5EAVA

Unliganded structure of the ornithine aminotransferase from toxoplasma gondii
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
422
structure length
422
Chain Sequence
RKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDSDAIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unliganded structure of the ornithine aminotransferase from Toxoplasma gondii
rcsb
source organism Toxoplasma gondii me49
molecule tags Transferase
molecule keywords Ornithine aminotransferase, mitochondrial, putative
total genus 149
structure length 422
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.6.1.13: Ornithine aminotransferase.
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5eavA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5eavA01
4F5HA 1ELUA 3AENB 1QISA 1SPAA 3N5MA 1T3IA 2W8WA 1H0CA 1ARSA 1SVVA 1V2FA 3BV0A 5EAVA 2BWOA 3AEOA 4ZSWA 4XJMA 3AEJA 4ADBA 2ZP7A 4A00A 1LK9A 1I29A 2AEVA 1C0NA 5F9SA 1GCKA 1AKBA 3HBXA 1C4KA 2VMRA 3AELA 4MKJA 4Q31A 1LC7A 3AEPA 2O7CA 2W7MA 5BJ3A 3T32A 1C7NA 4BQ0A 1D7VA 3PGYA 1WYVB 2VMOA 2EPJA 1OATA 2X5DA 4OT8A 2YOBA 4PVFA 3FTBA 4GE9A 4ZM4A 1ASNA 2G6WA 2Z20A 3MADA 4J5UA 4JE5A 1WYTA 1V2EA 4F5MA 1I48A 5DB5A 3FCRA 1S0AA 1M32A 2VMUA 5DJ9A 4U1TA 3UWCA 3GETA 2OQXA 3FFRA 3N75A 4B9BA 2BYJA 2AATA 5G4IA 2VGUA 2BWNA 3H7FA 5E4ZA 1W7LA 1S08A 4R8DA 2AEUA 2Z67A 4XJLA 2CY8A 1Y4IA 4FFCA 2FNUA 4GDYA 3MKJA 1BW0A 1SF2A 3WLXA 1ASMA 4A0HA 4ZDOA 2EGYA 5E3KA 5TF5A 4GRXA 3PDXA 3EI5A 1Z3ZA 3DXWA 4GE7A 1V72A 1CQ6A 2YKXA 1ASLA 4W1XA 3LWSA 1PG8A 4ZASA 3ZZKA 9AATA 4LNMA 1M4NA 2VI9A 4JEZA 2ZUKA 4ATQA 4IX8A 2F8JA 2D5YA 1AJSA 3FKDA 3GZDA 2WKAA 3W1IA 1MAPA 3PD6A 1AY8A 2E54A 1AHGA 5DJ1A 1YJYA 4Q75A 2R2NA 3I5TA 5FT5A 2W7GA 2VMWA 4A6UA 3TQXA 3CQ6A 1ORDA 4RITA 1TOKA 2OGAA 2TPLA 2W7EA 3F6TA 4A72A 3ASAA 2VIBA 1ASEA 4WXGA 3ATHA 1BT4A 3FQAA 2GB3A 2CH1A 4QGRA 3VK2A 3EIBA 1N31A 3ACZA 4I8AA 3RCHA 2BI9A 5EUNA 2W8TA 3FVUA 2AY7A 3PA9A 2R5CA 2X3LA 2VMSA 2VMXA 3JZLA 2VGTA 4M2JA 3PD6B 4XJOA 4E1OA 1DGEA 1C9CA 3FQ7A 1M0NA 2Q7WA 4Y0IA 1KL2A 2HOXA 3B8XA 3LY1A 1ASAA 2OATA 4EMYA 3L8AA 4IXOA 1WYVA 3E2YA 1OHVA 4WB0A 3NUBA 4ITXA 2HZPA 2BHXA 2O1BA 3FFHA 1C7GA 1VP4A 4RM1A 4RKDA 1JG8A 1CS1A 3RQ1A 2NMPA 2QB3A 3BCAA 4W5KA 2BIEA 2PO3A 4F5FA 1B5OA 3G0TA 1P3WA 4WYEA 3UE8A 4CBSA 3TFTA 2C0RA 2D64A 1U08A 3MBBA 5FT6A 3AENA 4UOYA 4ZWVA 4F4EA 3EZSA 4TN4A 1GC0A 1QITA 2VMTA 2VIAA 4WD2A 2Z9WA 1SZKA 2JGTA 3BWOA 5G2QA 2GMSA 2ZSLA 2YRRA 1LW5A 2VGVA 4BMKA 1DJUA 1EG5A 3R9AA 2D66A 4WYGA 1AY4A 1ARGA 2DOUA 2ZC0A 4XJPA 4AO9A 1WYTB 1ELQA 4P7YA 4B98A 1YIZA 3BN1A 4OYTA 4MGRA 3EUCA 2YCPA 1TPLA 2RFVA 1G4XA 5G09A 4XQ2A 3CBFA 4ADDA 3NX3A 1AHXA 3EI7A 1RV4A 3QN6A 1GC3A 2DR1A 4JE5D 1DTYA 1N2TA 1IBJA 2VMPA 1AAWA 2CFBA 2FN6A 3G8MA 3GWPA 4MY5A 4XEWA 1YIYA 1Z7DA 2QLRA 2W8JA 1MGVA 2AY8A 5EFSA 1D7SA 4TV7A 2QA3A 2R0TA 1AIBA 4UQVA 1AHEA 3BWNC 3WZFA 3F0HA 4Y0DA 5EIGB 1MAQA 3WGCA 3DU4A 4ISYA 4WP0A 2W7HA 3B46A 1TOEA 4WXFA 4EB5A 5J8QA 3ASBA 5C6UA 1AJRA 2W8VA 4WBTA 4EFFA 5LHAA 1IAYA 5G4JA 1S07A 3E2FA 2VYCA 2HP1A 2VLFA 2YHKA 1MDXA 4IXZA 3ZRPA 2AY1A 3BC8A 4Q6RA 3NYSA 4IW7A 3TATA 3KGXA 3PDBB 1O69A 2V1PA 3QBOA 4F5IA 1LKCA 1DJ9A 3GSBA 1FG7A 2BKWA 2CINA 4JEYA 3ECDA 3LVKA 3EIAA 1W7NA 2OGEA 2VGSA 3E2ZA 3P1TA 2AY2A 1DKAA 2BIGA 3IHJA 2O0RA 4MQQA 4F5LA 1O61A 5K8BA 2Z9VA 3QHXA 1IJIA 4OCAA 3L44A 5D5SA 3VK4A 2YRIA 1AAMA 3DXVA 3TFUA 1KMKA 4NOGA 4UHMA 2VMQA 1N8PA 4BHDA 3WGBA 2VLHA 3WCOA 2D63A 1ASFA 4GEBA 5EUDA 2GMUA 4LNLA 4F5GA 1VEFA 2ZY2A 3UAKA 3WCNA 2XBNA 2X8UA 2JJGA 2Z9UA 2ZYJA 3GBXA 1AHFA 1J04A 1CZCA 2HP2A 1LC8A 1KKPA 4R2NA 4WXBA 3II0A 2AY5A 1WYUB 2ZY4A 1G4VA 3MC6A 3HVYA 1TASA 4PIWA 1O4SA 4OBUA 3HLMA 1ASGA 1ASBA 1BJWA 1AMQA 4PFNA 1BJOA 2BYLA 3JWAA 1JS6A 4ITGA 3QGUA 2AY3A 3I4JA 3FVXA 4BA5A 3QPGA 1CQ8A 3AEJC 1O62A 2DGLA 2PB2A 5F8VA 1WKGA 4WLHA 3OKSA 3JU7A 4JF1A 3GZCA 1GEYA 2WK7A 2W7FA 3BCXA 3A8UX 1RVUA 3GR9A 1LS3A 1C7OA 3M5UA 4IXSA 3DYDA 4W1WA 3RBFA 2OKJA 1B8GA 2Z1YA 2JJHA 4ZDLA 1BS0A 3EZ1A 4OTLA 1S06A 3NTJA 3AOVA 2QBTA 1YAAA 3FZ7A 4OMAA 4Y0HA 4MSOA 2C81A 1KKJA 2HUIA 2DGKA 2EZ1A 1V2DA 4LW2A 1YJSA 3LVJA 1SZSA 1DGDA 1TATA 1B5PA 1SZUA 2EZ2A 1GEWA 3HMUA 2Z61A 2CTZA 3FSLA 3PDBA 3PPLA 1FC4A 4IYOB 4R5FA 1W7MA 3BCBA 3CQ4A 3CQ5A 3FZ6A 2CJHA 4JEWA 4K2MA 3RBLA 4IYOA 1ASCA 3EI6A 2EO5A 4Q76A 4DBCA 1BQAA 3BB8A 3MAFB 1WYUA 1TOGA 2HUUA 1M7YA 3D6KA 2DKJA 2CH2A 3A9ZA 3K28A 3LVLB 4ADCA 3NYTA 4ZAHA 3COGA 2W7DA 3ZZJA 1CL1A 1AX4A 3AATA 2JJEA 3A9YA 3GJUA 3BS8A 4HF8A 3VAXA 5BJ4A 2CJDA 2FNIA 4JEXA 1MDZA 2BI3A 2Z9XA 4RJ0A 1QJ3A 5D95A 4DGTA 3PAAA 1ASDA 7AATA 3DRDA 5FT4A 3FD0A 3GZDC 3MAFA 4M2KA 3DC1A 5FT8A 3USFA 1IX8A 4KAMA 3ELPA 3DODA 4W91A 3E77A 3WX9A 4BA4A 3ZRRA 4GE4A 2R5EA 8AATA 3HT4A 2VMYA 3VK3A 1OHWA 5M49A 4H51A 1BJNA 1D2FA 1GC4A 1W3UA 1RV3A 3B1EA 1QZ9A 1G7XA 4RIZA 4K2BA 1X28A 2XH1A 1IX7A 3LV2A 4WYDA 1YNUA 2D7YA 4DQ6A 1UKJA 5DX5A 3OP7A 4L0OA 3LVMA 4KYOA 4MQPA 1SFFA 4WYCA 2AY4A 2D7ZA 4UHOA 5I92A 3FDDA 4XK1A 3FVSA 4OBVA 1WSTA 4E77A 1S09A 4WLJA 4EU1A 3KGWA 2EH6A 3RUYA 3W1JA 5AX8A 1CQ7A 4TMRA 1MLYA 1G7WA 1FG3A 5HHYA 3NDNA 3QM2A 4KXKA 2C7TA 4U2HA 3HL2A 2QB2A 4N0WA 3NRAA 4LW4A 4A0FA 2JG2A 1GEXA 4AOAA 2E7JA 4XAUA 1WKHA 1BQDA 4UHNA 4O6ZA 3FDBA 1M0QA 1OXPA 2YKUA 1IVRA 3EI8A 3JW9A 1CZEA 1JS3A 1XEYA 3MAUA 2D61A 1W23A 1YJZA 1ARTA 2BIAA 3VP6A 3AEMA 2BI1A 2WK8A 1QGNA 4EB7A 1KL1A 2YKYA 2W7LA 1JF9A 2GQNA 1AIAA 3HQTA 4LNJA 3ZRQA 2ZY3A 4OC9A 1IAXA 3E9KA 4CXQA 4IY7A 4P3MA 3NU8A 4LC3A 4WB0B 3K7YA 5M4BA 1E5EA 2CJGA 1LW4A 3N0LA 1PMOA 2VMNA 2HORA 3AV7A 1M6SA 3KE3A 2ORDA 5HDMA 2HUFA 2JJFA 2W7IA 1IUGA 3B1CA 3CAIA 5EQCA 2YCTA 3E2ZB 3JTXA 2FM1A 1UU2A 1ARIA 4K2IA 3PIUA 2AY6A 2WK9A 2FQ6A 2JISA 2E7UA 1PMMA 2VMVA 3FZ8A 4JF0A 3NUIA 4ZLVA 4R5ZA 2W8UA 3NU7A 3ELEA 1GD9A 3DR7A 4M2MA 1AMRA 1RVYA 2ZJGA 3F9TA 3I16A 3WKRA 5M46A 1YOOA 1ZOBA 5G0AA 2CANA 3BWNA 1X0MA 5M4DA 1AY5A 2YCNA 3QI6A 1QIRA 4MKKA 5G2PA 3ISLA 5JAYA 4J8LA 1X29A 4AZKA 2E7IA 2C44A 3IF2A 2AY9A 3DR4A 