5EBMA

Kcsa t75g mutant in the nonconductive state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
218
structure length
218
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 42
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmA02
5JORB 2X44D 2EC8A 1QNZL 3F7QA 4QT5A 4IMLA 1OM3L 5GGVH 3PDOB 4OGAD 4N0UE 5C07E 3L3DA 5KN5B 4Z7VF 3GMLA 3NIDE 4APQA 3SQOH 1A6VH 5E8NB 1A6TB 2AJVL 2EDFA 3E8UH 2HYMA 2QSVA 5L88L 1E4XI 1R3LB 1I8IA 2DD8H 3ARXA 3RL2B 2HRPL 1QP1A 4FQCH 4NQED 3K3QA 3UP1A 4HK3N 2CDGB 4H1LA 5DQJB 1XGYL 4OQTL 5D7JB 3GBNL 1D9KA 5FDWB 5BS0B 3EFDH 3RBGA 3LS5H 2EDEA 4NDMB 5T1KD 1I9JL 3BUYA 4TNVF 1O5DT 2C4FU 3SGJA 5D6DC 2CKBB 5EPMB 5AYUL 5D7LA 5GGVL 1UJ3C 4GW1A 1T0NB 5E7FA 5DLML 1TTGA 2D0GA 4D3CL 4WGVB 3KWWA 4JM2A 1J05B 1TLKA 4TUOA 3SQOL 3V95A 4JN2A 1KENH 4ONOA 4XWGL 3E8UL 3RWEB 2VUOA 1OTSD 3R4DA 2DD8L 4PJIA 1KELH 5C0CB 4FQCL 5CZXD 1FFPB 4GS7C 2QSTA 2Z4QB 4JFDB 4X0KB 1LEKA 3QT2A 1B88A 3EFDL 4LKCB 5HHMB 2B2XH 3PGFH 5JO5B 3V79C 1LK2A 3EOBB 1T21B 2O26U 3MLSH 1JK8B 3CX5J 1T0MB 3JBG7 4HWBA 4K71C 2R2EA 5CLTA 3KYMA 4G6KL 3WXVH 1XGQA 2CXKA 4JPIA 4UV7H 3PWLB 1A3QA 4Y16B 2NX5B 2HMIC 4OLWH 2FB4L 1NEUA 4XP9H 1J86A 4HIEB 1G6RH 2ITCB 4PB9H 3TC9A 3VWKB 1FZOB 1AIFB 4ODXB 3GMPA 5E2TH 4ZUWA 5E2WH 1JNLH 1ACYH 3DTXA 3BGFB 4GFTB 4YPJA 1A8JH 3MRNA 1FVEA 2ID5A 4YHPB 4PJ7F 2UZXB 5BJTB 3MLSL 1RPQA 3QAZC 1FZMB 1H8OA 1JTOA 1CL7I 5KANI 1FFNB 4UV7L 3JZ7A 1HQRB 4NO0D 1IM9D 4CN1A 4C55A 5KSVB 3B43A 2HJLA 4Z7UF 2NXZB 1FL6A 2W0FB 4PB9L 5FDYA 5E94A 1H3XA 4OZIE 1QR1A 1HILA 3PWVA 4HFWB 5D6CB 1JNLL 3VXTA 1ACYL 1DQTA 5C0GA 5BV7B 5C9JA 5T1LA 2IADB 1ZT4B 4NQEE 3DWTA 1T1WB 2FEDD 5IB4B 1BFSA 1QSEE 3GMRB 4ODTH 4XZUA 1DCLA 3BVNB 4U2YA 1NDMB 1OGTB 1MCWW 2VZUA 1GGTA 1GGUA 4PS4H 4LSRH 1T1YB 3LKSA 1RUAH 8CGTA 4RGOL 1ZA3B 2F54B 3O3DB 5BZDB 4OD2A 4O2EB 3QO0A 3NCYP 2EDRA 2GCYB 2WW8A 2DQGH 3WFHB 3LZFH 3LN5A 1DJSA 1S5IH 1EPFA 4WV1B 5EOTB 4GG8A 5DK3A 1KJ2L 3TBVA 1DBJH 4KTEH 3G6AA 1XCTB 1CWVA 3ZE2E 4K2UL 3GO1H 2C26A 4PS4L 1E6JL 3SDDB 2IQAB 3EDKA 2WIIA 1RUAL 3PHOA 3D69B 4M7JL 4P2OB 3VMPA 3P77A 3TLRA 1UA6L 2R23A 4KKAC 4KI5C 3L3IA 4QRUB 4HUVA 3MV9E 3HE7D 2DQGL 4YDLC 3LD8B 1IRAY 3H9HB 2ICES 3PP3H 3IFPA 1OY3B 4KROB 2Y5TA 3ESUF 2EIZA 4TUKH 4X9BA 1N64H 5IG7A 3PWJA 3TIDB 1NBYA 5MENE 1ZA6A 1SM3H 2OM5A 4ONGH 5TFSH 3OMZA 3RNKA 2VDLH 5FB8B 4JFFA 4OIAA 3GMNA 4OZFG 4HWNA 4PRNB 4NOBA 5A3ID 3QISA 3GMMB 4XNQB 3P0YH 3WIFB 3VFNB 4JRYA 1RFDH 1IC7H 1JZ4A 1X5FA 5EU3B 1C5CL 1LEGA 1D5MA 3WIIL 1T89A 4QY8B 4NC0B 4L8SA 1N64L 4JANA 4PJ7A 4P5TD 5ESAB 4OLZH 2XN9A 4ONGL 1YEDA 3VFMA 4GRWH 1FLTX 1FPTH 2FSEB 1R3HB 1RIVH 2HA1A 2QKIB 2NR6D 4Z7UA 2WWMC 5CGYC 2XNAA 2R4RH 2A6KB 4RWYH 4N90E 1JNNL 2WMPA 4N9GA 3ZYIA 4ONFH 2OXGA 5ID0A 3DRQA 3HZVA 4E41A 4ORGA 1I7ZB 1RU9H 3ULUC 4HBQA 3GMQA 3GJFK 3NAAL 4LF3A 1MELA 4U0RC 4HF5H 4IOFC 1BWMA 1AP2B 3TFKD 2JJVA 5IOPA 1A6WL 5HGGS 3KLAA 1MI5B 4WO4D 1JZ2A 4U1LB 3QUXD 2MKWA 4X6FB 3UPRB 4AH2A 5HXMA 2AXFA 5MI0B 3KPOB 5IKCA 3S3JA 1JHKH 1E4KA 1KPVA 2EC9U 1OW0C 3IVKA 2ZUVA 3ZDXF 3WNMA 1V3KA 1RU9L 3WO3B 1G7IA 3BP6A 3CNKA 1ZS8B 3AS3A 1JP5A 1PJ9A 4HF5L 4ZO9A 3GSWB 4JGJA 3WHXB 1VENA 1RD6A 2G9HB 5FA4B 2ORBH 1KTLA 4DAGL 4NO2B 2NXYC 5GS0D 4H1LG 5DJDA 1HCFX 2Y36H 3K46A 3QIUD 4XCFH 5CUSL 2ZUYA 5C08E 2NY4D 3RNQA 2ZUQB 1BIIA 4CW1A 3BESR 2AJZB 4G8EB 4X7TB 3F7PC 2R0ZH 4LKXA 5HD8C 2P24A 3TM6A 1IGJA 5JDJA 2NW2A 3HZKA 3BH9B 4QRRB 1P53A 4MXWL 5ISZB 1F90L 3P3YA 4UTAL 4L29B 5DUPL 5DC4B 4G3YH 4GKSB 4YUEH 2XFXA 1XF2A 3WFZA 1AO7B 5DWUL 5BZWB 1CFNA 2NCMA 3FB5B 4U6XB 3ARSA 5I66B 5CBEA 4FZEL 3TZVD 1EEZB 4RDQF 3BOVA 1BOGA 4MA7H 3S36L 1AD0A 5F9WB 2F8VA 4P23C 3MUY1 1AGFB 4HWZA 3OB8A 1UXSB 1YEHH 1HXMB 2BHYA 4M3JA 4IHOA 2XWJA 3MZGB 5ANMB 4BZ1H 5H37H 1EBPA 1R24A 2DQEL 2IMNA 2K9UA 4UUJB 2X1QA 2IPTL 3Q6FB 4KK5C 1QBML 3QNYA 4JKPL 3ARDD 3DETD 1B4JL 3IAQA 4PRID 2Q8BH 3VD4A 1ORQA 2FD6H 3SY0A 5BV7L 3O4OC 1MCDA 1V3JA 1DLHA 2PW2A 4X6BB 5FECA 2YKLH 2BVUA 4PP1C 4RGND 3FB7A 2E7HA 15C8H 5I19L 3HE6B 2Z35A 2EDQA 4AEFA 1YC7A 4RAHA 5EU5A 3MO1B 2B1AL 4MX7B 5F3BA 5CIPB 1EVTC 5D7KD 3D5OF 1KPUB 5BVJB 2Q8BL 5ERWA 2X70A 2BCKB 5I1CH 3NCCB 4DN4H 3KS0H 2VLLA 2HKFH 3OKDB 3MUJA 3U6RA 4K3HA 2PTUA 3RVTC 4Y89A 1XF4B 3PDDA 3PABA 5C6TH 2GW5A 5BOZG 2GEEA 3PE9A 4URTB 4XC1H 1Q9KB 1DL7H 1MFEH 3HPLA 4LPTA 5E5MA 3RVVC 1K4DA 4PG2A 3OSKA 4CN4A 1QO3A 5L7XH 4AMKL 1IQDA 3DVIA 1I1AC 1AXTL 1DDHB 4WI9A 2XKSA 4NFBA 3CFBB 2AAVA 4APQD 3B9VA 3EUUA 4I77H 3D9AL 3QUYA 1R5VA 3TJEL 3X3GL 1HI6B 2EYSB 4Q97A 1T20B 5D2NC 3MV8D 4XP6H 4JG0H 3FAWA 3IRZA 4KMLB 1A6UL 3ZO0A 4EI5B 5C6TL 4LVHC 1CXHA 1ZV5A 4FABH 5KZCB 1DL7L 1E27A 2VQ1A 1P7QB 4LLWB 4ZO7A 3RWCB 2R1WB 1Z0MA 1XZ0A 3DGGA 1XIWA 3O9WC 2GUOA 3EO0A 2FJGA 3Q3GB 5DD0L 2FX8H 3C09C 5ETUB 4JM2D 1CFTA 1J0HA 3BWAA 5FV2A 3G5YA 4R4NC 2XG5A 2Y7QB 4PRIE 2VL4A 1ZLUH 4HWEH 2AXGB 3H9SA 4ISVA 3UO1H 3QIBA 1FO0A 1FYHB 2EE3A 3SKJH 4FABL 5JR1H 2G75A 4LIQL 3DYMA 4KY1H 4YX2H 1GC1H 1WFOA 2PF6A 4E0RA 4OCMC 3VRLF 1JE6A 4CMHB 1ORSB 1B0GA 1LO0L 2VDPH 5CSBA 3O41A 3LVEA 4DVRH 2LU4A 5D7KE 3MRGB 4XMPH 4Y5VA 1N0XH 5CAYB 