5EARA

Crystal structure of human wdr5 in complex with compound 9d
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
301
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLINPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription / transcription inhibitor
total genus 104
structure length 301
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5earA00
4X3EA 3L4OD 4X63B 3V9FA 3KRXB 3F3GA 4CZVA 2O9KA 4GGDA 3JZHA 1OMWB 1N6EA 4JT5C 2CO0A 4FAND 4CZXA 3I2NA 4O1QD 1OLZA 3BG1A 4CC9A 3EI4B 2AH0A 4I79A 3RN1D 2G9AA 2OJYA 4E54B 5IJ8E 3KRWB 3HFQA 2H6NA 5H1MA 2P9NC 3AL9A 2J56H 3SMRA 4A08A 3V7DB 3I7NA 2CNXA 3MZKA 3IIYA 4LGNA 3I7OA 3P4FA 1PGUA 3EMHA 2HKRA 4O3TB 2G99A 3FGBA 1B9YA 3IJCA 4J8BA 3MXXA 2P9IC 3I8EA 4CI8A 2YNPA 2P9KC 1SQJA 2PM9A 5SXMA 4H5JA 5KDOB 3UVKA 1SHYB 2AGXA 5CYKB 3FRXA 2YBAA 2I3SA 2H6KA 2H9MA 3BG0A 4EWRA 1FWXA 2OVQB 4H5IA 4CI1A 4XEIC 3UVMA 5FKTA 3I7HA 5CXBB 5HE1B 4CI3A 5FKRA 4PXWA 3CIKB 4ERZA 4XYHA 4ERQA 3EG6A 1JOFA 3RSEC 4GM9A 3C99A 4J87A 1MDAH 1Q47A 3A0FA 3EI4A 3SFZA 4JSVC 2AGWA 4X61B 4ES0A 2GNQA 4E54A 3F3FA 2HXCA 3IIWA 4PBYA 5A2Qg 4X60B 4CY2A 2H47A 4QT8A 5EMJB 2H6QA 1U2VC 4QRJA 4D6VA 5EAMA 4A11B 5EM2B 2TRCB 2H9NA 5IT9g 2IUPA 4MK0B 1N6FA 2CN3A 2P9SC 2HYEA 2IUQA 3EI2B 4FAVD 1N6DA 4L3GD 5GSAA 4JSXC 2P9LC 5AMSA 1SQ9A 2PM7B 3DM0A 3N0DA 2H9LA 5EARA 5C2VB 2XYIA 5I5IA 1QNIA 1TBGA 1TYQC 3PVWB 3ZWLB 1JJUB 1VYHC 1K32A 3PVUB 2B5LA 4GZ8A 4IA9A 5THAA 5K19A 5TDHB 2W18A 3OW8A 1B9XA 2IAAA 3I8CA 5EMKB 3E0CA 3IKOA 3OKTA 3JZGA 2OVPB 4AEZA 1XHMA 3JRPA 3U4YA 3EI1B 5FA5B 5CXBA 3K26A 3VA6A 2J57G 3PXWD 3RN0D 1A0RB 2CE8A 4N14A 2IUVA 2Z2OA 3W15A 4BUJC 2HESX 3AL8B 3OL2B 4ZOVA 2I0RA 4NSXA 3SBRA 4A7JA 2YMUA 4JSNC 3DXMC 5GXHA 2XL2A 2YB8B 4FA1D 4ZN4A 4J0XA 3AFCA 5EM2A 4A11A 2H13A 4ZOYA 3MKSB 4U1EI 3J81g 3EI2A 3SWSD 4CY1A 2OK4A 1PI6A 3SXTD 5IC7A 2UZXB 4A09B 5FKQA 3RFGA 3MMYA 4PNKB 5FQDA 4K3JB 4LG8A 3JB9L 2QC5A 4J73A 4FWWA 5TEFA 4J8GA 5IGOA 2HJBA 3UR4A 4FB1D 3SCYA 1NEXB 3NVNA 4CZYA 4FA5D 3EU7A 5FXYA 4CI2A 3SN6B 4QL1A 4FHLA 4O3UB 3SHFA 2Q7QA 3J80g 4GMBA 2I0SA 4FA4D 3ULEC 4GQ2P 2OVRB 5HE3B 3AL8A 3OL2A 3GFCA 2IWKA 5H17A 5IGQA 5C9ZB 3CFVA 2OK6A 2CE9A 1XKSA 1PEVA 4J81A 3UKRC 4J79A 5C2WB 2IURA 3OKYB 3NVQA 2XL3A 4J78A 4FA9D 2AGYA 4GM8A 2QXVA 3I7KA 2PM6B 3SJLD 2B5NA 1GXRA 4QQEA 4E5ZB 4A09A 4ESGA 3VH0A 4PBZA 4AOWA 4JSPC 1RI6A 2I3TA 5IJ7E 4GGCA 5CYKA 4CY3A 2IWFA 4GQ1A 2YNNA 2Z2NA 3DSMA 5B4WA 2AQ5A 1MG3A 5HYNB 1U4CA 1JMXB 4J86A 3C75H 3UVNA 3RLMD 3PSCB 2PM9B 4KFMB 3SBQA 3I89A 3EI3B 4GQBB 3RMZD 4A0AB 3PXSD 4Z8LA 4A2MA 4JXMA 5FKSA 2P9PC 4K3ID 5EMLB 4OWRA 3N0EA 3IJ0A 2BBKH 4O45A 4ZOZA 5AFU3 1ERJA 2MTAH 4GM3A 4O9DA 3NVXA 5GMKn 4A2LA 3VGZA 2EBSA 4XYIA 1GG2B 1P22A 3SVWD 3OTTA 3JAMg 1NR0A 4LG9A 5TEEA 2H14A 1GP2B 3B7FA 2I0TA 2Z2PA 5I5JA 4L3HD 5CXCB 3K27A 5HQGA 3OKYA 1JMZB 2YNOA 3V5WB 4HDJA 5I5MA 3DXKC 5HE0B 3GREA 3RRMC 5K1CC 5EAPA 4TZ4A 5EALA 4L9OA 4E5ZA 4U7AA 1YFQA 3ORVD 5AJAA 2CN2A 2UZYB 4Y7RA 5HE2B 2AH1A 5EMMB 3FM0A 1GOTB 4G56B 4J77A 5H14A 2OIZA 4BL0A 3RFHA 2J55H 3EI1A 4A0BB 2H68A 3DWLC 3EI3A 4A0AA 3I7PA 2B4EA 2AGLA 1PBYB 3BWSA 3UVOA 4UI9R 1MG2A 2AGZA 2B5MA 3EWEA 2BCJB 2PBIB 3PE7A 1K8KC 4PSXB 3I7LA 2H9PA 3AH8B 3L4MD 4JT6C 4OZUA 2H3XA 3PXTD 5CXCA 3JPXA 3UVLA 1XIPA 4J84A 2XU7A 3C9CA 5JWZA 4A08B 3UKUC 4PSWB 3SLED 4J82A 2GC7A 2HJ4A 4GGAA 4R7AB 3F3PA 4Y5RD 5FLXg 3CFSB 4CY5A 4ZOXA 3MKQA 4ERYA 3C5MA 2CO0C 3OKWA 4J0WA 4IMMA 5GXIA 3PSLA 2P9UC 3IJ1A 2HKMA 2GC4A 3JROA 5TF2A 1S4UX 3JZNA 1L0QA 3SBPA 3ODTA 4YVDA 4L1QD 3MZLA 4D0KA 4JD2C 4BH6A 4A0BA 4PC0A 1R5MA