1TOJA 1D7UA 3K40A 4GSAA 3A9XA 1ECXA 1B9HA 4W1VA 2GSAA 1M0OA 3AOWA 2YKVA 3B1DA 2R5CB 1TOIA 3P6KA 1CJ0A 4CBRA 4A6TA 4CVQA 1GC2A 1QJ5A 2CB1A 3JWBA 4ZWMA 4A6RA 3A2BA 1EJIA 4FL0A 1EQBA 3FRKA 3NNKA 4RLGA 4PFFA 1AKCA 3H14A 5LH9A 4A0GA 2DGMA 4E3QA 1TARA 1DFOA 2HOYA 3LG0A 3NYUA 3WY7A 2W7JA 4N0BA 1LC5A 3MEBA 1I41A 3PJ0A 4F5JA 3FQ8A 4RKCA 4ADEA 3AEMC 3E6GA 2BI2A 3G7QA 4A0RA 2BWPA 1J32A 1AICA 3EI9A 2VGZA 1VJOA 1D7RA 2OKKA 1PFFA 1CL2A 3WKSA 2Z1ZA 2CSTA 2VMZA 1BJOB 3KKIA 1GDEA 2V0YA 1AJSB 1I43A 4RAEA 2D65A 2X5FA 1OHYA 2BI5A 4HVKA 3DZZA 2W7KA 4WYAA 4CXRA 1B4XA 1BJ4A 3HDOA 3TCMA 4ZSYA 4F5KA 3RI6A 4AZJA 5EAAA 4RJYA 4ZM3A 2VGWA 1UU0A 1AMSA 1H1CA 3Q8NA 4MQRA 4ATPA 1XI9A 1AKAA 2ZY5A 2QMAA 5E5IA 3VOMA 5EUEA 1GBNA 1ZODA 4ZDPA 1MDOA 1UU1A 1IX6A 1E5FA 1DJEA 1X2AA 2HOZA 4WYFA 3RCHB 5IWQA 2PB0A 4JEVA 4AH3A 1AMAA 1KMJA 3W1HA 1MLZA 1M0PA 2ZSMA 3MC6C 1OXOA 2DKBA 2FYFA 2VI8A 3R4TA 5EIGA 4AO4A 1ZC9A 1B9IA 1ARHA 1AHYA 4E3RA 1BKGA 5HXXA 4W8IA
chains in the Genus database with same CATH superfamily
4F5HA 1ELUA 3AENB 1QISA 1SPAA 3N5MA 1T3IA 2W8WA 1H0CA 1ARSA 1SVVA 1V2FA 3BV0A 5EAVA 2BWOA 3AEOA 4ZSWA 4XJMA 3AEJA 4ADBA 2ZP7A 4A00A 1LK9A 1I29A 2AEVA 1C0NA 5F9SA 1GCKA 1AKBA 3HBXA 1C4KA 2VMRA 3AELA 4MKJA 4Q31A 1LC7A 3AEPA 2O7CA 2W7MA 5BJ3A 3T32A 1C7NA 4BQ0A 1D7VA 3PGYA 1WYVB 2VMOA 2EPJA 1OATA 2X5DA 4OT8A 2YOBA 1KAFA 4PVFA 3FTBA 4GE9A 4ZM4A 1ASNA 2G6WA 2Z20A 3MADA 4J5UA 4JE5A 1WYTA 1V2EA 4F5MA 1I48A 5DB5A 3FCRA 1S0AA 1M32A 2VMUA 5DJ9A 4U1TA 3UWCA 2KFPA 3GETA 2OQXA 3FFRA 3N75A 4B9BA 2BYJA 2AATA 5G4IA 2VGUA 2BWNA 2WB6A 3H7FA 5E4ZA 1W7LA 1S08A 4R8DA 2AEUA 2Z67A 4XJLA 2CY8A 1Y4IA 4FFCA 2FNUA 4GDYA 3MKJA 1BW0A 1SF2A 3WLXA 1ASMA 4A0HA 4ZDOA 2EGYA 5E3KA 5TF5A 4GRXA 3PDXA 3EI5A 1Z3ZA 3DXWA 4GE7A 1V72A 1CQ6A 2YKXA 1ASLA 4W1XA 3LWSA 1PG8A 4ZASA 3ZZKA 9AATA 4LNMA 1M4NA 2VI9A 4JEZA 2ZUKA 4ATQA 4IX8A 2F8JA 2D5YA 1AJSA 3FKDA 3GZDA 2WKAA 3W1IA 1MAPA 3PD6A 1AY8A 2E54A 1AHGA 5DJ1A 1YJYA 4Q75A 2R2NA 3I5TA 5FT5A 2W7GA 2VMWA 4A6UA 3TQXA 3CQ6A 1ORDA 4RITA 1TOKA 2OGAA 2TPLA 2W7EA 3F6TA 4A72A 3ASAA 2VIBA 1ASEA 4WXGA 3ATHA 1BT4A 3FQAA 2GB3A 2CH1A 4QGRA 3VK2A 3EIBA 1N31A 3ACZA 4I8AA 3RCHA 2BI9A 5EUNA 2W8TA 3FVUA 2AY7A 3PA9A 2R5CA 2X3LA 2VMSA 2VMXA 3JZLA 2VGTA 4M2JA 3PD6B 4XJOA 4E1OA 1DGEA 1C9CA 3FQ7A 1M0NA 2Q7WA 4Y0IA 1KL2A 2HOXA 3B8XA 3LY1A 1ASAA 2OATA 4EMYA 3L8AA 4IXOA 1WYVA 3E2YA 1OHVA 4WB0A 3NUBA 4ITXA 2HZPA 2BHXA 2O1BA 3FFHA 1C7GA 1VP4A 4RM1A 4RKDA 1JG8A 1CS1A 3RQ1A 2NMPA 2QB3A 3BCAA 4W5KA 2BIEA 2PO3A 4F5FA 1B5OA 3G0TA 1P3WA 4WYEA 3UE8A 4CBSA 3TFTA 2C0RA 2D64A 1U08A 3MBBA 5FT6A 3AENA 4UOYA 4ZWVA 4F4EA 3EZSA 4TN4A 1GC0A 1QITA 2VMTA 2VIAA 4WD2A 2Z9WA 1SZKA 2JGTA 3BWOA 5G2QA 2GMSA 2ZSLA 2YRRA 1LW5A 2VGVA 4BMKA 1DJUA 1EG5A 3R9AA 2D66A 4WYGA 1AY4A 1ARGA 2DOUA 2ZC0A 4XJPA 4AO9A 1WYTB 1ELQA 4P7YA 4B98A 1YIZA 3BN1A 4OYTA 4MGRA 3EUCA 2YCPA 1TPLA 2RFVA 1G4XA 5G09A 4XQ2A 3CBFA 4ADDA 3NX3A 1AHXA 3EI7A 1RV4A 3QN6A 1GC3A 2DR1A 4JE5D 1DTYA 1N2TA 1IBJA 2VMPA 1AAWA 2CFBA 2FN6A 3G8MA 3GWPA 4MY5A 4XEWA 1YIYA 1Z7DA 2QLRA 3H9XA 2W8JA 1MGVA 2AY8A 5EFSA 1D7SA 4TV7A 2QA3A 2R0TA 4K05A 1AIBA 4UQVA 1AHEA 3BWNC 3WZFA 3F0HA 4Y0DA 5EIGB 1MAQA 3WGCA 3DU4A 4ISYA 4WP0A 2W7HA 3B46A 1TOEA 4WXFA 4EB5A 5J8QA 3ASBA 5C6UA 1AJRA 2W8VA 4WBTA 4EFFA 5LHAA 1IAYA 5G4JA 1S07A 3E2FA 2VYCA 2HP1A 2VLFA 2YHKA 1MDXA 4IXZA 3ZRPA 2AY1A 3BC8A 4Q6RA 3NYSA 4IW7A 3TATA 3KGXA 3PDBB 1O69A 2V1PA 3QBOA 4F5IA 1LKCA 1DJ9A 3GSBA 1FG7A 2BKWA 2CINA 4JEYA 3ECDA 3LVKA 3EIAA 1W7NA 2OGEA 2VGSA 3E2ZA 3P1TA 2AY2A 1DKAA 2BIGA 3IHJA 2O0RA 4MQQA 4F5LA 1O61A 5K8BA 2Z9VA 3QHXA 1IJIA 4OCAA 3L44A 5D5SA 3VK4A 2YRIA 1AAMA 3DXVA 3TFUA 1KMKA 5KTBA 4NOGA 4UHMA 2VMQA 1N8PA 4BHDA 3WGBA 2VLHA 3WCOA 2D63A 1ASFA 4GEBA 5EUDA 2GMUA 4LNLA 4F5GA 1VEFA 2ZY2A 3UAKA 3WCNA 2XBNA 2X8UA 2JJGA 2Z9UA 2ZYJA 3GBXA 1AHFA 1J04A 1CZCA 2HP2A 1LC8A 1KKPA 4R2NA 4WXBA 3II0A 2AY5A 1WYUB 2ZY4A 1G4VA 3MC6A 3HVYA 1TASA 4PIWA 1O4SA 4OBUA 3HLMA 1ASGA 1ASBA 1BJWA 1AMQA 4PFNA 1BJOA 2BYLA 3JWAA 1JS6A 4ITGA 3QGUA 2AY3A 3I4JA 3FVXA 4BA5A 3QPGA 1CQ8A 3AEJC 1O62A 2DGLA 2PB2A 5F8VA 1WKGA 4WLHA 3OKSA 3JU7A 4JF1A 3GZCA 1GEYA 2WK7A 2W7FA 3BCXA 3A8UX 1RVUA 3GR9A 1LS3A 1C7OA 3M5UA 4IXSA 3DYDA 4W1WA 3RBFA 2OKJA 1B8GA 2Z1YA 2JJHA 4ZDLA 1BS0A 3EZ1A 4OTLA 1S06A 3NTJA 3AOVA 2QBTA 1YAAA 3FZ7A 4OMAA 4Y0HA 4MSOA 2C81A 1KKJA 2HUIA 2DGKA 2EZ1A 1V2DA 4LW2A 1YJSA 3LVJA 1SZSA 1DGDA 1TATA 1B5PA 1SZUA 2EZ2A 1GEWA 3HMUA 2Z61A 2CTZA 3FSLA 3PDBA 3PPLA 1FC4A 4IYOB 4R5FA 1W7MA 3BCBA 3CQ4A 3CQ5A 3FZ6A 2CJHA 4JEWA 4K2MA 3RBLA 4IYOA 1ASCA 3N4RA 3EI6A 2EO5A 4Q76A 4DBCA 1BQAA 3BB8A 3MAFB 1WYUA 1TOGA 2HUUA 3N4XA 1M7YA 3D6KA 2DKJA 2CH2A 3A9ZA 3K28A 3LVLB 4ADCA 3NYTA 4ZAHA 3COGA 2A1VA 2W7DA 3ZZJA 1CL1A 1AX4A 3AATA 2JJEA 3A9YA 3GJUA 3BS8A 4HF8A 3VAXA 5BJ4A 2CJDA 2FNIA 4JEXA 1MDZA 2BI3A 2Z9XA 4RJ0A 1QJ3A 5D95A 4DGTA 3PAAA 1ASDA 3N4SA 7AATA 3DRDA 5FT4A 3FD0A 3GZDC 3MAFA 4M2KA 3DC1A 5FT8A 3USFA 1IX8A 4KAMA 3ELPA 3DODA 4W91A 3E77A 3WX9A 4BA4A 3ZRRA 4GE4A 2R5EA 8AATA 3HT4A 2VMYA 3VK3A 1OHWA 5M49A 4H51A 1BJNA 1D2FA 1GC4A 1W3UA 1RV3A 3B1EA 1QZ9A 1G7XA 4RIZA 4K2BA 1X28A 2XH1A 1IX7A 3LV2A 4WYDA 1YNUA 2D7YA 4DQ6A 1UKJA 5DX5A 3OP7A 4L0OA 3LVMA 4KYOA 4MQPA 1SFFA 4WYCA 2AY4A 2D7ZA 4UHOA 5I92A 3FDDA 4XK1A 3FVSA 4OBVA 1WSTA 4E77A 1S09A 4WLJA 4EU1A 3KGWA 2EH6A 3RUYA 3W1JA 5AX8A 1CQ7A 4TMRA 1MLYA 1G7WA 1FG3A 5HHYA 3NDNA 3QM2A 4KXKA 2C7TA 4U2HA 3HL2A 2QB2A 4N0WA 3NRAA 4LW4A 4A0FA 2JG2A 1GEXA 4AOAA 2E7JA 4XAUA 1WKHA 1BQDA 4UHNA 4O6ZA 3FDBA 1M0QA 1OXPA 2YKUA 1IVRA 3EI8A 3JW9A 1CZEA 1JS3A 1XEYA 3MAUA 2D61A 1W23A 1YJZA 1ARTA 2BIAA 3VP6A 3AEMA 2BI1A 2WK8A 1QGNA 4EB7A 1KL1A 2YKYA 2W7LA 1JF9A 2GQNA 1AIAA 3HQTA 4LNJA 3ZRQA 2ZY3A 4OC9A 1IAXA 3E9KA 4CXQA 4IY7A 4P3MA 3NU8A 2QSRA 4LC3A 4WB0B 3K7YA 5M4BA 1E5EA 2CJGA 1LW4A 3N0LA 1PMOA 2VMNA 2HORA 3AV7A 1M6SA 3KE3A 2ORDA 3N7NA 5HDMA 2HUFA 2JJFA 2W7IA 1IUGA 3B1CA 3CAIA 5EQCA 2YCTA 3E2ZB 3JTXA 2FM1A 1UU2A 1ARIA 