5EBMA

Kcsa t75g mutant in the nonconductive state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmA02
4ZYKB 5DD0L 1KJ3L 4X7SH 3DX8A 1MAJA 2R56H 3CMGA 2IPUG 3MV01 1KTKE 4P4RA 4PJFB 4IRSC 3SDDB 3UYPA 1QHOA 1Q9LB 2HTKD 1D9KA 1QBBA 1L7IH 1I8MB 3C2AH 5FA3A 3WDIA 1G9MC 3DROB 3QHZH 43CAB 5DSCA 2AK4B 4RZCB 4Y4FB 3C08L 3S37L 5DC0A 1EEUA 4DKFL 1FFOB 3DO7A 2ZUTA 4PLKD 4ZS7H 3AUVA 3TVMD 1MF2H 4QF1B 3KLAB 2IG2L 4FA8A 2XWJB 3BPOB 3C60A 5F1KC 3W39B 5DJZA 3U0WH 1OD9A 4RGMC 2FNBA 2WIIB 3P0GB 4L3ED 4CVZB 4NC1C 1A3LL 4PV9B 4WI4A 4G8GD 1A7OH 3U2SB 2ZCLH 5DD1L 3D3VD 5B3NA 1W0VA 4I3SH 2D03H 3UYRH 5L8KB 1ADQA 1LVEA 2CGRL 4FZ8L 4HH9A 2MOVA 1MI5D 1DDHA 5I8CB 1XT5A 4HUUA 2WQRA 3ET9F 2NY1B 1VFAB 5IBLC 1A7NL 4ZMAT 2X2YA 1PLGH 3WFHA 4OZGF 4ZFZA 2CLRA 2BNQE 4XVSH 4XCYA 2R2HB 1E27A 2R8SL 4QKXB 4M7JH 4NO0D 5F9JB 5E8NA 1UACH 3CH8A 3QUYC 3RVWC 5D1ZA 5DJDB 3CXDH 5EUKB 2BVEA 4KDWA 2BSRA 5TQ2H 1EK3A 1VACA 1F58L 3UZEA 1F00I 4P3CL 4RFNB 2R0LH 4TQEH 3ZKSD 4ZD3H 2ILLA 1FO0B 1OW0C 4IRSB 4L29A 4AJ0A 4ELKA 4UOJA 5F1SA 5JW4M 3S35H 4HPOH 2X6MA 3DXAA 1A1OB 1HSAB 2W9LA 4NJ9L 5DI8B 2HJLA 1J0IA 3T0VA 3MLYH 4UMGA 1BM3H 4XTRD 4PP1C 2XTJC 3RBGA 1UKTA 3QDGA 1XGTA 4POYA 3MV9B 1OSZB 5J13B 4ENEC 3T8XA 2DIAA 3VGDA 3GUTA 1XCQB 3IDNA 4D3CL 3O3BA 1GIGL 2ICWI 5JIIA 3KXFD 2GK0A 1Q1JH 5J4MA 2AQ3A 4X6DE 1UWGH 4C58B 3ARFB 1JPST 1NMBL 5KSVB 5EOCH 4XC1L 2PCPB 1QRNE 1MFBL 3QXTA 1BZ9A 2DQJH 3GGWA 3G6JB 4NQCE 3LN4B 2HT4C 1WBZA 1S9YA 2FEEI 1AFVH 2R1WA 4Q0XL 2B7DT 4LPTA 2CLVA 3VWJD 3BPCA 1X5JA 3MXWH 5LWYH 5IK3B 4F7EB 5D2NC 1AQKH 4I8DA 3T2QA 2JIXD 5FUCE 2DIBA 1U92B 3LQAC 1EEZA 1NGXA 3EO1A 1S78C 4XP5L 1FFQA 1GGYA 3TNMA 5K9QG 2AV7B 5JNYA 5CP3H 4QRRA 1ZA3B 2PYEA 1KEMH 4LPWA 5F1OB 1WWWX 1P84K 5MEPB 1HQ4A 4XMLL 4G6ML 3UAJD 5ACMA 3BH8A 4O9HL 3IXTA 3RNKA 1XF2B 2PW1B 4QHNA 3V5HB 3BJ91 2HMIC 3U0TA 4JM2F 2YMXL 2X4OB 4HIHB 1DFBL 3H9HB 4HFWA 4IOIA 4MDIA 1G7MB 3IYLW 4FFZL 4PRPB 5E00B 3HG1B 5EO1A 4JDTH 4LSUL 4YFLI 2LABA 3BD3A 2YD5A 3DSFH 4NO3A 4YE4L 3HRZB 1NUGA 1YNTB 3DROA 3B83A 1LO2L 4WU7B 2VLKE 2BVPA 1FHGA 1YEJL 5BZDB 3NPSB 1ED3A 1NUDA 5FUZH 5GXBB 4DGYL 2F54E 3D39E 4MQ7B 5HHNB 2IAND 5JR1L 2KBGA 3C6SA 4LARH 4LHUA 4QRUB 2CDEB 1H0DB 3CZFB 4Y19E 1RUQL 1RU9H 2ICWB 3JV5A 1KN4H 3QFJE 1NLDH 4UIKH 4PV9A 1I85A 4RDQG 1YEDB 4OZFG 1QO3A 3TJEH 3SCMA 1TFHA 2ITDB 1NMCB 2GKIA 1JPGB 1WFOA 4XWGH 1U6AL 5CKGA 1TZGL 5ID0A 1F02I 2V2WB 4EXKA 5IVOA 1YEGL 4LLWB 3NPZB 1U8JB 3QIWB 4Y88A 4JREB 4AEEA 4NP4L 1FFNA 3CUPB 3MA7B 5EIIA 2X4NB 4Y1AD 3IRZA 3D25B 4KK6C 4P5TA 5AAWA 2GSIA 3F7YA 5HPMA 5T1LD 1UM6L 3VI3E 1RZIA 4PRHB 3GHBL 2XN9A 4BQ6A 4ODUB 5HYSA 2ADFL 4WW1A 3V5DA 5BV7L 3BGMA 4HDIB 2VDPL 2FR4B 4HGWB 4LRIC 3WO3B 5L7XL 1RJYA 3EOBB 3DTXB 1QSEB 1WVZA 1V8HA 2PXYC 4QYOA 1TXKA 2ENSA 5ESQA 3WXWL 1G7LB 3S88L 2FJFB 1RZJH 3CDGB 4FTVE 2ZOKB 1A5FH 3ARDC 3RWFA 1AXSA 1BWWA 1SBSH 2V9TA 2A6KB 1S9WA 1SJEA 4MD0B 2DI9A 4Q9QL 4P23D 3GBML 4BFEA 5GRVK 3WS3A 2OR9L 3MV9A 2KPNA 5DMGD 4XZUA 2ZCKL 3GUTB 4JY6B 3NA9H 2Z8RA 4ONOA 2OXGA 4LLYB 4TUKH 4TUJA 1Q0XL 1C8PA 1D5BB 2CJUH 5IBTH 3DX6A 4MHHI 4UTBH 4JE4B 4P57B 5ILTH 2NLJB 1YY9C 5IMMB 5F7DB 3FN0H 2JB5H 1F6FB 1FE8H 2JE8A 5C6TL 2XXMB 4XNQA 4LLDA 4QXTA 2YPLB 3RIFF 1J0KA 4OKDA 4Z95L 1CL7L 1LMKA 4OGAD 5DEZA 5HI4C 1X3DA 4NFBA 1NCWH 2FWOB 2F54A 4LKCA 2QHRL 1AKJA 1ZS8B 2R39A 1KJMA 2VL5A 1Q38A 3QSKB 4MD4A 1EEZB 1NGXB 4R0LC 4K3GA 2Y5EA 4KTEH 2AJZA 3HI5L 4JKPH 1U3JA 3HFML 5IP4A 2D31B 4L9LB 3F7RA 2OS7A 3N9GH 4QRRB 1PSKH 3QRGL 4F2MB 4JZJB 5JPNB 2XZAH 1OGAB 5EC2A 1KLUA 1CFVH 4EN3C 2RFXB 4LDOB 2XZQH 2P1YA 3RWGA 4OCXL 5KSUA 5GS1C 4KMLB 4Y1AE 3RNKB 4CUCA 4NHUA 3AS3A 4MB3A 4MJIA 5H2BA 3RIAF 3WV0A 3V5HA 4N5UA 3QRGH 1S5IL 1MJ8L 1IRAY 4PTUA 1QACA 5CUSH 3EDFA 4RAVB 3T09A 1GOFA 4C54A 5DMGC 3HUJB 4PJDA 4LK4A 4ZSOB 3TN0D 1OHQA 2H45A 3JUZA 4FMKA 1HNFA 1NCBL 2KH2B 5GRUH 4QOKB 1E4WH 1WEJH 4NWUL 1T80A 2WIMA 2E27L 4MA7L 3WDJA 3AAZA 1EFXB 5E2UL 5ITBL 3TH4T 2PO6D 3W11C 4HEPG 3RVUC 3MTRA 3BP6B 5E94B 2YC1B 3U4EA 5HHNA 5E8EA 1Q9KA 5EO9B 3RZCB 3BIAX 4Z0XA 3X3FL 4ZXBC 4ONFL 4JZOB 2ICWA 3IU4H 1PY4A 4OFYA 4ODVH 3GSOA 5LVEA 4UIMB 1MCFA 5F8RC 3WN5B 5EO0A 4CRPA 2XOTA 4OBRA 3ARZA 4R2GC 3NCYS 2CK0H 3JV0A 1IC5H 4OQTL 3FCTA 1DUZB 3E2HC 2DQEH 5JQHC 4YFLF 4GAFB 4GRLC 5JHDD 3GM0A 4I18C 3RWHA 2AJXL 2AK1L 3SKMB 1Z9OA 1CD0A 3X17A 2AJ3A 4KKBD 1TTGA 2J88L 1A6UH 4XGZB 3KLSA 2XN9B 4OD2A 2H32B 3BW9B 4B5EA 5F9OH 1T22A 3GFUA 1DN0B 3FB8A 4EEEA 2DOCA 3LRGA 4Z5RB 2FB4L 5SWSA 4K07A 1BWMA 1JNJA 3CU7A 2R2EB 3STZA 1B0RA 3NCCB 3KPQB 2IPKA 4X5WA 1VERA 2XRAH 3K74B 1KOAA 4ZUSB 3NIGE 3STLB 3NIDE 1M7DA 1VGKA 2BVYA 2DWDA 3WO4B 1N6VA 2GY5A 4ZOAA 4G8FA 4FRWA 2BNQB 4K7PX 2ZUSA 1DQJB 2GHWB 4IMKA 1UG9A 4MNGB 4APQB 1GL4B 3G04A 1MH5B 4WGVB 1MVUB 2F5BL 2HT2C 4OIIH 3VWJA 4MXWH 4Z7UB 3D0LB 5DS8A 5CBAB 1IC7H 3RY6C 4W6YB 3NGBC 2AEIT 5IMMA 1ND0A 3GSUA 5CIPA 1FH5L 4KK9D 3QWOA 3I9GL 1BFTA 4GQPH 4R97C 4J4PC 3VGBA 4N0CC 1FC1A 4ZDHB 1A2YB 4XVTL 3SGJC 3RVXC 1ERNA 4PRAA 3HR5B 3C9NB 1FAIL 2IBBA 3SKOB 4C56A 2BCKA 4PJAA 1AGBA 1T1XB 3TN0A 3WKNA 2FJGA 