chains in the Genus database with same CATH superfamily
4X3EA 3L4OD 4X63B 1H2WA 1H2ZA 2VC2A 1K3IA 3V9FA 3KRXB 3F3GA 3ZDXA 4AN1A 4CZVA 2O9KA 4GGDA 3JZHA 1OMWB 1N6EA 4JT5C 2CO0A 1H2YA 2VZ3A 4FAND 4CZXA 3I2NA 1H2XA 4BP9A 4O1QD 2HU7A 1OLZA 3BG1A 4CC9A 2XDWA 3EI4B 2AH0A 4Z7NA 4BCCA 4BP8A 4I79A 3RN1D 2G9AA 2OJYA 4E54B 5IJ8E 3KRWB 3HFQA 2VDRA 2H6NA 5H1MA 5M5TA 2P9NC 3AL9A 2J56H 3SMRA 4A08A 3V7DB 3I7NA 2CNXA 3MZKA 3IIYA 4LGNA 3I7OA 3VI4A 2VDMA 3P4FA 1PGUA 3EMHA 2HKRA 3ZDYA 4O3TB 2G99A 3FGBA 1U8CA 1B9YA 3IJCA 4J8BA 2EIDA 4O2WA 3MXXA 2P9IC 3I8EA 3ZE2A 4CI8A 2YNPA 2P9KC 3MUOA 1SQJA 3QI0A 2PM9A 5SXMA 4H5JA 5KDOB 3UVKA 1SHYB 3DDUA 2AGXA 5CYKB 1E8NA 3FRXA 2YBAA 2I3SA 2VDLA 2H6KA 2H9MA 3BG0A 4EWRA 1FWXA 2OVQB 1L5GA 4H5IA 4AMYA 4CI1A 4XEIC 3UVMA 4MMZA 3KCIA 5FKTA 1C9IA 3ZE1A 3I7HA 5CXBB 5HE1B 4CI3A 5FKRA 4PXWA 3CIKB 4ERZA 4XYHA 4WK4A 4ERQA 3EG6A 4MMYA 1JOFA 3RSEC 4GM9A 3C99A 1GOHA 4J87A 1MDAH 1Q47A 3A0FA 3EI4A 3IULA 3SFZA 4JSVC 2AGWA 4X61B 4ES0A 2GNQA 4E54A 4L1MA 3F3FA 2HXCA 3IIWA 4PBYA 5FFGA 5A2Qg 4X60B 3IJEA 4CY2A 2H47A 4QT8A 5EMJB 5E6UA 2H6QA 1U2VC 4QRJA 4D6VA 5EAMA 4A11B 5EM2B 2TRCB 2H9NA 5IT9g 4G55A 2IUPA 4MK0B 1N6FA 2CN3A 2P9SC 3EQ8A 2HYEA 2IUQA 3EI2B 4FAVD 1N6DA 4L3GD 5GSAA 4JSXC 2P9LC 5AMSA 1SQ9A 2PM7B 3DM0A 3N0DA 4NAAA 2VZ1A 2H9LA 5EARA 5C2VB 2XYIA 5I5IA 1QNIA 5M5UA 1TBGA 1TYQC 3PVWB 3O4HA 3ZWLB 1JJUB 1GOGA 1VYHC 1K32A 3PVUB 5C86A 1BPOA 2B5LA 4GZ8A 4IA9A 5THAA 3O4GA 5K19A 5TDHB 2W18A 3OW8A 1B9XA 2IAAA 3I8CA 5EMKB 3E0CA 1R5MA 3IKOA 3OKTA 3JZGA 2OVPB 3ZDZA 4AEZA 1XHMA 3JRPA 3U4YA 3EI1B 5FA5B 5M5SA 3O4JA 2XE4A 5CXBA 5E6RA 3K26A 3VA6A 2J57G 3PXWD 3RN0D 1UOOA 1A0RB 2CE8A 1VE7A 4N14A 2IUVA 2Z2OA 3FCSA 1UTCA 2QR5A 3W15A 1GOFA 4BUJC 4DNVA 3T3PA 2HESX 3AL8B 3OL2B 4ZOVA 2I0RA 4NSXA 3SBRA 4A7JA 2YMUA 4JSNC 3DXMC 4BCBA 5C92A 5GXHA 1VE6A 3NIGA 1UOQA 2XL2A 3EQ9A 2YB8B 2EIEA 4FA1D 4ZN4A 3NIFA 4J0XA 3AFCA 5EM2A 4A11A 2H13A 4ZOYA 3MKSB 3GC3B 4U1EI 3J81g 1QFMA 3EI2A 3SWSD 4CY1A 2OK4A 1PI6A 3SXTD 5IC7A 2UZXB 4A09B 5FKQA 5M5RA 3RFGA 3MMYA 4PNKB 5FQDA 4K3JB 5M61A 4LG8A 3JB9L 2QC5A 4J73A 4FWWA 5TEFA 4J8GA 4MMXA 5IGOA 3VI3A 2HJBA 3UR4A 4FB1D 3K72A 3SCYA 1NEXB 3IUQA 3NVNA 4CZYA 4FA5D 4Z7OA 2QZPA 3EU7A 5FXYA 4CI2A 3SN6B 1O6GA 4QL1A 4FHLA 1QFSA 4O3UB 4D9SA 3SHFA 2Q7QA 3J80g 4GMBA 2I0SA 2HU8A 3K6SA 4AMZA 3IURA 4FA4D 3ULEC 4GQ2P 2JKXA 2OVRB 4DNWA 5HE3B 3AL8A 3OL2A 3GFCA 2IWKA 5H17A 5IGQA 4NBMA 4RE5A 5C9ZB 3CFVA 2OK6A 3IUMA 1VZ2A 2CE9A 1XKSA 1PEVA 4J81A 3UKRC 4J79A 5C2WB 2IURA 3OKYB 3NVQA 4NENA 2XL3A 4J78A 4FA9D 2AGYA 4GM8A 2QXVA 2XZGA 3I7KA 4UM9A 2PM6B 3IVMA 3SJLD 2B5NA 1GXRA 4QQEA 4E5ZB 3NIDA 2VDPA 2EIBA 4A09A 4ESGA 3VH0A 4PBZA 4AOWA 4JSPC 1RI6A 2I3TA 5IJ7E 4GGCA 3GD1I 1T2XA 5CYKA 4CY3A 2IWFA 3EQ7A 3ZE0A 4GQ1A 2YNNA 2Z2NA 1TYEA 3DSMA 5B4WA 2AQ5A 3MVDK 1MG3A 5HYNB 1U4CA 1JMXB 4J86A 3C75H 3UVNA 3RLMD 3PSCB 2PM9B 4KFMB 3SBQA 4UM8A 3I89A 3EI3B 4GQBB 1O6FA 3RMZD 4A0AB 3PXSD 4Z8LA 3V4VA 4A2MA 4JXMA 5FKSA 2P9PC 4K3ID 5EMLB 4Z7QA 4OWRA 3N0EA 4AN0A 3QHYB 3IJ0A 2BBKH 3IUNA 4O45A 4ZOZA 5AFU3 3T3MA 4RE6A 1ERJA 4BCDA 2MTAH 4GM3A 4JHPC 2VDKA 4O9DA 3NVXA 5GMKn 4A2LA 3VGZA 2EBSA 4XYIA 1GG2B 1P22A 3SVWD 3OTTA 3JAMg 1NR0A 4LG9A 5TEEA 2H14A 