4K2IA 3PIUA 2AY6A 2WK9A 2FQ6A 2JISA 2E7UA 1PMMA 2VMVA 3FZ8A 4JF0A 3NUIA 4ZLVA 4R5ZA 2W8UA 3NU7A 3ELEA 1GD9A 3DR7A 4M2MA 1AMRA 1RVYA 2ZJGA 3F9TA 3I16A 3WKRA 5M46A 1YOOA 1ZOBA 5G0AA 2CANA 3BWNA 2FKIA 1X0MA 5M4DA 1AY5A 2YCNA 3QI6A 1QIRA 4MKKA 5G2PA 2G7JA 3ISLA 5JAYA 4J8LA 1X29A 4AZKA 2E7IA 2C44A 3IF2A 2AY9A 3DR4A 1TOJA 1D7UA 3K40A 4GSAA 3A9XA 1ECXA 1B9HA 4W1VA 2GSAA 1M0OA 3AOWA 2YKVA 3B1DA 2R5CB 1TOIA 3P6KA 1CJ0A 4CBRA 4A6TA 4CVQA 1GC2A 1QJ5A 2CB1A 3JWBA 4ZWMA 4A6RA 3A2BA 1EJIA 4FL0A 1EQBA 3FRKA 3NNKA 4RLGA 4PFFA 1AKCA 3H14A 5LH9A 4A0GA 2DGMA 4E3QA 2EYQA 1TARA 4H63Q 1DFOA 2HOYA 3LG0A 3NYUA 3WY7A 2W7JA 4N0BA 1LC5A 3MEBA 1I41A 3PJ0A 4F5JA 3FQ8A 4RKCA 4ADEA 3AEMC 3E6GA 2BI2A 3G7QA 4A0RA 2BWPA 1J32A 1AICA 3EI9A 2VGZA 1VJOA 1D7RA 2OKKA 1PFFA 1CL2A 3WKSA 2Z1ZA 2CSTA 2VMZA 1BJOB 3KKIA 1GDEA 2V0YA 1AJSB 1I43A 4RAEA 2D65A 2X5FA 1OHYA 2BI5A 4HVKA 3DZZA 2W7KA 4WYAA 4CXRA 1B4XA 1BJ4A 3HDOA 3TCMA 4ZSYA 4F5KA 3RI6A 4AZJA 5EAAA 4RJYA 4ZM3A 2VGWA 1UU0A 1AMSA 1H1CA 3Q8NA 4MQRA 4ATPA 1XI9A 1AKAA 2ZY5A 2QMAA 5E5IA 3VOMA 5EUEA 1GBNA 1ZODA 4ZDPA 1MDOA 1UU1A 1IX6A 1E5FA 1DJEA 1X2AA 2HOZA 4WYFA 3RCHB 5IWQA 2PB0A 4JEVA 4AH3A 1AMAA 1KMJA 3W1HA 1MLZA 1M0PA 2ZSMA 3MC6C 1OXOA 2DKBA 2FYFA 2VI8A 3R4TA 5EIGA 4AO4A 1ZC9A 1B9IA 1ARHA 1AHYA 4E3RA 1BKGA 5HXXA 4W8IA
chains in the Genus database with same CATH topology
4F5HA 1ELUA 3AENB 1QISA 1SPAA 3N5MA 1T3IA 2W8WA 1H0CA 1ARSA 1SVVA 1V2FA 3BV0A 5EAVA 2BWOA 3AEOA 4ZSWA 4XJMA 3AEJA 4ADBA 2ZP7A 4A00A 1LK9A 1I29A 2AEVA 1C0NA 5F9SA 1GCKA 1AKBA 3HBXA 1C4KA 2VMRA 3AELA 4MKJA 4Q31A 1LC7A 3AEPA 2O7CA 2W7MA 5BJ3A 3T32A 1C7NA 4BQ0A 1D7VA 3PGYA 1WYVB 2VMOA 2EPJA 1OATA 2X5DA 4OT8A 2YOBA 4PVFA 3FTBA 4GE9A 4ZM4A 1ASNA 2G6WA 2Z20A 3MADA 4J5UA 4JE5A 1WYTA 1V2EA 4F5MA 1I48A 5DB5A 3FCRA 1S0AA 1M32A 2VMUA 5DJ9A 4U1TA 3UWCA 2KFPA 3GETA 2OQXA 3FFRA 3N75A 4B9BA 2BYJA 2AATA 5G4IA 2VGUA 2BWNA 2WB6A 3H7FA 5E4ZA 1W7LA 1S08A 4R8DA 2AEUA 2Z67A 4XJLA 2CY8A 1Y4IA 4FFCA 2FNUA 4GDYA 3MKJA 1BW0A 1SF2A 3WLXA 1ASMA 4A0HA 4ZDOA 2EGYA 5E3KA 5TF5A 4GRXA 3PDXA 3EI5A 1Z3ZA 3DXWA 4GE7A 1V72A 1CQ6A 2YKXA 1ASLA 4W1XA 3LWSA 1PG8A 4ZASA 3ZZKA 9AATA 4LNMA 1M4NA 2VI9A 4JEZA 2ZUKA 4ATQA 4IX8A 2F8JA 2D5YA 1AJSA 3FKDA 3GZDA 2WKAA 3W1IA 1MAPA 3PD6A 1AY8A 2E54A 1AHGA 5DJ1A 1YJYA 4Q75A 2R2NA 3I5TA 5FT5A 2W7GA 2VMWA 4A6UA 3TQXA 3CQ6A 1ORDA 4RITA 1TOKA 2OGAA 2TPLA 2W7EA 3F6TA 4A72A 3ASAA 2VIBA 1ASEA 4WXGA 3ATHA 1BT4A 3FQAA 2GB3A 2CH1A 4QGRA 3VK2A 3EIBA 1N31A 3ACZA 4I8AA 3RCHA 2BI9A 5EUNA 2W8TA 3FVUA 2AY7A 3PA9A 2R5CA 2X3LA 2VMSA 2VMXA 3JZLA 2VGTA 4M2JA 3PD6B 4XJOA 4E1OA 1DGEA 1C9CA 3FQ7A 1M0NA 2Q7WA 4Y0IA 1KL2A 2HOXA 3B8XA 3LY1A 1ASAA 2OATA 4EMYA 3L8AA 4IXOA 1WYVA 3E2YA 1OHVA 4WB0A 3NUBA 4ITXA 2HZPA 2BHXA 2O1BA 3FFHA 1C7GA 1VP4A 4RM1A 4RKDA 1JG8A 1CS1A 3RQ1A 2NMPA 2QB3A 3BCAA 4W5KA 2BIEA 2PO3A 4F5FA 1B5OA 3G0TA 1P3WA 4WYEA 3UE8A 4CBSA 3TFTA 2C0RA 2D64A 1U08A 3MBBA 5FT6A 3AENA 4UOYA 4ZWVA 4F4EA 3EZSA 4TN4A 1GC0A 1QITA 2VMTA 2VIAA 4WD2A 2Z9WA 1SZKA 2JGTA 3BWOA 5G2QA 2GMSA 2ZSLA 2YRRA 1LW5A 2VGVA 4BMKA 1DJUA 1EG5A 3R9AA 2D66A 4WYGA 1AY4A 1ARGA 2DOUA 2ZC0A 4XJPA 4AO9A 1WYTB 1ELQA 4P7YA 4B98A 1YIZA 3BN1A 4OYTA 4MGRA 3EUCA 2YCPA 1TPLA 2RFVA 1G4XA 5G09A 4XQ2A 3CBFA 4ADDA 3NX3A 1AHXA 3EI7A 1RV4A 3QN6A 1GC3A 2DR1A 4JE5D 1DTYA 1N2TA 1IBJA 2VMPA 1AAWA 2CFBA 2FN6A 3G8MA 3GWPA 4MY5A 4XEWA 1YIYA 1Z7DA 2QLRA 3H9XA 2W8JA 1MGVA 2AY8A 5EFSA 1D7SA 4TV7A 2QA3A 2R0TA 4K05A 1AIBA 4UQVA 1AHEA 3BWNC 3WZFA 3F0HA 4Y0DA 5EIGB 1MAQA 3WGCA 3DU4A 4ISYA 4WP0A 2W7HA 3B46A 1TOEA 4WXFA 4EB5A 5J8QA 3ASBA 5C6UA 1AJRA 2W8VA 4WBTA 4EFFA 5LHAA 1IAYA 5G4JA 1S07A 3E2FA 2VYCA 2HP1A 2VLFA 2YHKA 1MDXA 4IXZA 3ZRPA 2AY1A 3BC8A 4Q6RA 3NYSA 4IW7A 3TATA 3KGXA 3PDBB 1O69A 2V1PA 3QBOA 4F5IA 1LKCA 1DJ9A 3GSBA 1FG7A 2BKWA 2CINA 4JEYA 3ECDA 3LVKA 3EIAA 1W7NA 2OGEA 2VGSA 3E2ZA 3P1TA 2AY2A 1DKAA 2BIGA 3IHJA 2O0RA 4MQQA 4F5LA 1O61A 5K8BA 2Z9VA 3QHXA 1IJIA 4OCAA 3L44A 5D5SA 3VK4A 2YRIA 1AAMA 3DXVA 3TFUA 1KMKA 5KTBA 4NOGA 4UHMA 2VMQA 1N8PA 4BHDA 3WGBA 2VLHA 3WCOA 2D63A 1ASFA 4GEBA 5EUDA 2GMUA 4LNLA 4F5GA 1VEFA 2ZY2A 3UAKA 3WCNA 2XBNA 2X8UA 2JJGA 2Z9UA 2ZYJA 3GBXA 1AHFA 1J04A 1CZCA 2HP2A 1LC8A 1KKPA 4R2NA 4WXBA 3II0A 2AY5A 1WYUB 2ZY4A 1G4VA 3MC6A 3HVYA 1TASA 4PIWA 1O4SA 4OBUA 3HLMA 1ASGA 1ASBA 1BJWA 1AMQA 4PFNA 1BJOA 2BYLA 3JWAA 1JS6A 4ITGA 3QGUA 2AY3A 3I4JA 3FVXA 4BA5A 3QPGA 1CQ8A 3AEJC 1O62A 2DGLA 2PB2A 5F8VA 1WKGA 4WLHA 3OKSA 3JU7A 4JF1A 3GZCA 1GEYA 2WK7A 2W7FA 3BCXA 3A8UX 1RVUA 3GR9A 1LS3A 1C7OA 3M5UA 4IXSA 3DYDA 4W1WA 3RBFA 2OKJA 1B8GA 2Z1YA 2JJHA 4ZDLA 1BS0A 3EZ1A 4OTLA 1S06A 3NTJA 3AOVA 2QBTA 1YAAA 3FZ7A 4OMAA 4Y0HA 4MSOA 2C81A 1KKJA 2HUIA 2DGKA 2EZ1A 1V2DA 4LW2A 1YJSA 3LVJA 1SZSA 1DGDA 1TATA 1B5PA 1SZUA 2EZ2A 1GEWA 3HMUA 2Z61A 2CTZA 3FSLA 3PDBA 3PPLA 1FC4A 4IYOB 4R5FA 1W7MA 3BCBA 3CQ4A 3CQ5A 3FZ6A 2CJHA 4JEWA 4K2MA 3RBLA 4IYOA 1ASCA 3N4RA 3EI6A 2EO5A 4Q76A 4DBCA 1BQAA 3BB8A 3MAFB 1WYUA 1TOGA 2HUUA 3N4XA 1M7YA 3D6KA 2DKJA 2CH2A 3A9ZA 3K28A 3LVLB 4ADCA 3NYTA 4ZAHA 3COGA 2A1VA 2W7DA 3ZZJA 1CL1A 1AX4A 3AATA 2JJEA 3A9YA 3GJUA 3BS8A 4HF8A 3VAXA 5BJ4A 2CJDA 2FNIA 4JEXA 1MDZA 2BI3A 2Z9XA 4RJ0A 1QJ3A 5D95A 4DGTA 3PAAA 1ASDA 3N4SA 7AATA 3DRDA 5FT4A 3FD0A 3GZDC 3MAFA 4M2KA 3DC1A 5FT8A 3USFA 1IX8A 4KAMA 3ELPA 3DODA 4W91A 3E77A 3WX9A 4BA4A 3ZRRA 4GE4A 2R5EA 8AATA 3HT4A 2VMYA 3VK3A 1OHWA 5M49A 4H51A 1BJNA 1D2FA 1GC4A 1W3UA 1RV3A 3B1EA 1QZ9A 1G7XA 4RIZA 4K2BA 1X28A 2XH1A 1IX7A 3LV2A 4WYDA 1YNUA 2D7YA 4DQ6A 1UKJA 5DX5A 3OP7A 4L0OA 3LVMA 4KYOA 4MQPA 1SFFA 4WYCA 2AY4A 2D7ZA 4UHOA 5I92A 3FDDA 4XK1A 3FVSA 4OBVA 1WSTA 4E77A 1S09A 4WLJA 4EU1A 3KGWA 2EH6A 3RUYA 3W1JA 5AX8A 1CQ7A 4TMRA 1MLYA 1G7WA 1FG3A 5HHYA 3NDNA 3QM2A 4KXKA 2C7TA 4U2HA 3HL2A 2QB2A 4N0WA 3NRAA 4LW4A 4A0FA 2JG2A 1GEXA 4AOAA 2E7JA 4XAUA 1WKHA 1BQDA 4UHNA 4O6ZA 3FDBA 1M0QA 1OXPA 2YKUA 1IVRA 3EI8A 3JW9A 1CZEA 1JS3A 1XEYA 3MAUA 2D61A 1W23A 1YJZA 1ARTA 2BIAA 3VP6A 3AEMA 