5EBWC

Kcsa with g77ester mutation
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
102
structure length
101
Chain Sequence
HGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 101
sequence length 102
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5ebwC00
2BOCC 3FB6C 4JTDB 5EBMC 4CBCA 3E83A 2BOBC 2K1EA 2EIJC 2Q68A 2EIKC 1M56C 3F7YC 3JYCA 4JTCB 3OR6C 4PDLA 4MVRA 5CBGA 3SYCA 1OCRC 2EILC 4GX2A 4BW5A 3TETA 1V55C 3SJQC 5IY5C 2A9HA 3OUSA 3WG7C 5EBWC 2WLMA 3GB7C 2ITCC 3LDDA 5B1BC 1R3IC 3SPHA 1LNQA 5KUMA 3ABLC 2HG5C 4I9WA 3E8GA 3K08A 2DYRC 4XDLA 5EBLC 3STLC 1K4DC 3LDEA 2KB1A 3IGAC 3K06A 4J9YB 4MVOA 4RAIA 2QKSA 2WLJA 3T2MA 2X6AA 3RW0A 4MVQA 1JVMA 4R8CA 4X89A 2ATKC 2ZD9A 3E86A 4GX0A 2R9RB 3T4DA 2YEVA 3SYAA 2H8PC 4LCUC 1R3KC 3AG3C 2AHYA 3AG4C 3LUTB 1ZWIC 4MW3A 4PA3A 4R6ZA 4F4LA 1BL8A 2WLLB 3TCUA 1J95A 1OCZC 1QLEC 3FB5C 3OGCC 4HYOA 4QNHB 4H33A 2JK5C 3ABMC 4QE7A 3UKMA 4H37A 2NLJC 4GX1A 4X88A 3BEHA 3UM7A 3KG2A 2WLIA 3HPLC 2A0LA 3SPJA 1R3JC 4GX5A 3E8BA 3K0DA 3F7VC 3SPCA 2EINC 1V54C 4ZBMA 3LDCA 4PA6A 4DXWA 2ITDC 1ORQC 3OUFA 4R50A 3RBZA 1R3LC 5B3SC 3RVZA 4WFFA 3SYQA 1G4YB 3OR7C 5EK0A 2X6BA 3SPGA 4P9PA 5BZBA 4RUFA 2DWEC 4WFHA 5EC1C 3FB7C 4MTOA 4UUJC 4MTFA 2A79B 3E8FA 1KKDA 1XL6A 3E89A 3RVYA 5CBHA 2HVKC 4MTGA 3T4ZA 1OCOC 2IH3C 4MVMA 2Q67A 2WLHA 2ZXWC 5B1AC 4XDJA 3SYPA 1P7BA 2WLIB 4MVUA 2OCCC 2HJFC 4P9OA 4TWKA 4P30A 4MVSA 4HZ3A 3F5WC 4R7CA 5J9PC 4X8AA 4XDKA 2HVJC 4MSWC 4PA7A 3E8HA 2DWDC 3EFFK 4KFMA 5KUKA 5E1AC 4RO2A 2Q69A 4RUEA 1OCCC 4LP8A 2HFEC 2P7TC 3K03A 3AG2C 3FB8C 3IFXA 3STZC 3X2QC 3ABKC 3SYOA 4PA4A 4PDVA 2WLLA 4MW8A 4WFGA 2EIMC 2WLKA 3VOUA 5EC2C 1XL4A 2QTOA 1S5HC 2Y69C 3ASOC 4P2ZA 4J9ZB 4MVZA 1M57C 3PJSK 4JTAB 4PDRA 3ZJZA 2WLNA 4EKWA 4LBEC 4G27B 2DYSC 4PDMA 4MS2A 1K4CC 2AHZA 3K04A 3LNMB 4G28B 2IH1C 2Q6AA 2W0FC 3AG1C 3SPIA 3ZRSA 3K0GA 2X6CA 4WFEA 4PA9A 3R65A 3ASNC 4QE9A 5CBFA 3T1CA 4OXSA
chains in the Genus database with same CATH superfamily