5L6YH 1GGIL 2AJZB 4GXVH 3PV7A 4XBEH 3FO0H 5EB9A 1AKJD 4CNIA 3AM8A 3ARSA 4LQFH 4FQJL 1GSMA 4M6OL 5DHXB 4LCIH 3CIQA 2E3VA 3BD4A 2EEAA 3WCYA 2APWA 2LAAA 4M6MH 3BSZL 4KI5D 3L7EA 3F5WA 4S0SD 2OL3H 2XKNB 3G5VB 3VI3F 1FORL 3TH2T 5INCA 5C0IA 1DQQA 1QA9A 5K93A 1DBKL 3QQNA 4YDKH 1FPTH 2J88H 2RCSL 4P46A 2UYLB 3VXSE 5TDPB 5HDQH 4R96B 1P7QA 1V5JA 2GYSA 4QGTA 5HHPB 4WFHD 2EEBA 4I18A 4NOBA 1IGML 4C4KO 4PJ5E 3EOTL 3L95B 1I3UA 1T7YA 5EN2A 1KJVB 4CMHB 2P46B 1AE6H 5DT1L 4Q97A 5KVEL 1N2RA 3WLWC 4HEME 5E94A 4KVNL 1NMBH 5KW9L 1QBLH 5C6WH 4JFYB 2VTFA 3VXRE 1CS6A 3KLHD 4Z0XB 2WM0A 1TQCC 1AD9B 4OUOA 5CEZL 3KR3H 3DMMA 1FSKC 1SEBB 3MGOB 3KPOB 5HVFB 3KPMB 3T0ED 3NFSH 4N0RA 2BVQA 4FXGA 3M1BB 4TNVF 3NZHL 1FZKB 3DYMA 4QHMB 5I1EH 1JHKH 1JL8A 3MACL 1RUAH 1R5VA 2FL5B 4RGOL 1MY7A 3EFFA 3OAUH 4EN3A 3F65A 4YXHL 3FT4A 1WT5C 4HV8A 4Q6IA 3DJ9A 3QUMH 4F3FA 1F4XH 1A4KB 5GJTH 2D4FA 4DN3L 2IANB 2IBGA 1RD6A 5IFJA 5FUZL 1LEKB 1BM3L 5HHMB 5DHYB 4P2YA 2NY6B 4Z77B 1AC6A 4JHWH 5JO5B 3QUML 2VC2H 1TNNA 2WANA 3PHOB 2VSCA 4U1NA 1IEBB 1LO3L 3H3PL 3Q6FB 4MQXD 3ARDD 5L2KD 4F7CB 1DEDA 4EOWH 2E6PA 5SWSB 1D5IH 2HVKB 5KJRL 3V52L 1PG7L 3I3BA 4X6BA 4R26H 2YD7A 3AXLA 3TA3D 1ITBB 3RWCA 4OCRH 5IG7A 3B43A 5F1IB 1VGKB 3VXRB 3T4YB 3BYTA 2CRYA 4JHWL 4M7LT 5D1QB 4ZYKA 1SYVA 2E7MA 3ALXA 5C7XL 3IFLH 2EE3A 1AD0B 3M8OL 2I9LA 2QQLH 3T1FA 4XNXL 4IDJL 3GJFK 1DBBL 1CFBA 2HLAA 5GJSL 1GVIA 1E4XL 3TC9A 4DAGH 2K9UA 1WBXB 1TLKA 1FYTB 1UWXH 2MJWA 5E1AB 1XGRA 4MZ2A 3TPKA 2CKBB 3VXMB 1YEEL 1F4YL 1QSEE 2OP4L 3QEUB 3KJ6H 4PG2A 43CAA 4HX1B 1I3VA 4PTTA 3AREA 2AABL 4R7DB 5EOCL 2HT4D 1AGFB 5FB8B 3MODH 5HHME 2JCCA 3GMLB 5FOJA 1G7HB 2PO6C 2F58H 4N9GA 2YD8A 4C56B 3QEGH 5JZ7C 4NGHL 4JDTL 3MBED 3UJJH 1R5IA 1YC7A 2QV2A 3UJIL 5LGHH 2IQAA 4JZJC 3SJVA 3O3EB 3Q0HA 3VA2C 2WNGA 1A14L 5GRXG 2XKNA 1F4YH 2OP4H 2VN7A 1OT2A 1CDGA 2WUBL 4JFDA 1NUNB 4NM8H 5D7JB 3DUHA 2FZ3B 3N06B 3S35X 3TA3A 2GJ6B 1DJSA 2ADFH 5L8LB 3ULVE 1OGTA 4L3AA 4QHUB 4L4JA 5T3ZL 4CDHA 2VISA 5E8NB 3SDDC 2NY2B 3H9SE 4OCYL 2G5RA 4I18B 4Q9RL 4ZUUB 5ENWA 4AIXA 1J10A 1FJ1B 4WEUD 2IWGA 5IUSA 1YPZF 2W0KA 4H0GA 5IT2H 4HH8A 3DSFL 4G5ZH 4NQUA 2H32H 5C0GB 4IRSA 1EDQA 1U6AH 1A9EA 4G43B 1UVQA 3REWB 3U46B 5CD3B 3LB6D 1CLYL 1XF4A 1ZHBA 5EA0L 4ERSL 3CXHJ 1WWAX 4ZOCA 3RZCC 5FYJE 1S7QB 4MQTB 5C0DB 4O9HH 3GSNL 3U9PH 3VU2A 1F3DH 1ZT1B 1CGSH 1C1EL 1MELA 2R0WH 2A9ML 2H9GA 5DJ0B 2PTUA 1CVRA 1D5MA 1XCQA 4DUVA 1ZHLA 2NY3D 3QG6B 3DPBA 2FL5A 3C5ZA 3JVGC 1CXLA 2MCG1 1KENL 5J56B 4JVPA 1NDGA 4P4KC 1YN6B 4QHKJ 1FRGH 4HG4K 4MAYD 4I0KA 5B8CC 1K8DA 4MDJA 3B6SB 3V0AC 5K9KA 3MPCA 1U3HC 3HC4L 1HHIB 2WUBH 5C9JA 3AC0A 3HC3H 4TVPD 4JHBA 4KPHH 1NCDH 3RJDA 4XCFH 3LQZB 4NRXA 3BI9X 4J4PD 5I1JL 1BD2E 4P2RA 5JOEA 1O7SA 2A9NL 5SWQA 1LO0L 2RR3A 4Y5XC 3T0DA 4YDLB 5IJVB 1CGXA 1TENA 4NRYB 2B4CC 3RVUD 2BOCB 3MV9D 4Z7QF 1JMZA 5L0QC 2BY0A 4P5MB 4WTWA 1U42A 3BPNC 5B39A 3THML 4E41E 3QA3B 4LOUC 1XH3A 1JJUA 1SM3H 5I2IA 1JZ4A 1U8MB 1ZA3A 2PYEB 3FQTB 3MJ6A 4HK0B 4OZGE 2VDQL 2VITB 5D6CA 1TCMA 2DTML 3X12B 3ULVD 4PS4H 3RGVD 4D0DB 4JM2D 3BP5A 1P4BH 3O6MH 4I4WA 5FYLD 2OJEB 2MTPA 3GMRB 3EGSA 3MRJB 3QUZB 4DGIL 1B90A 3IETB 5DRZA 4BH8A 3EYSL 4QXWA 4XPHL 3G5ZB 2Y5TA 3TT1L 3FMGL 1CLZL 4OLYL 4W4NA 3H42H 4L4TD 4NZTL 3VFTA 4NKIH 4PRIE 5IJKA 3KJ4C 1WISA 1OAUL 5F88B 3HRZA 1MHHB 3QEQE 2WLYA 4QTIL 3MCLL 3HE7D 3TZVD 1F4AA 2R4SL 5FUOH 2W0FA 1RY7B 1CTOA 1A7RL 1ZGLB 4R97B 4UQ2A 5GRZA 1A6AB 5LBSH 1F45A 5IGXH 5M7QA 1I1AD 2YPLE 1HHHB 2DQCL 4N0UA 1NAMH 3TPUA 2YBRB 4PJCB 4JQVA 1IQWL 4M5YL 4LASL 2D2OA 1UKSA 1KBGH 5IFHL 4OZIF 4KHTH 2AEPL 3MQIA 4MSWB 1CG9A 2R69H 4KK6D 5K59F 5ITBH 1EAJA 3QR2A 1MCBA 4NKDA 4LSDA 2C1PA 3TBVB 4G80B 3HFMH 2VRAA 3SGKA 3RNQA 1C12B 4EUPH 4GQ9H 4QY8A 3HPLB 3SDCC 3V6OA 1UKQA 4UTAH 5I74B 5CWSA 5DO2C 4X9IA 2X4NA 2EIDA 4NC1E 1EHAA 4WFFE 5HPMB 3ILQC 2LFGA 1AH1A 5I76B 1KEGL 1FYHB 2ZKHL 1CL7H 1I7TA 3OKDB 3KPSA 2XA3A 3DRQB 3WLWD 3OF6D 1U3HA 3OKMA 1U8KA 2AI0H 5IQ7L 3QH3B 4ISVA 2BXZA 4HGWA 4P2QD 3BKYL 5GGSB 5B3JF 1A9EB 1S7XB 2OX5A 1UVQB 3U30B 5J0BA 1IMHC 1D9KD 2Q3ZA 2RHEA 3EO9L 1S7UA 1N6QL 1RUML 3HE7B 3CFBB 4UILH 4UU9A 4PGCA 4NQCD 5IKCB 1LQSR 4A2MA 1UWEH 1FO0H 5T3ZE 3U9UB 5EZJB 3QDGE 2ZWLT 3DVNB 3ROLB 4WWKA 4JY6A 5F7KC 4Z8FH 1NAMB 4PJEF 4LLYA 4XP9H 5MEQA 1JZ8A 4TUJB 5IB2A 5EWIH 3BRDA 3RGHA 2IH3A 4PJ5B 3RKPA 2IEPA 3MCKA 1HYRC 2XICA 1MQKH 1OTUD 3KPPA 5C0JA 3BKYH 4JN2A 2FLBT 1RZKL 5KANG 2VDLH 4J3VA 2O5YL 4UV7H 6FABH 3C2SA 2PUQT 2ATKB 3SO5A 3ARYA 5DZLA 5C08E 1M4KA 3QUYB 5DJ6B 5AD0B 1HKLL 2DYPB 3FOLB 1T04B 2J12B 2EZ0D 2OK0H 4XPAL 2P47B 4P2RB 1H5BC 5HHQA 3LAFA 1MJ8H 3X3FH 3ULUH 1NC2B 2QTEA 5FYKD 4MS8C 4G8EA 3SBWC 4M7ZC 5CMAB 5F1NA 1U2CA 2B0SL 4P2OC 2Z8VC 4P5MA 1ZSDA 4ZFGL 2F74B 1XH3B 1EFXD 5I2IB 1OGAA 3R0MA 3JV4B 3UTOA 3ZMRA 5A3ID 3TCLA 1S5HB 4Y4KB 5E2UH 5I1IH 4RNRB 4YBLC 3GMPB 4CVWA 4P5TC 1EFQA 5KVGL 4OUUB 1OWRM 3L5JA 4LOUD 4OCWL 1QVOA 3J7HA 4OZHE 3C6LC 4WFFD 3ETBF 4WIQA 4NSKB 1QUNA 5KTEL 2AJSL 2Q7NA 4CU8A 1WCBB 3EIFA 4RGND 4Z7UE 1BJMA 5IB1A 4JPWL 5KANI 4R0LA 4DW2H 5JIHA 2BSED 1ZGLA 3BOVA 1BLNB 