3EI4B 4FA5D 5EM2B 3MUNA 4OWRA 3AL8A 5M5SA 1TBGA 3GC3B 2EBSA 1MG2A 3I7NA 1K32A 2H47A 3JZGA 4GQ2P 3EQ8A 3E0CA 2I0SA 4MMXA 4J82A 4A11B 2J55H 3U4YA 2EICA 3RRMC 2OK6A 4H5IA 1GG2B 3IULA 4UI9R 3MXXA 1YR2A 2WQ8A 4ZOXA 2AGXA 1H2YA 5IC7A 2EIEA 1N6DA 2PM6B 5M5VA 3VGZA 4D6VA 3I7PA 5H17A 5H14A 1FWXA 4JSNC 2Q7QA 1A12A 3K71A 1MG3A 3JROA 4AN0A 1PGUA 2HJ4A 2VDMA 2XDWA 3EWEA 4Z8LA 4Z7NA 1UOQA 1VE7A 1T2XA 2B4EA 3I7HA 3PXTD 4DNVA 4PNKB 3NIFA 3EQ7A 5FKQA 3RFGA 5C86A 4A09A 2P9LC 3T3PA 4BCBA 4IA9A 3IJCA 5IGOA 3RLMD 3OTTA 4PBYA 4GQ1A 4O9DA 2H6NA 5EMMB 4L1QD 2O9KA 3GD1I 4O45A 3FGBA 5FXYA 1H2ZA 2AH0A 5H1MA 4NBMA 4GMBA 5HDBA 2P9IC 4XYHA 4GZ8A 4E54B
chains in the Genus database with same CATH topology
4CY3A 1NEXB 4PC0A 4TZ4A 5I5JA 3PVWB 4GM8A 4ERZA 4E5ZA 4FAND 2HKRA 3F3PA 4GGCA 3GFCA 2H9PA 4JSVC 2GC4A 3I7OA 4Y5RD 3JPXA 5C9ZB 4L3HD 4GGAA 4J0WA 4J78A 3K26A 1B9YA 1SQJA 3VA6A 4PBZA 3PE7A 4JT5C 3DSMA 3CFVA 3V5WB 3C75H 3PXSD 4AEZA 3OKWA 1JMZB 4EWRA 1VYHC 4A2MA 1R5MA 2CE8A 2BBKH 1U2VC 4ZOVA 4A0BB 3I7LA 2XL2A 3W15A 3MZLA 3UVLA 1JMXB 3JZNA 5CYKA 5EALA 5FKRA 2IUPA 3SVWD 1P22A 2PM7B 4J86A 2I0RA 4JD2C 1JJUB 3NVNA 2XL3A 4U1EI 4FWWA 4FA4D 5HE3B 2P9KC 5EMJB 4LGNA 3EI4A 2PM9B 1XHMA 2CNXA 5CYKB 5EMKB 2OJYA 3I7KA 3L4MD 3DM0A 5C2WB 3EMHA 3SBRA 4CZXA 4J8BA 5TEFA 3IJ0A 3PSCB 2AQ5A 1PEVA 4J77A 5TDHB 3CIKB 2AGWA 2CN2A 3BG1A 3ULEC 4J87A 4J81A 3MKQA 1B9XA 3BWSA 2Z2PA 1U4CA 5HE1B 5FA5B 2HXCA 5TF2A 4PSXB 3I8EA 2YNPA 1GXRA 2H13A 3JB9L 1A0RB 5CXBB 3UVOA 4J79A 3AH8B 4BUJC 5KDOB 3EI1A 2PM9A 4D0KA 2IWFA 3ZWLB 4JSPC 1NR0A 4OZUA 5TEEA 4FAVD 2IURA 3KRWB 4FA9D 3SCYA 3AL8B 5AFU3 3DXMC 3EG6A 1YFQA 4N14A 4J0XA 2H3XA 3C5MA 3OKTA 5SXMA 3V7DB 5A2Qg 2QC5A 3RSEC 3AL9A 3EU7A 2HYEA 4A7JA 3IKOA 5I5IA 3J81g 3IJ1A 2MTAH 1PI6A 4X60B 2P9NC 3EI1B 4K3JB 4E5ZB 2HKMA 4O3UB 2IAAA 3DXKC 2TRCB 4A08A 4ERYA 3C99A 4XYIA 3SFZA 5EAMA 5B4WA 5I5MA 3L4OD 2UZXB 3JZHA 2OK4A 2P9PC 2OVRB 3OW8A 1N6FA 4A09B 3IIYA 3B7FA 2YNOA 3NVQA 2H68A 2B5MA 2Z2NA 3PSLA 3SLED 4L3GD 2H9LA 4K3ID 4FB1D 2UZYB 4GGDA 4JXMA 4ZOZA 4X3EA 4JSXC 4H5JA 4MK0B 3DWLC 5C2VB 4G56B 5GMKn 2YBAA 2HESX 3MKSB 3ORVD 5EAPA 2AH1A 4CZVA 4A08B 4J8GA 3N0EA 2W18A 5EMLB 3OL2B 4BL0A 1L0QA 4PSWB 4CI2A 1GP2B 4ZOYA 2J56H 1SHYB 3OKYA 3SBPA 3A0FA 2H14A 4ERQA 2H9MA 4CY2A 4X63B 4HDJA 5IJ8E 1MDAH 2OIZA 4CY5A 4CI1A 3I2NA 4GQBB 4ESGA 3MZKA 1OMWB 2PBIB 3GREA 5HQGA 4QQEA 3RMZD 4O1QD 2IUQA 2YMUA 3AFCA 4A0AB 3P4FA 3OKYB 4IMMA 2AGYA 3J80g 4J73A 1GOTB 4LG8A 4L9OA 5AJAA 3SXTD 2YB8B 