3THML 5HPMA 2PR4L 1M7DB 2MFNA 3AREA 1PX4A 2Q7NA 3QDJB 5TH2B 1MREL 1YEGH 1OP5K 4WDIA 1AGEA 1NFIA 4ZMAT 1I7TB 4ZUTA 3VWJD 5A43C 3P9MB 1NFDF 3ULVF 1PAMA 4ZTPH 3MJ9L 4MA8L 1FGVH 4DVRL 3FQTA 4NZJA 3RA7H 2EDBA 3QNXA 4F9LA 1AGCB 3WS6C 1YC8A 5J3HD 3D0LB 3CCHB 2EH7H 4AQOA 1UJ3B 4XTRC 3CU7A 1TQBC 2PXYC 5IMOA 1YEGL 1GHFH 3FN0L 3CIQA 1F42A 5T1LD 5ELIA 2DMKA 3EZ8A 1TZIA 4X8XA 2EDTA 4TTDD 5ICYA 5EBLA 5GGUB 2XXCB 3SJVB 3OJMB 4RIRA 2PTVA 3HI1A 2H2PD 4NQCA 1NUFA 2JB5L 4BUHA 1J1OL 5D7LE 4ZFGL 4QXUH 1T80A 1WWCA 4ODVL 1Q0YL 4DGVL 4M1DL 4D0CA 4BH8A 1CFVH 4K71B 3AAZB 4GW5A 1KJVB 2W9EH 4DGYH 2V5SA 4M1GL 4JDZA 1YDPA 4UDUA 5ID1A 2ZZUT 1ZWIA 4PJIE 4JFYB 1QFWM 1BFVH 5F7FA 5FYKH 1UZ6F 4ZOEA 4LEXH 4ZODA 4NRZB 5C0DA 3KLHC 3U36A 3GZKA 5JQ6H 5IVXB 4E5XA 3GNML 3MBXH 5I1AA 4P2RE 1ED3A 1CFVL 3QAZB 2P5WB 5IW1A 3B9KC 3MRIA 4XWOD 3NCEB 5FO8A 1QFWH 1ZHLB 2DQHL 3ZTJH 3VFTB 2H6PB 3RZCA 43CAB 3RRQA 4FQ2L 1M7IB 4XPFL 1OARH 1CFSB 5C0BE 3LN4A 4LEXL 5MEQB 5J6HB 5CJBA 1P7KA 3U2SA 2VISA 1WZ1L 4HJJL 3T4AB 3IDMB 1J7VR 5F71A 1MVUA 4JFFD 5IR1B 1IEHA 4HIXH 3BKCH 1CF8L 1CYGA 1SQ2N 2Q86A 4PRDA 4TVPD 3GRWH 1QUNA 4JRYD 4CMMB 1QFWL 1NGZA 2LVCA 2Z93B 4ODBD 4PJDB 2ADIA 1IAMA 3VA2C 2DWDB 2VUYA 2FO4B 4N8CL 4MJ6A 4HC1L 4CVXB 5TDNB 4FQ1L 1U8HA 2DF3A 3PWNA 4I4WA 1BFOB 4NPYA 3HRZB 2XN9D 4XCNA 1MFCH 2IAMA 5FM5O 4M5YL 1OVZA 3WN5A 4OCYH 2PKDA 4Z7VE 3G5XB 4F3FA 2GJZB 4QHUB 2ARWA 2F53B 3DX9A 3LKRB 3BGMA 4Z8FH 4XI5C 3BRDA 4YNYA 4E41D 3RPIA 2A74B 2VYRE 4LLAA 3V5KA 4AEHL 1UCBH 1DQMH 1NC4B 5K9KB 4OT1H 2EE6A 4HIIB 2DN7A 4NYLB 2GJ6A 4YDLB 2CLZA 4I5BA 4JVWA 1DQDL 2IFGA 2ZNXA 1IM3B 1NLBH 1S7SA 1CDIA 2NMSA 1M1SA 2I9LB 5AEAA 5EBWA 1KN4L 4OCYL 3QDGD 5F8QC 5BMFH 3C8KA 4Z8FL 1IAOA 1G9ML 4DTGH 2PYEB 2H8PA 3ZTNH 3O4LB 4K8RL 3BPLC 1SHMA 2EDHA 4G6MH 4BFGA 1JNJA 1ADQL 3EYVB 2DLHA 4TOYH 4H20L 5C8JB 2C4FT 3R8QA 2BVOA 2ILLA 2V2TB 5E4EC 2JIXB 4G6FD 4NO5A 5AYQA 3RVWC 1WCQA 3DO7A 4BH7A 4BJLA 1W0VA 4X9GA 1KXQE 3NN8B 3RWFB 1YUHB 3GGWA 5CILL 3FO2A 2YPKA 2UYLB 5FYJH 3ZTNL 5MERB 4TVPE 1I3GL 2Q20A 1OHQA 4JRYE 4KAQL 3VE0B 2WUCH 3ULSA 4EIGB 4R3SA 4MJIA 3KPPB 3C6LA 1BP3B 1MHHB 4TOYL 5EO1B 4RDQG 3K4AA 2XY2A 3BN9C 3RUGA 3N1FC 1K3ZA 4PJ7E 5GZNC 1BD2E 4R2GD 1PEWA 3OKNA 3MV7D 1NUDA 5HDQL 3NA4A 4OTXH 3QFDB 4U0RB 3X17A 3T0DA 1RHFA 4LRNL 4PLKC 2GTWA 3FRUB 2OZ4L 3LIZH 4Z7UE 4P2YA 3H8NA 4DKFL 3CLFL 4OFYD 3OJDB 4MJ5B 1EEQA 1I7UB 5H2BB 1KJMA 3DIFB 1A3RH 4HCRL 3O2WL 3BPCB 1SY6L 2HWZH 5L8KB 4U1SB 3MRPA 3AGVA 1HOCB 3ZKXC 4PJ9B 5IW6A 1K5NB 4JHBA 2FEEI 5IFJA 1HINL 5SWQB 4PLJD 1MWAB 1CXIA 1JWUB 2DQFA 5F1KC 1U3HC 3TF7C 4AENA 4PD4J 3EO1A 3QH3B 1KB5H 4HV8A 3LIZL 2DYPD 2WLZA 3TO4C 1WTLA 3IAPA 3T0EA 3DV4A 3BKYL 2NXYB 1EFQA 3WLWD 4PTUA 5ITFA 4P48A 3O6FA 4RZCB 4N0FA 1CD9B 1RJLB 4LLMB 3FZUD 1QRKA 4JHAH 3HMWH 1NDGA 4R4FH 1JGDB 4MQ7A 1DR9A 4CDHA 4RFOL 4NKDB 3L5HA 2CSPA 2LVEA 1X5ZA 3LKNA 1S7RA 5DC9B 4NWTH 1UADC 4XNXL 2YRPA 2WQ8A 1FBIL 1KB5L 2BY2A 3LPFA 1QSEB 5C0JB 3OAZH 2F5AL 3MRCB 2KZ1B 5TE7L 1U3JA 3OZ9L 4HK0A 3VFUA 2UY7A 3RWDA 3DRTB 4XAWH 2EXYC 2HT3D 3DV6A 2XQBH 3RPKA 1NCNA 2L7JA 2QHRH 4FTVB 3OHXB 4QRQA 3TN0C 1Y0LB 1GGYA 4HZLB 4NWTL 2R69L 4JZJC 3WKML 3IDNA 5MEPA 5K9QG 3M1BB 3QXTA 1U8PB 2OR9H 3WDJA 3OXSB 1T2QL 1AHWC 5K59E 1RIUH 5DMYA 2BJMH 4X99B 3MJ6A 2NPLX 1EBAA 2EIEA 4OB5L 3RU8L 4YHOH 3I2CH 3NIGF 3P9LA 4C83B 2R56H 2WQRA 4XHJC 3VFSA 4MAYC 2E7LC 2GYSA 1UVQA 3O4OB 3ALXA 4XPBH 1CGSL 5IV2A 1FIGL 5JXAL 1TVBB 3FO9A 3L5JA 4PREA 3ES6A 1A9BB 4GXVL 2CO6B 4FS0A 5ACLA 4AG4H 4G5ZL 3MRDB 5E6IA 3O11B 1NL0L 1XGTB 1DTUA 2OR9L 1I8KB 4HS8L 4LLQA 3UROR 3UTTA 3T0VA 2HT4C 1N7ML 2BJML 2YSSB 2DKUA 5EZJB 5B4MC 1AGDA 3V52L 3T3PE 1WT5C 1HSBA 1C5BL 3H9SD 3QIBD 2BVEA 1N0LA 4Q9BA 3VD5A 1ZANH 4QHNB 4K07A 5HDLA 3M17B 4O2CB 2W92A 4YZFF 4AG4L 3TNNB 3PIQB 5F96L 3B6SB 2Q6WA 1ETZA 4F57H 3DMMC 3DLQR 4YAQA 4F7EA 1BQHB 4PJGA 5FO9A 3MOBL 4JFXB 1P6AB 5DEFB 5EORH 3MLTB 2H32H 2X4NB 1KG0A 4KZDL 3ARED 3ZL4H 3UTSD 1I1AB 4GKZB 3ZDXE 1MIEH 2J6EL 4X4XA 2DI8A 5DK0A 4G9DA 2JLLA 3ALPA 4PJ8A 4PJCB 5IMKB 2XZCL 2NY6C 4NM8L 5D2NB 3I50L 4LARH 4M61B 4F57L 5LCVL 2VC2H 1MCSA 1NANI 4LVHB 5SWSA 1UGNA 5C0IA 5IB5B 5FOJA 1BGXH 5DHVB 5DURD 3BDXA 1KIRA 1U41A 3O9WB 2CLRB 1QBAA 4MWFA 3ZL4L 1L9NA 2C3VB 2CJUH 3KXFB 4OD3H 4Y5YA 3C09B 1MIEL 4L4JA 3CX5K 4KGLA 3CFDA 5KVDL 5DZOA 4XX1E 4KK6D 3P73A 1CLYH 5HGAB 3FT3A 3T3MF 3LKOB 4GSDH 1W2KT 2CRIA 3FTGA 2X7LA 1CICC 2NLJA 3DSFL 1EJ6A 1WBXA 4KDTA 4JO3L 4NQCD 3AS1A 1R0AL 2P47B 4WTZA 1IKNA 2RJMA 2B5IC 2X1OA 3V6OC 2NY1C 3D3VA 4NQTA 1A14L 5GGTA 3VXPA 4OZGB 1BAFH 3ULUL 1MOEA 1X6NA 3H9SE 1E4JA 1SEQL 2GAZA 1H15B 2BSSB 4NHCH 5EUKB 5GSRB 3T4YA 3AC0A 2XPGA 4QRTB 1MJ7L 3ARQA 4DQOH 3RTQB 1FRGH 1YECH 3VFOA 2D7TH 2LAAA 3G04A 3BZFA 3CMOH 5ALCL 3RWHA 4HGWB 1RK1B 3CSPA 5CLWA 1LK3L 1JPST 1BAFL 1N2RB 3UYPA 3KPNA 3RZCD 2A6DB 3V4PH 4KQ3L 1TQBB 2PXYB 3AXLA 3K0WA 5JPMA 3IETA 1FRGL 2CGRH 3FN9A 3AS0A 4YBLC 4L3ED 3TYFB 3TH2T 5DK2A 4M6AA 5ADOH 5J7CC 2AJ3A 4AK1A 1ND0B 2AEPH 3REWB 3ZT7A 2GK0B 2R1XA 4FHBD 5EZOL 5CSZB 5F8RC 1JWMA 3TNMB 3MLXH 5BW7C 5I8EA 3MLWL 1CDHA 4GH7B 1I4FB 