3LDBC 4X6EB 1JGVH 5AZEH 4K7FB 2ZG1A 3TGXA 4EDWH 2NW3A 1Y6KR 4NRZA 4HGKC 2XTJB 3IVKB 5J1SC 1AO7B 3EJZD 3IF1A 4C83B 2ORBH 3LHPL 3SGDH 3VWKD 3X3GH 4Y16C 1N3NB 1ORQB 2EXWD 3BEWA 3OPZH 4L3EA 1A3RL 4Q2ZB 1A47A 4HAGA 4WNQA 1U8NB 5EO0B 1OAKH 1IAKB 3LZFL 3A0OA 3FB6B 4I3RL 4GT7A 2BSRB 4KVCL 4XP5H 3HPLA 1KACB 4JY4A 1J0ZA 2V7NA 4O2CA 4XBGB 4MLSA 2CXKA 4PRID 1HHKB 3MMEB 5T5FH 1S9VB 4HS8H 4I2XA 4H1LG 1FNSH 1MRCL 1S7VA 3MXWL 1V05A 4K9EH 3B3IB 3IKKA 4YHMH 2X41A 4Q9BA 2Y07L 5DD6B 4JO2H 1JRHH 3DXAB 4PGEB 4OCWH 1NFDB 2ICCA 2QR0A 4D0BA 2VDOH 4PB9L 3FB7A 3WUWA 2C4FT 1QLEL 4Y19B 4DKEL 5F6IB 3JWDH 4U1HB 3VGGA 4LCCC 4XI5D 4K9EC 1LK2B 1FNLA 3BKJH 4QLRA 2Y7QA 3LSOA 3O3BB 3JWNC 4DVBB 3NAAL 1KB5A 3SKUD 1T1WA 2WK2A 3OL2A 4CMMA 2H3NB 3FONB 1BVKA 1T5XA 3HI6L 5I73B 4NFCA 2I5YH 4PGJA 1LK3L 3S4SB 1T4KA 3QUXB 3WLBB 5HHVH 3G6AA 4GRWE 3VFNB 2P8MA 3QIBB 2A83A 5C0RH 3LZFH 3ZE2F 4G3YH 1ACYH 4XH2B 4TQEL 5JOPE 3O11A 3T2PA 2HAZA 4N0CD 3I75B 3UTZA 4H25A 3EYQD 4NNPH 3WXVH 4P2QE 1FDLH 1T04A 4WUUD 3IDIB 2GEEA 2QADC 4EUPB 1U8LA 4NQCB 4PRAB 1G7QA 3C9NA 4WI2A 1HQ4B 3SKNA 2ORBL 3LHPH 5I18L 1AGBB 1E6JL 4KROC 5ICYB 2Y25A 3NH7H 1XF2A 3RL1A 2PW1A 4QHNB 4UINL 5BQ7A 4LLAA 4ZTPL 2FEDC 2NY6D 4JDVB 2FGWL 2H2PC 1G6RL 4FQQB 5ANMB 1I7ZA 2EE2A 4WY7L 1G7MA 5D1ZC 4ZD3L 3ARDB 3P0VH 4KVCH 4OGYH 5L2KB 2JCCF 4RNRA 1UM6H 4LVEA 3HMXL 2UZIH 1HWGB 2EE6A 1YNTA 4OUUA 1QD0A 15C8L 2VH5L 3DUSA 4TNWF 4ZAKB 3PV6B 1LO5B 3QAZB 4ONGH 4HMCA 3MLSH 5I9QC 2NTFA 4WWKC 1WZLA 3QCVL 3FQNB 4XXDA 5ETUA 4EXPX 4Q9QH 4NSKA 4R96A 1ZMYA 4OFPA 1BD2B 1DFBH 4KRNA 2VDRH 1CFTA 5H35B 1WCBA 3DOSA 2EYRA 4R4FL 2HVJB 5AYQA 2VDMH 3FTGB 1BEYL 5J9PB 3TBYB 4PG9B 4HIJB 4KFZC 1IAMA 2OMNA 1E4XH 3TBTB 3OB0H 1GIGH 3VG9B 3GO1L 3VXME 5DK2A 5FOBB 2FBOJ 1CDYA 5DURB 4L4VD 5IOPB 4C83A 2V2WA 1FG2A 1GYAA 1F3JA 2E5EA 1J5OL 4HZLB 5F9AC 2BERA 3E3QC 4C59B 3CK0H 1OPGH 1RK1B 3INUH 3PGDA 1B2WH 3O45B 1I4FB 1C16A 2P42B 3TWCH 2OZ4A 1ZHKA 5CAYB 4OF8A 3QISA 4YNYB 5TE4L 2BHZA 3BWAB 4NPYB 4OI7A 1J11A 3V5DB 2V7NB 1CI5A 3DGGA 4L8DB 4LFHD 4OCSH 4X6FB 4HJJH 4U05A 1A7QH 2EKSB 4UTAL 4PRNA 2IANA 5K33A 3TT1H 1LEIB 3QUZC 1IKNA 3EAKA 3V0WL 2CMRL 2DLIA 1M7IB 2BP3A 5DLMH 4NKIL 2KQNA 5I6XB 1E28A 4XP1L 4M43H 3OV6A 1CE6A 5D93C 1UXSB 5DMIH 1IFHL 2NTSP 4I9WE 2JB5L 2DLEA 2WWMC 3DNKA 1RURL 1BEYH 1NAML 1WC7A 3LKPB 1IGCL 2CDFB 3D18B 1JZ5A 2VSDA 4IOFD 4YXLL 3VW3H 4PRIA 1A14H 4LAQH 3QZWG 4JHZA 4NUJA 1TVDA 5M94B 4N90E 3FONA 1EEYA 4N9OB 4F57L 3EFDL 1UH3A 2ED8A 5C07B 4G6FD 1FL6B 1LP9E 5F7UA 4APQD 4Q58C 3TO4B 1KPRB 5D7LD 2A83B 1NGQL 4E41A 1FP5A 3BIKB 1OQXA 2NX5E 1KCRH 3GMNB 5A2LH 2GW5A 2V9RA 4M1CC 4O5LH 3SDAC 1RSFA 5DQDH 3HA0A 1DN2A 2MPAL 4HSQA 1VENA 1AGFA 4XPFH 5FB8A 1U8LB 3MRIA 1QKZH 3QJFB 1PKOA 5T1LB 4N9GB 1MHPL 2W9DL 5AUMB 1RUPL 5ICYA 1KTDA 3RY5A 2FO4B 5BQ7B 5C70A 4PYHA 3MLUL 5BO1H 1PFCA 2MQ0A 1FIGH 1FCGA 2OTUA 2OQJB 2G2RA 2IQAB 3OGCB 1BVLB 3O3EA 2CKBL 2E8ZA 1JN6B 1A6VL 4LLUA 2BSTA 3MCLH 3LKQA 3MLUH 5EOCJ 1K6QL 3TJEL 4OZGB 2FZ3A 1U58A 1QR1B 4Y16D 4JM2C 1QKZL 3AAZB 1VGEL 3P11L 2HWZL 5DDHB 4GSDH 5ETUB 2DMKA 4OD1L 2DQDL 4TOYH 1BD2A 3RTQC 1W72L 1FZOB 1JE6A 3U1SH 4M43L 2BVTA 5FK9A 4X6CE 1HH6B 2FX8H 2PW2A 3GEWB 3PL6D 2ICES 1R3IH 3FTGA 1NGQH 4D9LH 3WIHH 1HHGB 4RISL 3HZKA 3IJHB 2AJVL 4LVOB 3E1F1 2PTVA 4GW4B 1YECL 3NABH 1G84A 3S9DB 3WN5A 3H8NA 2G9HB 3U6RA 4U1LB 2C3VB 3KVQA 2AXJA 4AIZB 3QCUL 1MJJA 2HG5B 5D7KD 3QO1A 2W9DH 4M8QB 1NDMB 3OXRA 5C0CB 7FABH 3QIWC 2C3WA 1RIVL 4NYLA 4F9PC 3VH8A 1H3GA 3C5ZB 1WCQA 2F8OA 2ZSVB 3A6BH 5F7FA 5DJ8B 1KCRL 2NY4D 1I9JL 5TGBB 5DFVD 4FP8L 1CCZA 5DVMA 2W07A 1KIQA 5EUOB 4ZUVA 2A77H 3TIEA 3U0WL 3ALPA 1JZ3A 5HYSG 1YMMA 3AY4A 5FO8A 1UM5L 1JPSH 4OD1H 5TH2B 3MUGA 1A3LH 4G8IB 2WWKO 4TN9A 2FIRT 2VABB 1ULVA 4Y4FC 3QHTC 3JV6A 1A1MB 2VAAA 4G8FB 2X9YA 3LMJL 1A6TA 4LLVB 3AU1B 1DL7L 3EYQC 4MNGA 5DEFA 1T1YB 4LSQL 2YA1A 1HKFA 3BE1H 3BZ4A 3ILPA 5HI4D 3LKPA 1ZVHA 4J12A 5LG1A 3S37X 4E0RB 5FCSH 1KG0B 1DSFH 5I1HL 1I8KA 4F58L 2VITA 4P4RB 4JANB 5EBLA 4QXUL 1XGYH 4DZBB 2FIKB 3IJSA 1ACZA 1G9NL 2GTZA 5CINH 5HHMD 1L9NA 3MRLA 4RAUA 2DIJA 5CIPB 2VUYA 1C08B 4JO4L 4NQXA 4XNZB 1Y0LA 3O9WC 5CGMA 1FGVL 3IETA 5DRZB 4K94L 3KXFE 4F7MB 1UJ3C 1M7XA 1A2YA 1YPZE 3Q5OA 3GRWL 3M8OH 1FVCA 3O6LH 5IFHH 2CDGA 3HI1A 3WS6C 5BVJA 1KPUA 2IPUK 5MI0B 3C60B 4PJAB 4F7TB 5D6DC 1J1XH 1UB6A 1WZMA 3VJ6B 1JWUB 1XGYL 4KZDL 3B2VL 4K3JL 4O51B 2MQCA 2NXZC 3DX9B 1CGVA 2BNRE 5DWUH 4P59L 2PXYB 5HVGB 4U7SA 3DYOA 4PJCA 4XPAH 4YDIH 3G5VA 1IAIH 4L5FH 3MOBL 2FATH 3H9SD 1VFAA 1QA9B 3MNWA 4C4KT 4XMPL 1OY3B 2FBJH 3BXNB 2DLTA 5F9JA 2XWBB 5L9DL 3V8OA 1HH9B 3O4OB 4LLUB 3IJYA 1R6VA 3SDAA 4OB5L 3HRPA 2Z91B 3PHQB 2HMID 1YMMD 1C5DB 4BZ1L 2CR6A 4IRZL 1HOCA 5DR5L 4B0MM 3JWDL 2Y4SA 1A64A 1FPTL 1CD1B 2YK1L 2AS5M 3L3DA 1LD9B 4GAJH 3OWEA 4S0TD 1T0MA 4XPBL 3W0WB 4DOHE 3FO0L 4JPWH 5D2LB 2NY7L 3Q1SH 4BKLA 3KPRB 4LSSL 1JF5A 4PGCB 5IKCA 3JWOH 3SO3B 3FN9A 5CS7A 3O2VH 2HG5A 4M4PA 4Y5XA 1LE9A 1Y18A 4UV4H 5L0QB 3MOQA 5FYKH 1TJGL 2EDQA 3LS5H 3T0BA 3ROLA 3OXRB 5C0CA 4M1GH 4MA1B 1CFQA 1R3JA 1NAMA 5BS0E 1BZ9B 