3UKRC 3UR4A 3IIWA 4ES0A 3OL2A 3EI3B 3F3FA 4CZYA 5EM2A 4CI8A 2H9NA 1K8KC 3SMRA 2G99A 3KRXB 4A2LA 4PXWA 4A0AA 4XEIC 2H6KA 2AGZA 2CN3A 4GM3A 2HJBA 5JWZA 3UVKA 2I0TA 3F3GA 1TYQC 4QT8A 4CC9A 5K19A 2J57G 4JT6C 5FKSA 3ODTA 1PBYB 3UVMA 3UKUC 2I3TA 4AOWA 5EARA 3V9FA 2P9UC 2XU7A 3EI2A 3RN0D 4GM9A 4ZN4A 4J84A 5FQDA 2I3SA 5IJ7E 4BH6A 5CXCB 2CE9A 3FM0A 4QL1A 3FRXA 3RN1D 3JAMg 3BG0A 5AMSA 3K27A 1OLZA 5FLXg 1XIPA 2IUVA 4E54A 3SWSD 4QRJA 5GSAA 3I89A 5CXBA 2BCJB 3EI2B 5K1CC 3RFHA 2CO0A 2H6QA 4NSXA 2Z2OA 4KFMB 5HE0B 5FKTA 3C9CA 5GXHA 4FA1D 1SQ9A 4A0BA 2GC7A 5IGQA 2YNNA 3PXWD 3I8CA 2G9AA 4YVDA 4FHLA 5IT9g 3SBQA 4R7AB 5CXCA 4X61B 3JRPA 1S4UX 2B5NA 5THAA 4O3TB 1RI6A 2QXVA 2GNQA 3EI3A 3SJLD 4I79A 2OVPB 3UVNA 2CO0C 2B5LA 5GXIA 1N6EA 4CI3A 1JOFA 5HE2B 1QNIA 3VH0A 3HFQA 2XYIA 4U7AA 2P9SC 4CY1A 1ERJA 4Y7RA 2IWKA 3SN6B 2OVQB 3NVXA 2AGLA 3CFSB 3N0DA 3PVUB 1Q47A 4LG9A 5HYNB 1XKSA 4A11A 3MMYA 3SHFA 3EI4B 4FA5D 5EM2B 4OWRA 3AL8A 1TBGA 2EBSA 1MG2A 3I7NA 1K32A 2H47A 3JZGA 4GQ2P 3E0CA 2I0SA 4J82A 4A11B 2J55H 3U4YA 3RRMC 2OK6A 4H5IA 1GG2B 4UI9R 3MXXA 4ZOXA 2AGXA 5IC7A 1N6DA 2PM6B 3VGZA 4D6VA 3I7PA 5H17A 5H14A 1FWXA 4JSNC 2Q7QA 1MG3A 3JROA 1PGUA 2HJ4A 3EWEA 4Z8LA 2B4EA 3I7HA 3PXTD 4PNKB 5FKQA 3RFGA 4A09A 2P9LC 4IA9A 3IJCA 5IGOA 3RLMD 3OTTA 4PBYA 4GQ1A 4O9DA 2H6NA 5EMMB 4L1QD 2O9KA 4O45A 3FGBA 5FXYA 2AH0A 5H1MA 4GMBA 2P9IC 4XYHA 4GZ8A 4E54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CY3 A;  1NEX B;  4PC0 A;  4TZ4 A;  5I5J A;  3PVW B;  4GM8 A;  4ERZ A;  4E5Z A;  4FAN D;  2HKR A;  3F3P A;  4GGC A;  3GFC A;  2H9P A;  4JSV C;  2GC4 A;  3I7O A;  4Y5R D;  3JPX A;  5C9Z B;  4L3H D;  4GGA A;  4J0W A;  4J78 A;  3K26 A;  1B9Y A;  1SQJ A;  3VA6 A;  4PBZ A;  3PE7 A;  4JT5 C;  3DSM A;  3CFV A;  3V5W B;  3C75 H;  3PXS D;  4AEZ A;  3OKW A;  1JMZ B;  4EWR A;  1VYH C;  4A2M A;  1R5M A;  2CE8 A;  2BBK H;  1U2V C;  4ZOV A;  4A0B B;  3I7L A;  2XL2 A;  3W15 A;  3MZL A;  3UVL A;  1JMX B;  3JZN A;  5CYK A;  5EAL A;  5FKR A;  2IUP A;  3SVW D;  1P22 A;  2PM7 B;  4J86 A;  2I0R A;  4JD2 C;  1JJU B;  3NVN A;  2XL3 A;  4U1E I;  4FWW A;  4FA4 D;  5HE3 B;  2P9K C;  5EMJ B;  4LGN A;  3EI4 A;  2PM9 B;  1XHM A;  2CNX A;  5CYK B;  5EMK B;  2OJY A;  3I7K A;  3L4M D;  3DM0 A;  5C2W B;  3EMH A;  3SBR A;  4CZX A;  4J8B A;  5TEF A;  3IJ0 A;  3PSC B;  2AQ5 A;  1PEV A;  4J77 A;  5TDH B;  3CIK B;  2AGW A;  2CN2 A;  3BG1 A;  3ULE C;  4J87 A;  4J81 A;  3MKQ A;  1B9X A;  3BWS A;  2Z2P A;  1U4C