3V4PL 4EXKA 1XAUA 1DBBH 1JPGB 1WZKA 4YDJA 4YHLH 5D72H 4AIOA 4RMQA 1R3JA 5IIEA 3QQ3B 2E9BA 3ULVD 3NGBC 1I1YB 4P9HC 4RX4D 5T1DH 3QDMB 5ADOL 2YK1H 1NGWB 3LPWA 2IAMD 5E00A 1S9VB 2AEPL 3SE8H 1OT1A 3NZHL 4NQCE 3ZKMC 1N59A 2Y06L 3QI9A 2E8ZA 3S98A 4LFHD 3JV5A 3MLXL 4OGXH 1RZFH 1FC1A 1UT9A 4WUKH 1ZSDB 4LCUA 5GS1B 2A2QT 3EDJA 3L3KB 2EYTB 1NCDL 2JB6B 4ZTOL 3B9KB 3SDYH 1NC2B 4GMTH 4JR9H 5C0AB 2GJ6D 3VRIB 2YK1L 1J10A 2DL2A 4HLJA 5E5RB 1T66D 4GRWB 1GZQA 2A9ML 5GRJH 5I8KH 2X4OB 2AABH 3AS2A 3GKZA 3RGVC 3CDYA 4TQEH 5LBSL 3K1DA 3VI4E 2VXSH 4NZRL 2ZKHH 4U1MA 5T3ZD 1FQ9C 4FQHB 2ICWJ 2FJFB 3BDBA 2F5BL 2VZSA 1D3CA 1E28B 4XXDB 1J5OH 4PJFB 4HBCH 4XP5H 2ZPKH 3ARZA 3VRLE 2QTEA 1VGKA 5DVNA 4JAMA 3SE4A 1INEL 2V17H 4LCYA 4LPUA 1YYLL 5LXGH 3QQ4A 1WAAF 5ESVA 4M48L 3GHEL 1A9EB 4WU5B 1IT9H 2LE9A 2LQRA 1HHJA 2BSRA 4R96A 1FG2A 1L6ZA 4Z7WB 1GAFL 2WBJD 3DBXA 3QUYC 4LHJB 3RWGA 1ZHNB 1KT2A 3C08L 1JVKA 4ODUA 1S9YB 4Y8DC 4MJID 1XH3A 3L3OB 4X4ZA 4NUGH 1FL3B 3GJFH 2Z8RA 1OCWH 5CINL 4DCQA 2A73A 3ULVE 5J0BA 4K3JL 2ARJA 4DFHA 5JZ7D 5LJYH 1JZ8A 1Z9SA 1QPPA 1RUKL 4RFEB 4LSSH 2AEQH 4RMUA 5KBNC 1MVFA 1P4IH 1FYTB 4RCAA 2VZOA 5E56A 4BM7A 1MJJA 2CIIB 4ONHB 2XXMB 4ZUUB 1VFBA 3UZEA 3N9GL 3NFNB 5JMRA 1MLBA 1UFUA 2AJXH 4LPCA 4JRXB 3SKMB 3DURB 5J13C 3QWQB 3FMGH 3BPLB 4O9HH 5J12C 5KSAC 1Q0XH 2GJ6E 3BMWA 5HDOA 5HHXL 5F6HJ 3FFCA 3GI9L 4U1KB 4NOFA 4YHIB 2VXQH 2JK5A 1FE8L 2K3TA 1BPVA 3IFLL 5HYFA 4Y5VC 2VDNH 4LHUA 2XY1A 3QUMB 4XPTH 5C0RL 2R8SH 1PG7L 4F7TA 5DRZB 5EOQL 4BQCA 1NANH 4PY7A 3C60C 3KPRD 4Z18A 4M7LT 3KPMB 4UU9B 2VH5L 2QL1A 3FMGL 5DJZA 4QWWD 4O9HL 1UZ6E 3QUZC 4CJ1A 2C1PB 3MGOA 4CNIB 3T8XB 1TJHL 2A6JB 1P5VA 2VXQL 5D1QA 1HZHL 1A1MA 2PTTB 1VKXB 1LO4H 2VDNL 2AGJH 3FONA 1BVLB 2LTQC 1OGAD 5J89A 2FBOJ 3AY4A 1JGLL 2OBGA 4ZSOA 3VXRB 3O81A 2IH1A 5TDOA 4KVCL 3EYQD 4WTZG 5TQ2H 1SYVB 1I8LA 5C0FA 5FHAH 1H5BA 1OAXH 3C6SB 3ARYA 2H3NB 1FNGB 3GIZH 3QJHA 4MJIE 5TGBA 5FGCE 1DLFH 5HBBA 3KPSB 3MRRB 3W9DA 3RUGE 4GJTB 3KPQA 4G8GD 1WAAA 3MR9B 3Q6GL 1S8DB 4BFBD 2AGJL 1FGNL 3ZKXB 4Y4KC 1CDUA 5EC2A 2R0LH 4W6YB 5GZOD 4HDIA 4PBWD 5DT1L 1U3HB 3WS3A 4B7IA 4XVUC 4P2RB 2GSGB 2O5YL 5DQDH 5KJRH 4L9LA 1I3RB 4XNYL 5FHAL 1HXYB 3HZYA 4TVSa 1CE6A 4QRSA 4TSCH 3OR6B 4H0IA 3MRKA 1BZ9B 4PLNC 3L9RA 1U8OA 3DVNB 4JFOB 4P4KA 3GSNB 3SCMC 3FQUA 4GAYA 1KNOB 2I07B 1BQUA 4ZFFB 5GS0H 4NFDA 2QEJA 1NBVH 1QFUH 3ARBA 3LKPA 5DQDL 2G2RB 3T0EE 3TO2A 1P84J 3WFEH 3IS1X 5I1IL 3T09A 4XBPA 4Y2OA 4Z7NF 3ME0A 3OKEA 1N6QH 4JFEA 3OXRB 1IVLA 3QEQB 1CD1A 4N0YL 4HMCA 4YHKL 1T04A 3SDCC 2WIMA 1EFXB 3QXVA 4IRJA 2I9TA 4QCIA 4HX1A 2P8LA 3PHSA 3TN0B 1RZ8A 3RHWF 5KOMC 1BQLH 1L7TH 1QFUL 1AXSB 3G9AB 1PSKH 4JZJB 1GYAA 4YXKH 4EQ3A 1PQZB 1S78C 3WFEL 4OQTA 5D5MB 1AHWB 3DNKA 4LMQE 3NFSH 4NCC1 3NFPB 1N6QL 4QRPA 5JA9A 1DVFA 3JTSB 3MRMB 4UIMB 5C92A 3TCLB 1WSST 4JO2L 1GPOL 3IU3B 4OZFH 3RIFF 2Y4SA 4NHUA 4MAYB 4OI7A 4OUUA 5TDPB 1TPXC 1GZPA 5SWSD 4NN5C 1NAKL 4DUVA 3LRSA 4N5EC 1S5HA 2Y23A 5C2BL 4KHTH 1BVKA 4K7PX 2ENSA 4LOUC 4YXKL 3BEVA 3MRHA 3VJ6B 3QA3A 4JPWL 3UDWA 1NCBL 2B20A 4LEOB 5E9DB 3LV3B 4X6EA 3KS0J 4KPHH 4AQ1B 3B2UD 4P9ML 4XPGH 1KIQB 3B8YA 2OQJA 1HHHB 3KLSA 1JFQH 3A67H 4G43B 3Q48A 3T08A 4R9HA 4JLRB 2F58L 2HJKB 5FHBH 4QHKJ 5JDSB 4IJ3C 4LSTL 4MNQA 4EN3C 4KHTL 3IU4H 3L5WB 4IRSA 2DLIA 4WCYH 1HYRC 3UTTE 4QXGL 2DLFL 4PY8I 3DI3B 3ETBF 3U4EB 2ADFH 5IBUG 3VG0H 3SKNA 1E4XL 1RZKH 4M6NH 5I8OH 1J11A 1JFQL 4X9FA 3A67L 4WW1B 3H3BC 4EIZC 3HUJF 4MZ2A 4RGMC 4BQ8A 1GGCH 2P5EB 2OTWB 3QXAB 1MHPH 2BERA 4UTBL 2P7TA 1II4E 3ELAT 1W0YT 3LQAC 3IU4L 2EYRA 1NGPH 4K94C 5F70A 3VXNA 1OF2A 1F3DJ 5B8CC 1CU4L 4FQLL 5IFHL 1TNNA 1P1ZA 1WITA 1A7PH 3EDEA 1TETH 3TBYA 1RZKL 1YYMH 4DEPC 3MRLB 1S7VB 3CPLA 1YJDC 3V7MA 1NMBH 3C6LC 4JZNA 5JXEC 4IOSD 1MQ8A 4H1LH 2JJSA 1A6ZA 1EAPA 2BOBA 3V0WH 1LILA 5AZ2H 5BXFB 5L9DH 1U8QB 1NGPL 3EO9L 1U92B 4GQ9H 4JHWL 5FK9A 1IAIM 5SWSE 2AJYH 2R4SH 4GRLD 5CP7A 5CZKA 4NC2B 3DXAB 1CICB 4Q74A 5T3XE 1KBGH 1ZVSA 3UJJH 4LPVA 1KJ2A 5EU7C 1Z6JT 1FJ1A 2E5EA 5I17B 3V6BR 1WV7T 5C7XL 5IESL 4PJXB 1YYML 1KXVC 2B5IB 2P44B 5E8OB 1G7QB 3H3PH 3P4OB 2OJEB 1NMBL 4F33B 4LHUG 5BRZB 1B2WH 3OKOA 1DEEA 3DUUB 4XCEB 4Z7QE 1IAIH 4LP5A 3NOIA 3V0WL 3SKOA 1KB9J 5AZ2L 2VDRH 4KGJA 4HGKC 2I24N 2AJYL 3G6DH 1G0XA 1IZJA 3V5DA 4HWBH 1KBGL 1CL7L 1M6OB 3QI9D 1RK0A 3QQ9D 2DQIH 2KQMA 2VAAB 3UJIH 3FJTA 3D3VE 5EBMA 4B0MM 4Y4FD 5A2LH 3NIGE 3TJHD 3H3PL 1T0PB 2FEDC 4PJ5B 1ITCA 1JWSB 5EC1B 1IAIL 4ALAL 2XRAL 4WHTA 1DQLH 3UPAA 2VDRL 3U7WL 1A1NB 5DI8A 3G6DL 5M7QA 3HZMB 1TCMA 4HWBL 2ZSWA 1U2CA 3CUPB 3BP4A 4Z95H 3DX7B 1OAYH 5SWZA 1HH9A 2E27L 4YBLB 3UJIL 4RMTA 2P8MA 3RVUD 1CLCA 4LU5L 4M43H 2O93L 1G7JB 4OZHF 3D25A 4U31A 5INCA 3REVA 3SGKC 5IROA 3HUJA 1DUYA 1WISA 1AJ7L 5JUEH 5ACZB 2PNDA 5H94A 4BFEA 4F58H 3BIKB 4JFPA 2R1YA 1U8NA 2VSCA 3NGBB 1OAYL 1Z2KA 5JORA 5BQ7B 2FYYB 4J6RH 2QQKH 3SQBA 3PDOA 1BIHA 5KN5A 2DM3A 3FAXA 3MLYH 3O2VL 5E8NA 1A6TA 4O00A 1FH5L 1FSKC 4XAKD 2P4AB 1R3LA 2GKIA 3F6IA 3BYYA 2NW3B 1BJ1H 3RL2A 2VOTA 3V7AE 2E9JA 1BLNB 2CDGA 5DQJA 5D7JA 5FDWA 5BS0A 5K9JH 1FIEA 1H3UA 3FRPA 3NH7H 4NDMA 