2BI1A 2WK8A 1QGNA 4EB7A 1KL1A 2YKYA 2W7LA 1JF9A 2GQNA 1AIAA 3HQTA 4LNJA 3ZRQA 2ZY3A 4OC9A 1IAXA 3E9KA 4CXQA 4IY7A 4P3MA 3NU8A 2QSRA 4LC3A 4WB0B 3K7YA 5M4BA 1E5EA 2CJGA 1LW4A 3N0LA 1PMOA 2VMNA 2HORA 3AV7A 1M6SA 3KE3A 2ORDA 3N7NA 5HDMA 2HUFA 2JJFA 2W7IA 1IUGA 3B1CA 3CAIA 5EQCA 2YCTA 3E2ZB 3JTXA 2FM1A 1UU2A 1ARIA 4K2IA 3PIUA 2AY6A 2WK9A 2FQ6A 2JISA 2E7UA 1PMMA 2VMVA 3FZ8A 4JF0A 3NUIA 4ZLVA 4R5ZA 2W8UA 3NU7A 3ELEA 1GD9A 3DR7A 4M2MA 1AMRA 1RVYA 2ZJGA 3F9TA 3I16A 3WKRA 5M46A 1YOOA 1ZOBA 5G0AA 2CANA 3BWNA 2FKIA 1X0MA 5M4DA 1AY5A 2YCNA 3QI6A 1QIRA 4MKKA 5G2PA 2G7JA 3ISLA 5JAYA 4J8LA 1X29A 4AZKA 2E7IA 2C44A 3IF2A 2AY9A 3DR4A 1TOJA 1D7UA 3K40A 4GSAA 3A9XA 1ECXA 1B9HA 4W1VA 2GSAA 1M0OA 3AOWA 2YKVA 3B1DA 2R5CB 1TOIA 3P6KA 1CJ0A 4CBRA 4A6TA 4CVQA 1GC2A 1QJ5A 2CB1A 3JWBA 4ZWMA 4A6RA 3A2BA 1EJIA 4FL0A 1EQBA 3FRKA 3NNKA 4RLGA 4PFFA 1AKCA 3H14A 5LH9A 4A0GA 2DGMA 4E3QA 2EYQA 1TARA 4H63Q 1DFOA 2HOYA 3LG0A 3NYUA 3WY7A 2W7JA 4N0BA 1LC5A 3MEBA 1I41A 3PJ0A 4F5JA 3FQ8A 4RKCA 4ADEA 3AEMC 3E6GA 2BI2A 3G7QA 4A0RA 2BWPA 1J32A 1AICA 3EI9A 2VGZA 1VJOA 1D7RA 2OKKA 1PFFA 1CL2A 3WKSA 2Z1ZA 2CSTA 2VMZA 1BJOB 3KKIA 1GDEA 2V0YA 1AJSB 1I43A 4RAEA 2D65A 2X5FA 1OHYA 2BI5A 4HVKA 3DZZA 2W7KA 4WYAA 4CXRA 1B4XA 1BJ4A 3HDOA 3TCMA 4ZSYA 4F5KA 3RI6A 4AZJA 5EAAA 4RJYA 4ZM3A 2VGWA 1UU0A 1AMSA 1H1CA 3Q8NA 4MQRA 4ATPA 1XI9A 1AKAA 2ZY5A 2QMAA 5E5IA 3VOMA 5EUEA 1GBNA 1ZODA 4ZDPA 1MDOA 1UU1A 1IX6A 1E5FA 1DJEA 1X2AA 2HOZA 4WYFA 3RCHB 5IWQA 2PB0A 4JEVA 4AH3A 1AMAA 1KMJA 3W1HA 1MLZA 1M0PA 2ZSMA 3MC6C 1OXOA 2DKBA 2FYFA 2VI8A 3R4TA 5EIGA 4AO4A 1ZC9A 1B9IA 1ARHA 1AHYA 4E3RA 1BKGA 5HXXA 4W8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F5H A;  1ELU A;  3AEN B;  1QIS A;  1SPA A;  3N5M A;  1T3I A;  2W8W A;  1H0C A;  1ARS A;  1SVV A;  1V2F A;  3BV0 A;  5EAV A;  2BWO A;  3AEO A;  4ZSW A;  4XJM A;  3AEJ A;  4ADB A;  2ZP7 A;  4A00 A;  1LK9 A;  1I29 A;  2AEV A;  1C0N A;  5F9S A;  1GCK A;  1AKB A;  3HBX A;  1C4K A;  2VMR A;  3AEL A;  4MKJ A;  4Q31 A;  1LC7 A;  3AEP A;  2O7C A;  2W7M A;  5BJ3 A;  3T32 A;  1C7N A;  4BQ0 A;  1D7V A;  3PGY A;  1WYV B;  2VMO A;  2EPJ A;  1OAT A;  2X5D A;  4OT8 A;  2YOB A;  4PVF A;  3FTB A;  4GE9 A;  4ZM4 A;  1ASN A;  2G6W A;  2Z20 A;  3MAD A;  4J5U A;  4JE5 A;  1WYT A;  1V2E A;  4F5M A;  1I48 A;  5DB5 A;  3FCR A;  1S0A A;  1M32 A;  2VMU A;  5DJ9 A;  4U1T A;  3UWC A;  3GET A;  2OQX A;  3FFR A;  3N75 A;  4B9B A;  2BYJ A;  2AAT A;  5G4I A;  2VGU A;  2BWN A;  3H7F A;  5E4Z A;  1W7L A;  1S08 A;  4R8D A;  2AEU A;  2Z67 A;  4XJL A;  2CY8 A;  1Y4I A;  4FFC A;  2FNU A;  4GDY A;  3MKJ A;  1BW0 A;  1SF2 A;  3WLX A;  1ASM A;  4A0H A;  4ZDO A;  2EGY A;  5E3K A;  5TF5 A;  4GRX A;  3PDX A;  3EI5 A;  1Z3Z A;  3DXW A;  4GE7 A;  1V72 A;  1CQ6 A;  2YKX A;  1ASL A;  4W1X A;  3LWS A;  1PG8 A;  4ZAS A;  3ZZK A;  9AAT A;  4LNM A;  1M4N A;  2VI9 A;  4JEZ A;  2ZUK A;  4ATQ A;  4IX8 A;  2F8J A;  2D5Y A;  1AJS A;  3FKD A;  3GZD A;  2WKA A;  3W1I A;  1MAP A;  3PD6 A;  1AY8 A;  2E54 A;  1AHG A;  5DJ1 A;  1YJY A;  4Q75 A;  2R2N A;  3I5T A;  5FT5 A;  2W7G A;  2VMW A;  4A6U A;  3TQX A;  3CQ6 A;  1ORD A;  4RIT A;  1TOK A;  2OGA A;  2TPL A;  2W7E A;  3F6T A;  4A72 A;  3ASA A;  2VIB A;  1ASE A;  4WXG A;  3ATH A;  1BT4 A;  3FQA A;  2GB3 A;  2CH1 A;  4QGR A;  3VK2 A;  3EIB A;  1N31 A;  3ACZ A;  4I8A A;  3RCH A;  2BI9 A;  5EUN A;  2W8T A;  3FVU A;  2AY7 A;  3PA9 A;  2R5C A;  2X3L A;  2VMS A;  2VMX A;  3JZL A;  2VGT A;  4M2J A;  3PD6 B;  4XJO A;  4E1O A;  1DGE A;  1C9C A;  3FQ7 A;  1M0N A;  2Q7W A;  4Y0I A;  1KL2 A;  2HOX A;  3B8X A;  3LY1 A;  1ASA A;  2OAT A;  4EMY A;  3L8A A;  4IXO A;  1WYV A;  3E2Y A;  1OHV A;  4WB0 A;  3NUB A;  4ITX A;  2HZP A;  2BHX A;  2O1B A;  3FFH A;  1C7G A;  1VP4 A;  4RM1 A;  4RKD A;  1JG8 A;  1CS1 A;  3RQ1 A;  2NMP A;  2QB3 A;  3BCA A;  4W5K A;  2BIE A;  2PO3 A;  4F5F A;  1B5O A;  3G0T A;  1P3W A;  4WYE A;  3UE8 A;  4CBS A;  3TFT A;  2C0R A;  2D64 A;  1U08 A;  3MBB A;  5FT6 A;  3AEN A;  4UOY A;  4ZWV A;  4F4E A;  3EZS A;  4TN4 A;  1GC0 A;  1QIT A;  2VMT A;  2VIA A;  4WD2 A;  2Z9W A;  1SZK A;  2JGT A;  3BWO A;  5G2Q A;  2GMS A;  2ZSL A;  2YRR A;  1LW5 A;  2VGV A;  4BMK A;  1DJU A;  1EG5 A;  3R9A A;  2D66 A;  4WYG A;  1AY4 A;  1ARG A;  2DOU A;  2ZC0 A;  4XJP A;  4AO9 A;  1WYT B;  1ELQ A;  4P7Y A;  4B98 A;  1YIZ A;  3BN1 A;  4OYT A;  4MGR A;  3EUC A;  2YCP A;  1TPL A;  2RFV A;  1G4X A;  5G09 A;  4XQ2 A;  3CBF A;  4ADD A;  3NX3 A;  1AHX A;  3EI7 A;  1RV4 A;  3QN6 A;  1GC3 A;  2DR1 A;  4JE5 D;  1DTY A;  1N2T A;  1IBJ A;  2VMP A;  1AAW A;  2CFB A;  2FN6 A;  3G8M A;  3GWP A;  4MY5 A;  4XEW A;  1YIY A;  1Z7D A;  2QLR A;  2W8J A;  1MGV A;  2AY8 A;  5EFS A;  1D7S A;  4TV7 A;  2QA3 A;  2R0T A;  1AIB A;  4UQV A;  1AHE A;  3BWN C;  3WZF A;  3F0H A;  4Y0D A;  5EIG B;  1MAQ A;  3WGC A;  3DU4 A;  4ISY A;  4WP0 A;  2W7H A;  3B46 A;  1TOE A;  4WXF A;  4EB5 A;  5J8Q A;  3ASB A;  5C6U A;  1AJR A;  2W8V A;  4WBT A;  4EFF A;  5LHA A;  1IAY A;  5G4J A;  1S07 A;  3E2F A;  2VYC A;  2HP1 A;  2VLF A;  2YHK A;  1MDX A;  4IXZ A;  3ZRP A;  2AY1 A;  3BC8 A;  4Q6R A;  3NYS A;  4IW7 A;  3TAT A;  3KGX A;  3PDB B;  1O69 A;  2V1P A;  3QBO A;  4F5I A;  1LKC A;  1DJ9 A;  3GSB A;  1FG7 A;  2BKW A;  2CIN A;  4JEY A;  3ECD A;  3LVK A;  3EIA A;  1W7N A;  2OGE A;  2VGS A;  3E2Z A;  3P1T A;  2AY2 A;  1DKA A;  2BIG A;  3IHJ A;  2O0R A;  4MQQ A;  4F5L A;  1O61 A;  5K8B A;  2Z9V A;  3QHX A;  1IJI A;  4OCA A;  3L44 A;  5D5S A;  3VK4 A;  2YRI A;  1AAM A;  3DXV A;  3TFU A;  1KMK A;  4NOG A;  4UHM A;  2VMQ A;  1N8P A;  4BHD A;  3WGB A;  2VLH A;  3WCO A;  2D63 A;  1ASF A;  4GEB A;  5EUD A;  2GMU A;  4LNL A;  4F5G A;  1VEF A;  2ZY2 A;  3UAK A;  3WCN A;  2XBN A;  2X8U A;  2JJG A;  2Z9U A;  2ZYJ A;  3GBX A;  1AHF A;  1J04 A;  1CZC A;  2HP2 A;  1LC8 A;  1KKP A;  4R2N A;  4WXB A;  3II0 A;  2AY5 A;  1WYU B;  2ZY4 