A;  5HE1 B;  5FA5 B;  2HXC A;  5TF2 A;  4PSX B;  3I8E A;  2YNP A;  1GXR A;  2H13 A;  3JB9 L;  1A0R B;  5CXB B;  3UVO A;  4J79 A;  3AH8 B;  4BUJ C;  5KDO B;  3EI1 A;  2PM9 A;  4D0K A;  2IWF A;  3ZWL B;  4JSP C;  1NR0 A;  4OZU A;  5TEE A;  4FAV D;  2IUR A;  3KRW B;  4FA9 D;  3SCY A;  3AL8 B;  5AFU 3;  3DXM C;  3EG6 A;  1YFQ A;  4N14 A;  4J0X A;  2H3X A;  3C5M A;  3OKT A;  5SXM A;  3V7D B;  5A2Q g;  2QC5 A;  3RSE C;  3AL9 A;  3EU7 A;  2HYE A;  4A7J A;  3IKO A;  5I5I A;  3J81 g;  3IJ1 A;  2MTA H;  1PI6 A;  4X60 B;  2P9N C;  3EI1 B;  4K3J B;  4E5Z B;  2HKM A;  4O3U B;  2IAA A;  3DXK C;  2TRC B;  4A08 A;  4ERY A;  3C99 A;  4XYI A;  3SFZ A;  5EAM A;  5B4W A;  5I5M A;  3L4O D;  2UZX B;  3JZH A;  2OK4 A;  2P9P C;  2OVR B;  3OW8 A;  1N6F A;  4A09 B;  3IIY A;  3B7F A;  2YNO A;  3NVQ A;  2H68 A;  2B5M A;  2Z2N A;  3PSL A;  3SLE D;  4L3G D;  2H9L A;  4K3I D;  4FB1 D;  2UZY B;  4GGD A;  4JXM A;  4ZOZ A;  4X3E A;  4JSX C;  4H5J A;  4MK0 B;  3DWL C;  5C2V B;  4G56 B;  5GMK n;  2YBA A;  2HES X;  3MKS B;  3ORV D;  5EAP A;  2AH1 A;  4CZV A;  4A08 B;  4J8G A;  3N0E A;  2W18 A;  5EML B;  3OL2 B;  4BL0 A;  1L0Q A;  4PSW B;  4CI2 A;  1GP2 B;  4ZOY A;  2J56 H;  1SHY B;  3OKY A;  3SBP A;  3A0F A;  2H14 A;  4ERQ A;  2H9M A;  4CY2 A;  4X63 B;  4HDJ A;  5IJ8 E;  1MDA H;  2OIZ A;  4CY5 A;  4CI1 A;  3I2N A;  4GQB B;  4ESG A;  3MZK A;  1OMW B;  2PBI B;  3GRE A;  5HQG A;  4QQE A;  3RMZ D;  4O1Q D;  2IUQ A;  2YMU A;  3AFC A;  4A0A B;  3P4F A;  3OKY B;  4IMM A;  2AGY A;  3J80 g;  4J73 A;  1GOT B;  4LG8 A;  4L9O A;  5AJA A;  3SXT D;  2YB8 B;  3UKR C;  3UR4 A;  3IIW A;  4ES0 A;  3OL2 A;  3EI3 B;  3F3F A;  4CZY A;  5EM2 A;  4CI8 A;  2H9N A;  1K8K C;  3SMR A;  2G99 A;  3KRX B;  4A2L A;  4PXW A;  4A0A A;  4XEI C;  2H6K A;  2AGZ A;  2CN3 A;  4GM3 A;  2HJB A;  5JWZ A;  3UVK A;  2I0T A;  3F3G A;  1TYQ C;  4QT8 A;  4CC9 A;  5K19 A;  2J57 G;  4JT6 C;  5FKS A;  3ODT A;  1PBY B;  3UVM A;  3UKU C;  2I3T A;  4AOW A;  5EAR A;  3V9F A;  2P9U C;  2XU7 A;  3EI2 A;  3RN0 D;  4GM9 A;  4ZN4 A;  4J84 A;  5FQD A;  2I3S A;  5IJ7 E;  4BH6 A;  5CXC B;  2CE9 A;  3FM0 A;  4QL1 A;  3FRX A;  3RN1 D;  3JAM g;  3BG0 A;  5AMS A;  3K27 A;  1OLZ A;  5FLX g;  1XIP A;  2IUV A;  4E54 A;  3SWS D;  4QRJ A;  5GSA A;  3I89 A;  5CXB A;  2BCJ B;  3EI2 B;  5K1C C;  3RFH A;  2CO0 A;  2H6Q A;  4NSX A;  2Z2O A;  4KFM B;  5HE0 B;  5FKT A;  3C9C A;  5GXH A;  4FA1 D;  1SQ9 A;  4A0B A;  2GC7 A;  5IGQ A;  