1GP2B 3IUJA 3B7FA 2I0TA 2Z2PA 5I5JA 2VDNA 2EICA 2VDQA 4L3HD 5CXCB 3K27A 5HQGA 3OKYA 5HDBA 1JMZB 2YNOA 3V5WB 4HDJA 2BKLA 5I5MA 3OF7A 3DXKC 5HE0B 3GREA 1VZ3A 3RRMC 5K1CC 5EAPA 4TZ4A 5EALA 4L9OA 4E5ZA 4U7AA 1JV2A 1YFQA 3ORVD 5AJAA 2CN2A 1M1XA 2UZYB 4Y7RA 5HE2B 2AH1A 5EMMB 2VDOA 4O02A 3FM0A 1GOTB 4G56B 4J77A 4NC4A 1UOPA 5H14A 2OIZA 4BL0A 3RFHA 4JHNA 2J55H 3MUNA 3EI1A 4A0BB 2H68A 3DWLC 3EI3A 1E5TA 4A0AA 3I7PA 3V4PA 2B4EA 2AGLA 1PBYB 3BWSA 3UVOA 4UI9R 1MG2A 2AGZA 2HU5A 2B5MA 3EWEA 4WK2A 1A12A 4WJKA 5M5VA 2BCJB 2PBIB 4DNUA 1JTDB 1YR2A 3K71A 4IRZA 3PE7A 1K8KC 4PSXB 3I7LA 2H9PA 3AH8B 3L4MD 4JT6C 4OZUA 2H3XA 3PXTD 5CXCA 3JPXA 3UVLA 1E8MA 1XIPA 4G1MA 1I2MB 4J84A 2XU7A 3C9CA 5E6SA 5JWZA 3UKUC 4PSWB 4A08B 3SLED 4J82A 4AX4A 2GC7A 2HJ4A 4GGAA 3O4IA 4R7AB 3F3PA 4QAMA 4Y5RD 1C9LA 5FLXg 3CFSB 4CY5A 4ZOXA 3MKQA 4ERYA 3C5MA 5FFOA 4WK0A 2CO0C 3OKWA 4J0WA 4IMMA 5GXIA 3PSLA 2P9UC 3IJ1A 2HKMA 2GC4A 4G1EA 3JROA 5TF2A 1S4UX 3JZNA 1L0QA 3SBPA 3ODTA 4YVDA 4L1QD 3MZLA 4D0KA 4JD2C 4BH6A 4A0BA 3FCUA 4PC0A 2WQ8A
chains in the Genus database with same CATH topology
4X3EA 3L4OD 4X63B 3V9FA 3KRXB 3F3GA 4CZVA 2O9KA 4GGDA 3JZHA 1OMWB 1N6EA 4JT5C 2CO0A 4FAND 4CZXA 3I2NA 4O1QD 1OLZA 3BG1A 4CC9A 3EI4B 2AH0A 4I79A 3RN1D 2G9AA 2OJYA 4E54B 5IJ8E 3KRWB 3HFQA 2H6NA 5H1MA 2P9NC 3AL9A 2J56H 3SMRA 4A08A 3V7DB 3I7NA 2CNXA 3MZKA 3IIYA 4LGNA 3I7OA 3P4FA 1PGUA 3EMHA 2HKRA 4O3TB 2G99A 3FGBA 1B9YA 3IJCA 4J8BA 3MXXA 2P9IC 3I8EA 4CI8A 2YNPA 2P9KC 1SQJA 2PM9A 5SXMA 4H5JA 5KDOB 3UVKA 1SHYB 2AGXA 5CYKB 3FRXA 2YBAA 2I3SA 2H6KA 2H9MA 3BG0A 4EWRA 1FWXA 2OVQB 4H5IA 4CI1A 4XEIC 3UVMA 5FKTA 3I7HA 5CXBB 5HE1B 4CI3A 5FKRA 4PXWA 3CIKB 4ERZA 4XYHA 4ERQA 3EG6A 1JOFA 3RSEC 4GM9A 3C99A 4J87A 1MDAH 1Q47A 3A0FA 3EI4A 3SFZA 4JSVC 2AGWA 4X61B 4ES0A 2GNQA 4E54A 3F3FA 2HXCA 3IIWA 4PBYA 5A2Qg 4X60B 4CY2A 2H47A 4QT8A 5EMJB 2H6QA 1U2VC 4QRJA 4D6VA 5EAMA 4A11B 5EM2B 2TRCB 2H9NA 5IT9g 2IUPA 4MK0B 1N6FA 2CN3A 2P9SC 2HYEA 2IUQA 3EI2B 4FAVD 1N6DA 4L3GD 5GSAA 4JSXC 2P9LC 5AMSA 1SQ9A 2PM7B 3DM0A 3N0DA 2H9LA 5EARA 5C2VB 2XYIA 5I5IA 1QNIA 1TBGA 1TYQC 3PVWB 3ZWLB 1JJUB 1VYHC 1K32A 3PVUB 2B5LA 4GZ8A 4IA9A 5THAA 5K19A 5TDHB 2W18A 3OW8A 1B9XA 2IAAA 3I8CA 5EMKB 3E0CA 3IKOA 3OKTA 3JZGA 2OVPB 4AEZA 1XHMA 3JRPA 3U4YA 3EI1B 5FA5B 5CXBA 3K26A 3VA6A 2J57G 3PXWD 3RN0D 1A0RB 2CE8A 4N14A 2IUVA 2Z2OA 3W15A 4BUJC 2HESX 3AL8B 3OL2B 4ZOVA 2I0RA 4NSXA 3SBRA 4A7JA 2YMUA 4JSNC 3DXMC 5GXHA 2XL2A 2YB8B 4FA1D 4ZN4A 4J0XA 3AFCA 5EM2A 4A11A 2H13A 4ZOYA 3MKSB 4U1EI 3J81g 3EI2A 3SWSD 4CY1A 2OK4A 1PI6A 3SXTD 5IC7A 2UZXB 4A09B 5FKQA 3RFGA 3MMYA 4PNKB 5FQDA 4K3JB 4LG8A 3JB9L 2QC5A 4J73A 4FWWA 5TEFA 4J8GA 5IGOA 2HJBA 3UR4A 4FB1D 3SCYA 1NEXB 3NVNA 4CZYA 4FA5D 3EU7A 5FXYA 4CI2A 3SN6B 4QL1A 4FHLA 4O3UB 3SHFA 2Q7QA 3J80g 4GMBA 2I0SA 4FA4D 3ULEC 4GQ2P 2OVRB 5HE3B 3AL8A 3OL2A 3GFCA 2IWKA 5H17A 5IGQA 5C9ZB 3CFVA 2OK6A 2CE9A 1XKSA 1PEVA 4J81A 3UKRC 4J79A 5C2WB 2IURA 3OKYB 3NVQA 2XL3A 4J78A 4FA9D 2AGYA 4GM8A 2QXVA 3I7KA 2PM6B 3SJLD 2B5NA 1GXRA 4QQEA 4E5ZB 4A09A 4ESGA 3VH0A 4PBZA 4AOWA 4JSPC 1RI6A 2I3TA 5IJ7E 4GGCA 5CYKA 4CY3A 2IWFA 4GQ1A 2YNNA 2Z2NA 3DSMA 5B4WA 2AQ5A 1MG3A 5HYNB 1U4CA 1JMXB 4J86A 3C75H 3UVNA 3RLMD 3PSCB 2PM9B 4KFMB 3SBQA 3I89A 3EI3B 4GQBB 3RMZD 4A0AB 3PXSD 4Z8LA 4A2MA 4JXMA 5FKSA 2P9PC 4K3ID 5EMLB 4OWRA 3N0EA 3IJ0A 2BBKH 4O45A 4ZOZA 5AFU3 1ERJA 2MTAH 4GM3A 4O9DA 