A;  1G4V A;  3MC6 A;  3HVY A;  1TAS A;  4PIW A;  1O4S A;  4OBU A;  3HLM A;  1ASG A;  1ASB A;  1BJW A;  1AMQ A;  4PFN A;  1BJO A;  2BYL A;  3JWA A;  1JS6 A;  4ITG A;  3QGU A;  2AY3 A;  3I4J A;  3FVX A;  4BA5 A;  3QPG A;  1CQ8 A;  3AEJ C;  1O62 A;  2DGL A;  2PB2 A;  5F8V A;  1WKG A;  4WLH A;  3OKS A;  3JU7 A;  4JF1 A;  3GZC A;  1GEY A;  2WK7 A;  2W7F A;  3BCX A;  3A8U X;  1RVU A;  3GR9 A;  1LS3 A;  1C7O A;  3M5U A;  4IXS A;  3DYD A;  4W1W A;  3RBF A;  2OKJ A;  1B8G A;  2Z1Y A;  2JJH A;  4ZDL A;  1BS0 A;  3EZ1 A;  4OTL A;  1S06 A;  3NTJ A;  3AOV A;  2QBT A;  1YAA A;  3FZ7 A;  4OMA A;  4Y0H A;  4MSO A;  2C81 A;  1KKJ A;  2HUI A;  2DGK A;  2EZ1 A;  1V2D A;  4LW2 A;  1YJS A;  3LVJ A;  1SZS A;  1DGD A;  1TAT A;  1B5P A;  1SZU A;  2EZ2 A;  1GEW A;  3HMU A;  2Z61 A;  2CTZ A;  3FSL A;  3PDB A;  3PPL A;  1FC4 A;  4IYO B;  4R5F A;  1W7M A;  3BCB A;  3CQ4 A;  3CQ5 A;  3FZ6 A;  2CJH A;  4JEW A;  4K2M A;  3RBL A;  4IYO A;  1ASC A;  3EI6 A;  2EO5 A;  4Q76 A;  4DBC A;  1BQA A;  3BB8 A;  3MAF B;  1WYU A;  1TOG A;  2HUU A;  1M7Y A;  3D6K A;  2DKJ A;  2CH2 A;  3A9Z A;  3K28 A;  3LVL B;  4ADC A;  3NYT A;  4ZAH A;  3COG A;  2W7D A;  3ZZJ A;  1CL1 A;  1AX4 A;  3AAT A;  2JJE A;  3A9Y A;  3GJU A;  3BS8 A;  4HF8 A;  3VAX A;  5BJ4 A;  2CJD A;  2FNI A;  4JEX A;  1MDZ A;  2BI3 A;  2Z9X A;  4RJ0 A;  1QJ3 A;  5D95 A;  4DGT A;  3PAA A;  1ASD A;  7AAT A;  3DRD A;  5FT4 A;  3FD0 A;  3GZD C;  3MAF A;  4M2K A;  3DC1 A;  5FT8 A;  3USF A;  1IX8 A;  4KAM A;  3ELP A;  3DOD A;  4W91 A;  3E77 A;  3WX9 A;  4BA4 A;  3ZRR A;  4GE4 A;  2R5E A;  8AAT A;  3HT4 A;  2VMY A;  3VK3 A;  1OHW A;  5M49 A;  4H51 A;  1BJN A;  1D2F A;  1GC4 A;  1W3U A;  1RV3 A;  3B1E A;  1QZ9 A;  1G7X A;  4RIZ A;  4K2B A;  1X28 A;  2XH1 A;  1IX7 A;  3LV2 A;  4WYD A;  1YNU A;  2D7Y A;  4DQ6 A;  1UKJ A;  5DX5 A;  3OP7 A;  4L0O A;  3LVM A;  4KYO A;  4MQP A;  1SFF A;  4WYC A;  2AY4 A;  2D7Z A;  4UHO A;  5I92 A;  3FDD A;  4XK1 A;  3FVS A;  4OBV A;  1WST A;  4E77 A;  1S09 A;  4WLJ A;  4EU1 A;  3KGW A;  2EH6 A;  3RUY A;  3W1J A;  5AX8 A;  1CQ7 A;  4TMR A;  1MLY A;  1G7W A;  1FG3 A;  5HHY A;  3NDN A;  3QM2 A;  4KXK A;  2C7T A;  4U2H A;  3HL2 A;  2QB2 A;  4N0W A;  3NRA A;  4LW4 A;  4A0F A;  2JG2 A;  1GEX A;  4AOA A;  2E7J A;  4XAU A;  1WKH A;  1BQD A;  4UHN A;  4O6Z A;  3FDB A;  1M0Q A;  1OXP A;  2YKU A;  1IVR A;  3EI8 A;  3JW9 A;  1CZE A;  1JS3 A;  1XEY A;  3MAU A;  2D61 A;  1W23 A;  1YJZ A;  1ART A;  2BIA A;  3VP6 A;  3AEM A;  2BI1 A;  2WK8 A;  1QGN A;  4EB7 A;  1KL1 A;  2YKY A;  2W7L A;  1JF9 A;  2GQN A;  1AIA A;  3HQT A;  4LNJ A;  3ZRQ A;  2ZY3 A;  4OC9 A;  1IAX A;  3E9K A;  4CXQ A;  4IY7 A;  4P3M A;  3NU8 A;  4LC3 A;  4WB0 B;  3K7Y A;  5M4B A;  1E5E A;  2CJG A;  1LW4 A;  3N0L A;  1PMO A;  2VMN A;  2HOR A;  3AV7 A;  1M6S A;  3KE3 A;  2ORD A;  5HDM A;  2HUF A;  2JJF A;  2W7I A;  1IUG A;  3B1C A;  3CAI A;  5EQC A;  2YCT A;  3E2Z B;  3JTX A;  2FM1 A;  1UU2 A;  1ARI A;  4K2I A;  3PIU A;  2AY6 A;  2WK9 A;  2FQ6 A;  2JIS A;  2E7U A;  1PMM A;  2VMV A;  3FZ8 A;  4JF0 A;  3NUI A;  4ZLV A;  4R5Z A;  2W8U A;  3NU7 A;  3ELE A;  1GD9 A;  3DR7 A;  4M2M A;  1AMR A;  1RVY A;  2ZJG A;  3F9T A;  3I16 A;  3WKR A;  5M46 A;  1YOO A;  1ZOB A;  5G0A A;  2CAN A;  3BWN A;  1X0M A;  5M4D A;  1AY5 A;  2YCN A;  3QI6 A;  1QIR A;  4MKK A;  5G2P A;  3ISL A;  5JAY A;  4J8L A;  1X29 A;  4AZK A;  2E7I A;  2C44 A;  3IF2 A;  2AY9 A;  3DR4 A;  1TOJ A;  1D7U A;  3K40 A;  4GSA A;  3A9X A;  1ECX A;  1B9H A;  4W1V A;  2GSA A;  1M0O A;  3AOW A;  2YKV A;  3B1D A;  2R5C B;  1TOI A;  3P6K A;  1CJ0 A;  4CBR A;  4A6T A;  4CVQ A;  1GC2 A;  1QJ5 A;  2CB1 A;  3JWB A;  4ZWM A;  4A6R A;  3A2B A;  1EJI A;  4FL0 A;  1EQB A;  3FRK A;  3NNK A;  4RLG A;  4PFF A;  1AKC A;  3H14 A;  5LH9 A;  4A0G A;  2DGM A;  4E3Q A;  1TAR A;  1DFO A;  2HOY A;  3LG0 A;  3NYU A;  3WY7 A;  2W7J A;  4N0B A;  1LC5 A;  3MEB A;  1I41 A;  3PJ0 A;  4F5J A;  3FQ8 A;  4RKC A;  4ADE A;  3AEM C;  3E6G A;  2BI2 A;  3G7Q A;  4A0R A;  2BWP A;  1J32 A;  1AIC A;  3EI9 A;  2VGZ A;  1VJO A;  1D7R A;  2OKK A;  1PFF A;  1CL2 A;  3WKS A;  2Z1Z A;  2CST A;  2VMZ A;  1BJO B;  3KKI A;  1GDE A;  2V0Y A;  1AJS B;  1I43 A;  4RAE A;  2D65 A;  2X5F A;  1OHY A;  2BI5 A;  4HVK A;  3DZZ A;  2W7K A;  4WYA A;  4CXR A;  1B4X A;  1BJ4 A;  3HDO A;  3TCM A;  4ZSY A;  4F5K A;  3RI6 A;  4AZJ A;  5EAA A;  4RJY A;  4ZM3 A;  2VGW A;  1UU0 A;  1AMS A;  1H1C A;  3Q8N A;  4MQR A;  4ATP A;  1XI9 A;  1AKA A;  2ZY5 A;  2QMA A;  5E5I A;  3VOM A;  5EUE A;  1GBN A;  1ZOD A;  4ZDP A;  1MDO A;  1UU1 A;  1IX6 A;  1E5F A;  1DJE A;  1X2A A;  2HOZ A;  4WYF A;  3RCH B;  5IWQ A;  2PB0 A;  4JEV A;  4AH3 A;  1AMA A;  1KMJ A;  3W1H A;  1MLZ A;  1M0P A;  2ZSM A;  3MC6 C;  1OXO A;  2DKB A;  2FYF A;  2VI8 A;  3R4T A;  5EIG A;  4AO4 A;  1ZC9 A;  1B9I A;  1ARH A;  1AHY A;  4E3R A;  1BKG A;  5HXX A;  4W8I A; 
#chains in the Genus database with same CATH topology
 4F5H A;  1ELU A;  3AEN B;  1QIS A;  1SPA A;  3N5M A;  1T3I A;  2W8W A;  1H0C A;  1ARS A;  1SVV A;  1V2F A;  3BV0 A;  5EAV A;  2BWO A;  3AEO A;  4ZSW A;  4XJM A;  3AEJ A;  4ADB A;  2ZP7 A;  4A00 A;  1LK9 A;  1I29 A;  2AEV A;  1C0N A;  5F9S A;  1GCK A;  1AKB A;  3HBX A;  1C4K A;  2VMR A;  3AEL A;  4MKJ A;  4Q31 A;  1LC7 A;  3AEP A;  2O7C A;  2W7M A;  5BJ3 A;  3T32 A;  1C7N A;  4BQ0 A;  1D7V A;  3PGY A;  1WYV B;  2VMO A;  2EPJ A;  1OAT A;  2X5D A;  4OT8 A;  2YOB A;  1KAF A;  4PVF A;  3FTB A;  4GE9 A;  4ZM4 A;  1ASN A;  2G6W A;  2Z20 A;  3MAD A;  4J5U A;  4JE5 A;  1WYT A;  1V2E A;  4F5M A;  1I48 A;  5DB5 A;  3FCR A;  1S0A A;  1M32 A;  2VMU A;  5DJ9 A;  4U1T A;  3UWC A;  2KFP A;  3GET A;  2OQX A;  3FFR A;  3N75 A;  4B9B A;  2BYJ A;  2AAT A;  5G4I A;  2VGU A;  2BWN A;  2WB6 A;  3H7F A;  5E4Z A;  1W7L A;  1S08 A;  4R8D A;  2AEU A;  2Z67 A;  4XJL A;  2CY8 A;  1Y4I A;  4FFC A;  2FNU A;  