2YNN A;  3PXW D;  3I8C A;  2G9A A;  4YVD A;  4FHL A;  5IT9 g;  3SBQ A;  4R7A B;  5CXC A;  4X61 B;  3JRP A;  1S4U X;  2B5N A;  5THA A;  4O3T B;  1RI6 A;  2QXV A;  2GNQ A;  3EI3 A;  3SJL D;  4I79 A;  2OVP B;  3UVN A;  2CO0 C;  2B5L A;  5GXI A;  1N6E A;  4CI3 A;  1JOF A;  5HE2 B;  1QNI A;  3VH0 A;  3HFQ A;  2XYI A;  4U7A A;  2P9S C;  4CY1 A;  1ERJ A;  4Y7R A;  2IWK A;  3SN6 B;  2OVQ B;  3NVX A;  2AGL A;  3CFS B;  3N0D A;  3PVU B;  1Q47 A;  4LG9 A;  5HYN B;  1XKS A;  4A11 A;  3MMY A;  3SHF A;  3EI4 B;  4FA5 D;  5EM2 B;  4OWR A;  3AL8 A;  1TBG A;  2EBS A;  1MG2 A;  3I7N A;  1K32 A;  2H47 A;  3JZG A;  4GQ2 P;  3E0C A;  2I0S A;  4J82 A;  4A11 B;  2J55 H;  3U4Y A;  3RRM C;  2OK6 A;  4H5I A;  1GG2 B;  4UI9 R;  3MXX A;  4ZOX A;  2AGX A;  5IC7 A;  1N6D A;  2PM6 B;  3VGZ A;  4D6V A;  3I7P A;  5H17 A;  5H14 A;  1FWX A;  4JSN C;  2Q7Q A;  1MG3 A;  3JRO A;  1PGU A;  2HJ4 A;  3EWE A;  4Z8L A;  2B4E A;  3I7H A;  3PXT D;  4PNK B;  5FKQ A;  3RFG A;  4A09 A;  2P9L C;  4IA9 A;  3IJC A;  5IGO A;  3RLM D;  3OTT A;  4PBY A;  4GQ1 A;  4O9D A;  2H6N A;  5EMM B;  4L1Q D;  2O9K A;  4O45 A;  3FGB A;  5FXY A;  2AH0 A;  5H1M A;  4GMB A;  2P9I C;  4XYH A;  4GZ8 A;  4E54 B; 
#chains in the Genus database with same CATH topology
 4CY3 A;  1NEX B;  4PC0 A;  4TZ4 A;  4G1M A;  3PVW B;  5I5J A;  4NAA A;  4O02 A;  4GM8 A;  2VDR A;  4ERZ A;  4E5Z A;  4FAN D;  2HKR A;  3F3P A;  4GGC A;  3GFC A;  3IUQ A;  2H9P A;  4JSV C;  1C9L A;  2GC4 A;  3EQ9 A;  3I7O A;  4Y5R D;  3JPX A;  5C9Z B;  4L3H D;  4O2W A;  4GGA A;  4J0W A;  4J78 A;  3K26 A;  1B9Y A;  1SQJ A;  3VA6 A;  4PBZ A;  3PE7 A;  4JT5 C;  3DSM A;  3CFV A;  3V5W B;  3C75 H;  3PXS D;  4AEZ A;  3OKW A;  1JMZ B;  4EWR A;  1VYH C;  4A2M A;  1UOO A;  1R5M A;  2CE8 A;  2BBK H;  1M1X A;  3K72 A;  2XZG A;  1U2V C;  4ZOV A;  4A0B B;  3I7L A;  2XL2 A;  1JTD B;  5E6S A;  5FFO A;  3W15 A;  3MZL A;  3UVL A;  1JMX B;  3JZN A;  3QI0 A;  5CYK A;  5EAL A;  1GOH A;  5FKR A;  2IUP A;  3SVW D;  1P22 A;  2PM7 B;  4J86 A;  5E6R A;  4G1E A;  4BP9 A;  2I0R A;  4JD2 C;  1JJU B;  3NVN A;  2XL3 A;  4U1E I;  4FWW A;  5M61 A;  4G55 A;  1VZ2 A;  4FA4 D;  5HE3 B;  2P9K C;  5EMJ B;  1I2M B;  4LGN A;  3EI4 A;  3O4G A;  4BCD A;  2PM9 B;  1XHM A;  2CNX A;  5CYK B;  4MMY A;  5EMK B;  2OJY A;  3I7K A;  3L4M D;  3DM0 A;  5C2W B;  2VDP A;  3EMH A;  3SBR A;  2QR5 A;  4CZX A;  4J8B A;  5TEF A;  3IJ0 A;  3PSC B;  3ZE1 A;  2AQ5 A;  4Z7O A;  1PEV A;  