3NVXA 5GMKn 4A2LA 3VGZA 2EBSA 4XYIA 1GG2B 1P22A 3SVWD 3OTTA 3JAMg 1NR0A 4LG9A 5TEEA 2H14A 1GP2B 3B7FA 2I0TA 2Z2PA 5I5JA 4L3HD 5CXCB 3K27A 5HQGA 3OKYA 1JMZB 2YNOA 3V5WB 4HDJA 5I5MA 3DXKC 5HE0B 3GREA 3RRMC 5K1CC 5EAPA 4TZ4A 5EALA 4L9OA 4E5ZA 4U7AA 1YFQA 3ORVD 5AJAA 2CN2A 2UZYB 4Y7RA 5HE2B 2AH1A 5EMMB 3FM0A 1GOTB 4G56B 4J77A 5H14A 2OIZA 4BL0A 3RFHA 2J55H 3EI1A 4A0BB 2H68A 3DWLC 3EI3A 4A0AA 3I7PA 2B4EA 2AGLA 1PBYB 3BWSA 3UVOA 4UI9R 1MG2A 2AGZA 2B5MA 3EWEA 2BCJB 2PBIB 3PE7A 1K8KC 4PSXB 3I7LA 2H9PA 3AH8B 3L4MD 4JT6C 4OZUA 2H3XA 3PXTD 5CXCA 3JPXA 3UVLA 1XIPA 4J84A 2XU7A 3C9CA 5JWZA 4A08B 3UKUC 4PSWB 3SLED 4J82A 2GC7A 2HJ4A 4GGAA 4R7AB 3F3PA 4Y5RD 5FLXg 3CFSB 4CY5A 4ZOXA 3MKQA 4ERYA 3C5MA 2CO0C 3OKWA 4J0WA 4IMMA 5GXIA 3PSLA 2P9UC 3IJ1A 2HKMA 2GC4A 3JROA 5TF2A 1S4UX 3JZNA 1L0QA 3SBPA 3ODTA 4YVDA 4L1QD 3MZLA 4D0KA 4JD2C 4BH6A 4A0BA 4PC0A 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3E A;  3L4O D;  4X63 B;  3V9F A;  3KRX B;  3F3G A;  4CZV A;  2O9K A;  4GGD A;  3JZH A;  1OMW B;  1N6E A;  4JT5 C;  2CO0 A;  4FAN D;  4CZX A;  3I2N A;  4O1Q D;  1OLZ A;  3BG1 A;  4CC9 A;  3EI4 B;  2AH0 A;  4I79 A;  3RN1 D;  2G9A A;  2OJY A;  4E54 B;  5IJ8 E;  3KRW B;  3HFQ A;  2H6N A;  5H1M A;  2P9N C;  3AL9 A;  2J56 H;  3SMR A;  4A08 A;  3V7D B;  3I7N A;  2CNX A;  3MZK A;  3IIY A;  4LGN A;  3I7O A;  3P4F A;  1PGU A;  3EMH A;  2HKR A;  4O3T B;  2G99 A;  3FGB A;  1B9Y A;  3IJC A;  4J8B A;  3MXX A;  2P9I C;  3I8E A;  4CI8 A;  2YNP A;  2P9K C;  1SQJ A;  2PM9 A;  5SXM A;  4H5J A;  5KDO B;  3UVK A;  1SHY B;  2AGX A;  5CYK B;  3FRX A;  2YBA A;  2I3S A;  2H6K A;  2H9M A;  3BG0 A;  4EWR A;  1FWX A;  2OVQ B;  4H5I A;  4CI1 A;  4XEI C;  3UVM A;  5FKT A;  3I7H A;  5CXB B;  5HE1 B;  4CI3 A;  5FKR A;  4PXW A;  3CIK B;  4ERZ A;  4XYH A;  4ERQ A;  3EG6 A;  1JOF A;  3RSE C;  4GM9 A;  3C99 A;  4J87 A;  1MDA H;  1Q47 A;  3A0F A;  3EI4 A;  3SFZ A;  4JSV C;  2AGW A;  4X61 B;  4ES0 A;  2GNQ A;  4E54 A;  3F3F A;  2HXC A;  3IIW A;  4PBY A;  5A2Q g;  4X60 B;  4CY2 A;  2H47 A;  4QT8 A;  5EMJ B;  2H6Q A;  1U2V C;  4QRJ A;  4D6V A;  5EAM A;  4A11 B;  5EM2 B;  2TRC B;  2H9N A;  5IT9 g;  2IUP A;  4MK0 B;  1N6F A;  2CN3 A;  2P9S C;  2HYE A;  2IUQ A;  3EI2 B;  4FAV D;  1N6D A;  4L3G D;  5GSA A;  4JSX C;  2P9L C;  5AMS A;  1SQ9 A;  2PM7 B;  3DM0 A;  3N0D A;  2H9L A;  5EAR A;  5C2V B;  2XYI A;  5I5I A;  1QNI A;  1TBG A;  1TYQ C;  3PVW B;  3ZWL B;  1JJU B;  1VYH C;  1K32 A;  3PVU B;  2B5L A;  4GZ8 A;  4IA9 A;  5THA A;  5K19 A;  5TDH B;  2W18 A;  3OW8 A;  1B9X A;  2IAA A;  3I8C A;  5EMK B;  3E0C A;  3IKO A;  3OKT A;  3JZG A;  2OVP B;  4AEZ A;  1XHM A;  3JRP A;  3U4Y A;  3EI1 B;  5FA5 B;  5CXB A;  3K26 A;  3VA6 A;  2J57 G;  3PXW D;  3RN0 D;  1A0R B;  2CE8 A;  4N14 A;  2IUV A;  2Z2O A;  3W15 A;  4BUJ C;  2HES X;  3AL8 B;  3OL2 B;  4ZOV A;  2I0R A;  4NSX A;  3SBR A;  4A7J A;  2YMU A;  4JSN C;  3DXM C;  5GXH A;  2XL2 A;  2YB8 B;  4FA1 D;  4ZN4 A;  4J0X A;  3AFC A;  5EM2 A;  4A11 A;  2H13 A;  4ZOY A;  3MKS B;  4U1E I;  3J81 g;  3EI2 A;  3SWS D;  4CY1 A;  2OK4 A;  1PI6 A;  3SXT D;  5IC7 A;  2UZX B;  4A09 B;  5FKQ A;  3RFG A;  3MMY A;  4PNK B;  5FQD A;  4K3J B;  4LG8 A;  3JB9 L;  2QC5 A;  4J73 A;  4FWW A;  5TEF A;  4J8G A;  5IGO A;  2HJB A;  3UR4 A;  4FB1 D;  3SCY A;  1NEX B;  3NVN A;  4CZY A;  4FA5 D;  3EU7 A;  5FXY