3GK8H 2VXQH 4Z7QE 2NPLX 5B38A 1CIUA 4N1CA 2V5SA 4LKXA 1OAZH 2NY0D 2K7QA 4PUBL 1K5NB 4RBPK 3TVMC 5IK3A 1IEBA 4F7EA 2C1OA 3MRGA 1JNLL 5I30L 4MXWL 3HN3A 3NAAH 5EUOA 3RAJL 4YHPB 2YSSB 4U6VH 4CJ0A 3CLFH 3TIEB 5EOQL 2VDKH 4YHML 3GJFH 4APQC 1YMMB 3BPOC 5JNYB 1QRNB 4KAQL 3B2UC 4WCYH 3MUGB 4Y4HC 1S78D 1KULA 4HWZB 2W65A 1BX2B 2A73A 5CJXC 1BFOB 2C4FU 1T0NB 3HKFA 3BH8B 1X9QA 3I6LD 1F6AB 4X6DF 3SGJA 1KTLA 4HWNA 1MIEH 2NCMA 3ZDYE 4R7NB 5DEFB 3BN9D 1Z2KA 4KUCF 3TNNA 2Z35A 3P4NA 4HLJA 3MRMA 4PJXA 2VLKD 3EBAA 5DO2D 1IM9D 4OF0A 1PG7W 4JGJA 3T1WA 2L0DA 2X7LA 4FQ2L 1PG7X 5EBLB 2BXYA 1YN7B 3L5WB 3U83A 1EGJA 4MYWB 5E2WL 1TTFA 2VR9A 1YNKL 4YHYB 4JB9H 3QWRA 1XGRB 4BYHA 3ARFC 2APFA 4WW2B 4HX1A 4PTTB 1IBGH 5E5MB 4F7MA 4J2XA 1WIOA 3WD5L 4BELD 3UJIH 4N5ED 5INDB 2R1YB 1EVUA 1RUKL 4JRYE 5HYJB 4PB9H 4LQ1A 5BZWA 3VA6A 4M61A 3TBWA 1OM3L 3VD3A 3DI3B 2BZDA 4KK5C 1GZPA 1NMAL 4DFIA 1CBVH 5DMKA 2CSPA 4JGMA 3QI9A 1F13A 4I3RH 4PBXA 5IFAH 5I15L 4HUMB 4OGAC 3EOAA 3DX9A 3P4OB 3AMKA 5D7JD 2E7LA 2ITDA 4LSSH 4LEOB 1OAQH 1JPGA 5KSAC 1VFBB 2H2PD 2ZCKH 2OR7A 4ZPVB 5DTFB 3UMTA 1T89C 4KAQH 5IFAL 2X4QA 2GY7B 2XFXB 1JYXA 1FC2D 3BUYA 1CT8A 3CFJB 3MRCB 4NZDA 1JZ2A 2B1HL 3I85A 1OM3H 3QDJD 5BW7A 2QQKL 1EUUA 3GSXB 4YHLH 4OLUH 4PIRF 9CGTA 2H6PA 2VN4A 3PP4L 4WW1B 1FJ1A 1EPFA 2HJKA 4PB0L 1YYMH 4QOKE 3L3IA 4UBDD 3W5MA 2DBJA 3DUUB 2IQ9L 3EHBD 3PQYB 5I75C 1H3UA 1BZQK 1A9BB 4RIRA 3BDBA 4KRMB 1DLFL 1QSEA 4GSDL 5DRNA 3GIVA 4AQOA 1X5GA 5ESQB 1YNLH 1U8HB 3TWCL 2BSSA 5JXED 3H9SB 2DDQL 1X7QA 4Y5VB 2ADJA 4GXUM 3W0WA 2P5WA 1MCPH 2EYTB 2CKBH 3DARA 4YUEL 3IAQA 4BKLB 1OAUH 4MJ6A 1I3RB 5IROC 4PJXE 1MNUH 1P7KB 5HD8C 4XWGL 1L6ZA 3HB3D 1Z9SA 2VR5A 1RVFH 4YHOH 4YHIA 3BKML 5E9DA 3U36A 1KN4L 1LGVA 4ENED 1QFUL 1JPTH 2O5ZH 5CZVH 4BQ9A 4LASH 2DQEL 3KWWA 1IAOA 2IALA 1B3JA 4MCYB 3GSWA 5JHDB 4GBXB 3MRFA 4EI5C 1XGPB 4KROD 4UTBL 3O4LD 3O11B 3I75A 4FP8H 4V1DB 3F58H 3T65B 4YHPA 5I15H 5AEAA 3RTQD 2ZKHH 3FFDA 1KIUA 2K1MA 1NGWA 3IDIA 1SVZA 1CU4H 3OXSB 4K8RC 5D6CB 3IXAB 3HZYB 3L3HA 1D6EB 2IMNA 4XCFL 1QP1A 1O5DT 2A9NH 4Z76A 5L2JB 4OLVH 2Q86B 4Q6IC 4NWUH 5GSVB 5KG9A 5K9QI 4R2GD 4XB8A 1ZT7A 3GBNL 2JB6B 3HUJA 1UWEL 5IF0A 1SBSL 4S1QH 3L5WA 4NZJA 4GAGH 2P48B 4U1SB 4XNMA 1HYSC 1FV1B 2VLJB 1E6OH 1EEQA 4BA8A 1TTUA 4QOKA 3FN0L 3W82A 1CFNB 2F5AL 4U31A 4Y16A 5C08B 1EFXA 3ZZ1A 4HKBB 2FECL 3UP1A 3QDMB 5I1DA 1JWSB 4PD4J 1JNNH 3D2UB 2HFTA 3FFCD 5CEYA 2R1YA 3T0AA 1HHHA 3G5XB 1RK0A 4EIZC 1Q9KB 3VFWA 1Q9WA 4B41A 4U6XB 1UA6H 2BJML 7FABL 3RZCA 4WI3A 1A8JH 5DMKB 3RJQB 4PY7B 2DAVA 5T1DH 4L8CB 3SDXF 2E27H 4Z18A 3PQYD 4OIAA 5KSBB 4KZDH 4RMQA 1KIPB 1NKRA 4RFEA 4YDVA 3K1DA 1WITA 3T2NL 1I1AA 1I3GH 5DTFA 4V1DD 4D2NA 4R90H 4Z6AT 2WUCH 5E8PB 2DQIL 1YUHA 1I7RA 2SEBA 4IM8A 4ZAKD 4HWBA 3QUMB 1HINL 4N0FB 2WP3O 2ZUXA 3C87A 4HJGB 5TF1H 1ZK9A 1OAXH 3CVIL 2DM4A 3CFKA 1C16B 3IDXL 1A4JA 4KQ4H 2RJMA 3AB0B 3KPSB 2H32A 4WFHE 3EZJB 4NPYA 4P46C 1IKFH 2DRUA 2FX9H 3OHXA 1ZWIA 5C8JB 2EKSA 2NZIA 4WHYH 4MNHA 4Y8AA 4YXKL 3QO0A 5KOMC 1CQYA 1IQDA 1KJ2H 4K7PL 1HNGA 3O6FC 5EC1A 2C3GA 5DD5H 5GISH 1N5YH 1S7UB 2QADB 5IV2A 2QQQA 5CHNB 1YEIL 4YLQT 1AHWC 1U3HD 2VXSH 2HRPH 2DWDB 4LRIA 1BQUA 3MV8E 4MAYB 3ROOB 3P9LB 3KYKH 3FMGH 3MLXL 1G0YR 2UV3A 3L6FA 1WC7B 2DKMA 3WFCL 3NBNA 2V2TA 1W72B 1QSFB 5CJOL 4J4PA 5DQDL 2W9EL 5FYLE 4BK5A 5C3LD 1MJUH 4QTHB 1EJOL 5DEGB 3D0VA 5F9DC 5A2IH 1JHLH 1KELH 3HS0B 4JCLA 3GSUB 3DBXB 3TO2A 3OKNB 2XT1B 1BGXH 1ZVSA 1QTYT 4WDIB 5CLWA 1U91A 4PJEB 4MNGE 3ZT5A 4X6CA 3JUYA 3T0WA 2KUTA 3MA9H 3HR5A 3GSWB 3B2VH 4JZNB 1BOGB 3PIQB 4FQ1H 4TRPL 5HGBA 2BCKB 5DC9B 1MLBA 1NGYB 3OB8A 2BY3A 2EDYA 4P3DB 3T65A 4G8EB 4RISH 4MX7A 5D6DA 3RY4A 2EDTA 12E8L 1PQZB 4OLWH 3RAJH 1OB1A 5HYFA 3M17B 3GJFB 3MLPA 4YXKH 2EDHA 2E6JA 2CQVA 4WTXA 1KB9K 1G0DA 5DGRA 4GLRI 4I48A 5SWZD 3H3PH 4XVJH 5HDBF 1A6PA 1S3KL 2LE9A 4HG4J 1IM3B 3LKSA 2W59A 4ELMA 4NN7C 2OQJA 4JFHE 1BBDL 2H26A 5J8OA 3OGCA 2W0LA 4FFVC 4S1SL 5IF0B 4NQDE 5GJTL 2IF7A 1UC6A 3LIZL 4F58H 3BZEB 4NM4H 3V4PH 4OZGA 3AS2A 4NKOA 4DFHA 2VLRA 2NX5D 4XVSL 1JTTA 2X09A 4U33A 4LF3A 5DJXA 4X6EA 3LIZH 2BRRL 4PUBH 3QCTH 2NW3B 5DMYA 4NRZB 3ZKMD 3OKOA 3SOBH 7CGTA 5D1XA 2Y06L 1D6VH 4EQ3A 4AMKH 3AGVA 3UPRA 1SEBA 3MGOA 4G6JH 5FV1L 1IILE 3BPLC 5GGRY 1NBZB 2D0HA 3M1BA 2G9HA 4IDLA 1JVKA 1T3FB 3GO1H 1IGYA 4FMFA 1KPVA 5IBUG 2ZPKL 4W4OC 5CJOH 5B38G 2OZ4H 2V5YA 1Q0YL 4FQCH 3CZJA 3IDJA 5GGSY 2I07B 1XCTB 4F3FB 4XNXH 2A0LD 4M8VA 1YA5A 4I0PD 4NT6A 3N0PB 5GZOC 1AHWB 4GAJL 4P23C 1XMWA 4PRHE 5KJRH 1AGCB 3SE8H 1FGNH 3VGHA 1EO5A 5HI3C 5F3HA 4JG1H 2CO6B 3OKEB 3RI5F 2Z31A 3C8KA 1F3RB 3O6FB 4QRPA 3ZKND 2QKIA 2O61B 3PWPB 4JFFD 4MNHB 4KDTA 4XC3H 1J8HA 4PJ7E 1LK2A 4CU7A 1G7IB 5JTWA 2FYYB 2Y7QB 2EH7H 4HS3B 4OCYH 5HHOD 2C7UB 3RWCB 1QLFB 5E7BA 1EO7A 2A1WH 3VFRA 1Q9OA 5ICZA 4CMMB 2JLLA 1BVKB 1T5XB 2VO5A 4POUB 4MAYA 3MRNB 4LNVA 5DJAA 3FO2B 5FA4A 5D1QA 1YEFL 3HG1D 4W6XB 3S4SA 4HXAH 4JO3L 5EA0H 5KSAB 1K2DB 1BIIB 1AGDB 2X4UB 3QULA 5F7NC 4KXZH 1DCLA 1OSPH 3KR3L 3WFEL 3V6FB 2CD0A 3PNWB 4TVSa 4YGVA 2JCCE 5IQ9B 4M7JL 4NQXB 2R0ZL 3MRBA 3RDTC 