4J77 A;  5TDH B;  3CIK B;  2AGW A;  2CN2 A;  3BG1 A;  3ULE C;  4J87 A;  4J81 A;  3V4V A;  3MKQ A;  1B9X A;  3BWS A;  2Z2P A;  1U4C A;  5HE1 B;  5FA5 B;  2HXC A;  3O4I A;  2VZ1 A;  5TF2 A;  4PSX B;  3I8E A;  4NEN A;  2YNP A;  1GXR A;  2H13 A;  2QZP A;  3JB9 L;  1A0R B;  5CXB B;  3UVO A;  4J79 A;  3T3M A;  3KCI A;  2HU7 A;  2VC2 A;  3AH8 B;  4BUJ C;  5KDO B;  3EI1 A;  2PM9 A;  3ZDZ A;  4D0K A;  4DNU A;  2IWF A;  3O4J A;  3ZWL B;  4JSP C;  1NR0 A;  4OZU A;  5TEE A;  4FAV D;  2IUR A;  3KRW B;  4FA9 D;  3SCY A;  3AL8 B;  5AFU 3;  3DXM C;  3EG6 A;  1YFQ A;  4N14 A;  4J0X A;  2H3X A;  1UOP A;  3C5M A;  3ZE0 A;  3OKT A;  5SXM A;  4UM9 A;  3V7D B;  5A2Q g;  2QC5 A;  1VE6 A;  3RSE C;  3AL9 A;  3EU7 A;  4QAM A;  2HYE A;  4A7J A;  3IKO A;  2JKX A;  1E5T A;  4AMZ A;  5I5I A;  3J81 g;  4WK2 A;  4NC4 A;  3IJ1 A;  2MTA H;  1PI6 A;  4X60 B;  1O6G A;  3K6S A;  2P9N C;  3EI1 B;  4K3J B;  3IVM A;  4DNW A;  4E5Z B;  2HKM A;  4O3U B;  2IAA A;  3DXK C;  3OF7 A;  3VI4 A;  2TRC B;  4A08 A;  4AN1 A;  2VZ3 A;  4ERY A;  3C99 A;  4XYI A;  3SFZ A;  5EAM A;  5B4W A;  1U8C A;  5I5M A;  3L4O D;  2UZX B;  3JZH A;  2OK4 A;  2P9P C;  2OVR B;  3OW8 A;  1JV2 A;  1BPO A;  1N6F A;  2VDN A;  3IIY A;  3B7F A;  2YNO A;  3NVQ A;  4A09 B;  2H68 A;  2B5M A;  4BP8 A;  2Z2N A;  3PSL A;  2HU8 A;  3SLE D;  4L3G D;  2H9L A;  4K3I D;  4FB1 D;  2UZY B;  4IRZ A;  4GGD A;  4JXM A;  4ZOZ A;  5E6U A;  4X3E A;  4JSX C;  4H5J A;  4MK0 B;  3DWL C;  5C2V B;  4G56 B;  5GMK n;  2YBA A;  2HES X;  3MKS B;  3O4H A;  3ORV D;  5EAP A;  2AH1 A;  4CZV A;  4A08 B;  4J8G A;  3N0E A;  2W18 A;  5EML B;  3OL2 B;  4BL0 A;  5M5U A;  1L0Q A;  4PSW B;  4MMZ A;  3IUJ A;  4CI2 A;  1GP2 B;  4ZOY A;  2J56 H;  1SHY B;  3OKY A;  3SBP A;  3IUR A;  3A0F A;  2H14 A;  4ERQ A;  2H9M A;  4CY2 A;  4X63 B;  4HDJ A;  5IJ8 E;  1MDA H;  2OIZ A;  4CY5 A;  4CI1 A;  3I2N A;  4GQB B;  4ESG A;  3MZK A;  4WK0 A;  1OMW B;  2PBI B;  4BCC A;  3GRE A;  5HQG A;  4QQE A;  3RMZ D;  4O1Q D;  2IUQ A;  2YMU A;  3ZDX A;  3AFC A;  4A0A B;  3P4F A;  3OKY B;  4IMM A;  2AGY A;  3J80 g;  4J73 A;  1GOT B;  5M5T A;  3FCS A;  4L9O A;  4LG8 A;  5AJA A;  2YB8 B;  3SXT D;  3UR4 A;  3IIW A;  3UKR C;  4ES0 A;  3OL2 A;  3EI3 B;  3F3F A;  4CZY A;  5EM2 A;  4CI8 A;  2H9N A;  1K8K C;  3SMR A;  2G99 A;  3KRX B;  3QHY B;  4A2L A;  4PXW A;  3DDU A;  4A0A A;  4JHN A;  4XEI C;  2VDQ A;  2AGZ A;  2H6K A;  2CN3 A;  4GM3 A;  1L5G A;  2HJB A;  5JWZ A;  3UVK