A;  4CI2 A;  3SN6 B;  4QL1 A;  4FHL A;  4O3U B;  3SHF A;  2Q7Q A;  3J80 g;  4GMB A;  2I0S A;  4FA4 D;  3ULE C;  4GQ2 P;  2OVR B;  5HE3 B;  3AL8 A;  3OL2 A;  3GFC A;  2IWK A;  5H17 A;  5IGQ A;  5C9Z B;  3CFV A;  2OK6 A;  2CE9 A;  1XKS A;  1PEV A;  4J81 A;  3UKR C;  4J79 A;  5C2W B;  2IUR A;  3OKY B;  3NVQ A;  2XL3 A;  4J78 A;  4FA9 D;  2AGY A;  4GM8 A;  2QXV A;  3I7K A;  2PM6 B;  3SJL D;  2B5N A;  1GXR A;  4QQE A;  4E5Z B;  4A09 A;  4ESG A;  3VH0 A;  4PBZ A;  4AOW A;  4JSP C;  1RI6 A;  2I3T A;  5IJ7 E;  4GGC A;  5CYK A;  4CY3 A;  2IWF A;  4GQ1 A;  2YNN A;  2Z2N A;  3DSM A;  5B4W A;  2AQ5 A;  1MG3 A;  5HYN B;  1U4C A;  1JMX B;  4J86 A;  3C75 H;  3UVN A;  3RLM D;  3PSC B;  2PM9 B;  4KFM B;  3SBQ A;  3I89 A;  3EI3 B;  4GQB B;  3RMZ D;  4A0A B;  3PXS D;  4Z8L A;  4A2M A;  4JXM A;  5FKS A;  2P9P C;  4K3I D;  5EML B;  4OWR A;  3N0E A;  3IJ0 A;  2BBK H;  4O45 A;  4ZOZ A;  5AFU 3;  1ERJ A;  2MTA H;  4GM3 A;  4O9D A;  3NVX A;  5GMK n;  4A2L A;  3VGZ A;  2EBS A;  4XYI A;  1GG2 B;  1P22 A;  3SVW D;  3OTT A;  3JAM g;  1NR0 A;  4LG9 A;  5TEE A;  2H14 A;  1GP2 B;  3B7F A;  2I0T A;  2Z2P A;  5I5J A;  4L3H D;  5CXC B;  3K27 A;  5HQG A;  3OKY A;  1JMZ B;  2YNO A;  3V5W B;  4HDJ A;  5I5M A;  3DXK C;  5HE0 B;  3GRE A;  3RRM C;  5K1C C;  5EAP A;  4TZ4 A;  5EAL A;  4L9O A;  4E5Z A;  4U7A A;  1YFQ A;  3ORV D;  5AJA A;  2CN2 A;  2UZY B;  4Y7R A;  5HE2 B;  2AH1 A;  5EMM B;  3FM0 A;  1GOT B;  4G56 B;  4J77 A;  5H14 A;  2OIZ A;  4BL0 A;  3RFH A;  2J55 H;  3EI1 A;  4A0B B;  2H68 A;  3DWL C;  3EI3 A;  4A0A A;  3I7P A;  2B4E A;  2AGL A;  1PBY B;  3BWS A;  3UVO A;  4UI9 R;  1MG2 A;  2AGZ A;  2B5M A;  3EWE A;  2BCJ B;  2PBI B;  3PE7 A;  1K8K C;  4PSX B;  3I7L A;  2H9P A;  3AH8 B;  3L4M D;  4JT6 C;  4OZU A;  2H3X A;  3PXT D;  5CXC A;  3JPX A;  3UVL A;  1XIP A;  4J84 A;  2XU7 A;  3C9C A;  5JWZ A;  4A08 B;  3UKU C;  4PSW B;  3SLE D;  4J82 A;  2GC7 A;  2HJ4 A;  4GGA A;  4R7A B;  3F3P A;  4Y5R D;  5FLX g;  3CFS B;  4CY5 A;  4ZOX A;  3MKQ A;  4ERY A;  3C5M A;  2CO0 C;  3OKW A;  4J0W A;  4IMM A;  5GXI A;  3PSL A;  2P9U C;  3IJ1 A;  2HKM A;  2GC4 A;  3JRO A;  5TF2 A;  1S4U X;  3JZN A;  1L0Q A;  3SBP A;  3ODT A;  4YVD A;  4L1Q D;  3MZL A;  4D0K A;  4JD2 C;  4BH6 A;  4A0B A;  4PC0 A;  1R5M A; 
#chains in the Genus database with same CATH topology
 4X3E A;  3L4O D;  4X63 B;  1H2W A;  1H2Z A;  2VC2 A;  1K3I A;  3V9F A;  3KRX B;  3F3G A;  3ZDX A;  4AN1 A;  4CZV A;  2O9K A;  4GGD A;  3JZH A;  1OMW B;  1N6E A;  4JT5 C;  2CO0 A;  1H2Y A;  2VZ3 A;  4FAN D;  4CZX A;  3I2N A;  1H2X A;  4BP9 A;  4O1Q D;  2HU7 A;  1OLZ A;  3BG1 A;  4CC9 A;  2XDW A;  3EI4 B;  2AH0 A;  4Z7N A;  4BCC A;  4BP8 A;  4I79 A;  3RN1 D;  2G9A A;  2OJY A;  4E54 B;  5IJ8 E;  3KRW B;  3HFQ A;  2VDR A;  2H6N A;  5H1M A;  5M5T A;  2P9N C;  3AL9 A;  2J56 H;  3SMR A;  4A08 A;  3V7D B;  3I7N A;  2CNX A;  3MZK A;  3IIY A;  4LGN A;  3I7O A;  3VI4 A;  2VDM A;  3P4F A;  1PGU A;  3EMH A;  2HKR A;  3ZDY A;  4O3T B;  2G99 A;  3FGB A;  1U8C A;  1B9Y A;  3IJC A;  4J8B A;  2EID A;  4O2W A;  3MXX A;  2P9I C;  3I8E A;  3ZE2 A;  4CI8 A;  2YNP A;  2P9K C;  3MUO A;  1SQJ A;  3QI0 A;  2PM9 A;  5SXM A;  4H5J A;  5KDO B;  3UVK A;  1SHY B;  3DDU A;  2AGX A;  5CYK B;  1E8N A;  3FRX A;  2YBA A;  2I3S A;  2VDL A;  2H6K A;  2H9M A;  3BG0 A;  4EWR A;  1FWX