3G9VA 2EDWA 4Z6AT 2CKBA 5I8CB 5EPMA 4P2CG 4XRCB 3LAFA 4OI9A 1T0NA 3BD5A 2Z92B 1J05A 3RWEA 4GT7A 3T3ME 3KHQA 1T2XA 5LVEA 2Q1EA 2QLVB 2UWEF 4EZMA 5C0CA 2P42B 2W60B 1FFPA 2Z4QA 4JFDA 4X0KA 2ED9A 1CQYA 5GGQH 4LKCA 3O8XD 5JO5A 1S7XB 4N0CC 5I15L 3EOBA 5DGQA 4P49A 3PUCA 1JK8A 3V4UL 1T0MA 3GSUB 4I3SH 4TVPH 5B39B 4C4KT 3PWLA 4Y16A 2NX5A 3IAGC 1C16B 4KRNA 4JQVC 4XHQA 3RJDA 2NY3C 3W82A 1G0DA 4HIEA 2ITCA 1A6PA 3VWKA 1FZOA 5ABDE 1V3MA 1AIFA 4ODXA 3QFJB 2EE2A 4OCWH 1G7MB 2VR4A 2VTFA 2XTJD 3MRFB 12E8L 4R26L 5GXBB 4PV9B 5D1QD 4YHPA 3AVEA 5BJTA 2W9DH 5D1ZD 1PLGH 1FZMA 3B5TA 3BAEL 5KVFH 4I3SL 1QYGL 1FFNA 4Y5YC 5KSVA 4ACPA 3WKNA 1Q1JL 3I75B 4PD4K 3ECBB 3MBED 4KUZH 2W0FA 1ZEAH 4MNGB 5E1AB 2WV3A 4HFWA 5D6CA 3WYRA 5TE6H 1BQSA 1GOGA 4OV6F 2YPVL 3R8BB 5KG9B 3CVHB 2VXUL 2IADA 1ZLSH 1ZT4A 2OJZH 3QIUC 1T1WA 5IB4A 2BNRD 3GMRA 5J12B 5KSAB 1D6VL 1IKNC 5KVFL 3BVNA 2MPAH 5HYJB 1NDMA 1OGTA 4NC1E 1LQSR 4K7FB 1T1YA 2ITDB 1MEXL 4OCLC 1EO8L 5KVEL 1ZA3A 2F54A 1JGEB 3O3DA 5BZDA 4O2EA 4EDWH 1Z5LB 3V4VH 3GM8A 2GCYA 4F8TA 3WFHA 3K4ZA 3MLZH 4X5WB 4WV1A 5EOTA 1YMMD 4BK4A 1F8TL 1BOYA 3QUZB 2MPAL 4HXAL 1XCTA 3FFCE 3QIWD 3TVMC 1I1FB 3ARBD 3I02B 2YXMA 3SDDA 4ODSH 2IQAA 3D69A 3VXUA 3MREA 4P2OA 4F7CB 4PG9B 1CGYA 3VFWA 2LTQB 4LPXA 1IEBB 4QRUA 3AU1B 1A5FL 1CGTA 4JFED 3OKKB 2EDOA 3BN3B 3MLZL 2YD6A 5TQ0H 3H9HA 5DJ2B 1LO5B 4MCZB 5DR5H 3O3AB 5FKPB 3GSXB 4OBSA 1QSFD 4OSUL 4RQQB 3TIDA 3MFGB 1C1EL 5FB8A 1TTUA 2N7AA 1LO3L 1KULA 4PRNA 2YPLB 3GMMA 4OJFL 4Y4KB 1X5YA 4ZSOE 1A7QH 5FF6B 4QRPD 3WIFA 1VERA 5IJKA 4YPGB 1DVFD 3C8DA 5CZVH 3IGAB 5HHVL 3VFNA 3RIAF 4PJEF 3IFOB 4BZYA 4K55A 2X4TB 5EU3A 2XKUA 1GXEA 3NTCH 5HPOA 4DW2H 3N1MC 2VZTA 4ZAKC 5ESAA 4L8DB 1RAMA 1NMAL 2YMXH 1WAAE 4ZPTB 4JY6B 4OLUH 1WIUA 1BHGA 4G6JH 4RA3A 1JZ3A 1A7OH 3SCMB 3GMOB 1AY1H 2FSEA 1R3HA 1LWRA 3PV6B 4MDJA 2CRYA 2QKIA 4LAQH 3JV4B 3C2SA 2AK1H 5JHLH 5B3JF 1RMFH 2A6KA 3HI6H 5HYQB 4HPYH 1TTFA 3I6LE 3ESVF 3EYSL 4FZ8L 4LVNC 3EYFB 1I7ZA 4P9HL 4MS8C 4J8RB 4NNYB 4JVUA 3RX7A 3G5ZB 3WL9B 3L3HB 4MNQD 1AP2A 4IRSD 2AXJA 3SDCB 1A7OL 3BW9B 2OCFD 1MI5A 4YO0B 2C3HA 4U1LA 1A7RL 3O0RH 4U7MA 3TV3H 3WJJA 4LASH 2AVGA 4G8IB 1JPSH 2ZUWA 4M93C 4X6FA 3UC0H 3UPRA 4LAQL 4XGZB 2AK1L 2ATPB 5KAQF 1RMFL 4EJ1C 2MWCA 3KPOA 1J88A 1QLRB 4OF3A 1K85A 4NSKB 3F7YB 2NY2C 2KH2B 4WGWB 4KVNH 1F11B 4JFEE 5GJTH 3QRFM 2JELH 1KC5H 1UB6B 1ZS8A 5T1MB 4WHYG 1MCIA 3L7EB 3GSWA 4JO4H 3WHXA 4MD4B 2CRZA 4OCXL 1NFDB 2G9HA 5FA4A 2GK2A 4MMZC 2EXWD 5HI3D 3TV3L 1TPXB 4NO2A 3MOQA 3UZVB 1JPSL 4NN5B 3QHZH 2C4XA 2CLVB 2JJUA 1KSRA 1I9EA 4WEBL 5GPRA 1WEJH 3W11C 4L4TB 4PYHA 5EU6B 3FRPG 1QRNB 1N4XH 2DB8A 2BDNL 4XBEL 4PRHB 3QRGL 2AJZA 3MODL 4G8EA 4QRPE 3W0WB 2VDMH 4X7TA 2R2CA 3DVGB 4ZOCA 3KJ6H 4M4RA 5DD5H 1P4BL 3BH9A 5SX4H 4QRRA 5L2KB 4Q6YA 2BHZA 3CFCL 5ITBH 2QJDA 5ISZA 2BFVH 4NC1C 4IMKC 4L29A 4MQSB 3RI5K 3QHZL 3MLUL 4YHML 1KLGB 4GKSA 2VDKL 4GW4B 1MAKA 1AO7A 5BZWA 1MCPL 3KYOB 4JKLA 5DD3H 4EN3B 2X2YA 5DJ8B 1N4XL 3FB5A 4U6XA 5JHDB 5I66A 3VWJC 1IGFH 5DJ6B 1EEZA 1W0WB 2VDML 4M6OH 2Z8SA 5CFHA 3S9DB 2XICA 1HHIB 2IGFH 3KJ6L 4Q2ZB 1AGFA 4JM4H 1UXSA 5LKNA 1HXMA 5T1KB 1G6VK 5I0ZA 5ANMA 5ITBL 2BFVL 3VD9A 2XG4A 2IAND 4RGMB 4MNQE 4UUJA 4CU6A 2F19H 3Q6FA 1AR1D 1OAZH 5DD3L 3L5IA 2Y07L 3TBSB 4F9PA 2HN7B 3B9DA 2F8XC 5B8CB 2WLYA 3CVHL 4M6OL 1FO0L 1LMKA 1FZJB 2CK0L 4UOW0 4X6BA 4WI3A 1OQOA 1UEYA 1R5IB 4DEPB 1JRHI 3HE6A 4UQ2B 5TE4H 2HT2C 3X13B 2F19L 3MO1A 1YQVL 4MX7A 5SWZD 5CIPA 1ERNA 3ARPA 1U8IB 4NQSB 1KCUH 3SE9L 1KPUA 5DGRA 1TJIL 3CFIC 5BVJA 1G7HB 1J0JA 2YWZA 2HKHH 2BCKA 1QKZH 5INDB 1I8LC 4DUWA 4Z7NE 1ZHBB 3OKDA 1IILE 2SEBB 5F1SA 1SJHB 2FATL 1X4XA 2J5LC 3G6JF 4UOW1 3ZE0E 2N1KA 3ZHLA 1XEDA 1XF4A 2DM4A 5TE4L 4FFVC 5D71L 3FHQA 4KJWC 2MMXA 5F6IC 4X7SH 3ZSTA 2JCCA 2X4QB 1Q9KA 4MA3B 4OLYL 4JQXC 5J1TC 1EGJL 4JCMA 4NO0B 4G9FD 1CFQB 2HFFB 1TXKA 1M4KA 1DDHA 4OQ1A 5GRUH 5L6YL 4PGCB 3CFBA 4HKJB 4POZC 2ESVD 3R1GH 2VDQH 4EUPG 4WI7A 1J1PH 4G8FB 1HI6A 2EYSA 1IL1B 1PY9A 3CSYB 4LSPL 1T20A 5ACMA 4Y4HC 3MRQB 4JY5H 2GHWB 4EI5A 4X7SL 4P4KC 2HTKD 1JGUH 5D7JD 5LAXB 1P7QA 1QOKA 4LLWA 3RWCA 4NNXB 2R1WA 2I5YH 2AJUL 1X9QA 2GI7A 3Q3GA 1ADQA 4XB7A 2XWBB 5IVXF 4NRYB 3MCG1 1D6EB 3HPJB 5ETUA 1Q9LB 5IHLB 3ZT6A 4M7LH 2FECI 1S7WB 3JWDC 4KUCF 1MFBH 5DRWB 2VXTH 2DMCA 2Y7QA 4Y2DD 2AXGA 2FZ3B 1I3VA 5AWNH 4JY5L 5FYLL 5EUOF 5DMKB 5HHMD 4IRJC 4YK4C 2J88H 2I5YL 5HY9B 2ZG2A 1MNUL 1ORSA 1KIPB 5SWZE 4D9RE 1RZJH 3BRGC 2VR5A 4M7LL 3MRGA 2FL5B 1MFBL 4HQQH 1M7DA 1D5XB 4W68A 5F9OH 1F2QA 2F15A 4ZNCD 3QDJA 4K3DH 4BZ2H 3VWKD 3WFCL 5AWNL 2D7OA 4PJDF 5TH2A 3HUJE 3ULVH 2ENYA 2OZ4A 4P5KB 2C5DC 3E6FB 1FSKB 1I7TA 1FFRA 3D2UD 3P9MA 3T1FB 5EU4B 4CN6A 3K80A 3NCYS 4WWKC 5HGDB 1F5WA 2X09A 1U8LB 1WCBB 4Q9CA 1AGCA 5HHQB 5D6DA 4MAUH 2NXZD 3D0LA 3K2UH 3CCHA 4K3DL 1NUNB 1UJ3A 3ULVL 3T2NL 1BZ7B 3BQUC 4LBEB 5ADPL 4YIQB 3PQYD 4C59B 3OR7B 1JGVH 1ACZA 5GGUA 5BS0E 2BNUB 4KTDH 3SJVA 4Y19B 5J57B 5BO1L 2OSLB 4J23A 5DMIH 3I84A 3RKDD 3T65B 3DROB 2XZQH 4OD1H 2BSTB 2AV1B 3K2UL 2F54D 1X3DA 4YBQD 3AAZA 1KJVA 4KK9C 1BZQK 2D03H 3X3FL 3V0VB 4CVUA 1OSZB 5BVPL 3O3BB 