5DD3L 2IADB 1KXTB 1CN4A 4FQXD 3CX5K 4PJEA 1KT2A 4ZQKB 4X4XA 5BS0B 1FVCB 2I5YL 4X7SL 1MPAL 4NHCH 3WFDL 5FM4A 2HFEA 5IMKB 4GG6A 5IB5A 3EYFA 5EORL 4BZ2L 4Y4FA 2A74B 4MX7B 2D03L 1NEZG 5FYJU 4XCNB 5L8JB 1AJ7H 3M17A 4TUOA 3VFPB 3KLAA 4FQQA 1K8IA 3HNVH 3T2OA 1AE6L 4HXBL 3Q3GB 3TF7C 4HZAA 4PP2A 1S9KC 1T7WA 4OZIB 1UACL 1BJ1H 3QEGL 1J0HA 5JLZB 4ZODA 1ZVYA 1JGDB 4MMZC 4MQSB 4OLVL 2JJVA 4GH7B 1B0GB 4G6AD 4JFHD 5DJ2A 3BMVA 1HIML 3O4LB 4X8JB 5GGTA 3UTPD 5EG6C 5DT1H 3HE6A 4ZSOE 5B3JE 5E8DL 1U36A 1CICD 1WAAA 4H26B 1OOAA 3PHQA 5GGRA 4M93B 4NOFA 5J9PA 2WINB 2O5ZL 4GUPB 5D1ZB 5EUKA 4ZS6D 4K3EH 3WFZA 5CP3A 5FOBA 2VLRD 2J8HA 3MRDA 4I0PA 3CC5B 3E6FA 3AS0A 4KY1L 1AGEB 1T2JA 3R1GH 4OKVA 4F9PA 1TQBB 5D1XB 1JTOA 5T1MB 1IKNC 3BDYL 4Y7MA 4C57C 3QDHA 4GKZB 4U0RC 2X4SA 4HBQA 5L7XH 1NSNL 2YHGA 5T1DL 1JCKA 3PGDB 5C0RL 2YUZA 1H3XA 2XIDA 1MCCA 5L88H 2CXGA 2YRZA 1XGTB 3EO0B 1HXYA 2J6EH 4PJIF 3BWAA 4O2EA 3SQOL 3TJHC 3WXVL 2MMXA 3PABA 2J5LB 4U3HA 1K8DB 5HSFA 3B6SA 5K9KB 3ARUA 3QIBC 4JKWA 2YA0A 3QXWA 3SGKC 1KLGA 5GGQH 1NH6A 5F21B 5IESH 4Z7VE 4L3CB 1X4XA 1E6OL 3TCXA 4P4KA 1N5AA 3MUY1 5JXEA 3O6FA 5B22A 3QXUA 3UTSD 4J8RB 4X4YA 1J8HB 3OJVC 2F53D 4F33A 2YSSA 5E7FA 1I7UA 3UTTD 4JKKA 3TT3L 1HEZB 3I2CH 2GSGA 4PJGA 1ZKAA 1U8MA 4LCCB 1LNUA 2DQIH 3FZUC 5J6HB 5C0EB 1N59B 2VLLB 2XWTB 1WWBX 3DVGB 3RRQA 4CDGC 3HAEG 2DQFA 2A6IB 4K3DH 2EXYC 4Z7UF 2HKFL 3TV3L 1ZLWH 1DBAL 3MRMB 1J1PL 1V7ML 4NN5C 4FFYL 2X10A 3KHQA 4KMTH 2X4UA 1X5IA 1OW0A 5I1AA 4E41B 1RIUH 5EU5B 4WI6A 4YXLH 4ZS6C 3MV7B 1JTPA 1MCWW 3WKMH 3CSYA 3DMMD 3D3VA 2B4CH 2QJDA 4WW2A 1PZ5B 3B5GA 3HZMA 4L9DA 1I1RA 1G6VK 4ZQKA 3BEVA 1EHLL 3QIUD 1EV2E 3ZTNL 3KYOA 4BH7A 5FGBA 1LP9B 3FT2B 4K3DL 2YBRA 4FG6D 5AUMA 3DX8B 3HUJE 4HKJB 2B1HH 1QSZA 3CFDB 5AWNH 3E6HB 3DHMA 4M5ZL 1JYVA 4IJ3B 3QIUC 4L8BA 3B9AA 5JW3H 1NCBH 1X6NA 1W8OA 4FQXA 4KKCC 2F8XC 5FYJD 2H2SC 3LRSB 3TBVA 4LEOA 4EKXA 4WI5A 2AK4A 4RZCA 5J11B 2CO7B 3NFNB 3VH8G 4PP2B 3L9RA 2APBA 3O6KL 4S2SA 4WVRA 1QQDA 4OCXH 5M95B 2BOBB 2YUWA 1Z6JT 4NBYB 3BUYB 4ERSH 4DVRH 3CFJA 3MRCA 1K85A 1X5FA 4HIIB 2Y72A 3C6LB 4JPIB 4R4BA 1T21B 4RGNE 2G60H 2VDLL 4LLWA 5F70A 4NO2B 4WUKH 1QYGH 3PXJA 4PGBB 3A6OA 4YR6B 5AZ2H 2YPVH 4JFEE 4H5SA 3U4BH 4PG2C 4ODUA 4JM2A 3GI8H 5IMOA 2XZAL 4MCZB 2R9HD 2XG4A 3RPIA 4LNRA 5DRNB 1XAUA 2CIKA 1CLZH 2VR4A 3C5ZC 4XCYB 4OD3L 2FEEL 1Z5LA 4EI5D 3SDDD 5TPWH 4WV1A 1JWMA 1MFNA 5EU3A 1BJ1J 4J1UA 1RJCA 2AVGA 1PYWB 1FGVH 1RJYB 5ACLA 1MJJB 3C09B 5E8OB 2VQ1B 2FD6L 4OI9A 4QYOB 5IBTL 1KBGL 3L1OL 4KHXH 4KV5E 2ZOKA 5D9SA 1NANI 1DUYA 2DD8H 1DVFD 1EAPB 4LFHG 3VXUA 4MJ6B 4L29B 2ADIA 4LCYB 2P8PB 5FKAB 3EO0A 5DUML 3S3JA 3HI5H 1CZ8H 1U9KA 1HKLH 4O2EB 1RJZA 3T77A 4JVUA 5JHLH 2C26A 5D4QA 3TM6A 4PBWD 3QNYB 1A3RH 1CD9B 3O6KH 1X44A 1O7VA 3PWJA 2VZTA 5EU6B 2UVEA 2E9BA 4K23H 3WFBH 3QDGB 4P57A 4QCIA 3ZTNH 5AD0A 4WWID 4M4RA 1QPXA 1N5AB 3O6ML 4XP9L 3LQMA 4JPKH 4RGNC 4MCYA 3JZ7A 1B0WA 1XGPA 2J7LA 5AWNL 5ILTL 3BH9A 1Y6MR 3U0PA 4LPYA 3UTSE 2M8XA 3ARFA 4I3GA 5E99L 3FB5A 4E9LA 1I7UB 2BMKB 5E6ID 3PWNB 4F15B 4LCCA 2ARJA 3ZYZA 3G6JA 2IG2H 3GGWB 4MD4B 1AXTL 1OT1A 2VJXA 4LSRH 4Y2DC 4DZBA 4G6JL 1I8LA 2ATPA 4U3CA 2GTZB 2D0GA 1S9XB 3QCTL 4GXUN 5EC2B 4KUZL 3S36L 2YD4A 2KL6A 5DZOA 3KPNB 1V7NH 1XZ0B 4QTIH 2EDRA 2P5WD 5BMFL 3NA9L 2DLGA 3MRHB 3I02B 1PSKL 3UZQA 3P9MB 3TNMB 1CDUA 5TJWK 5EU5A 5I74C 1JI2A 4ETQA 3WUWG 3L3OA 5GGTH 4PTUB 3N1QC 5CCKH 4LGSB 5AZ2L 1XGQB 3V0VA 1SEQH 2J4WH 1H3PL 4F7TA 5IB1B 5IW6A 4PJDB 5T5NF 1UB6B 1JWUA 3R4DA 1F4WH 1P6AB 3S96B 3OKLB 5E03A 1UB5B 1EBAA 3BWUC 1PBYA 1REIA 3DMMC 4U6XA 2EDWA 3ULSA 4HUKB 5MEOA 2QSCL 1W72H 1Z3GH 1KXVC 4XNZC 1RV6X 4PJ9A 4O00A 4GG6F 2VDKL 5IIEA 3LN5B 1MQKL 1P4IL 3VRJB 5I30H 4AG4L 4OLWL 3GSOB 4UDUA 5DWUL 1ED3B 1HI6B 1U95B 4AEHL 4JY4B 4O2CB 1MRFL 4FQPA 4HC1H 3O41A 4O2FB 4QRUA 3MMEA 3NIDF 1UEMA 2DM2A 5LGKA 4KRPB 4HJGA 3MROA 1FO0L 5IVNA 1EUTA 3X13A 4JDZA 1G6RB 2ARJQ 4H0IA 4L4TB 5H8DA 2HFGL 3L3DB 3OJDB 3SDXB 3C5SB 4TTDD 1QEWA 3LKNA 2P24B 1RUMH 3L3GA 3LD8C 1CXIA 3BW9A 2OZ4L 5D2LA 2NR6D 5DUPH 3GIZL 1FFNB 3CUPA 4PJ7F 4NO0A 5FHBL 4WEBH 3CCHB 5D96B 2C9AA 1KB5B 1X5YA 1YQ2A 4HKXA 4FOMA 5TE6L 2GJZB 3MOBH 2VQ1A 1UGNA 1EMTH 4Y5XB 3CU1A 1NBVL 2XTLA 2X1PA 4NKMB 5IBLD 5JW5A 1XEDA 4OQ1A 1KV3A 5SWSE 4LSPL 1I85C 5A3IC 3T0EE 1UJ3A 3VFNA 1RZFH 2BNQA 4IBLT 2F53B 4OB5H 1JHTA 4MA8L 5GZNC 2XG5A 5FM5M 1Q1JL 4WUUA 2B2XH 1A7BA 4U3XA 1A7OL 1CGSL 1U0QA 1WV7T 4P23A 2AV1A 3WSQL 4LRNH 1V3LA 4HXBH 4S1RH 4IRZH 4KC3B 3F12A 4UI2A 3NMEA 5ECJE 3SDDA 2P8LB 3MUZ1 2DQJL 3GSQB 5IR1A 3QFJA 3Q2CA 4BFBD 4EUPA 4M1GL 1AJ7L 5FDYA 4U49A 4GKNA 2R0LL 4KRPD 4XP6H 5BJTB 1KYOJ 1IL1B 1DBJH 1NGYA 1IC7L 3QAZC 4ZUWB 3C60C 3EYUH 5IHUH 3VMNA 1KTLB 5MHSE 1ORSB 1MCSA 4XC1H 1OSPL 2BMKA 1L7IL 4KK8C 4QF1A 3D9AH 2FCBA 1WZKA 1Y6NR 1MSPA 1RULH 4CW1B 2X7LB 2XZCH 1SMOA 3VWKC 1YMME 2C5DC 4CNIB 3EYVA 4YH6A 1IEHA 2L4OA 3D9AL 3FN3A 3P4MB 1NLDL 5A16A 1CQKA 2DM3A 2Z93B 1IM3A 3DUSB 3VFUB 2A1WL 4FFVD 4ONHB 3EDKA 2H26B 2EC8A 5BXFB 1M71A 3F5WB 2LAGB 1PJ9A 5FKPA 5INCB 3P9MA 3WNKA 2CR3A 4K3EL 4PY8J 5JIPA 