4GDY A;  3MKJ A;  1BW0 A;  1SF2 A;  3WLX A;  1ASM A;  4A0H A;  4ZDO A;  2EGY A;  5E3K A;  5TF5 A;  4GRX A;  3PDX A;  3EI5 A;  1Z3Z A;  3DXW A;  4GE7 A;  1V72 A;  1CQ6 A;  2YKX A;  1ASL A;  4W1X A;  3LWS A;  1PG8 A;  4ZAS A;  3ZZK A;  9AAT A;  4LNM A;  1M4N A;  2VI9 A;  4JEZ A;  2ZUK A;  4ATQ A;  4IX8 A;  2F8J A;  2D5Y A;  1AJS A;  3FKD A;  3GZD A;  2WKA A;  3W1I A;  1MAP A;  3PD6 A;  1AY8 A;  2E54 A;  1AHG A;  5DJ1 A;  1YJY A;  4Q75 A;  2R2N A;  3I5T A;  5FT5 A;  2W7G A;  2VMW A;  4A6U A;  3TQX A;  3CQ6 A;  1ORD A;  4RIT A;  1TOK A;  2OGA A;  2TPL A;  2W7E A;  3F6T A;  4A72 A;  3ASA A;  2VIB A;  1ASE A;  4WXG A;  3ATH A;  1BT4 A;  3FQA A;  2GB3 A;  2CH1 A;  4QGR A;  3VK2 A;  3EIB A;  1N31 A;  3ACZ A;  4I8A A;  3RCH A;  2BI9 A;  5EUN A;  2W8T A;  3FVU A;  2AY7 A;  3PA9 A;  2R5C A;  2X3L A;  2VMS A;  2VMX A;  3JZL A;  2VGT A;  4M2J A;  3PD6 B;  4XJO A;  4E1O A;  1DGE A;  1C9C A;  3FQ7 A;  1M0N A;  2Q7W A;  4Y0I A;  1KL2 A;  2HOX A;  3B8X A;  3LY1 A;  1ASA A;  2OAT A;  4EMY A;  3L8A A;  4IXO A;  1WYV A;  3E2Y A;  1OHV A;  4WB0 A;  3NUB A;  4ITX A;  2HZP A;  2BHX A;  2O1B A;  3FFH A;  1C7G A;  1VP4 A;  4RM1 A;  4RKD A;  1JG8 A;  1CS1 A;  3RQ1 A;  2NMP A;  2QB3 A;  3BCA A;  4W5K A;  2BIE A;  2PO3 A;  4F5F A;  1B5O A;  3G0T A;  1P3W A;  4WYE A;  3UE8 A;  4CBS A;  3TFT A;  2C0R A;  2D64 A;  1U08 A;  3MBB A;  5FT6 A;  3AEN A;  4UOY A;  4ZWV A;  4F4E A;  3EZS A;  4TN4 A;  1GC0 A;  1QIT A;  2VMT A;  2VIA A;  4WD2 A;  2Z9W A;  1SZK A;  2JGT A;  3BWO A;  5G2Q A;  2GMS A;  2ZSL A;  2YRR A;  1LW5 A;  2VGV A;  4BMK A;  1DJU A;  1EG5 A;  3R9A A;  2D66 A;  4WYG A;  1AY4 A;  1ARG A;  2DOU A;  2ZC0 A;  4XJP A;  4AO9 A;  1WYT B;  1ELQ A;  4P7Y A;  4B98 A;  1YIZ A;  3BN1 A;  4OYT A;  4MGR A;  3EUC A;  2YCP A;  1TPL A;  2RFV A;  1G4X A;  5G09 A;  4XQ2 A;  3CBF A;  4ADD A;  3NX3 A;  1AHX A;  3EI7 A;  1RV4 A;  3QN6 A;  1GC3 A;  2DR1 A;  4JE5 D;  1DTY A;  1N2T A;  1IBJ A;  2VMP A;  1AAW A;  2CFB A;  2FN6 A;  3G8M A;  3GWP A;  4MY5 A;  4XEW A;  1YIY A;  1Z7D A;  2QLR A;  3H9X A;  2W8J A;  1MGV A;  2AY8 A;  5EFS A;  1D7S A;  4TV7 A;  2QA3 A;  2R0T A;  4K05 A;  1AIB A;  4UQV A;  1AHE A;  3BWN C;  3WZF A;  3F0H A;  4Y0D A;  5EIG B;  1MAQ A;  3WGC A;  3DU4 A;  4ISY A;  4WP0 A;  2W7H A;  3B46 A;  1TOE A;  4WXF A;  4EB5 A;  5J8Q A;  3ASB A;  5C6U A;  1AJR A;  2W8V A;  4WBT A;  4EFF A;  5LHA A;  1IAY A;  5G4J A;  1S07 A;  3E2F A;  2VYC A;  2HP1 A;  2VLF A;  2YHK A;  1MDX A;  4IXZ A;  3ZRP A;  2AY1 A;  3BC8 A;  4Q6R A;  3NYS A;  4IW7 A;  3TAT A;  3KGX A;  3PDB B;  1O69 A;  2V1P A;  3QBO A;  4F5I A;  1LKC A;  1DJ9 A;  3GSB A;  1FG7 A;  2BKW A;  2CIN A;  4JEY A;  3ECD A;  3LVK A;  3EIA A;  1W7N A;  2OGE A;  2VGS A;  3E2Z A;  3P1T A;  2AY2 A;  1DKA A;  2BIG A;  3IHJ A;  2O0R A;  4MQQ A;  4F5L A;  1O61 A;  5K8B A;  2Z9V A;  3QHX A;  1IJI A;  4OCA A;  3L44 A;  5D5S A;  3VK4 A;  2YRI A;  1AAM A;  3DXV A;  3TFU A;  1KMK A;  5KTB A;  4NOG A;  4UHM A;  2VMQ A;  1N8P A;  4BHD A;  3WGB A;  2VLH A;  3WCO A;  2D63 A;  1ASF A;  4GEB A;  5EUD A;  2GMU A;  4LNL A;  4F5G A;  1VEF A;  2ZY2 A;  3UAK A;  3WCN A;  2XBN A;  2X8U A;  2JJG A;  2Z9U A;  2ZYJ A;  3GBX A;  1AHF A;  1J04 A;  1CZC A;  2HP2 A;  1LC8 A;  1KKP A;  4R2N A;  4WXB A;  3II0 A;  2AY5 A;  1WYU B;  2ZY4 A;  1G4V A;  3MC6 A;  3HVY A;  1TAS A;  4PIW A;  1O4S A;  4OBU A;  3HLM A;  1ASG A;  1ASB A;  1BJW A;  1AMQ A;  4PFN A;  1BJO A;  2BYL A;  3JWA A;  1JS6 A;  4ITG A;  3QGU A;  2AY3 A;  3I4J A;  3FVX A;  4BA5 A;  3QPG A;  1CQ8 A;  3AEJ C;  1O62 A;  2DGL A;  2PB2 A;  5F8V A;  1WKG A;  4WLH A;  3OKS A;  3JU7 A;  4JF1 A;  3GZC A;  1GEY A;  2WK7 A;  2W7F A;  3BCX A;  3A8U X;  1RVU A;  3GR9 A;  1LS3 A;  1C7O A;  3M5U A;  4IXS A;  3DYD A;  4W1W A;  3RBF A;  2OKJ A;  1B8G A;  2Z1Y A;  2JJH A;  4ZDL A;  1BS0 A;  3EZ1 A;  4OTL A;  1S06 A;  3NTJ A;  3AOV A;  2QBT A;  1YAA A;  3FZ7 A;  4OMA A;  4Y0H A;  4MSO A;  2C81 A;  1KKJ A;  2HUI A;  2DGK A;  2EZ1 A;  1V2D A;  4LW2 A;  1YJS A;  3LVJ A;  1SZS A;  1DGD A;  1TAT A;  1B5P A;  1SZU A;  2EZ2 A;  1GEW A;  3HMU A;  2Z61 A;  2CTZ A;  3FSL A;  3PDB A;  3PPL A;  1FC4 A;  4IYO B;  4R5F A;  1W7M A;  3BCB A;  3CQ4 A;  3CQ5 A;  3FZ6 A;  2CJH A;  4JEW A;  4K2M A;  3RBL A;  4IYO A;  1ASC A;  3N4R A;  3EI6 A;  2EO5 A;  4Q76 A;  4DBC A;  1BQA A;  3BB8 A;  3MAF B;  1WYU A;  1TOG A;  2HUU A;  3N4X A;  1M7Y A;  3D6K A;  2DKJ A;  2CH2 A;  3A9Z A;  3K28 A;  3LVL B;  4ADC A;  3NYT A;  4ZAH A;  3COG A;  2A1V A;  2W7D A;  3ZZJ A;  1CL1 A;  1AX4 A;  3AAT A;  2JJE A;  3A9Y A;  3GJU A;  3BS8 A;  4HF8 A;  3VAX A;  5BJ4 A;  2CJD A;  2FNI A;  4JEX A;  1MDZ A;  2BI3 A;  2Z9X A;  4RJ0 A;  1QJ3 A;  5D95 A;  4DGT A;  3PAA A;  1ASD A;  3N4S A;  7AAT A;  3DRD A;  5FT4 A;  3FD0 A;  3GZD C;  3MAF A;  4M2K A;  3DC1 A;  5FT8 A;  3USF A;  1IX8 A;  4KAM A;  3ELP A;  3DOD A;  4W91 A;  3E77 A;  3WX9 A;  4BA4 A;  3ZRR A;  4GE4 A;  2R5E A;  8AAT A;  3HT4 A;  2VMY A;  3VK3 A;  1OHW A;  5M49 A;  4H51 A;  1BJN A;  1D2F A;  1GC4 A;  1W3U A;  1RV3 A;  3B1E A;  1QZ9 A;  1G7X A;  4RIZ A;  4K2B A;  1X28 A;  2XH1 A;  1IX7 A;  3LV2 A;  4WYD A;  1YNU A;  2D7Y A;  4DQ6 A;  1UKJ A;  5DX5 A;  3OP7 A;  4L0O A;  3LVM A;  4KYO A;  4MQP A;  1SFF A;  4WYC A;  2AY4 A;  2D7Z A;  4UHO A;  5I92 A;  3FDD A;  4XK1 A;  3FVS A;  4OBV A;  1WST A;  4E77 A;  1S09 A;  4WLJ A;  4EU1 A;  3KGW A;  2EH6 A;  3RUY A;  3W1J A;  5AX8 A;  1CQ7 A;  4TMR A;  1MLY A;  1G7W A;  1FG3 A;  5HHY A;  3NDN A;  3QM2 A;  4KXK A;  2C7T A;  4U2H A;  3HL2 A;  2QB2 A;  4N0W A;  3NRA A;  4LW4 A;  4A0F A;  2JG2 A;  1GEX A;  4AOA A;  2E7J A;  4XAU A;  1WKH A;  1BQD A;  4UHN A;  4O6Z A;  3FDB A;  1M0Q A;  1OXP A;  2YKU A;  1IVR A;  3EI8 A;  3JW9 A;  1CZE A;  1JS3 A;  1XEY A;  3MAU A;  2D61 A;  1W23 A;  1YJZ A;  1ART A;  2BIA A;  3VP6 A;  3AEM A;  2BI1 A;  2WK8 A;  1QGN