3LMJL 2H26B 1SBSL 4JFYA 4JGMA 5C0CE 5LWYH 3SBWC 2P49B 5ILTH 4JFDE 4NKIL 3WFBH 3CK0H 4WO4B 5HHME 1NBZB 3B83A 4KTDL 1KGCE 4NRZA 3QUXB 1AI1L 4NWUL 4LK4A 5JW3L 5DMIL 4YJZL 5IVXA 4HUNB 4LSUH 2WM0A 3OKMB 2XZQL 3ZKSD 3U1SH 3VXUD 2R9HD 1TNMA 2V9TA 5IUSA 2NX5E 2P5WA 2AK4D 2D03L 4M5ZL 4S2SB 1ZHLA 3KNBB 1PBYA 4OM1H 3I9GL 3GBMH 3VXSD 3VFTA 2H6PA 43CAA 4I18C 3VGGA 3SPVB 3CAFA 1CFSA 5E2JA 3CK0L 3B2VL 5MEQA 4R8WL 4K94L 2FEEL 5J6HA 1ODAA 3MFFB 5D93C 3GFUA 1MCOH 2MQ3A 3FT4B 5E1HB 3OKLB 3WLBB 4LSUL 1C12B 3T4AA 3IDMA 1Y18B 4HIJB 1ZT7B 5IR1A 3E6HB 3U1SL 3QIUB 1HNGA 4O4YL 2YC1B 4DOHB 3M8OH 1A64A 4CMMA 1YJDL 1IKFH 4RNRA 2Z93A 4PJDA 2I60L 3JTTB 2VDOL 4Z7OF 1P84K 3EDDA 3BI9X 3N0PB 2DWDA 2FO4A 3S6CA 1MFDH 5TDNA 4CVXA 1I9RL 4KJPC 3HFMH 1BFOA 3HRZA 1IC4H 5K93A 2EDYA 4K7PH 1Q8MA 4LNRB 5I1EL 4YXHH 2BP3A 1KLUB 2L4OA 4YWGL 3TZVB 2FHFA 3TVMB 3G5XA 1EZVY 4S11A 4L8BB 5F7EH 2GJZA 4QHUA 2F53A 2F54E 4IS6B 1YA5A 5DS8B 4CU7A 1BF2A 2A74A 5KAQG 1TCRA 1NC4A 1MFDL 2FLRT 5K9KA 3FOLB 3SGEH 4HIIA 5IB1B 4HXBL 4NYLA 4D9LH 2J6EA 2N56A 3MNVB 3ARDB 4GAGH 3S36X 4WENB 1IM3A 1MI5D 1RUQH 2ATKB 3RGHA 2I9LA 5A40E 4O58L 3QULB 5HHOD 2KUTA 3GSOB 1G9EA 5DO2C 1A2YB 1AFVL 2GY7B 4S1RH 4WY7H 4QKXB 2PYEA 2APWA 3P9WB 1YZZA 3O4LA 3LB6D 3U4BL 5CEZL 1VFOA 3OWEA 4YHYC 2E6QA 3EYVA 2OK0H 4HH8A 1S3KH 1U42A 1CDCA 5C8JA 4PIRF 5ENWB 5DTFB 2V2TA 4WI8A 2JIXA 4ZAKB 4A6YB 2D7NA 1YNKH 4TSBH 4S1RL 4WY7L 5IHZB 3NN8A 3RWFA 1YUHA 1CR9L 1FNEB 4HT1L 2AJSH 1TMCB 2UYLA 3K74B 5MERA 3O2DH 1U93B 3WD5L 3UJTH 2A77L 1TZGL 5F7LB 1OTUD 3VE0A 1DBKL 2EO9A 2OK0L 3C9NB 3NZ8B 3KPPA 3PWUB 1MHHA 4WUUB 5EO1A 1S3KL 5GHWH 2FHCA 4QRRD 4GMSH 2CMRH 1CFBA 4LVNB 4L5FH 4K3EL 4XNUL 1KCVL 5LQBH 5ISZD 2BRRH 1YNKL 3QFDA 1M7XA 1WFTA 1UQSB 4TSBL 2HVKA 4LIQE 4ENED 2IFFH 3FRUA 4J2XA 2AW2A 3PP4H 3NA9H 3MRJB 3P4NB 1KPRB 3H42H 2B4CH 3MV8B 3OJDA 4MJ5A 1I7UA 5H2BA 2ZUTA 1ES0B 3DIFA 4NZTL 1OAQL 4UB0H 3BPCA 1OW0A 4GMSL 2NY2B 4U1SA 4CL7A 3MA9L 4OKVB 1HOCA 4PJ9A 1CLOH 3P4LA 5DA0B 4H8WC 4MHHG 5SWQA 1MWAA 1JWUA 1JHLL 1MI5E 3QH3A 4OLVL 4HHAB 1K6QH 4Y16C 1RIHH 4FG6C 3W9EB 2APXA 4NUJA 5T33H 4OLEA 5EB9A 4RZCA 1RJLA 4HMEA 2HFTA 3JVGC 4LLMA 3ZT5A 5DUMH 1H3PL 3QEGH 4XVJH 5FA3B 1JGDA 1QHOA 1INDH 4S1QL 3UTPD 3BT2H 4NKDA 5IF0B 1CLOL 3Q1SL 1OQXA 3B5GA 4PJCF 5T3XH 1XGQB 3S7GA 4G6AD 1KB9K 4FQXC 1QSEA 3U0PB 5C0JA 3MRCA 3GMPB 2O5XH 3FHAA 4PGJA 1MCNA 3U30C 3HG1B 1UZ8B 4HWUA 4UINH 1B3JA 1S7QB 3DRTA 1YN6B 3VWJB 1MCCA 3MRBB 2X1PA 1INDL 1FLRL 3IDGB 3BT2L 4FTVA 4LL9A 3OHXA 1Y0LA 5ICXB 1NCAL 5T3XL 4HZLA 4QRRE 3TP4A 1CE1H 4NP4H 5ISZE 2XACC 3M1BA 3HB3D 2L0DA 1U8PA 3OXSA 2J7LA 1KTDB 4TUJB 1AO7E 3OF6D 5GGTH 4NBYB 4S0TD 4OF5A 4X99A 3IFNL 4C83A 4KXZH 2ADGB 1KIUA 4YHZL 1CDGA 4OZGF 3DJ9A 5CEXB 1FL5B 1WGOA 5IEHB 4KKCD 4EI5D 4J4PD 3MNZB 4WV1C 5DD1L 1TVBA 4K8RD 1A9BA 5SV3A 1L0QA 5D96C 5ANME 5GISL 2IQ9H 5E2UH 3MRDA 1JJUA 3O11A 5E2VH 3M45A 4U6VL 1XGTA 2WAHA 1I8KA 4EVNB 4OM0L 2QQNH 3QXDB 1UG9A 3S4SB 1O7SA 2CDEB 2K7PA 2YSSA 3HTLX 5EZJA 3D1MC 3OV6A 3WNNA 2FX7H 3L3JA 1T83C 1PFCA 4K9EH 5E8PB 4QHNA 4BFIB 3U9PH 2NY5H 1IGYB 3M17A 4O2CA 4KROC 2J5LB 3TNNA 3PIQA 3B6SA 4M02A 5E2VL 2W38A 4WTWA 3EJZD 3TESA 5F6IB 1BQHA 1IGML 2DQDH 4JFXA 3MCKA 3WDHA 5DEFA 4EBQH 1N6VA 2V9QA 3SO3C 3MLTA 1MY7A 3RQ3A 5I30H 3SGDH 2X4NA 1NEZB 5IJKC 2NTFB 3QDJD 1I1AA 1MRDH 4GKZA 2EIZB 1S7TB 4JFQB 4ZO6A 3C5ZD 3QZWB 4PJCA 4L1DA 5IMKA 5D2NA 4M61A 4Y4HB 3GMNB 5KW9H 4X7CC 3CXHJ 3H0TB 3QG7H 5IB5A 5TF1L 1HH6B 2E7CA 3L5XH 4JPVL 5DHVA 5F7DB 3O9WA 1ZLVK 1MPAH 2A6IB 2CLRA 2XA8H 5D4QA 1MFAL 1MRDL 2C3VA 3KXFA 3PV7A 4LSVL 3BHBB 2VLJD 5FUOH 4AIZB 4EEEA 2DQTH 5HGAA 2CK2A 1IGCL 3NMEA 5CD5C 1T5XB 1QFHA 3HN3A 3RY6C 3QG7L 3SJVD 5E70A 1E4WL 4HFUL 2VQUA 2DQUL 4H0HB 4ZUVB 3L5XL 4GRWF 3V6FB 4YK4B 3WJJC 3MJGX 4NNPH 4NQUA 2X4SB 5DVOA 5IK3B 4WI5A 4OZGA 2HMID 3EOTL 4PPTA 4GAJL 3R0NA 3HNSH 1BJ1J 1H15A 2BSSA 2IF7A 5EUKA 2DJSA 5GSRA 4PJFF 4Q9RL 3HI5L 1A7NL 4QRTA 1T22B 2JTDA 4O2FB 3RTQA 5IB3B 1H0DB 3QDGB 2VQTA 3VGBA 4WHDA 1UM4L 2K1MA 4ERSH 4WWKB 2XQYK 3WJLC 4HG4J 4HGWA 1RK1A 2P5WD 1FV1B 2ZUQC 1F45A 5HI4C 1CLZH 2GTZB 3QDJE 1N2RA 3WS6A 3NPZB 6CGTA 1UWGL 1PGRB 2A6DA 3BZ4B 2R0WL 1MRCL 2PXYA 4Z78B 2DDQL 3S37L 4XNMB 4OLXH 3B4NA 3BQUB 1MAJA 1IGIH 5CGTA 3O6MH 3TYFA 1ONQB 2EDXA 1QPXA 2HTLC 4ERSL 3U83A 1DN0B 1ND0A 1HIMH 2XI9A 1A0QH 3REWA 4JJ5B 2GK0A 5C86A 3ISWA 43C9B 5CSZA 4PR5B 3D87B 1CXLA 3JWOC 1XR9B 1I4FA 1C8PA 1JPGA 4HSQA 1G1CA 4P2QD 2ZCKL 3QQ3A 3MV7B 3SOBH 2DS4A 2V5RA 1I1YA 1IGIL 4NJAL 2XFXB 3QDMA 4P3CH 1MLCB 2A9NH 1NGWA 2VNCA 4ZS6C 4ZD3H 1S9VA 1G9NH 3SJVE 5BCAA 4EXPX 2ICWI 3CFEB 1HN1A 1ZSDA 3MMEB 4H88H 4YXLH 4M00A 1FCCA 1WZMA 5DDHB 3MLPA 4X83A 3L3KA 2EYTA 1TQCC 5A2IH 4WIQA 2JB6A 3LRHA 1NC4D 3O6KL 5GGRY 4KKAD 4KI5D 3B9KA 5IB2B 3HE6C 1NC2A 5DMGD 3QPQC 4LLDB 1JZ6A 2EDDA 5C0AA 3VRIA 3KDMB 4XXCC 4PTTB 4I18B 3MUGB 2BHUA 1RHHB 4U6YB 2DYPB 5IVXE 2Q8AL 2X4OA 1T5WB 5D93B 4Q58C 4JDTH 4W4OC 1GGIH 3EOAB 1LNUB 1NAMB 4FQHA 3LCYA 3O4LD 2R2HB 2FJFA 2P5WE 3WFDH 5E8EB 1E28A 1MIML 1MAMH 2ZP0T 4MLSA 4XXDA 1AD9B 4FA8A 4PJFA 3UMTA 4HPOH 2PW1B 4TNWK 