A;  2VDK A;  2I0T A;  3F3G A;  1TYQ C;  4QT8 A;  4Z7Q A;  4CC9 A;  5K19 A;  2J57 G;  4JT6 C;  5FKS A;  3IUM A;  1E8M A;  3ODT A;  1PBY B;  3UVM A;  3UKU C;  2I3T A;  3ZE2 A;  4AOW A;  5EAR A;  1TYE A;  3V9F A;  2P9U C;  2XU7 A;  3EI2 A;  1H2W A;  3RN0 D;  5FFG A;  3NIG A;  4GM9 A;  4ZN4 A;  4J84 A;  4WJK A;  5FQD A;  1UTC A;  2EIB A;  2I3S A;  4D9S A;  3MUO A;  4WK4 A;  5IJ7 E;  4BH6 A;  5CXC B;  2CE9 A;  3FM0 A;  4QL1 A;  3FRX A;  3RN1 D;  3JAM g;  3BG0 A;  5AMS A;  1O6F A;  3K27 A;  1OLZ A;  5FLX g;  1XIP A;  2IUV A;  2VDL A;  4E54 A;  3SWS D;  4QRJ A;  5GSA A;  3I89 A;  4JHP C;  5CXB A;  2BCJ B;  3EI2 B;  5K1C C;  1VZ3 A;  3RFH A;  2CO0 A;  2H6Q A;  4NSX A;  2Z2O A;  4KFM B;  5HE0 B;  5FKT A;  4AX4 A;  3C9C A;  5GXH A;  2BKL A;  4FA1 D;  3FCU A;  1SQ9 A;  4A0B A;  3VI3 A;  3MVD K;  2GC7 A;  2VDO A;  1GOG A;  4RE5 A;  5IGQ A;  2YNN A;  3PXW D;  3I8C A;  2G9A A;  4AMY A;  4YVD A;  3IUN A;  4FHL A;  5IT9 g;  1GOF A;  2EID A;  3SBQ A;  4R7A B;  5CXC A;  4X61 B;  3JRP A;  1S4U X;  2B5N A;  1C9I A;  5THA A;  1H2X A;  1E8N A;  4O3T B;  1RI6 A;  5C92 A;  3NID A;  2QXV A;  4L1M A;  2GNQ A;  3EI3 A;  3SJL D;  4I79 A;  3ZDY A;  2OVP B;  3UVN A;  2CO0 C;  2B5L A;  5GXI A;  1N6E A;  3IJE A;  4CI3 A;  4RE6 A;  1JOF A;  3V4P A;  5HE2 B;  1QNI A;  3VH0 A;  1QFS A;  3HFQ A;  2XYI A;  4U7A A;  2P9S C;  1QFM A;  4CY1 A;  1ERJ A;  4Y7R A;  2IWK A;  2HU5 A;  3SN6 B;  1K3I A;  3NVX A;  2AGL A;  3CFS B;  2OVQ B;  3N0D A;  4UM8 A;  3PVU B;  1Q47 A;  5M5R A;  4LG9 A;  5HYN B;  1XKS A;  4A11 A;  2XE4 A;  3MMY A;  3SHF A;  3EI4 B;  4FA5 D;  5EM2 B;  3MUN A;  4OWR A;  3AL8 A;  5M5S A;  1TBG A;  3GC3 B;  2EBS A;  1MG2 A;  3I7N A;  1K32 A;  2H47 A;  3JZG A;  4GQ2 P;  3EQ8 A;  3E0C A;  2I0S A;  4MMX A;  4J82 A;  4A11 B;  2J55 H;  3U4Y A;  2EIC A;  3RRM C;  2OK6 A;  4H5I A;  1GG2 B;  3IUL A;  4UI9 R;  3MXX A;  1YR2 A;  2WQ8 A;  4ZOX A;  2AGX A;  1H2Y A;  5IC7 A;  2EIE A;  1N6D A;  2PM6 B;  5M5V A;  3VGZ A;  4D6V A;  3I7P A;  5H17 A;  5H14 A;  1FWX A;  4JSN C;  2Q7Q A;  1A12 A;  3K71 A;  1MG3 A;  3JRO A;  4AN0 A;  1PGU A;  2HJ4 A;  2VDM A;  2XDW A;  3EWE A;  4Z8L A;  4Z7N A;  1UOQ A;  1VE7 A;  1T2X A;  2B4E A;  3I7H A;  3PXT D;  4DNV A;  4PNK B;  3NIF A;  3EQ7 A;  5FKQ A;  3RFG A;  5C86 A;  4A09 A;  2P9L C;  3T3P A;  4BCB A;  4IA9 A;  3IJC A;  5IGO A;  3RLM D;  3OTT A;  4PBY A;  4GQ1 A;  4O9D A;  2H6N A;  5EMM B;  4L1Q D;  2O9K A;  3GD1 I;  4O45 A;  3FGB A;  5FXY A;  1H2Z A;  2AH0 A;  5H1M A;  4NBM A;  4GMB A;  5HDB A;  2P9I C;  4XYH A;  4GZ8 A;  4E54 B; 