A;  4EB7 A;  1KL1 A;  2YKY A;  2W7L A;  1JF9 A;  2GQN A;  1AIA A;  3HQT A;  4LNJ A;  3ZRQ A;  2ZY3 A;  4OC9 A;  1IAX A;  3E9K A;  4CXQ A;  4IY7 A;  4P3M A;  3NU8 A;  2QSR A;  4LC3 A;  4WB0 B;  3K7Y A;  5M4B A;  1E5E A;  2CJG A;  1LW4 A;  3N0L A;  1PMO A;  2VMN A;  2HOR A;  3AV7 A;  1M6S A;  3KE3 A;  2ORD A;  3N7N A;  5HDM A;  2HUF A;  2JJF A;  2W7I A;  1IUG A;  3B1C A;  3CAI A;  5EQC A;  2YCT A;  3E2Z B;  3JTX A;  2FM1 A;  1UU2 A;  1ARI A;  4K2I A;  3PIU A;  2AY6 A;  2WK9 A;  2FQ6 A;  2JIS A;  2E7U A;  1PMM A;  2VMV A;  3FZ8 A;  4JF0 A;  3NUI A;  4ZLV A;  4R5Z A;  2W8U A;  3NU7 A;  3ELE A;  1GD9 A;  3DR7 A;  4M2M A;  1AMR A;  1RVY A;  2ZJG A;  3F9T A;  3I16 A;  3WKR A;  5M46 A;  1YOO A;  1ZOB A;  5G0A A;  2CAN A;  3BWN A;  2FKI A;  1X0M A;  5M4D A;  1AY5 A;  2YCN A;  3QI6 A;  1QIR A;  4MKK A;  5G2P A;  2G7J A;  3ISL A;  5JAY A;  4J8L A;  1X29 A;  4AZK A;  2E7I A;  2C44 A;  3IF2 A;  2AY9 A;  3DR4 A;  1TOJ A;  1D7U A;  3K40 A;  4GSA A;  3A9X A;  1ECX A;  1B9H A;  4W1V A;  2GSA A;  1M0O A;  3AOW A;  2YKV A;  3B1D A;  2R5C B;  1TOI A;  3P6K A;  1CJ0 A;  4CBR A;  4A6T A;  4CVQ A;  1GC2 A;  1QJ5 A;  2CB1 A;  3JWB A;  4ZWM A;  4A6R A;  3A2B A;  1EJI A;  4FL0 A;  1EQB A;  3FRK A;  3NNK A;  4RLG A;  4PFF A;  1AKC A;  3H14 A;  5LH9 A;  4A0G A;  2DGM A;  4E3Q A;  2EYQ A;  1TAR A;  4H63 Q;  1DFO A;  2HOY A;  3LG0 A;  3NYU A;  3WY7 A;  2W7J A;  4N0B A;  1LC5 A;  3MEB A;  1I41 A;  3PJ0 A;  4F5J A;  3FQ8 A;  4RKC A;  4ADE A;  3AEM C;  3E6G A;  2BI2 A;  3G7Q A;  4A0R A;  2BWP A;  1J32 A;  1AIC A;  3EI9 A;  2VGZ A;  1VJO A;  1D7R A;  2OKK A;  1PFF A;  1CL2 A;  3WKS A;  2Z1Z A;  2CST A;  2VMZ A;  1BJO B;  3KKI A;  1GDE A;  2V0Y A;  1AJS B;  1I43 A;  4RAE A;  2D65 A;  2X5F A;  1OHY A;  2BI5 A;  4HVK A;  3DZZ A;  2W7K A;  4WYA A;  4CXR A;  1B4X A;  1BJ4 A;  3HDO A;  3TCM A;  4ZSY A;  4F5K A;  3RI6 A;  4AZJ A;  5EAA A;  4RJY A;  4ZM3 A;  2VGW A;  1UU0 A;  1AMS A;  1H1C A;  3Q8N A;  4MQR A;  4ATP A;  1XI9 A;  1AKA A;  2ZY5 A;  2QMA A;  5E5I A;  3VOM A;  5EUE A;  1GBN A;  1ZOD A;  4ZDP A;  1MDO A;  1UU1 A;  1IX6 A;  1E5F A;  1DJE A;  1X2A A;  2HOZ A;  4WYF A;  3RCH B;  5IWQ A;  2PB0 A;  4JEV A;  4AH3 A;  1AMA A;  1KMJ A;  3W1H A;  1MLZ A;  1M0P A;  2ZSM A;  3MC6 C;  1OXO A;  2DKB A;  2FYF A;  2VI8 A;  3R4T A;  5EIG A;  4AO4 A;  1ZC9 A;  1B9I A;  1ARH A;  1AHY A;  4E3R A;  1BKG A;  5HXX A;  4W8I A; 
#chains in the Genus database with same CATH homology
 4F5H A;  1ELU A;  3AEN B;  1QIS A;  1SPA A;  3N5M A;  1T3I A;  2W8W A;  1H0C A;  1ARS A;  1SVV A;  1V2F A;  3BV0 A;  5EAV A;  2BWO A;  3AEO A;  4ZSW A;  4XJM A;  3AEJ A;  4ADB A;  2ZP7 A;  4A00 A;  1LK9 A;  1I29 A;  2AEV A;  1C0N A;  5F9S A;  1GCK A;  1AKB A;  3HBX A;  1C4K A;  2VMR A;  3AEL A;  4MKJ A;  4Q31 A;  1LC7 A;  3AEP A;  2O7C A;  2W7M A;  5BJ3 A;  3T32 A;  1C7N A;  4BQ0 A;  1D7V A;  3PGY A;  1WYV B;  2VMO A;  2EPJ A;  1OAT A;  2X5D A;  4OT8 A;  2YOB A;  4PVF A;  3FTB A;  4GE9 A;  4ZM4 A;  1ASN A;  2G6W A;  2Z20 A;  3MAD A;  4J5U A;  4JE5 A;  1WYT A;  1V2E A;  4F5M A;  1I48 A;  5DB5 A;  3FCR A;  1S0A A;  1M32 A;  2VMU A;  5DJ9 A;  4U1T A;  3UWC A;  2KFP A;  3GET A;  2OQX A;  3FFR A;  3N75 A;  4B9B A;  2BYJ A;  2AAT A;  5G4I A;  2VGU A;  2BWN A;  2WB6 A;  3H7F A;  5E4Z A;  1W7L A;  1S08 A;  4R8D A;  2AEU A;  2Z67 A;  4XJL A;  2CY8 A;  1Y4I A;  4FFC A;  2FNU A;  4GDY A;  3MKJ A;  1BW0 A;  1SF2 A;  3WLX A;  1ASM A;  4A0H A;  4ZDO A;  2EGY A;  5E3K A;  5TF5 A;  4GRX A;  3PDX A;  3EI5 A;  1Z3Z A;  3DXW A;  4GE7 A;  1V72 A;  1CQ6 A;  2YKX A;  1ASL A;  4W1X A;  3LWS A;  1PG8 A;  4ZAS A;  3ZZK A;  9AAT A;  4LNM A;  1M4N A;  2VI9 A;  4JEZ A;  2ZUK A;  4ATQ A;  4IX8 A;  2F8J A;  2D5Y A;  1AJS A;  3FKD A;  3GZD A;  2WKA A;  3W1I A;  1MAP A;  3PD6 A;  1AY8 A;  2E54 A;  1AHG A;  5DJ1 A;  1YJY A;  4Q75 A;  2R2N A;  3I5T A;  5FT5 A;  2W7G A;  2VMW A;  4A6U A;  3TQX A;  3CQ6 A;  1ORD A;  4RIT A;  1TOK A;  2OGA A;  2TPL A;  2W7E A;  3F6T A;  4A72 A;  3ASA A;  2VIB A;  1ASE A;  4WXG A;  3ATH A;  1BT4 A;  3FQA A;  2GB3 A;  2CH1 A;  4QGR A;  3VK2 A;  3EIB A;  1N31 A;  3ACZ A;  4I8A A;  3RCH A;  2BI9 A;  5EUN A;  2W8T A;  3FVU A;  2AY7 A;  3PA9 A;  2R5C A;  2X3L A;  2VMS A;  2VMX A;  3JZL A;  2VGT A;  4M2J A;  3PD6 B;  4XJO A;  4E1O A;  1DGE A;  1C9C A;  3FQ7 A;  1M0N A;  2Q7W A;  4Y0I A;  1KL2 A;  2HOX A;  3B8X A;  3LY1 A;  1ASA A;  2OAT A;  4EMY A;  3L8A A;  4IXO A;  1WYV A;  3E2Y A;  1OHV A;  4WB0 A;  3NUB A;  4ITX A;  2HZP A;  2BHX A;  2O1B A;  3FFH A;  1C7G A;  1VP4 A;  4RM1 A;  4RKD A;  1JG8 A;  1CS1 A;  3RQ1 A;  2NMP A;  2QB3 A;  3BCA A;  4W5K A;  2BIE A;  2PO3 A;  4F5F A;  1B5O A;  3G0T A;  1P3W A;  4WYE A;  3UE8 A;  4CBS A;  3TFT A;  2C0R A;  2D64 A;  1U08 A;  3MBB A;  5FT6 A;  3AEN A;  4UOY A;  4ZWV A;  4F4E A;  3EZS A;  4TN4 A;  1GC0 A;  1QIT A;  2VMT A;  2VIA A;  4WD2 A;  2Z9W A;  1SZK A;  2JGT A;  3BWO A;  5G2Q A;  2GMS A;  2ZSL A;  2YRR A;  1LW5 A;  2VGV A;  4BMK A;  1DJU A;  1EG5 A;  3R9A A;  2D66 A;  4WYG A;  1AY4 A;  1ARG A;  2DOU A;  2ZC0 A;  4XJP A;  4AO9 A;  1WYT B;  1ELQ A;  4P7Y A;  4B98 A;  1YIZ A;  3BN1 A;  4OYT A;  4MGR A;  3EUC A;  2YCP A;  1TPL A;  2RFV A;  1G4X A;  5G09 A;  4XQ2 A;  3CBF A;  4ADD A;  3NX3 A;  1AHX A;  3EI7 A;  1RV4 A;  3QN6 A;  1GC3 A;  2DR1 A;  4JE5 D;  1DTY A;  1N2T A;  1IBJ A;  2VMP A;  1AAW A;  2CFB A;  2FN6 A;  3G8M A;  3GWP A;  4MY5 A;  4XEW A;  1YIY A;  1Z7D A;  2QLR A;  3H9X A;  2W8J A;  1MGV A;  2AY8 A;  5EFS A;  1D7S A;  4TV7 A;  2QA3 A;  2R0T A;  4K05 A;  1AIB A;  4UQV A;  1AHE A;  3BWN C;  3WZF A;  3F0H A;  4Y0D A;  5EIG B;  1MAQ A;  3WGC A;  3DU4 A;  4ISY A;  4WP0 A;  2W7H A;  3B46 A;  1TOE A;  4WXF A;  4EB5 A;  5J8Q A;  3ASB A;  5C6U A;  1AJR A;  2W8V A;  4WBT A;  4EFF A;  5LHA A;  1IAY A;  5G4J A;  1S07 A;  3E2F A;  2VYC A;  2HP1 A;  2VLF A;  