1PW3A 4ZFZB 2R2HA 1Q94B 4NJ9H 4HHAB 5IWLA 1P7QB 1BBJA 2LU7A 2X89D 2GCYA 3GJEA 5DJDA 3LEYL 5HHPA 1J1OH 2X5PA 35C8H 3ZKXC 1NQBA 1JF1B 4NZUL 3S96A 4H8WH 2R9HC 4RCAA 4Y5VC 4ALAH 4ZPVA 4JCMA 5I16B 4ZSOA 4IHOB 1HDMA 35C8L 2ED7A 4GO6B 1PKQB 3IU3B 2WMPA 1QFWH 2DQHH 3QI9D 4JFPB 4JG1L 1NBZA 3HC4H 4X7FC 1IGYB 1A5FL 4H8WC 2E7CA 5E6IB 1M1SA 4WY7H 1CGUA 1ZHKB 3KPMA 3HNVL 4PJXF 1HI6A 5T3ZD 2J8UF 4FTVB 4GRMB 2MFNA 1UZ8B 2R69L 5EU7E 2EXWC 4JPVH 2QQLL 4NJAL 1AQKL 1JGUL 4HV8B 4AL8H 1BIHA 1EO8H 3ARVA 2C4XA 3NH7L 3C5SA 5HDQL 3OKEA 2ZUWA 3BRGC 4FXLA 3L3GB 3QT2A 1NFIA 2O61A 4GMTL 1NGPL 3WE6A 1IGJB 1DANU 4MQXC 4TVPL 5C09B 4GS7C 3LKOB 1GZQA 1C5BH 3HTLX 1T2XA 4Y1AA 1M05A 1KCVH 2NQCA 3N50A 4UNTA 1P7KA 2EDOA 4DQOL 5EU6D 1BPVA 4LGRB 4OCNC 2Q76A 1S7WB 2LVCA 2DDQH 2W60A 4ODXA 1EO8L 2AEQH 3QQ3B 4HIEA 3TFKD 3RUGB 2C3XA 3ABZA 5C07A 4LCWE 1INEL 4M3KB 3NZ8A 3DX7A 2OL3A 5MEPA 1FL6A 3GNMH 1LO4H 3VXPB 4NO5B 1DVFB 3TO4A 3N85L 2EH8H 1CGTA 3KPQA 5GGVH 4X5WB 5C2BH 1HINH 5C92A 3PWPD 2YXFA 2VE6B 1ZGLM 3NA4A 2YZ1A 1F4XL 4U1MB 4G8GA 3FFDB 3NTCL 2CH8A 3VDAA 3MZTA 2AK4E 2QQNL 4NO3B 1WBXA 3BP7A 1FYTA 3CLEH 3NACL 1T1ZB 4Z7VB 5F6HJ 4XAKE 2JELL 1MH5A 3UZVB 1N4XL 2VXVL 3VXMD 4Z7UA 2HN7A 1H8OA 5DS8B 5CBAA 1JGLH 5BZDA 4MAYC 3PGFL 5L2JA 1AQDB 4UDTB 4HULB 5E4IA 3M07A 4TUOB 3VFPA 2NYYC 5GSVA 5KG9B 4R3SA 2N4IA 4Y2DA 1BVLA 4I9WD 2NXZB 4KI5F 3MV9E 4CU6A 5ITFA 1JNNL 1FRGL 1X4YA 4HJ0C 2DYPD 1R5IB 4OFDA 5F7LB 4PRDA 2B1AL 2PO6A 3P4MA 2NYYD 2Z93A 2ENYA 5FGCE 2FHFA 1JGDA 2WWKT 5KVFH 5DJZB 4X6DB 3L3JB 3QDMA 5I1DB 4M6NL 5ID0B 3D2UA 2X4PA 3U9PL 3O4LA 3QUZD 5D7JA 2IGFL 1N0LA 1C5CH 3CH1A 3OF6A 4U2YA 1S7SA 3TA3B 1IGTB 5FK9B 1HH6A 3SE9L 3KS0H 4OFVA 3D25A 4YAQB 3MCG1 1AXIB 4GKSA 3QXVA 3L7EB 3WFBL 3QCUH 5CJ8A 1BBJB 3HZKB 3IJHA 2GCYB 3GJEB 1YEIH 3BGAA 1I1YB 4MXQC 2VB5A 2VXTH 2JK5A 3QG7L 5HDLA 1CXEA 5DVKA 3LN9A 4P46B 3CK0L 5TQ0L 2NY0C 4XPGH 1BQLH 2ICEA 5DFTA 3MO1A 4G9DB 4BZYA 2ZG3A 3EOBA 4M93C 3LCYA 3FT3A 1PKQA 2A6DA 2VUOA 2G75B 3L95A 4ODVL 1UCBH 5SWZB 4K94C 1G7JB 1NDMA 1SJEB 4MD0A 2AKRB 2VDNH 4PJ8C 4JQVC 1HXYB 2AXGA 2J3SA 1ZT1A 3V8CA 5A2FA 3DHJA 4R90L 2XNAA 5BMFH 5HI5C 1BD2D 3ARGB 1ITCA 5ADOH 1KSRA 3G6JE 5DJYA 1X5HA 1HQRB 5CILL 4BSVB 3EJJX 4FXGB 4O4YH 5GGUA 4P4KB 1S5IH 4WUKL 2BDNH 5ID1B 1XIWB 4ZO6A 1R5VB 3WO4C 5IW1A 2N56A 3FT4B 3PUCA 2MHAB 3ROOA 3P9LA 4G9FB 1RZKH 1TNMA 1DE4A 4S1QL 1PVHA 3HNSL 3OTTA 3TYGH 1NGZA 5CEXB 1ZA6B 1J18A 4O5LL 1ZS8A 3E8UH 2PCPA 1W72A 3QDMD 5K9JH 4CVXB 1E4KC 5HD8D 2Q6WA 4ZAKC 3MLWL 5DEGA 5FHAL 1NC4B 2W60B 3FQXB 2VXSL 3EOYG 4GS7B 2ARWA 4MXVF 4KK8D 2LQRA 4QRRD 4G7VL 5I8EB 1U91B 4ORGB 1R3HA 4OAWB 4OIBA 3AXLB 2YN3A 2J8UA 3HI1B 1UXWB 1JK8B 1QSFE 4YFEA 1CDCA 1QFPA 4LLMA 2Q8AH 2VZVA 5HYIA 4X8XA 1OB1B 2FJHA 1D3CA 2HP4A 4OQTA 3QWRD 1FN4B 1EGJL 4JAMA 3BP7B 3V7AG 5HXMA 2R29H 3FT2A 1F97A 2Z4QA 2D7MA 3H9HA 4OZHB 4LL9A 3LDBB 5KTEH 3SGEH 1FH5H 5LGJB 1AQDA 4KHXL 4PJIE 1H3PH 2DQGL 4NNXB 3BXNA 3O0RL 3QXDB 4LPCA 1TJIL 3VXMA 2BNUA 5CP7A 4H1LB 3QEUA 2ERJC 1MCDA 3NFNA 2MWCA 4NCC1 5I18H 3N1GC 4ZNEA 4H88L 2PO6B 2MNUA 4Y4HB 1MWAA 2AXFB 1JPFB 2NY1D 1HZHH 3AMLA 5T33L 1I9RH 3FFCB 2L7JA 3CH1B 4KUZH 3T3MF 4Z7WB 3MFFA 4KXZI 1QO3B 2AJYH 5GSRB 5SV3A 2AJUH 5T1KB 2XRAL 1X5LA 5GRVL 1I7TB 2YD3A 3ZYOA 3V6OE 2VMFA 1R3LB 5KS9A 3QIWA 1IZKA 1U8JA 1DSFL 2GQHA 3ZHKA 3AROA 5FUOL 2Q8AL 2O5YH 4YC2B 1TJHL 1FNFA 1LDPL 3WL9B 2J6EA 3MO1B 4G9DA 1S7XA 2VDML 5ALBH 5EWIL 3X3GL 2A6DB 2B0SH 4PGZA 5DK0B 2I07A 5GHWH 2IPKB 4Y2OA 4JRXE 2Y1VA 4AYFA 4ZUSA 5D5MA 2WQ8A 5AZEL 3UDWA 5KSAD 4LCYA 4YHZH 4E41D 1QBLL 3BVNA 1ZLVH 3D87B 1F8TL 2KZWA 2ZPKH 3U46A 2Z31B 4APQA 5GS0D 4Q7DA 4OV5A 3QNYA 3G04B 3FQUA 4GAYB 2IH3B 4PJ5A 4UT6H 4RMSA 1DQLH 3QEQD 1U41A 4ZTPH 4HWEL 1GGIH 4BSVA 4FXKA 4XZUB 1ND0B 3HE7C 1HZHL 5T33H 1OF2B 1UZ6F 4L4TE 3GI9L 3WNNA 4XMPH 3VFRB 4HWZA 3VXQA 1WBYB 1FLRH 4QT5B 2DYPA 3FOLA 3SDYL 3V6BR 2NLJA 1FDLL 5C86A 3MYJB 5DR5H 1JV5B 4HMEA 3SKOA 2VL4A 3PWNA 4PJXB 3HNTH 3RHWF 1AGDA 3H2WA 4CVXA 3O3UN 1NC4A 5IHBA 1NC2D 2EICA 4NRXB 1ZSDB 1CE1L 4ZFFB 4LKCB 3SPVB 1A3QA 2VKXA 2ZCHL 1CYGA 5I8EA 1XZ0A 4HPYH 1IM9B 1ZEAL 2Q8BL 3OJ2C 4X4XB 1ODAA 4FFYH 5C0IB 5BVPH 3BKCL 5BZWB 1JK8A 3L3OB 4HS8L 3TBWB 5T3XD 3W81A 1MFBH 1KLUB 1JNLH 3W9EA 4XNUH 1C5BL 4TVPE 1MQ8A 3WFEH 3OMZA 1IEAA 4XCNA 4YDIL 1CGWA 4AT6B 1NMCC 4B7IA 3F6IA 2B5IC 3MFGB 5ESAB 3SO3C 2Z8WC 1BZ7A 1QBAA 2IH1B 2LTQB 3NFPA 1P4LA 5GS3A 1KJVA 4RMVA 1T7XA 5H94A 1A7PL 5EU4A 4NBZB 5E2TL 1OCWL 3EW3B 4K7FA 3ARBB 2EIEA 4NNXA 4FFWC 1E4JA 1MHHA 2AEWA 1B4RA 1YJDL 3VRJA 1FZJA 5KVMC 4KU1A 3DMMB 1I9IL 3GBLA 2H6PB 4YBQC 4HPOL 4JJ5A 5GGQL 1A6AA 3IB4A 4Q2ZA 4HK3N 4JFDE 1AIFA 1VPOL 4UB0L 3L3IB 1KJ2A 5EO9A 4JQIH 4GUPA 3MUHL 1V7MH 4JZOA 4HQQH 2WBJA 4GMTH 3MRDB 1G6RA 2Y36L 4MSWA 3WS6A 1MLCB 1P2CB 3U7WH 1NEUA 1U8HA 3HE6C 3OJDA 3MJGX 3JTSB 1JBJA 1JNHA 1WLHA 3TIDB 5C0AB 4PGEA 1T66D 4CKVX 2FDBP 4XMKL 5FM5O 1R3LA 1JGEA 3GHEL 1TDQA 3DETD 4AQ1B 5C08D 5E2WH 4RA0C 5FECB 1AFVL 1D5XB 1MRDL 3HZVB 5I76A 3O2WH 5JDJA 4XP1H 1DBML 3VFSB 5HJ3A 4XCEA 2DMCA 1U3HB 5D5MB 3QIWD 1MFCL 3WBDA 1QFWL 