#chains in the Genus database with same CATH homology
 4CY3 A;  1NEX B;  4PC0 A;  4TZ4 A;  5I5J A;  3PVW B;  4GM8 A;  4ERZ A;  4E5Z A;  4FAN D;  2HKR A;  3F3P A;  4GGC A;  3GFC A;  2H9P A;  4JSV C;  2GC4 A;  3I7O A;  4Y5R D;  3JPX A;  5C9Z B;  4L3H D;  4GGA A;  4J0W A;  4J78 A;  3K26 A;  1B9Y A;  1SQJ A;  3VA6 A;  4PBZ A;  3PE7 A;  4JT5 C;  3DSM A;  3CFV A;  3V5W B;  3C75 H;  3PXS D;  4AEZ A;  3OKW A;  1JMZ B;  4EWR A;  1VYH C;  4A2M A;  1R5M A;  2CE8 A;  2BBK H;  1U2V C;  4ZOV A;  4A0B B;  3I7L A;  2XL2 A;  3W15 A;  3MZL A;  3UVL A;  1JMX B;  3JZN A;  5CYK A;  5EAL A;  5FKR A;  2IUP A;  3SVW D;  1P22 A;  2PM7 B;  4J86 A;  2I0R A;  4JD2 C;  1JJU B;  3NVN A;  2XL3 A;  4U1E I;  4FWW A;  4FA4 D;  5HE3 B;  2P9K C;  5EMJ B;  4LGN A;  3EI4 A;  2PM9 B;  1XHM A;  2CNX A;  5CYK B;  5EMK B;  2OJY A;  3I7K A;  3L4M D;  3DM0 A;  5C2W B;  3EMH A;  3SBR A;  4CZX A;  4J8B A;  5TEF A;  3IJ0 A;  3PSC B;  2AQ5 A;  1PEV A;  4J77 A;  5TDH B;  3CIK B;  2AGW A;  2CN2 A;  3BG1 A;  3ULE C;  4J87 A;  4J81 A;  3MKQ A;  1B9X A;  3BWS A;  2Z2P A;  1U4C A;  5HE1 B;  5FA5 B;  2HXC A;  5TF2 A;  4PSX B;  3I8E A;  2YNP A;  1GXR A;  2H13 A;  3JB9 L;  1A0R B;  5CXB B;  3UVO A;  4J79 A;  3AH8 B;  4BUJ C;  5KDO B;  3EI1 A;  2PM9 A;  4D0K A;  2IWF A;  3ZWL B;  4JSP C;  1NR0 A;  4OZU A;  5TEE A;  4FAV D;  2IUR A;  3KRW B;  4FA9 D;  3SCY A;  3AL8 B;  5AFU 3;  3DXM C;  3EG6 A;  1YFQ A;  4N14 A;  4J0X A;  2H3X A;  3C5M A;  3OKT A;  5SXM A;  3V7D B;  5A2Q g;  2QC5 A;  3RSE C;  3AL9 A;  3EU7 A;  2HYE A;  4A7J A;  3IKO A;  5I5I A;  3J81 g;  3IJ1 A;  2MTA H;  1PI6 A;  4X60 B;  2P9N C;  3EI1 B;  4K3J B;  4E5Z B;  2HKM A;  4O3U B;  2IAA A;  3DXK C;  2TRC B;  4A08 A;  4ERY A;  3C99 A;  4XYI A;  3SFZ A;  5EAM A;  5B4W A;  5I5M A;  3L4O D;  2UZX B;  3JZH A;  2OK4 A;  2P9P C;  2OVR B;  3OW8 A;  1N6F A;  4A09 B;  3IIY A;  3B7F A;  2YNO A;  3NVQ A;  2H68 A;  2B5M A;  2Z2N A;  3PSL A;  3SLE D;  4L3G D;  2H9L A;  4K3I D;  4FB1 D;  2UZY B;  4GGD A;  4JXM A;  4ZOZ A;  4X3E A;  4JSX C;  4H5J A;  4MK0 B;  3DWL C;  5C2V B;  4G56 B;  5GMK n;  2YBA A;  2HES X;  3MKS B;  3ORV D;  5EAP A;  2AH1 A;  4CZV A;  4A08 B;  4J8G A;  3N0E A;  2W18 A;  5EML B;  3OL2 B;  4BL0 A;  1L0Q A;  4PSW B;  4CI2 A;  1GP2 B;  4ZOY A;  2J56 H;  1SHY B;  3OKY A;  3SBP A;  3A0F A;  2H14 A;  4ERQ A;  