3TIEB 2B1HH 4YHNB 3RY4A 2JIXD 1EV2E 1WIPA 2B4CC 5D1XC 2VLLB 1OT2A 1EMTL 1QLEH 3QWRA 1A9EA 2EDLA 4WU5A 4NKMB 2J8HA 5IT2L 1BBJB 4Z7WA 2DQCH 1ZHNA 4BQ6A 4QNPE 2JJTC 2WWMD 4PJDE 4PBVC 1S9YA 2DBLL 3L3OA 3P30H 4PJAB 1K9TA 2BXZA 5F9AC 2UVEA 2B1HL 4FQIL 4ZS7L 3OX8B 5F6HI 3ULUD 1MRFH 3EJYC 3BH8B 3IDYC 4MXQD 4RFEA 3NACL 2AQ1A 3F62A 3F8UB 1QLEL 1Z3GL 4JFZL 4LLYB 4F2MB 1FYTA 5EIIB 4JKMA 3L1OH 2CIIA 4ONHA 4ZUUA 2NYYC 3NFNA 5IW3A 5DFVC 2F53E 5DJAB 3H2WA 3IKCA 2RIKA 3T1WA 1OM3H 3X14B 4JRXA 3SKMA 2VB5A 4ODWB 1FFOB 3DURA 5IHBA 3OG6B 1IAKB 4HIHB 4XVTH 1T03H 1MRFL 4W81A 5L88H 3BPNC 2HRPH 4U1KA 3MXVH 4YHIA 1XGYH 4OQTH 3JWDL 3QUMA 2NXYD 1I9JH 5IM7B 5DXWA 1R6VA 1OTTC 35C8H 5DRZA 1N26A 2PYEE 5D5MF 5AYUH 1G7PB 3O4LE 3ZDYF 2D9QB 5DLMH 2VE6B 1XF5B 1Z9LA 4D3CH 3KPMA 4UU9A 1RVFL 1EXUB 1G0YR 1KN2H 3AUVA 1UH2A 4XWGH 4XVTL 1T03L 3GSVB 5HYSB 5HD8D 3A6CH 3KPLB 2C1PA 4IIQC 1S9XB 4EOWL 4OCRL 2FCBA 1NGYB 4CNIA 2DOCA 3MXVL 4DKEH 4JKKA 3T8XA 1F6AB 2A6JA 1QSED 3GUTB 1KYOJ 2W07A 4Z0XB 2PTTA 3O3EB 3CLEL 1VKXA 2DJ4A 3UTSB 1BVLA 2W0PA 3ILQC 1BBDL 3QWOB 35C8L 4QHMB 2DTSA 3VXRA 3Q0HA 4CVZB 1IFHH 1SYVA 4G6KH 1YPZF 4NKQB 1KN2L 1F4XL 2DLTA 3C6SA 5F89B 2H3NA 1FNGA 2FB4H 4FTVD 1D5BB 2X89A 3A6OA 1U0QA 3A6CL 5DJYB 3KPSA 4P23D 5DYOB 3VDCA 4AL8H 1VSCA 4DKEL 2N4IA 5DURB 3ULUE 3S34L 3CDGB 3WIHL 3MR9A 1S8DA 1N5YH 1QVOB 5HVHC 4KK5D 5ALBH 2KKQA 2IPKB 2H9GB 1IFHL 1U3HA 4P2RA 2GSGA 1J8HB 1V7NL 3EHBC 1I3RA 1PG7W 2I25N 4NM4L 1HXYA 3QPXL 4Y8AA 3TO4A 4IBLT 4GRLC 4K3GA 3MV9D 5HI5C 3OR6A 2IMMA 1BZ9A 1U8JB 5JW4Q 1L6XA 4EI6B 2EDKA 4B50A 4AL8L 4PBXA 3DVNA 4JFOA 2CDFB 4PP1D 5C0BA 3GSNA 5JTWA 2O61B 2UZYB 4OAWB 1KNOA 4QXWA 3GK8L 2I07A 2DTML 1N5YL 4ZFFA 4HS6B 2ZOLB 5ALBL 5MEND 4GW5B 1ZMYA 3VFVA 5JMOC 3LQZB 2G2RA 4FQXB 5ID1B 1CI5A 3S3PA 1M71B 1WFUA 3EIFA 1AKJD 9CGTA 3F5WB 3VA6A 4D0BB 3GHBH 2YEZB 5DZLA 2Z0BA 3MV01 4OZHB 4O51B 3OXRA 1HHGB 3QEQA 4RGOH 3U30B 4H26B 3RVTD 1FORH 1EFXA 3GSQB 3TN0A 3RVVD 3O6LH 1KJ2H 3MRIB 3S96B 2HFGL 1AXSA 3BP7B 4JZJA 2QR0B 1PQZA 2HVJB 1T7WA 1I1AD 5D5MA 4K2UH 4F37F 3X12B 4AY0A 1AHWA 3GHBL 1E6JH 4Z7VA 4PJXF 1UYWH 4N90D 3NFPA 2MCG1 3JTSA 2Q76B 3MRMA 4M7JH 1OOAA 4UIMA 3TCLA 2IJ0C 1UA6H 3IU3A 1VFAB 1FORL 4L3EB 4FTVE 3B9AA 4MAYA 2E7LA 4PB0L 3ARRA 5TDPA 4PRBB 3HC3L 1K2DB 5FAAA 5DFWH 4G80B 3O6LL 4D0DB 3BZEB 6FABL 3HNTL 5D96B 3LHPL 3O9WD 3BZDA 3VJ6A 4RMRA 5TJWK 4LEOA 5E9DA 4WEMB 3LV3A 1R3IL 1FNSL 1UYWL 4I4WB 1KIQA 4R4ND 1X5IA 5FXCH 1HHHA 1WT5A 5E08L 4G43A 2UWEB 3QR2A 2HJKA 5JDSA 4KQ4L 1C5CH 5FYKU 3WIIH 3L5WA 1N5AB 5EH1A 4X8JB 3TWCH 1JTPA 4FFYL 2OR7A 3D39B 3DMMA 3D0VB 3L7FB 1DEDA 3HR5B 2EH8H 2VLMD 3U4EA 3MGAA 4ELKB 4P5MB 5LGJB 3SO3B 5C08D 1OD9A 1D5ZB 1FDLL 4XB8A 4R7NB 4UBDC 4WW1A 3BO8B 4JKWA 3UX9B 1JNNH 3QJFB 3OAYH 1J0YA 25C8L 3ZE1F 3FQXB 2P5EA 3QXAA 2OTWA 2BVTA 4DVBB 5MP6H 3NAAH 1YN7B 4IOIB 5F1IB 5I1JH 2FX9L 3TWCL 1BD2A 4JHZA 2VLRB 2MQ0A 4XH2B 1EUTA 3NIFF 2EH8L 3LS4H 4WHYH 2PETA 4LGPB 1A6WH 3I3BA 2DICA 4GLRH 5I76B 3MRLA 1S7VA 1MCEA 3JWNC 1WBZA 4XTRD 3H9ZA 1YY8B 2EKSB 3CVIL 4XP4L 1F13A 1URLA 4I0PC 5GS3A 2XOTA 2ZCHH 4PJCE 5D2NE 5MP6L 5BXFA 3VCLB 1U8QA 1U92A 5I1JL 1YY9C 1KJ3L 3DXAA 1CICA 3LS4L 2WBJB 3BP5B 1H3WM 5I17A 3D85B 1RV6X 4DAGH 2XTJC 1YEEL 4PJXA 3KXFE 5E6ZA 5E8OA 1G7QA 1VADB 5D9SB 3V6OA 3P4OA 2OJEA 4F33A 2YUZA 5CUSH 5BRZA 4J7RA 3DUUA 4XCEA 1XGUB 2ZCHL 4FQPA 3RWJB 4UMGA 4PJ9C 4ZPVB 2CKBL 2KZWA 4OZ4B 2F9BT 3MBEC 3PGDB 5A16B 1M6OA 1RZGB 3T77B 3KLHD 4NN7C 4HUXB 4MXWH 3JSSA 1AH1A 2FJHB 2VAAA 4LPYA 1F90H 1KJMB 4UTAH 1CG9B 1JF1B 1QFOA 1LE5B 5DUPH 1S9WB 2OL3B 2VLME 3VH8B 1LEIB 2ZOKB 5DWUH 4OZGE 1MHEB 4PJ5A 3WUZA 5K33A 1JWSA 4U1IB 1L0XA 1A4JB 4YE4L 5EC1A 4FZEH 5JW4R 5C0AD 2R29H 5IQ9B 3WXWL 5KANG 3S36H 1N6UA 1A1NA 3HZMA 3QCUL 4MZ3A 1XT5A 3CUPA 4PRPB 3BJ91 3DX7A 2QSQA 4XMKH 2DQEH 4FMKA 1QFWI 3KPRB 1A47A 2IPTH 5F9JA 1QBMH 4JKPH 5D7SL 1VPOH 4N9OB 5FYJU 1J0ZA 1B4JH 1G7JA 1TJGL 4PJEB 5BW7A 5BV7H 2V5MA 2R29L 3S5LB 3RVXD 1PG7X 3W5MA 5ACZA 1BECA 4OF7A 5DEZA 1A6AB 3BIKA 1U95B 3DUSB 4DK3A 4P3WA 5I19H 2OX5A 5GRVK 1OGAB 2FHBA 1K8IB 1EIBA 1PYWB 1HSAB 5BQ7A 3QWRD 4XMKL 2FYYA 3JXAA 5J4MA 1V3LA 4GUPB 2B1AH 5EWIL 3DO3A 1VPOL 4AEIL 4HW6A 3OJ2C 4TNWF 3AMLA 4QHLB 2P8PB 4TYUA 2Z9TA 4XI5D 3LH2L 2NW3A 4L3CB 2XZAH 4G8GB 1TQCB 2FNBA 1BLNA 4H5SB 1DUZB 3QDME 4EUPH 2YD2A 4O02H 5I1LB 5J6GA 3V6ZB 4U1JB 1FYTD 4MB5A 5I8CA 4U3CA 4Y7MA 4XRCA 5TPWL 1AXIB 4UDTB 4S1DD 2Z92A 4AMKH 3RGVA 5F7HA 1AXTH 4I1NB 4JRXD 4LLUB 4L4VB 1DSFL 2XZAL 3A6BH 3F12B 3DPBA 5IFAH 5JPNB 3D9AH 2W60A 3TJEH 3V0AC 3X3GH 2W9LA 5C0AE 5IQ7L 2BMKB 2WUBH 4O02L 1F58L 4FMFA 1EJOH 4OFIA 4GRWE 1A6UH 1S7XA 3EYOB 3RVWD 4NQVB 3P4MB 5FGRA 3GSUA 3IF1B 1BF8A 5JIIA 5I2IB 5IWLA 5B39A 3Q5OA 4G42B 1BREA 1HQ4B 5D1XB 3RL1B 5DD0H 4ZDHB 1C16A 1KFAH 5F1NB 3D48R 4MXVF 3MA7B 4S10A 1I8MB 3A6BL 4RMSA 5IFAL 2X1XR 4Z77B 4PJFE 3QFJA 3CXDL 1OSPH 1G7MA 2WUBL 4MNHB 3D6GA 1EJOL 3MRFA 2WWKT 3BN9D 1C7TA 4PV9A 4LIQH 1D9KD 2V2XB 1QACA 3CFKB 5GZND 4FXLA 2NQCA 4RAUB 3RDTC 3IDYB 1NPUA 2YA1A 5D7LD 1LO0H 4WFED 1F3DH 4D2NA 3I75A 1KFAL 4Z7WE 4PLKD 5JOPE 3ECBA 