2YHK A;  1MDX A;  4IXZ A;  3ZRP A;  2AY1 A;  3BC8 A;  4Q6R A;  3NYS A;  4IW7 A;  3TAT A;  3KGX A;  3PDB B;  1O69 A;  2V1P A;  3QBO A;  4F5I A;  1LKC A;  1DJ9 A;  3GSB A;  1FG7 A;  2BKW A;  2CIN A;  4JEY A;  3ECD A;  3LVK A;  3EIA A;  1W7N A;  2OGE A;  2VGS A;  3E2Z A;  3P1T A;  2AY2 A;  1DKA A;  2BIG A;  3IHJ A;  2O0R A;  4MQQ A;  4F5L A;  1O61 A;  5K8B A;  2Z9V A;  3QHX A;  1IJI A;  4OCA A;  3L44 A;  5D5S A;  3VK4 A;  2YRI A;  1AAM A;  3DXV A;  3TFU A;  1KMK A;  5KTB A;  4NOG A;  4UHM A;  2VMQ A;  1N8P A;  4BHD A;  3WGB A;  2VLH A;  3WCO A;  2D63 A;  1ASF A;  4GEB A;  5EUD A;  2GMU A;  4LNL A;  4F5G A;  1VEF A;  2ZY2 A;  3UAK A;  3WCN A;  2XBN A;  2X8U A;  2JJG A;  2Z9U A;  2ZYJ A;  3GBX A;  1AHF A;  1J04 A;  1CZC A;  2HP2 A;  1LC8 A;  1KKP A;  4R2N A;  4WXB A;  3II0 A;  2AY5 A;  1WYU B;  2ZY4 A;  1G4V A;  3MC6 A;  3HVY A;  1TAS A;  4PIW A;  1O4S A;  4OBU A;  3HLM A;  1ASG A;  1ASB A;  1BJW A;  1AMQ A;  4PFN A;  1BJO A;  2BYL A;  3JWA A;  1JS6 A;  4ITG A;  3QGU A;  2AY3 A;  3I4J A;  3FVX A;  4BA5 A;  3QPG A;  1CQ8 A;  3AEJ C;  1O62 A;  2DGL A;  2PB2 A;  5F8V A;  1WKG A;  4WLH A;  3OKS A;  3JU7 A;  4JF1 A;  3GZC A;  1GEY A;  2WK7 A;  2W7F A;  3BCX A;  3A8U X;  1RVU A;  3GR9 A;  1LS3 A;  1C7O A;  3M5U A;  4IXS A;  3DYD A;  4W1W A;  3RBF A;  2OKJ A;  1B8G A;  2Z1Y A;  2JJH A;  4ZDL A;  1BS0 A;  3EZ1 A;  4OTL A;  1S06 A;  3NTJ A;  3AOV A;  2QBT A;  1YAA A;  3FZ7 A;  4OMA A;  4Y0H A;  4MSO A;  2C81 A;  1KKJ A;  2HUI A;  2DGK A;  2EZ1 A;  1V2D A;  4LW2 A;  1YJS A;  3LVJ A;  1SZS A;  1DGD A;  1TAT A;  1B5P A;  1SZU A;  2EZ2 A;  1GEW A;  3HMU A;  2Z61 A;  2CTZ A;  3FSL A;  3PDB A;  3PPL A;  1FC4 A;  4IYO B;  4R5F A;  1W7M A;  3BCB A;  3CQ4 A;  3CQ5 A;  3FZ6 A;  2CJH A;  4JEW A;  4K2M A;  3RBL A;  4IYO A;  1ASC A;  3N4R A;  3EI6 A;  2EO5 A;  4Q76 A;  4DBC A;  1BQA A;  3BB8 A;  3MAF B;  1WYU A;  1TOG A;  2HUU A;  3N4X A;  1M7Y A;  3D6K A;  2DKJ A;  2CH2 A;  3A9Z A;  3K28 A;  3LVL B;  4ADC A;  3NYT A;  4ZAH A;  3COG A;  2A1V A;  2W7D A;  3ZZJ A;  1CL1 A;  1AX4 A;  3AAT A;  2JJE A;  3A9Y A;  3GJU A;  3BS8 A;  4HF8 A;  3VAX A;  5BJ4 A;  2CJD A;  2FNI A;  4JEX A;  1MDZ A;  2BI3 A;  2Z9X A;  4RJ0 A;  1QJ3 A;  5D95 A;  4DGT A;  3PAA A;  1ASD A;  3N4S A;  7AAT A;  3DRD A;  5FT4 A;  3FD0 A;  3GZD C;  3MAF A;  4M2K A;  3DC1 A;  5FT8 A;  3USF A;  1IX8 A;  4KAM A;  3ELP A;  3DOD A;  4W91 A;  3E77 A;  3WX9 A;  4BA4 A;  3ZRR A;  4GE4 A;  2R5E A;  8AAT A;  3HT4 A;  2VMY A;  3VK3 A;  1OHW A;  5M49 A;  4H51 A;  1BJN A;  1D2F A;  1GC4 A;  1W3U A;  1RV3 A;  3B1E A;  1QZ9 A;  1G7X A;  4RIZ A;  4K2B A;  1X28 A;  2XH1 A;  1IX7 A;  3LV2 A;  4WYD A;  1YNU A;  2D7Y A;  4DQ6 A;  1UKJ A;  5DX5 A;  3OP7 A;  4L0O A;  3LVM A;  4KYO A;  4MQP A;  1SFF A;  4WYC A;  2AY4 A;  2D7Z A;  4UHO A;  5I92 A;  3FDD A;  4XK1 A;  3FVS A;  4OBV A;  1WST A;  4E77 A;  1S09 A;  4WLJ A;  4EU1 A;  3KGW A;  2EH6 A;  3RUY A;  3W1J A;  5AX8 A;  1CQ7 A;  4TMR A;  1MLY A;  1G7W A;  1FG3 A;  5HHY A;  3NDN A;  3QM2 A;  4KXK A;  2C7T A;  4U2H A;  3HL2 A;  2QB2 A;  4N0W A;  3NRA A;  4LW4 A;  4A0F A;  2JG2 A;  1GEX A;  4AOA A;  2E7J A;  4XAU A;  1WKH A;  1BQD A;  4UHN A;  4O6Z A;  3FDB A;  1M0Q A;  1OXP A;  2YKU A;  1IVR A;  3EI8 A;  3JW9 A;  1CZE A;  1JS3 A;  1XEY A;  3MAU A;  2D61 A;  1W23 A;  1YJZ A;  1ART A;  2BIA A;  3VP6 A;  3AEM A;  2BI1 A;  2WK8 A;  1QGN A;  4EB7 A;  1KL1 A;  2YKY A;  2W7L A;  1JF9 A;  2GQN A;  1AIA A;  3HQT A;  4LNJ A;  3ZRQ A;  2ZY3 A;  4OC9 A;  1IAX A;  3E9K A;  4CXQ A;  4IY7 A;  4P3M A;  3NU8 A;  2QSR A;  4LC3 A;  4WB0 B;  3K7Y A;  5M4B A;  1E5E A;  2CJG A;  1LW4 A;  3N0L A;  1PMO A;  2VMN A;  2HOR A;  3AV7 A;  1M6S A;  3KE3 A;  2ORD A;  3N7N A;  5HDM A;  2HUF A;  2JJF A;  2W7I A;  1IUG A;  3B1C A;  3CAI A;  5EQC A;  2YCT A;  3E2Z B;  3JTX A;  2FM1 A;  1UU2 A;  1ARI A;  4K2I A;  3PIU A;  2AY6 A;  2WK9 A;  2FQ6 A;  2JIS A;  2E7U A;  1PMM A;  2VMV A;  3FZ8 A;  4JF0 A;  3NUI A;  4ZLV A;  4R5Z A;  2W8U A;  3NU7 A;  3ELE A;  1GD9 A;  3DR7 A;  4M2M A;  1AMR A;  1RVY A;  2ZJG A;  3F9T A;  3I16 A;  3WKR A;  5M46 A;  1YOO A;  1ZOB A;  5G0A A;  2CAN A;  3BWN A;  2FKI A;  1X0M A;  5M4D A;  1AY5 A;  2YCN A;  3QI6 A;  1QIR A;  4MKK A;  5G2P A;  2G7J A;  3ISL A;  5JAY A;  4J8L A;  1X29 A;  4AZK A;  2E7I A;  2C44 A;  3IF2 A;  2AY9 A;  3DR4 A;  1TOJ A;  1D7U A;  3K40 A;  4GSA A;  3A9X A;  1ECX A;  1B9H A;  4W1V A;  2GSA A;  1M0O A;  3AOW A;  2YKV A;  3B1D A;  2R5C B;  1TOI A;  3P6K A;  1CJ0 A;  4CBR A;  4A6T A;  4CVQ A;  1GC2 A;  1QJ5 A;  2CB1 A;  3JWB A;  4ZWM A;  4A6R A;  3A2B A;  1EJI A;  4FL0 A;  1EQB A;  3FRK A;  3NNK A;  4RLG A;  4PFF A;  1AKC A;  3H14 A;  5LH9 A;  4A0G A;  2DGM A;  4E3Q A;  2EYQ A;  1TAR A;  4H63 Q;  1DFO A;  2HOY A;  3LG0 A;  3NYU A;  3WY7 A;  2W7J A;  4N0B A;  1LC5 A;  3MEB A;  1I41 A;  3PJ0 A;  4F5J A;  3FQ8 A;  4RKC A;  4ADE A;  3AEM C;  3E6G A;  2BI2 A;  3G7Q A;  4A0R A;  2BWP A;  1J32 A;  1AIC A;  3EI9 A;  2VGZ A;  1VJO A;  1D7R A;  2OKK A;  1PFF A;  1CL2 A;  3WKS A;  2Z1Z A;  2CST A;  2VMZ A;  1BJO B;  3KKI A;  1GDE A;  2V0Y A;  1AJS B;  1I43 A;  4RAE A;  2D65 A;  2X5F A;  1OHY A;  2BI5 A;  4HVK A;  3DZZ A;  2W7K A;  4WYA A;  4CXR A;  1B4X A;  1BJ4 A;  3HDO A;  3TCM A;  4ZSY A;  4F5K A;  3RI6 A;  4AZJ A;  5EAA A;  4RJY A;  4ZM3 A;  2VGW A;  1UU0 A;  1AMS A;  1H1C A;  3Q8N A;  4MQR A;  4ATP A;  1XI9 A;  1AKA A;  2ZY5 A;  2QMA A;  5E5I A;  3VOM A;  5EUE A;  1GBN A;  1ZOD A;  4ZDP A;  1MDO A;  1UU1 A;  1IX6 A;  1E5F A;  1DJE A;  1X2A A;  2HOZ A;  4WYF A;  3RCH B;  5IWQ A;  2PB0 A;  4JEV A;  4AH3 A;  1AMA A;  1KMJ A;  3W1H A;  1MLZ A;  1M0P A;  2ZSM A;  3MC6 C;  1OXO A;  2DKB A;  2FYF A;  2VI8 A;  3R4T A;  5EIG A;  4AO4 A;  1ZC9 A;  1B9I A;  1ARH A;  1AHY A;  4E3R A;  1BKG A;  5HXX A;  4W8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...