3B9VA 1T1WB 1TZGH 4Y4FD 1PX3A 2VXVH 4U1IA 2CKNA 4WO4C 4X7EC 3KWWB 4D3CH 1EERB 1U8IA 1A0QH 2VNCA 5E2VH 2IALB 5EFIA 2CLZB 4QRRE 4TNVK 2QQNH 3G08A 3VW3L 4XBPB 3IDYB 4J8RA 4X4YB 2PYEE 4FZEH 1M7DB 1RUPH 4N0UE 5EDXA 4UNVA 1EIBA 5EZJA 1OPGL 2QL1A 3D85D 5CBEA 1CIDA 4BFIA 3GSQA 4FXKB 5IR1B 3VFOB 4Z7NE 1NGWB 4UT7L 3OXSA 1OF2A 2E7BA 1UCTA 2IPTH 3FQRA 4NCC2 5JA9A 5LJYH 3HZYA 2FO1A 1XFPA 2XWTA 2YD9A 4LU5H 4JN2B 1TCRA 4JM4H 3MYJA 4RSVA 1T6VN 1G7HA 4EDXA 3AS1A 4GJTB 3S35L 2UUDH 5GS1A 4M7LH 1PDKA 1ZT7B 4TVPH 4G8GE 3RL1B 3MBXH 3S4SG 1RPQA 1S7RA 2NY5C 4XCCL 2BHUA 4XNMB 2F58L 3EYVB 4AEIL 5D7SH 1P84J 3CSYB 2V7HA 4H8WL 2VDRL 4ONHA 4UAOC 1NPUA 1DQDL 1T1XA 1X5KA 3TN0B 4L4VA 1IVLA 3HZMB 5DHVB 4XI5C 1JGUH 3HHRB 3UTQB 3ZDZE 4MHHG 5EBWA 3KYOB 1MFCH 1J5OH 4RFOH 4OT1H 1PY9A 1IGIL 2XKSA 4KKAD 2N7BA 2NY5H 1Q9WB 4KWUA 4K8RH 3VRLF 3CFDA 4X7DC 2Z0BA 4PREA 1I1AC 2BNQD 2A6JA 4AT6A 1W0YT 2A0LC 3ARED 1CXHA 3F7VA 1GGCH 4YX2L 4PLKC 5MENB 4OM0L 2R0WL 4PJGE 1I1AB 1J0JA 1IT9H 4LP4A 5C0GA 4S2SB 3D6GA 2XN9E 2X9WA 4J6RH 4A6YH 4M5YH 1J12A 4WENB 3RDTA 4JY5L 3ZE1F 3A6BL 1GCFA 1VADB 5BOZG 3C5ZD 1VDGA 5HGHA 1MCLA 3FAXA 4R0LB 1A4JB 2GITB 3SN6N 3UAJC 4NQDD 1GC1H 3QNZB 3OQ3B 2NXYC 4F57H 1S7TA 2H9GB 3RWDB 5CGYD 1D5MB 5J3HD 2VOTA 4JM2B 5IMOB 1MCJA 1U8QB 3Q6GL 4DUWA 5IEHB 4WO4A 5FGCB 1VKXA 3NIFE 3L7FA 3RPIB 3RZWA 2I27N 3MRQA 1UADC 2DQDH 1MLCA 5T3ZH 4UT7H 1I75A 4J3SA 4BM7A 2NW2A 1LP9F 4JFXB 3Q6GH 3LEXA 2PETA 4WFGE 3B9DA 3C5JB 5FYLL 4LU5L 2X1XR 4XHJD 3BKMH 4BQBA 4NWTL 4O02L 3U4BL 1HHKA 5D2LE 1M05B 2DQCH 2BY2A 5I71B 5JQ6H 3E2HB 3G9AB 4KQ3H 5IJVA 1UXSA 4NRYA 3U7AA 2NY6C 3DV6B 2E7HA 3D85B 4EI5A 1RJZB 3T77B 5BO1L 3WNPA 5JO5A 3FRUA 4ODXB 4KGJA 5B39B 2NY3C 1EMTL 4YPGA 2R29L 3QA3A 2XQYG 4A6YL 1MHPH 2DL9A 4TULL 1W8NA 2AQ1A 4WDIA 5FYKE 3JSSA 4HT1L 4Y2DD 3MLTB 4YQXL 1U8IB 4FZ8H 2I9TA 5TDOA 4OJFH 2AGJL 3QPXH 3KYMB 2W9EH 3BH9B 1MLBB 4HKZA 3BP4A 5F1IA 1YQVL 1HK6A 2YRPA 3VFTB 3BIKA 1YY9D 3BT2H 2AGJH 5F88A 3KXFB 3QUXA 3WLBA 3IFPB 1AD0A 2OTWA 2ATPB 1MFAH 2HJFA 2Z9TA 1RMFL 3QIBA 5HGDA 1SBBA 3MV8A 3CX5J 4ODTH 4AG4H 3C08H 5CZKA 3MRIB 4LDEB 4YHNA 3TPUB 5GS1B 4X80H 3V4UH 4G9FE 3UTZB 2CKBA 1PAMA 8FABA 1JMXA 1NCTA 4PBVC 5KBNC 1QBML 3NABL 1P69B 4TSBH 1CG9B 1ZTXH 1RQ5A 3GMLA 1X5ZA 3ZT6A 5C71A 3RX7A 4Z78B 1ZT4B 1NANH 3BZFA 4NFDA 4PP1D 3RIAK 4ODHH 2L7UA 2EDJA 3LKQB 3ULUF 4JHAH 3IAPA 1HILA 1LEGB 4WJ5B 5BRZD 3OKLA 3IKCB 3BESR 5H37H 3MX0A 5I6XC 4NUGL 4BK4A 4YAQA 2FHCA 2OTPA 1INQB 2RCSH 5IVXB 3ARDA 5L2KA 1EHXA 4GKSB 3T2NH 2A6JB 3O6FD 4XNUL 1V3KA 5CCKL 3KPRD 3OKDA 1E4WL 5GGTL 3OR7A 2Q7YB 3F7VB 2P5EA 1JRHL 3DRQA 5ACZB 4JVWA 2GJ6A 4PRPE 5CKAA 1T3FA 3SE3A 2QSQA 1KPVB 2EDEA 2ZJSL 3MA9L 1EA9C 4QHUA 3C8DA 4TRPH 4DTGL 4DKEH 3BHBA 5DF0A 4KJYA 1ES0A 5E6YA 2R23A 3FO1B 2P43B 4IOFC 1LE5B 2KQMA 3HE7A 4EN3D 4NQVA 3X13B 2HKHH 3MLYL 4KDTC 4N1EA 3WUZA 4L4TA 5GQBA 4PJ7A 1QOKA 3O8XD 3QNZA 3REWA 3LKNB 3RWDA 4WWKB 4PGDA 1NJ9B 5B39G 1KUMA 1ZHBB 4Z7NF 2D7OA 4I2XE 4LVOC 3PQYE 1U8QA 5IEHA 3BQUD 2BRQA 4DZ8A 3W5NA 2YZ8A 3WNLA 4OI8A 2XQBH 3LOWA 4JRXA 5DJ8A 5TQ2L 1PEZA 1FNEB 4LSPH 5DJ0A 1QLFA 5ID1A 2ATKA 4RX4D 4YXHH 4D0CB 3ARFD 4ZUVB 1EBPA 3MLZL 5HY9A 4N8PA 5HYQB 3DIFA 2AK4D 4GMSL 5MERA 4NQEB 5KVEH 2FLRT 3FO2A 1NBYA 4XWOD 5TH2A 4KROB 1QNZL 1HHIA 4JO2L 1DVFC 5KSAA 4P2RD 1A1MA 2VAAB 3VG0H 4GG8A 1JYNA 3O9WB 5CEZH 5DUPL 5KOVC 5I1KH 3BFOA 1FAIH 1A21A 3Q48A 4LP5A 1IGFH 3GSRB 5SX4H 4NZRL 1I8KB 3ALWA 4JANA 4Q74A 2P8LA 4JFQA 3IJSB 2MKLC 3QFJB 4P2OD 4PJ9D 5IM7A 4V2CB 4RAUB 2V2XB 4X0KB 1C08A 4RMWA 4GKNB 3ME0A 5DQJB 3TEUA 4U1KA 3EYFB 3JWDC 3WN5C 4NN6C 4XP4L 1P5UA 2CUHA 1ACYL 5I1IL 2A74A 4UQ3A 4QO1A 4YC2C 3KYNB 5GS0H 2GT9A 3VFGH 4JB9L 5HI5D 5HBBA 4EVNA 5MEND 2HTLC 4YDKL 1YC8A 3S34L 4K71C 2GJ6E 1A22B 1MCOL 3EGSB 2Q8BH 3VWJC 3KXFA 4YWGL 5BVPL 2Y5TB 2Y07H 2YEZB 5I0ZA 3TFKC 1BLNA 1Z9MA 1NFKA 5HYJE 3IT8D 1QFHA 5D5ME 3MUJA 1KCSL 4GRLA 4JR9L 3K4DA 5BXFA 1B0GA 4M7ZB 2ZSWA 4LIQE 5FKPB 3HC0B 2W1NA 1NGPH 4MJID 1ETZB 2WZPD 4L3EB 2YPKB 2HH0H 4H26A 3RWEB 4AENB 3CXHK 5GGRB 1ZV5A 4UAOB 1OAZL 5CLTA 3QCVH 3S3SA 3RHWK 4AK1A 5GSRA 5GGVY 4C55A 1F5WA 1ZANL 4P2QA 4OLUL 4LSVH 1C7SA 3D69B 5I16A 2VXQL 1HOCB 4GKZA 1CXFA 3JWOL 3OR7B 4MWFA 5T5FL 1LD9A 3GSNA 4JQIL 3CJJA 3RTQB 3RU8H 1NAKL 4CADA 4AY0A 3O3DB 5DDHA 1FNAA 1S8DA 1I8IA 2D7NA 5I1KL 4GBXD 3SE8L 2APXA 3BHBB 5EZLA 4PJHE 5I1GL 1SVCP 5F7EL 4OLXH 3PABB 2R23B 4KTEL 1CDBA 1UZ8A 1KLGB 2AXHA 3VCLB 3QH3A 4ISVB 4YHLL 4OLXL 3S7GA 1H5BA 2X89A 4YHYC 1WAAE 5IROA 5JW4R 4ZOBA 2RGSA 3WHXA 5J89A 3B9KB 4S10A 1T83C 2QSTA 5HYEA 1GHFH 5CGTA 3PDOA 2YR3A 5D7LE 5C09A 3QO1B 2P8MB 2NXYB 4G7YL 4OZ4B 4Y1AB 1YNKH 1YY8A 3G5YB 1XR8B 1EZVY 1MIEL 2GSGB 5GZND 3CFCL 4S1DD 3KDMB 3PGFH 5IESL 4LHUG 5BV7H 1MHEB 5J6HA 3UYOD 1C7TA 2DBLL 4E5XA 3LPGA 1OQOA 4WEMB 5E70A 3DIFB 3WFDH 1K4CB 3KPPB 3HPJA 5JHDE 1IZJA 1G7QB 3DETC 3HC3L 5SX5K 5CD5C 3NZ8B 5LBSL 4KJQD 3V2AR 2FH8A 1A1NB 1TZHB 1KCVL 2OSLA 4LBEB 2QADD 3BDYH 5JR1H 3SQOH 3V7AE 2ADGB 2X4RA 3QEHB 5CD5D 3GSRA 4LMQE 5EU6E 3SJVD 4U1MA 5FYKL 4PJFA 3JV6B 2VDNL 3R1GL 4P0DA 