3V2AR 4NBZB 2CR6A 4PRAB 4MNGA 5E1AA 3THMH 2PR4H 2VITB 1OSPL 3VRJB 2J4WL 1LDPH 4M8QB 1RY7B 3QO1B 5KG9A 3CVHA 4XBGB 4UNUA 1MREH 1T3FB 3O3UN 1Y6KR 1KIRB 3W2DH 4HULB 5KSAA 2M2DA 3F58L 3KAAA 5HYJA 1VA9A 3BPNB 1FYTE 2X4RA 4K7FA 4P2RD 1W72B 5F1OB 2ITDA 4KMTH 3MJ9H 4MA8H 1HDMB 3TO4D 1JGEA 2A0LD 1Z5LA 4JRXE 3HHRB 4YGVB 1AGBB 1LDPL 3C60A 4BSVB 1JPTH 3VI3E 5C0BD 4X5WA 1CTOA 5D7IB 2IWGA 3RTQC 3FN0H 4E9LA 3W2DL 5J06A 1IGTB 3QUZA 4DUXA 4IIQB 1ZGLB 1I1FA 3I02A 1T6WA 5E8DL 4KMTL 2NNAA 1F3RB 4F7CA 4PG9A 1EGJA 4WFGD 2JB5H 2BX5A 1J1OH 4ZFGH 1IEBA 3AU1A 3I6GB 3OKKA 4MMXC 5GGRB 5FOBB 4NT6B 3VFRB 4ODVH 1Q0YH 4DGVH 4M1DH 1JPTL 3G6JB 5DQ9B 5E7BA 3BX7C 5DJ2A 5L8LB 2EXYD 1EFXD 1RURL 1LO5A 4M1GH 4MCZA 2OLDA 3O3AA 3GSXA 5FKPA 1H3VA 4PJBB 3FO0L 4M9OA 3UYRL 4RQQA 1WK0A 2OL3L 4TULL 4WW2C 5CMAB 4I9WE 3ABZA 2YPLA 4OZIF 3GNMH 4Y4KA 3VXRE 2IPUG 3RWIB 4WFEE 5FF6A 5HVHB 4X4YB 4Q6IC 2XV6B 3GI8H 4YPGA 1X4YA 3IGAA 5JPMB 3IFOA 3BE1L 1JRHL 2EO1A 2X4TA 1ZGLP 3T0AA 4LSQL 4MAYD 3E2HC 5D70H 2DQHH 1PVHA 3KPSE 4GRLB 4L8DA 4FQ2H 4CBPA 4XPFH 4P57B 2MTPA 3NABH 4ZPTA 4JY6A 3SCMA 5KTEL 2UZIH 4X4MA 3GMOA 5E9DD 5I8EB 2NY0C 2FRGP 1EHAA 1WZ1H 4KKBC 1YEJL 4HJJH 3PV6A 5GS1C 4NKOB 2HT4D 3JV4A 3GI8L 5HYQA 1CF8H 5B4MD 4LVOC 3ROLB 5ECJE 3EYFA 1LP9B 5D70L 5DJ0B 5EUOB 4NNYA 3UBXI 3TBTA 3FKUS 3G5ZA 4XC3L 3CZFB 1OAUL 1TVHB 3ZE2F 3WL9A 3L3HA 4AT6B 5CIPH 3NABL 4N8CH 4HC1H 4FQ1H 3SDCA 5DMJB 2UZIL 3BW9A 2BNQB 3DMMD 4MCYB 4Y4FB 4ZUSB 4ODHH 5KOVC 4YO0A 4AT6A 4G8IA 1MCKA 3CXHK 5HGBB 4XGZA 4KJQC 2ATPA 2HLFC 4PLOB 1J12A 2GFBB 2HTKC 1QLRA 4M5YH 4XCCH 4NSKA 1E0OB 1FNHA 3F7YA 2J8OA 4R4BB 4WFGE 2IH3B 4ZOAA 3TEUA 5LGHL 3QEQE 1U2HA 1UB6A 2P5ED 5T1MA 4D8PB 32C2B 3L7EA 2FH6A 4AEHH 1FVCB 4MD4A 4YDVB 1DQQB 5I75C 1NFDA 2NY6D 1BD2D 1BX2B 4Y2DC 4ODHL 4U1MB 1VGEL 4FRWA 3C5JB 1ZLVH 4X98B 1Q38A 2FECL 1DQDH 2CLVA 2QSCL 2DKMA 1I7RB 4L4TA 5D5ME 5EU6A 1KN4H 4XCCL 4OBRA 4LGSB 1QRNA 2RBLA 3GJEB 3ZDYE 1IC5L 4PRHA 3TCXA 3W0WA 3DVGA 1G9MH 1RZIB 2GJJA 1Q9OB 4K8RH 2QADD 4I3RL 4M7ZC 5L2KA 1ADQH 2XTLA 4JO1L 4LSDA 1SJEB 4HEME 1CICD 4TNVK 4H20H 2IBZY 5CD3B 5D2LB 1GIGL 1KLGA 2YD4A 4GW4A 4EN3A 3KYOA 5DJ8A 5E9DE 2VLKB 3R06B 5IMLB 5DVMA 4BELD 5JHDA 2NY1D 2MCPL 5JNYA 5DJ6A 1W0WA 5BRZD 5CILH 4HG4K 1HHIA 5B39G 4Q2ZA 4WJ5B 4MQXD 1X7QB 1I3GH 3ARGC 5DJCB 3U48A 2ZJSL 4KAQH 1X44A 2G60L 5DUBB 1TZHB 5T1KA 3MGTB 4PGBB 5F88B 3STBA 3QNZB 2A83B 5B21A 4JN1H 3TA3C 4XX1G 3BGAA 4QLRA 1U58B 4HUMB 4UT6L 3T04D 2YA0A 5JOFB 4YH6A 4KRPC 3TBSA 3QB7C 5HDQH 4MVBC 2HN7A 5B8CA 4EKXA 4LRNH 1BWWA 1NJ9B 1X5LA 2CO7B 2D3VA 1FZJA 2C1OB 2OZ4H 3UTQB 4KI1A 3KR3L 1JV5B 3WO4C 4DKFH 1R5IA 3O8XB 4FFZL 4DN3L 3RKDC 3CLFH 2PO6C 4UQ2A 2P5EE 5JXEA 1W72L 4HCRH 4JN1L 3X13A 3O2WH 4I0PB 4CDGC 1SY6H 1PX3A 2VRAA 3IDJB 2JKXA 3ARFC 5A2FA 1NCWL 1U8IA 1B90A 4NQSA 3ORJA 1FHGA 1QTYT 1HINH 1G7HA 2W0KA 3U4AA 3EGSB 4ETQB 3KYNB 1E6OH 4Z9KB 1ZHBA 1HYSC 2SEBA 5C0NC 1YNLH 1SJHA 2XTJB 3BKYH 3VXOB 2CUIA 2EECA 4X6DB 3B8SA 2FBJL 4ZFOB 4YQXH 5F7MC 4YFLF 2AI0L 4LCCC 1LD9B 5D1ZB 2X4QA 4U1HB 4MA3A 3K2MC 1JF5A 4M03A 4NO0A 5I9QC 1KCRL 1CFQA 4RFOH 2HFFA 4J3VA 3DXAE 3CX2A 1Q94B 3MBEB 3OGOE 4PGCA 4HKJA 3IJHB 4XNXH 4MD0B 4WFHD 1NLDL 1FBIH 3G5VB 1E6OL 4PJXE 4NN7B 5CP3A 1YNLL 3V6OE 2CPCA 4G8FA 2F5AH 3EBAA 4PV8A 1IL1A 2VKXA 5TE7H 3CSYA 5BRZE 4YQXL 3FCTB 3MRQA 3OZ9H 3TT1L 2HLAB 2BNRB 5KVGH 3V8OA 5LAXA 1HEZA 4NNXA 2IPUK 4QTIL 5FEBA 4OI8A 1MHCB 5IHUL 3TYGL 2XWBA 2H1PL 4NRYA 2R69H 4HUKB 3WKMH 1D6EA 2QQLH 3HPJA 4XPHH 2O5ZL 1Q9LA 3RGVD 4KKLC 1S7WA 1T2QH 4Y1AB 1UWEL 5DRWA 5J56B 3DVFA 2FZ3A 3K8LA 4PJ5E 5IP4A 1YMMB 2APTA 2JE8A 4OF6A 4OB5H 3RU8H 5KVGL 5DMKA 2NY7L 2X6MA 1L9MA 2Q3ZA 3SGKA 5FM5M 3QIWB 5HY9A 2ZUUA 3NCJL 3VFPA 1CGSH 1FIGH 5JXAH 1KIPA 3FO1B 3R0MA 3LQMA 5FCUL 4GXVH 2QQLL 4XPHL 4Y5XB 2RCSL 4G5ZH 1I3UA 3IJSB 4ZFZB 2FL5A 1NL0H 4GG6B 4HS8H 1D5XA 5KS9B 2EIBA 4JQIL 1P7HL 3HMXA 1MSPA 1N7MH 1OB1B 3QUYD 3V52H 3MV11 3WSQL 3EDFA 1GC1C 1JI2A 4QTHB 3ZE1E 1EO5A 4HGMA 1PKQB 4P5KA 1C5BH 1QSFB 4X80L 3E6FA 3HAEB 3T1FA 5EU4A 5HGDA 4NZDA 1T7XA 3OBAA 4ZNEA 1XIWD 3NIFE 1T7YA 5F96H 1J0KA 3WEXB 1U8LA 1WCBA 1LO2H 5AG8A 5HHQA 3MOBH 3PWPB 4WFFD 3PGCB 2Y6SC 2YA2A 4WFHE 4DGIL 3MNWB 4FFWC 4PJHB 4NQXB 4M3KB 4KZDH 3T2OA 1BZ7A 4LBEA 4ZXBC 4YIQA 2GQHA 2J6EH 3OR7A 4F7PB 3HR6A 5KSAD 1AR2A 2BNUA 4Y19A 5M94B 5I1HL 2K7QA 1OTUC 2XZCH 4NM8H 2OSLA 3I50H 3S35L 1GGBH 5LCVH 3T65A 3DROA 1LO2L 5FYJE 2BSTA 3BDYL 2AV1A 3HNVL 3QCTL 5L8JB 1KYOK 2NZ9D 5I1GL 3B5HA 2W59A 2VSDA 3V0VA 1OSZA 3C60D 3O3BA 2H26A 5IMMB 4I8DA 4JQVA 5KVDH 4LP4A 3EYUL 1L4IA 3QUZD 4HJ0C 1NBZA 4WO4A 3QUXA 2Q3AA 2Z91B 1GGBL 3LRGA 3OKMA 2PN5A 3DSFH 2QBWA 1U3YA 1ULVA 3CFJB 2X4PB 1R0AH 4JO3H 1PDKA 3RDTB 1ZAGA 5DD6B 4JB9L 2EC9T 4S2SA 3CH1B 2P46B 3KNBA 2COQA 1FP5A 1EX0A 1G6RB 4YFLI 1IBGH 1JUFB 4C56B 3KGRA 1A14H 2YUVA 1MY5A 3QFJE 3SPVA 2B0SH 2YUWA 3ULUH 5IBTH 3MFFA 4HKBB 1SEQH 1NFKA 3FT4A 4J12A 3OKLA 3WLBA 1C12A 1Y18A 3ET9F 4P46C 4HIJA 1MJ7H 1ZT7A 3E6HA 3QIUA 3DUHA 1GSMA 4Y4KD 5I16B 2KPNA 4P4RB 2YC1A 1NCTA 2VN7A 1FAIL 2X4UA 4WFFE 5ALCH 3JTTA 1IBGL 4MNGE 1LK3H 3UAJD 1WC7B 