A;  2OVQ B;  1L5G A;  4H5I A;  4AMY A;  4CI1 A;  4XEI C;  3UVM A;  4MMZ A;  3KCI A;  5FKT A;  1C9I A;  3ZE1 A;  3I7H A;  5CXB B;  5HE1 B;  4CI3 A;  5FKR A;  4PXW A;  3CIK B;  4ERZ A;  4XYH A;  4WK4 A;  4ERQ A;  3EG6 A;  4MMY A;  1JOF A;  3RSE C;  4GM9 A;  3C99 A;  1GOH A;  4J87 A;  1MDA H;  1Q47 A;  3A0F A;  3EI4 A;  3IUL A;  3SFZ A;  4JSV C;  2AGW A;  4X61 B;  4ES0 A;  2GNQ A;  4E54 A;  4L1M A;  3F3F A;  2HXC A;  3IIW A;  4PBY A;  5FFG A;  5A2Q g;  4X60 B;  3IJE A;  4CY2 A;  2H47 A;  4QT8 A;  5EMJ B;  5E6U A;  2H6Q A;  1U2V C;  4QRJ A;  4D6V A;  5EAM A;  4A11 B;  5EM2 B;  2TRC B;  2H9N A;  5IT9 g;  4G55 A;  2IUP A;  4MK0 B;  1N6F A;  2CN3 A;  2P9S C;  3EQ8 A;  2HYE A;  2IUQ A;  3EI2 B;  4FAV D;  1N6D A;  4L3G D;  5GSA A;  4JSX C;  2P9L C;  5AMS A;  1SQ9 A;  2PM7 B;  3DM0 A;  3N0D A;  4NAA A;  2VZ1 A;  2H9L A;  5EAR A;  5C2V B;  2XYI A;  5I5I A;  1QNI A;  5M5U A;  1TBG A;  1TYQ C;  3PVW B;  3O4H A;  3ZWL B;  1JJU B;  1GOG A;  1VYH C;  1K32 A;  3PVU B;  5C86 A;  1BPO A;  2B5L A;  4GZ8 A;  4IA9 A;  5THA A;  3O4G A;  5K19 A;  5TDH B;  2W18 A;  3OW8 A;  1B9X A;  2IAA A;  3I8C A;  5EMK B;  3E0C A;  1R5M A;  3IKO A;  3OKT A;  3JZG A;  2OVP B;  3ZDZ A;  4AEZ A;  1XHM A;  3JRP A;  3U4Y A;  3EI1 B;  5FA5 B;  5M5S A;  3O4J A;  2XE4 A;  5CXB A;  5E6R A;  3K26 A;  3VA6 A;  2J57 G;  3PXW D;  3RN0 D;  1UOO A;  1A0R B;  2CE8 A;  1VE7 A;  4N14 A;  2IUV A;  2Z2O A;  3FCS A;  1UTC A;  2QR5 A;  3W15 A;  1GOF A;  4BUJ C;  4DNV A;  3T3P A;  2HES X;  3AL8 B;  3OL2 B;  4ZOV A;  2I0R A;  4NSX A;  3SBR A;  4A7J A;  2YMU A;  4JSN C;  3DXM C;  4BCB A;  5C92 A;  5GXH A;  1VE6 A;  3NIG A;  1UOQ A;  2XL2 A;  3EQ9 A;  2YB8 B;  2EIE A;  4FA1 D;  4ZN4 A;  3NIF A;  4J0X A;  3AFC A;  5EM2 A;  4A11 A;  2H13 A;  4ZOY A;  3MKS B;  3GC3 B;  4U1E I;  3J81 g;  1QFM A;  3EI2 A;  3SWS D;  4CY1 A;  2OK4 A;  1PI6 A;  3SXT D;  5IC7 A;  2UZX B;  4A09 B;  5FKQ A;  5M5R A;  3RFG A;  3MMY A;  4PNK B;  5FQD A;  4K3J B;  5M61 A;  4LG8 A;  3JB9 L;  2QC5 A;  4J73 A;  4FWW A;  5TEF A;  4J8G A;  4MMX A;  5IGO A;  3VI3 A;  2HJB A;  3UR4 A;  4FB1 D;  3K72 A;  3SCY A;  1NEX B;  3IUQ A;  3NVN A;  4CZY A;  4FA5 D;  4Z7O A;  2QZP A;  3EU7 A;  5FXY A;  4CI2 A;  3SN6 B;  1O6G A;  4QL1 A;  4FHL A;  1QFS A;  4O3U B;  4D9S A;  3SHF A;  2Q7Q A;  3J80 g;  4GMB A;  2I0S A;  2HU8 A;  3K6S A;  4AMZ A;  3IUR A;  4FA4 D;  3ULE C;  4GQ2 P;  2JKX A;  2OVR B;  4DNW A;  5HE3 B;  3AL8 A;  3OL2 A;  3GFC A;  2IWK A;  5H17 A;  5IGQ A;  4NBM A;  4RE5 A;  5C9Z B;  3CFV A;  2OK6 A;  3IUM A;  1VZ2 A;  2CE9 A;  1XKS A;  1PEV A;  4J81 A;  3UKR C;  4J79 A;  5C2W B;  2IUR A;  3OKY B;  3NVQ A;  4NEN A;  2XL3 A;  4J78 A;  4FA9 D;  2AGY A;  4GM8 A;  2QXV A;  2XZG A;  3I7K A;  4UM9 A;  2PM6 B;  3IVM A;  3SJL D;  2B5N A;  1GXR A;  4QQE A;  4E5Z B;  3NID A;  2VDP A;  2EIB A;  4A09 A;  4ESG A;  3VH0 A;  4PBZ A;  4AOW A;  4JSP C;  1RI6 A;  2I3T A;  5IJ7 E;  4GGC A;  3GD1 I;  1T2X A;  5CYK A;  4CY3 A;  2IWF A;  3EQ7 A;  3ZE0 A;  4GQ1 A;  2YNN A;  2Z2N A;  1TYE A;  3DSM A;  5B4W A;  2AQ5 A;  3MVD K;  1MG3 A;  5HYN B;  1U4C A;  1JMX B;  4J86 A;  3C75 H;  3UVN A;  3RLM D;  3PSC B;  2PM9 B;  4KFM B;  3SBQ A;  4UM8 A;  3I89 A;  3EI3 B;  4GQB B;  1O6F A;  3RMZ D;  4A0A B;  3PXS D;  4Z8L A;  3V4V A;  4A2M A;  4JXM A;  5FKS A;  2P9P C;  4K3I D;  5EML B;  