3W2DH 4F9LA 3AU1A 3RWJB 3VDBA 5LKNA 4X0KA 4M48H 5IHZB 3BZ4B 3ILPB 2EDBA 2DMBA 1I8MA 1FNGA 5LAXA 2VXTL 4FS0A 5A43C 3V79C 3GKWL 4HKJA 5CSGA 1GGBH 4NM8L 2HN7B 3E6HA 5E8DH 2VLRE 5INDA 3OAZK 4UDTA 2KKQA 4U1JA 4XAKD 1TETH 5H35A 3NFPB 2UUDK 4CVZA 2XTJE 3TBTA 2X40A 5KS9F 4GRWH 4Q9RH 4HGMA 2BK8A 3ARWA 4KY1H 3G6DH 4HUNB 3VFMB 5I73C 2JJUA 1RU9L 1I8LC 4DCQA 2ESVB 2VXUL 4R4BB 1OWWA 2J2ZA 4HCRL 4XPFL 3MJ9H 5C09D 3V4VL 3VXUD 5FHAH 1GGCL 4X9HA 2DTMH 3HE6D 1IGTA 4ZO8A 1MVFA 5DJCA 4TTGA 1E27B 4M9OA 4YK4C 1RK1A 3QPQD 3ZE0F 3WNOA 4XX1G 2IAMA 4E42B 4H5SB 3HUJF 4KKAC 1YMHA 4RX4A 3LEVH 1I1YA 1VCAA 2B1AH 3IFNL 3MNWB 2NX5A 2JK5B 2WBJB 3DECA 3ECBA 4JRXD 5I17B 1LILA 3CLEL 3NACH 1U8NA 1NFDE 2JIXA 3N1PC 3OX8A 4P2QB 4ZTOL 4ZXBA 1HH9A 1IAKA 4PRNB 1N4XH 1PYWA 3B5TA 4ELKB 4RFOL 1JNHB 2CJUL 1ZHNA 4DKAA 3K46A 3GB7B 1JGLL 4CL7A 2G75A 3VXSB 2Z91A 4ODWB 1E28B 4ZUTA 3V6ZB 3UTPE 1UH2A 4CADB 3H9SA 2IMMA 3BO8B 1CE6B 1KEGH 1S7VB 5DZNA 1I9EA 1D5XA 4XAWH 2VQUA 5FEBA 4LPXA 4G42B 3FQWA 1CD1A 4X6CF 5MI0C 4JREC 5ANME 1RUQH 4CN6A 4D0BB 5FO7B 1YPZA 3BX7C 1UZ6E 3MRRB 5CJBA 5J13C 2DS4A 1OAYL 4L4VE 4P2RE 3O0RH 1BJ8A 3WUWB 5FYLH 3BQUA 5EU6A 1N64L 4OJFL 1T0MB 1C1EH 1KGCD 3PL6B 3VGEA 3MRPA 4I5BA 1F4HA 4GLRH 1I3GL 3MGTA 4PV8A 1INEH 2QSVA 3KPRA 4F37F 1A6ZB 1O0VA 4RWYL 2F15A 4EZMA 3H7LA 1MUJB 3L3KA 3RWIB 1SYSB 3MZGB 4G9FA 1IQWH 2EDFA 1DE4B 3VXNB 5KN5A 1IAOB 1Y18B 4HC1A 3NPSC 4TPRH 3B8SA 4WFGD 3SHSA 1XR8A 2NNAA 4M7KH 1UA6L 4UUJA 4DGIH 4DTGH 5HHOA 1U92A 1UM5H 4R4ND 3FQRB 2Q6WB 3T3PF 3G6AB 5KVFL 4NC2B 1DQTA 2N7AA 2AV7A 1S9XA 3FQXA 1KFAH 3RA7L 4YBHA 4KTDH 3HAEH 4EDXB 4XH2A 5E08H 3REVB 1WT5A 1N6QH 2CIIB 5ALCH 5E99H 1KTDB 3MRHA 4KZEL 4AZ8A 3UX9B 1JPSL 5B21A 2OSLB 4LBEA 2DJUA 5L2KE 3QDJE 2EZ0C 3E0GA 3KPLA 5J1AA 2G2RB 3SOBL 2X70A 3QIUA 1XGQA 2V7HB 4IOIB 4U6YB 2JB6A 3QUXD 5I75B 4L4VB 4PRPA 5E00A 2PYED 5EO1B 1ZLUH 1F6AA 3RWJA 2PN5A 4TUKL 5TDNA 4UZGA 4R7NA 3ULUE 2X05A 3SKJL 4KTDL 5LAXB 1H3TA 4KJWD 1I7ZB 1BAFH 3I50H 5MEOB 1JWSA 3ULVF 1YN7A 1Q0YH 1CR9L 2XQBL 1J1XL 4P5TD 4JRWA 1NEZB 3PV6A 4L9LC 5I1CH 2F19L 4DK6A 1XF3B 3TH3T 4UDUB 1QR4A 1SJXA 4KQ4L 4XVJL 5L6YL 1U95A 4Y4HA 1LO3H 1T5WA 2R56L 3O41B 5IW3A 1J05A 1CFTB 1WFNA 2EYRB 1J87A 1WAAF 3WIHL 3S36X 3ARBD 1G9NC 5J11C 2B2XL 4MA3A 5DMJB 4QXUH 3NCJL 4Z7WA 4DEPC 4WRLA 1OD7A 5B4MC 4N0FA 4KKLC 5DJCB 3O3AA 4M8QA 5T1KA 2P24A 1EHNA 4KGLA 3CFEA 4WW2C 5F93C 2AAVA 3QFDA 5F96L 2XPGB 2NX5B 2DLFH 2GAZB 3MRQB 1DEEA 3VE0A 3BKCH 5HHVL 2QLVB 5SWSD 4YGAB 4NO0B 3CCHA 5TGBA 3OGOE 4ZXBB 1BGXL 2NW2B 3UCRA 2H1PH 1ZHNB 2QSCH 1MFAL 4RFNC 3BAEH 2YD2A 3GB7A 1QSVA 4YNYA 2H8PA 2HJKB 5JW5B 4LLQA 4WUUE 2VC2L 2YS4A 5D7JC 3I9GH 3WEXB 1CE1H 4WI9A 4KZEH 4WHDA 2M1KA 1FFPB 1XF5A 3MRKB 3TJHD 1SEQL 2J4WL 4RMUA 1MF2L 4OV5B 2DQHL 3RVVC 4HAFA 1FCCA 1JHKL 1KB5H 5I8KH 3DX6B 3LMJH 1XR9A 2P5WB 5CJQL 2NY7H 4HW6A 3ZKQD 2EDXA 2X9XA 4FQXC 1MEXH 1KF9B 1RMFH 4LIQH 1FGNL 4YK4B 1GXEA 4X5XA 3SKJH 3MRLB 1JP5A 2N1KA 3CMOH 3RP1A 1KB5L 5I8KL 4KK9C 1Y0LB 1FNSL 1MRCH 3NCMA 3D18A 5F71A 5BJTA 4J3OC 1IKFL 3CXDL 4PRIB 4KKLD 2OL3L 4R9HA 3PG2A 3ELAT 2PR4H 3U36B 3K8LA 4C56D 1URLA 4P46D 1R5WA 2KDGA 4IDJH 2V9QA 3H0TA 3TVMA 5KS9E 3VXOA 1KPUB 5D7KE 2FRGP 4WEBL 1KJMB 2VL5B 3ZE1E 3JWOC 3MJ8B 1S9YB 4NNYB 4PRBB 3GHEH 4PJ5D 2D7TL 4HJ0D 4GBXA 2RFXA 1MFDH 4HUXA 2XY2A 3VXTB 2R2CA 1KIRB 5IEKB 2CRIA 1YEKL 1IM9A 3KHOA 3MLXH 3AFLA 4WHTA 4LEXH 3HB3C 3QNXA 2YA2A 5C0BE 4YEFA 5C0CE 4FQLL 4PJBE 1OVZA 3ESVF 4OCMC 5T1LA 2DF3A 3I6KA 3STBA 1ZT4A 3BZFB 4DUXA 3QZWB 3CDYA 3H9ZA 5AYUL 3INUL 1DQDH 1WQVT 4GW5B 4YDLC 3NCYP 5JPMA 5ESAA 1R24A 4RMTA 1DBMH 2P5WE 2Q86A 3OR6A 2X4OA 1ZEAH 1D7FA 1MY5A 1P4LB 4HFWB 3IDYC 4OSUH 3NCFB 3GMQA 5DJXB 3DV4A 1CFSB 4U6VL 1M6OB 3GDBA 5E8EB 3EHBC 1DLFH 1U58B 4LCUA 3RDTD 5ACZA 4R4FH 3KNBA 4OCLC 1A6WH 3G6JF 1U3ZA 3U7WL 4TNWK 1AIFB 1H3WM 3UJJL 4XWOC 1CF8L 1H0DA 4PJHF 4KJQC 5GS2H 2HRLA 1BQHB 2HT3D 4NZRH 4FNLH 3IAGC 2I25N 4MA3B 3MACH 3F8UB 2IJ0C 1NBVH 1TQCB 4Y19D 3S5LB 1RZGA 3VXUE 4L8CA 3R06B 1CGYA 1WUNT 3B9KC 1P2CA 3GIZH 4JQXA 2UZIL 3VXSD 1FFRA 2NY3B 5IVZB 3RKDD 1I9IH 2AABH 3QXAA 4PGDB 2B8OT 4H1LH 4NIKB 3CFCH 5C0AA 4ONGL 4OD2B 4IS6A 4JRYA 4PJHA 1KN2L 4EBQH 3OAYH 4DZ8B 2NXYD 3PDGA 5GS0L 3ILQD 3QUMA 3DURB 4XPTL 1MIML 4MB5A 3ZYIA 2NMSA 2WBJD 2GSIB 5FYJL 3F7YB 1FNEA 1CK0L 1DBAH 1OTUC 1CBVL 2VLMD 3VGAB 1A7PH 4N68A 3WD5H 4PLOB 1RJLA 4LSVL 4R2GB 5HYQA 1YYLL 3OHXB 1QRNA 3UTSA 4I77L 3RUGA 5CIPH 5C8JA 3WIFB 1J8HE 3DX7B 2OL3B 1IQDB 4MB4A 4PD4K 2W65B 4DJMA 4X98A 1FFPA 1DVFA 3DYPA 3MRKA 3QQ9C 3TT3H 5D7IB 3RX5A 1DQJA 3MLSL 5JW4Q 5EFIB 3LH2H 3IS1X 1RVFL 5TFSH 3RWFB 5IV2B 1AXSB 4MS8D 1AP2A 1MCKA 3S97C 3QYCA 1XR9B 3MLRH 5DRWB 4P9MH 3EYUL 3NGBB 1VSCA 1QFUH 2HTLD 5IHUL 3PNWA 4YGVB 1SY6L 2Q1EA 3ZDZF 2YKLH 1KCSH 3QWOB 1ZANH 5DQJA 4WI7A 5D71L 4OGXL 4E0RA 3GKZA 3DXAE 1VESA 1RZJL 4HD9A 1TCRB 2FIKA 2WSKA 3PWVA 3ARGD 1R5WB 3MV7E 4S11A 3V5KB 1GPOL 3DBXA 3EUUA 3TO2B 3LVEA 3QP3A 4FZEL 1I1FA 4UT9H 5JA8B 2ERJB 2YPLA 1VFMA 5ITFB 4J23A 4HWBL 4QNPF 4B50A 2G60L 1S7RB 5K9OB 4MA7H 2WLZA 5C0NC 5F44A 1GPOH 1QLRA