2B0SL 5KVMC 5JIKA 3GSRB 1T6VN 1L0YA 5IBTL 3TT3L 5F7YC 5IJVB 1JL8A 3MJ8B 2DIAA 3PNWB 1MWAH 5FYLD 2W65B 4KQ3H 1FJ1B 3SDXB 4LNRA 5L0QC 1AE6H 3SCMD 5HYJE 1KLUA 1I85C 2J8UB 1MH5B 4JM2F 1JCKA 4HH9B 4U7SA 2XWTB 4M7KL 3IXTB 3U0WL 3TVMA 2GSIB 5DHYB 5CJQH 4I13B 2Z8WC 1KCLA 4L8BA 4U6TA 2ICWB 4G7VH 4PJIF 2VJXA 4XPAL 4IS6A 4PUBL 1MJUH 5DS8A 4HUWB 5EZOH 1RZ7L 3C5SB 4LCIH 3HB3C 2VAJA 4P99A 3B3IB 3MLWH 3FOLA 2I27N 2IANB 4D9QD 1HKFA 5IB1A 1MWAL 2Z31C 2E6PA 3MNVA 3ARDA 3SDCD 1AE6L 5H8DA 5IEKB 2ATKA 4HKZB 3SDAC 4CGTA 2VN4A 3QULA 4KKCC 3VXQB 2OXHA 5CJQL 3GSOA 1YEKL 4WW2B 1A2YA 2ZSVB 3NZHH 3BD3A 4G7VL 1S78D 2YR3A 1MJUL 4OF8A 2Y06H 5HGHB 4S1SL 4M62L 4LCIL 5D8JL 1P9MC 1CXEA 2R0KL 3P11H 4Q6IB 1UKQA 3EKCA 3HA0A 1NCDH 1L7IL 4ZTOH 5J9PB 3VW3L 1PW3A 5ENWA 2FIKB 5DTFA 3E2HB 4ZAKA 4A6YA 1Z9OA 4N5ED 1A7BA 3HS0B 3VGEA 5IHZA 2A9MH 4GQPH 5EU6D 4LOUD 4GOSA 1FNEA 3L3GB 2YPLE 4FP8H 3QSKB 4MXVE 4M6ML 2NY0B 1U93A 5SV4A 5LBSH 3MC0A 2BVPB 2BY0A 1JN6B 4NZRH 3P11L 3C9NA 3KYKH 3NZ8A 4LVOB 3PWUA 4WUUA 2F5BH 1GJIA 5L2KD 4G9FB 1DQJA 5F21B 3QBTB 1QD0A 4FNLL 5FYLE 3P0VL 1U91B 5I71C 4KRMB 1F4YH 1UQSA 2ESVB 3LOWA 4YEEA 5DRNB 4EN3D 1INEH 1D7FA 2GT9B 4X4ME 1YYLH 4FP8L 5JHDD 3C5ZC 3UYOD 4QF1B 3WNKA 3P4NA 3MRJA 1KPRA 4M48H 3GHEH 3MV8A 3DHJA 1A4KB 3KYKL 1OL0A 1ES0A 4K23H 2ZWLT 1GAFH 2PYFB 5GRYA 3C08H 5CGMA 2V7NB 3JV6B 2IBBA 2X5PA 1NGXB 4D9QE 4OKVA 2G5BB 2FLBT 1S7UA 1XGPB 5KSUB 5CINH 1B6DA 1F4YL 2BRQA 1A6VL 2D9CA 4K3JH 5IWLC 5I75B 4HHAA 3UXFA 1RUKH 4PP2B 1RJYB 4Y2DB 2AXHA 2D31B 3W9EA 4K23L 1UWXK 1HHKB 3LS5L 3N9GH 4GO6B 1NKOA 5FA3A 4MD5B 3C6LD 4F8QA 5JXED 4LQFH 4NFCA 1PKOA 4M1CC 5IF0A 1JHTB 2DBJA 3ROOB 4KU1A 4LGRB 1NFDE 5DHVH 4M7ZB 4Q0XH 5ESQB 2FWOB 3VXMB 1KENL 2DL9A 3BJLA 3U0PA 3AM8C 5HHXH 3GI9H 1KELL 3IS0X 4IMKA 1UH4A 5E4IA 3CDFA 4L4TE 5EU6E 1MQKH 4GRMB 1QRNE 1K8DB 1FE8H 3IFLH 4PRHE 5C0RH 3HG1A 1UZ8A 1S7QA 3W0WE 2B2XL 1PG7H 1YN6A 2DJUA 3PGFL 4JPKH 3VWJA 2RQ8A 3D2UB 5EOQH 3MRBA 1QSVA 4LQFL 3IDGA 4XCYB 5ICXA 3Q5TA 3WXVL 2VH5H 1T7VA 5L2KE 4Q0XL 3ARGB 4I2XB 3VG9C 4OLWL 4XP9L 1KTDA 1G6RL 2OR8A 4TUJA 3RX5A 3TA3B 1TJHH 5IVZB 1R3KB 1MQKL 5E2TL 2JJWA 1HZHH 5E2WL 5JHDE 3T0ED 5FKAB 4HEPG 4KRPB 5J1AB 1IAII 2ADGA 3O6FD 5IVNA 4JPKL 1JGLH 5I74C 3PQYB 5CEXA 1FL5A 5IEHA 1GCFA 4JY4B 1LGVA 2GITB 4KVCH 3C87A 3MNZA 4JZOB 3MLRH 1RQ5A 5CEZD 2IBGA 3WO4B 2PO6B 4EVNA 1ZVHA 3QXDA 3S4SA 4FXGB 2CDEA 2BY1A 3M07A 3Q6GH 1FGNH 3ARFB 3LSOB 3INUH 2RHEA 5DT1H 1T1ZB 4KC3B 5E8PA 2O5YH 4ODTL 1UKTA 4BFIA 7FABH 4XNYH 1IGYA 5FCSH 3MLRL 4EUPB 3VMOA 5GJSH 1Q72H 4LSRL 4H25B 3ILPB 1WUNT 5EG6C 3VXUB 1CN4A 3MREB 4LCCB 3VFWB 4I3GA 3BD4A 1FNAA 4JQXA 4YFEA 3AROA 4Z5RB 2AK4B 5I9QB 3INUL 4NN6C 5DMGC 3LZFL 4HMDA 4GBXC 2UY6A 1NEZA 1S5IL 2NTFA 2X10A 3VXSB 1KOAA 5FUZH 3STLB 3CH8A 1AC6A 5EU7E 1DBJL 4N8PA 4KTEL 7FABL 1S7TA 2YZ8A 4JFQA 5I1IH 5KSBB 3QZWA 5GJSL 3GO1L 1Q72L 2VL5B 1CXFA 4XNZC 1UB5B 4Y4HA 5HDBF 3HCVB 4N0YH 4YHKH 3H0TA 1RSFA 5K59F 1UJTA 5E6ID 1HH6A 4GXUN 5F7DA 5GRWA 3WUWB 4X7FC 3UTTD 2A6IA 3QP3A 1MUJB 5FUZL 3LY6A 1YMHB 1NKRA 3BHBA 4UAOC 4TUKL 4AIZA 1OD7A 1NUGA 1AQDB 1PEZA 1SM3L 4OF0A 5TFSL 1T5XA 5F7UA 2VDLL 3IJYB 4DKAA 4CVWA 3ZKNC 4OV5B 4JO2H 4Y19D 1GPOH 5CEZE 1CDYA 3P0YL 4MDJB 3SEPA 4ZUVA 3V6FA 4C54A 3H7BB 1RFDL 1P4LB 1IC7L 1NAKH 2FGWH 4N0CD 3T3PF 2X4SA 3V7AG 1WIOA 4JEGB 4BUGA 5C2BH 4JRWA 5IK3A 3W39B 4JPWH 1NCBH 1I75A 2VXVH 4MXQC 4OLZL 3BXNB 3VGAC 2NY3D 4JGUA 4P9MH 1CS6A 1FPTL 1T22A 3X11B 3ZMRA 4O2FA 1RIVL 4PJ8D 5IB3A 1H0DA 3QDGA 3IDXH 3IDIB 3RP1A 5HHOB 3S8WA 2R4RL 4RWYL 3IRPX 3ARUA 2F58H 5AD0B 1M05B 2FGWL 4LSTH 4ONFL 4WWKA 5T3XD 3GBNH 1FV1A 2LU3A 3WIHA 4J1UB 2VXVL 2GTZA 4QXGH 2DLFH 4MA1C 1YPZB 1LVEA 3BZ4A 1E4XH 4Z78A 2V2WB 3PL6C 4PJAF 4X7DC 4XNMA 1MJ8H 3IDXL 3BQUA 4ZXBB 1ONQA 4OGAC 2F74B 4ZNEE 1DN0A 1JHKL 3HC0B 4UTBH 2HFEB 4ELMB 2AQ2A 2C9AA 4JJ5A 2WANA 2Y5EA 5C09B 1A22B 2KDGA 4R0LC 43C9A 3PXHA 4PR5A 1HE7A 3ZHDA 3D3VD 1CU4H 4FQLH 5IFHH 1CCZA 5DEGB 4RRPA 3V8CA 1XR9A 4MDIB 3DOSA 2ORBL 2C7UB 1VESA 3BSZH 3MV7A 1MJ8L 2Y36L 4KJYB 1X5XA 1MLCA 2ICCA 4XCFL 3QEHB 3SBWA 3QHTC 4Y19E 4KV5F 1JZ7A 3L6FB 3QUMH 1GVIA 2R0ZL 3EO9H 3FB6B 4JHWH 3TVMD 3CFEA 1O7VA 1OTSC 4OFYA 3MMEA 4U4BA 5DDHA 5CZXC 1NSNH 5C7XH 5IESH 3EOYG 5IB2A 3BSZL 4AM0B 4LLDA 2R2BB 4G3YL 2DIJA 4YUEL 3KDMA 4PTTA 4I18A 3MUGA 1SYSB 1RHHA 3QUML 4BKLB 4U6YA 2DYPA 2ADJB 1H9VA 1T5WA 1ZT1B 2BC4B 3VGDA 4MA7L 4L9DA 1WF5A 4HLZG 5CBAB 4P46B 1CL7H 3EOAA 1LNUA 1NAMA 1YEHL 2R2HA 1NSNL 4BZ1L 5E8EA 3U0TA 1YEFH 1AD9A 3FFDB 4HAGA 5F3HB 2PW1A 3TIEA 3JUZA 4YHNA 5GGSB 4ALAH 2XRAH 4ZAKD 2RFXB 2FD6L 3U7WH 3HC4H 3QG6B 1R5WB 1BFTA 1CZ8H 5L0QB 2YKLL 1EEUA 4NKMA 5FIEA 1BBJA 15C8L 4DOHE 4AYFA 5EFIB 2E27H 4LHQB 1IJ9A 1YEFL 3T2PA 3S4SG 4DKDC 2JCCB 3FL7A 2XYCA 4WUUD 4PJAA 5EO0B 4Y0GA 2HG5B 4LU5H 2FR4B 8FABB 4OFDA 3GSNH 4MGXA 3OX8A 4X9IA 4KZEH 4MS8D 3UTOA 3BH8A 1AJ7H 5EO9B 5AUMB 5I1CL 4U3HA 4DN4L 2D7QA 3HC4L 2HKFL 2Z31B 1U8KB 1CZ8L 4LLYA 1SEBB 3QEUB 4F2MA 5EIIA 3U7AA 3CC5B 3SDAB 3I6KB 5DJAA 4XC1L 4L8CB 1MFEL 2VIRB 1EEYB 3SN6N 3X14A 5C71A 4KDVA 1FFOA 4LLVB 2OI9B 2NY2D 1VHPA