4Z7Q A;  4OWR A;  3N0E A;  4AN0 A;  3QHY B;  3IJ0 A;  2BBK H;  3IUN A;  4O45 A;  4ZOZ A;  5AFU 3;  3T3M A;  4RE6 A;  1ERJ A;  4BCD A;  2MTA H;  4GM3 A;  4JHP C;  2VDK A;  4O9D A;  3NVX A;  5GMK n;  4A2L A;  3VGZ A;  2EBS A;  4XYI A;  1GG2 B;  1P22 A;  3SVW D;  3OTT A;  3JAM g;  1NR0 A;  4LG9 A;  5TEE A;  2H14 A;  1GP2 B;  3IUJ A;  3B7F A;  2I0T A;  2Z2P A;  5I5J A;  2VDN A;  2EIC A;  2VDQ A;  4L3H D;  5CXC B;  3K27 A;  5HQG A;  3OKY A;  5HDB A;  1JMZ B;  2YNO A;  3V5W B;  4HDJ A;  2BKL A;  5I5M A;  3OF7 A;  3DXK C;  5HE0 B;  3GRE A;  1VZ3 A;  3RRM C;  5K1C C;  5EAP A;  4TZ4 A;  5EAL A;  4L9O A;  4E5Z A;  4U7A A;  1JV2 A;  1YFQ A;  3ORV D;  5AJA A;  2CN2 A;  1M1X A;  2UZY B;  4Y7R A;  5HE2 B;  2AH1 A;  5EMM B;  2VDO A;  4O02 A;  3FM0 A;  1GOT B;  4G56 B;  4J77 A;  4NC4 A;  1UOP A;  5H14 A;  2OIZ A;  4BL0 A;  3RFH A;  4JHN A;  2J55 H;  3MUN A;  3EI1 A;  4A0B B;  2H68 A;  3DWL C;  3EI3 A;  1E5T A;  4A0A A;  3I7P A;  3V4P A;  2B4E A;  2AGL A;  1PBY B;  3BWS A;  3UVO A;  4UI9 R;  1MG2 A;  2AGZ A;  2HU5 A;  2B5M A;  3EWE A;  4WK2 A;  1A12 A;  4WJK A;  5M5V A;  2BCJ B;  2PBI B;  4DNU A;  1JTD B;  1YR2 A;  3K71 A;  4IRZ A;  3PE7 A;  1K8K C;  4PSX B;  3I7L A;  2H9P A;  3AH8 B;  3L4M D;  4JT6 C;  4OZU A;  2H3X A;  3PXT D;  5CXC A;  3JPX A;  3UVL A;  1E8M A;  1XIP A;  4G1M A;  1I2M B;  4J84 A;  2XU7 A;  3C9C A;  5E6S A;  5JWZ A;  3UKU C;  4PSW B;  4A08 B;  3SLE D;  4J82 A;  4AX4 A;  2GC7 A;  2HJ4 A;  4GGA A;  3O4I A;  4R7A B;  3F3P A;  4QAM A;  4Y5R D;  1C9L A;  5FLX g;  3CFS B;  4CY5 A;  4ZOX A;  3MKQ A;  4ERY A;  3C5M A;  5FFO A;  4WK0 A;  2CO0 C;  3OKW A;  4J0W A;  4IMM A;  5GXI A;  3PSL A;  2P9U C;  3IJ1 A;  2HKM A;  2GC4 A;  4G1E A;  3JRO A;  5TF2 A;  1S4U X;  3JZN A;  1L0Q A;  3SBP A;  3ODT A;  4YVD A;  4L1Q D;  3MZL A;  4D0K A;  4JD2 C;  4BH6 A;  4A0B A;  3FCU A;  4PC0 A;  2WQ8 A; 
#chains in the Genus database with same CATH homology
 4X3E A;  3L4O D;  4X63 B;  3V9F A;  3KRX B;  3F3G A;  4CZV A;  2O9K A;  4GGD A;  3JZH A;  1OMW B;  1N6E A;  4JT5 C;  2CO0 A;  4FAN D;  4CZX A;  3I2N A;  4O1Q D;  1OLZ A;  3BG1 A;  4CC9 A;  3EI4 B;  2AH0 A;  4I79 A;  3RN1 D;  2G9A A;  2OJY A;  4E54 B;  5IJ8 E;  3KRW B;  3HFQ A;  2H6N A;  5H1M A;  2P9N C;  3AL9 A;  2J56 H;  3SMR A;  4A08 A;  3V7D B;  3I7N A;  2CNX A;  3MZK A;  3IIY A;  4LGN A;  3I7O A;  3P4F A;  1PGU A;  3EMH A;  2HKR A;  4O3T B;  2G99 A;  3FGB A;  1B9Y A;  3IJC A;  4J8B A;  3MXX A;  2P9I C;  3I8E A;  4CI8 A;  2YNP A;  2P9K C;  1SQJ A;  2PM9 A;  5SXM A;  4H5J A;  5KDO B;  3UVK A;  1SHY B;  2AGX A;  5CYK B;  3FRX A;  2YBA A;  2I3S A;  2H6K A;  2H9M A;  3BG0 A;  4EWR A;  1FWX A;  2OVQ B;  4H5I A;  4CI1 A;  4XEI C;  3UVM A;  5FKT A;  3I7H A;  5CXB B;  5HE1 B;  4CI3 A;  5FKR A;  4PXW A;  3CIK B;  4ERZ A;  4XYH A;  4ERQ A;  3EG6 A;  1JOF A;  3RSE C;  4GM9 A;  3C99 A;  4J87 A;  1MDA H;  1Q47 A;  3A0F A;  3EI4 A;  3SFZ A;  4JSV C;  2AGW A;  4X61 B;  4ES0 A;  2GNQ A;  4E54 A;  3F3F A;  2HXC A;  3IIW A;  4PBY A;  5A2Q g;  4X60 B;  4CY2 A;  2H47 A;  4QT8 A;  5EMJ B;  2H6Q A;  1U2V C;  4QRJ A;  4D6V A;  5EAM A;  4A11 B;  5EM2 B;  2TRC B;  2H9N A;  5IT9 g;  2IUP A;  4MK0 B;  1N6F A;  2CN3 A;  2P9S C;  2HYE A;  2IUQ A;  3EI2 B;  4FAV D;  1N6D A;  4L3G D;  5GSA A;  4JSX C;  2P9L C;  5AMS A;  1SQ9 A;  2PM7 B;  3DM0 A;  3N0D