2H9M A;  4CY2 A;  4X63 B;  4HDJ A;  5IJ8 E;  1MDA H;  2OIZ A;  4CY5 A;  4CI1 A;  3I2N A;  4GQB B;  4ESG A;  3MZK A;  1OMW B;  2PBI B;  3GRE A;  5HQG A;  4QQE A;  3RMZ D;  4O1Q D;  2IUQ A;  2YMU A;  3AFC A;  4A0A B;  3P4F A;  3OKY B;  4IMM A;  2AGY A;  3J80 g;  4J73 A;  1GOT B;  4LG8 A;  4L9O A;  5AJA A;  3SXT D;  2YB8 B;  3UKR C;  3UR4 A;  3IIW A;  4ES0 A;  3OL2 A;  3EI3 B;  3F3F A;  4CZY A;  5EM2 A;  4CI8 A;  2H9N A;  1K8K C;  3SMR A;  2G99 A;  3KRX B;  4A2L A;  4PXW A;  4A0A A;  4XEI C;  2H6K A;  2AGZ A;  2CN3 A;  4GM3 A;  2HJB A;  5JWZ A;  3UVK A;  2I0T A;  3F3G A;  1TYQ C;  4QT8 A;  4CC9 A;  5K19 A;  2J57 G;  4JT6 C;  5FKS A;  3ODT A;  1PBY B;  3UVM A;  3UKU C;  2I3T A;  4AOW A;  5EAR A;  3V9F A;  2P9U C;  2XU7 A;  3EI2 A;  3RN0 D;  4GM9 A;  4ZN4 A;  4J84 A;  5FQD A;  2I3S A;  5IJ7 E;  4BH6 A;  5CXC B;  2CE9 A;  3FM0 A;  4QL1 A;  3FRX A;  3RN1 D;  3JAM g;  3BG0 A;  5AMS A;  3K27 A;  1OLZ A;  5FLX g;  1XIP A;  2IUV A;  4E54 A;  3SWS D;  4QRJ A;  5GSA A;  3I89 A;  5CXB A;  2BCJ B;  3EI2 B;  5K1C C;  3RFH A;  2CO0 A;  2H6Q A;  4NSX A;  2Z2O A;  4KFM B;  5HE0 B;  5FKT A;  3C9C A;  5GXH A;  4FA1 D;  1SQ9 A;  4A0B A;  2GC7 A;  5IGQ A;  2YNN A;  3PXW D;  3I8C A;  2G9A A;  4YVD A;  4FHL A;  5IT9 g;  3SBQ A;  4R7A B;  5CXC A;  4X61 B;  3JRP A;  1S4U X;  2B5N A;  5THA A;  4O3T B;  1RI6 A;  2QXV A;  2GNQ A;  3EI3 A;  3SJL D;  4I79 A;  2OVP B;  3UVN A;  2CO0 C;  2B5L A;  5GXI A;  1N6E A;  4CI3 A;  1JOF A;  5HE2 B;  1QNI A;  3VH0 A;  3HFQ A;  2XYI A;  4U7A A;  2P9S C;  4CY1 A;  1ERJ A;  4Y7R A;  2IWK A;  3SN6 B;  2OVQ B;  3NVX A;  2AGL A;  3CFS B;  3N0D A;  3PVU B;  1Q47 A;  4LG9 A;  5HYN B;  1XKS A;  4A11 A;  3MMY A;  3SHF A;  3EI4 B;  4FA5 D;  5EM2 B;  4OWR A;  3AL8 A;  1TBG A;  2EBS A;  1MG2 A;  3I7N A;  1K32 A;  2H47 A;  3JZG A;  4GQ2 P;  3E0C A;  2I0S A;  4J82 A;  4A11 B;  2J55 H;  3U4Y A;  3RRM C;  2OK6 A;  4H5I A;  1GG2 B;  4UI9 R;  3MXX A;  4ZOX A;  2AGX A;  5IC7 A;  1N6D A;  2PM6 B;  3VGZ A;  4D6V A;  3I7P A;  5H17 A;  5H14 A;  1FWX A;  4JSN C;  2Q7Q A;  1MG3 A;  3JRO A;  1PGU A;  2HJ4 A;  3EWE A;  4Z8L A;  2B4E A;  3I7H A;  3PXT D;  4PNK B;  5FKQ A;  3RFG A;  4A09 A;  2P9L C;  4IA9 A;  3IJC A;  5IGO A;  3RLM D;  3OTT A;  4PBY A;  4GQ1 A;  4O9D A;  2H6N A;  5EMM B;  4L1Q D;  2O9K A;  4O45 A;  3FGB A;  5FXY A;  2AH0 A;  5H1M A;  4GMB A;  2P9I C;  4XYH A;  4GZ8 A;  4E54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...