A;  2H9L A;  5EAR A;  5C2V B;  2XYI A;  5I5I A;  1QNI A;  1TBG A;  1TYQ C;  3PVW B;  3ZWL B;  1JJU B;  1VYH C;  1K32 A;  3PVU B;  2B5L A;  4GZ8 A;  4IA9 A;  5THA A;  5K19 A;  5TDH B;  2W18 A;  3OW8 A;  1B9X A;  2IAA A;  3I8C A;  5EMK B;  3E0C A;  3IKO A;  3OKT A;  3JZG A;  2OVP B;  4AEZ A;  1XHM A;  3JRP A;  3U4Y A;  3EI1 B;  5FA5 B;  5CXB A;  3K26 A;  3VA6 A;  2J57 G;  3PXW D;  3RN0 D;  1A0R B;  2CE8 A;  4N14 A;  2IUV A;  2Z2O A;  3W15 A;  4BUJ C;  2HES X;  3AL8 B;  3OL2 B;  4ZOV A;  2I0R A;  4NSX A;  3SBR A;  4A7J A;  2YMU A;  4JSN C;  3DXM C;  5GXH A;  2XL2 A;  2YB8 B;  4FA1 D;  4ZN4 A;  4J0X A;  3AFC A;  5EM2 A;  4A11 A;  2H13 A;  4ZOY A;  3MKS B;  4U1E I;  3J81 g;  3EI2 A;  3SWS D;  4CY1 A;  2OK4 A;  1PI6 A;  3SXT D;  5IC7 A;  2UZX B;  4A09 B;  5FKQ A;  3RFG A;  3MMY A;  4PNK B;  5FQD A;  4K3J B;  4LG8 A;  3JB9 L;  2QC5 A;  4J73 A;  4FWW A;  5TEF A;  4J8G A;  5IGO A;  2HJB A;  3UR4 A;  4FB1 D;  3SCY A;  1NEX B;  3NVN A;  4CZY A;  4FA5 D;  3EU7 A;  5FXY A;  4CI2 A;  3SN6 B;  4QL1 A;  4FHL A;  4O3U B;  3SHF A;  2Q7Q A;  3J80 g;  4GMB A;  2I0S A;  4FA4 D;  3ULE C;  4GQ2 P;  2OVR B;  5HE3 B;  3AL8 A;  3OL2 A;  3GFC A;  2IWK A;  5H17 A;  5IGQ A;  5C9Z B;  3CFV A;  2OK6 A;  2CE9 A;  1XKS A;  1PEV A;  4J81 A;  3UKR C;  4J79 A;  5C2W B;  2IUR A;  3OKY B;  3NVQ A;  2XL3 A;  4J78 A;  4FA9 D;  2AGY A;  4GM8 A;  2QXV A;  3I7K A;  2PM6 B;  3SJL D;  2B5N A;  1GXR A;  4QQE A;  4E5Z B;  4A09 A;  4ESG A;  3VH0 A;  4PBZ A;  4AOW A;  4JSP C;  1RI6 A;  2I3T A;  5IJ7 E;  4GGC A;  5CYK A;  4CY3 A;  2IWF A;  4GQ1 A;  2YNN A;  2Z2N A;  3DSM A;  5B4W A;  2AQ5 A;  1MG3 A;  5HYN B;  1U4C A;  1JMX B;  4J86 A;  3C75 H;  3UVN A;  3RLM D;  3PSC B;  2PM9 B;  4KFM B;  3SBQ A;  3I89 A;  3EI3 B;  4GQB B;  3RMZ D;  4A0A B;  3PXS D;  4Z8L A;  4A2M A;  4JXM A;  5FKS A;  2P9P C;  4K3I D;  5EML B;  4OWR A;  3N0E A;  3IJ0 A;  2BBK H;  4O45 A;  4ZOZ A;  5AFU 3;  1ERJ A;  2MTA H;  4GM3 A;  4O9D A;  3NVX A;  5GMK n;  4A2L A;  3VGZ A;  2EBS A;  4XYI A;  1GG2 B;  1P22 A;  3SVW D;  3OTT A;  3JAM g;  1NR0 A;  4LG9 A;  5TEE A;  2H14 A;  1GP2 B;  3B7F A;  2I0T A;  2Z2P A;  5I5J A;  4L3H D;  5CXC B;  3K27 A;  5HQG A;  3OKY A;  1JMZ B;  2YNO A;  3V5W B;  4HDJ A;  5I5M A;  3DXK C;  5HE0 B;  3GRE A;  3RRM C;  5K1C C;  5EAP A;  4TZ4 A;  5EAL A;  4L9O A;  4E5Z A;  4U7A A;  1YFQ A;  3ORV D;  5AJA A;  2CN2 A;  2UZY B;  4Y7R A;  5HE2 B;  2AH1 A;  5EMM B;  3FM0 A;  1GOT B;  4G56 B;  4J77 A;  5H14 A;  2OIZ A;  4BL0 A;  3RFH A;  2J55 H;  3EI1 A;  4A0B B;  2H68 A;  3DWL C;  3EI3 A;  4A0A A;  3I7P A;  2B4E A;  2AGL A;  1PBY B;  3BWS A;  3UVO A;  4UI9 R;  1MG2 A;  2AGZ A;  2B5M A;  3EWE A;  2BCJ B;  2PBI B;  3PE7 A;  1K8K C;  4PSX B;  3I7L A;  2H9P A;  3AH8 B;  3L4M D;  4JT6 C;  4OZU A;  2H3X A;  3PXT D;  5CXC A;  3JPX A;  3UVL A;  1XIP A;  4J84 A;  2XU7 A;  3C9C A;  5JWZ A;  4A08 B;  3UKU C;  4PSW B;  3SLE D;  4J82 A;  2GC7 A;  2HJ4 A;  4GGA A;  4R7A B;  3F3P A;  4Y5R D;  5FLX g;  3CFS B;  4CY5 A;  4ZOX A;  3MKQ A;  4ERY A;  3C5M A;  2CO0 C;  3OKW A;  4J0W A;  4IMM A;  5GXI A;  3PSL A;  2P9U C;  3IJ1 A;  2HKM A;  2GC4 A;  3JRO A;  5TF2 A;  1S4U X;  3JZN A;  1L0Q A;  3SBP A;  3ODT A;  4YVD A;  4L1Q D;  3MZL A;  4D0K A;  4JD2 C;  4BH6 A;  4A0B A;  4PC0 A;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...