3CHXA 4GKJO 2QGNA 1VQKV 3KZIZ 1B3QA 2K1EA 4X20A 2WPDG 3VQYA 4K8ZA 5JH7A 1I5XA 4K8XA 5EIBD 2QM7A 1K33A 3K5NA 2UXCO 1RM1B 4KL1A 5KUMA 4GZRB 5IYDO 4YHHO 1H2NA 1AP5A 1JFFA 2ZR3A 1HDJA 1I0HA 4J7JA 5GW7A 4EB6A 3OTFA 2CK3G 1HR0B 4IT5A 2LW7A 1I94B 4ABMA 3J81N 4DK1A 4JF3A 4JI5B 2DN9A 1KMIZ 4H13B 1QLEC 4H33A 1XHXA 4LF5O 4CC5A 2DE0X 2WLIA 1V55B 3E8BA 1S77D 4YJ3B 3L75H 2ZT9B 3RBZA 3K59A 1NT2B 4O4HB 1WPXA 2DYRB 3D3IA 5F2VO 4QPKA 2H94A 4UCUA 5IYBO 1CEZA 3FB7C 3CJHB 1VMGA 4AQYO 1IBLO 2OIEA 2RMKB 1OCOC 2LFRA 1SF9A 4X1IB 4J11A 2XAJA 1VQ9V 1FFTB 3E8HA 4UCVA 1EN6A 2Q69A 5FL7G 5K1XA 5D5PA 3CEIA 2RCVA 1NTKH 4I50A 2WLKA 2F4VB 3Q4HA 1US6A 1ZX3A 1ZSPA 1H2SB 1URFA 1N8RW 1GH6A 3JALB 2YIAA 4OGQB 5CBFA 1K5QA 1JPXA 4JTDB 3GWKC 1N33O 2FB5A 2EIKC 1UFIA 5CBGA 2YSUB 1Q3EA 4TQDA 2EZOA 1IURA 2IJJA 4O4JA 4NKGB 4DV6O 3RYCB 4O4LB 4X62B 1L0LH 5GONB 1Z2GA 1M57B 3HKCA 2CH7A 3B77A 2QKSA 1QLNA 2JVDA 4J7ZA 2ZD9A 2QEXV 2AZ0A 3HKDA 4X20B 3OW2U 2NN4A 2YEVA 2H8PC 2AHYA 5JH7B 3APOA 1VQ6V 3H1JH 4AHCA 4X64O 3K5OA 5L3BA 1WJZA 4X65B 3CCUV 1Q8IA 1K8AW 3SPJA 3U11A 4DV1O 1OZ0A 5KHKA 5KX5A 1JOYA 1JFFB 2QWOB 4OPHA 3UCSC 1SKVA 2EZPA 5B1BB 1EBOA 2Z5UA 1XUQA 3H1IH 4MTXA 2XAGA 2BTQA 3D3QA 2X6BA 2W6JG 3ZMZA 1KKDA 3DGEA 3RYIA 3T4ZA 2Q8VA 4MTGA 5LP6A 2GUZA 1TGOA 1YF2A 1QCEA 2WLIB 4IIJA 3D36A 3ZCCA 2UXXA 5FPRA 1MSDA 1W59A 5AG2A 1TAEA 2Q9LA 4RO2A 3K03A 3AG2C 3IFXA 2UUBO 3ABKC 2N04A 2B1IA 1NZ6A 1XL4A 4PDRA 2WLNA 1AI7A 1IXMA 1LR1A 3RGBA 2ZR2A 2X6CA 2Y69B 1XBLA 1H2KA 2CTRA 3R65A 3ZHTA 5HFMA 4JI4B 3E83A 3ZS8C 1P84F 4LNUA 4PDLA 2BSKA 4FFKA 4WFBV 3LSUA 4I50B 1PNKA 3Q4HB 1KP2A 1EZJA 2QKCA 4QJFB 1LNQA 2HG5C 3X2QB 1K92A 3QO5A 3IGAC 4PD4F 3CWBH 3RW0A 4LFCB 3B2EE 1NKDA 1EN4A 1Q90D 4N23A 3LUTB 3A8TA 4O4JB 2JGDA 4ZI7A 4DR7O 4PV1B 5EIBC 1N34B 1EFRG 1IX9A 1R3JC 5IE9A 4GUNA 3HKCB 2CH7B 2EBOA 2D3OW 1RFYA 4LWSA 3G4SV 3HKDB 3E35A 2YEVB 5D5QA 1DK1A 5B1AC 5KX5B 2VQFO 2LGQA 4LR3A 3DSQA 3DC5A 4DUYB 1MZFA 2HFEC 2BTQB 3LNNA 4IHJA 5H9CA 5IWAO 1AR5A 2EIMC 2R70A 1P4RA 3RYIB 3H01A 5LP6B 2GUZB 1TA8A 4B3TO 4AI8A 1D5NA 1ZTEA 2XHBA 2KG7B 3FYEB 2ZQMA 1IBKB 5EZYA 4BW5A 3I5DA 3MHHC 3SJQC 2JJ1G 4LF9O 4JI3B 3CCMV 3I55V 1OCCB 2P06A 3IJ4A 2PZSA 1GM8A 3K06A 1Y6XA 4RAIA 3TXQA 4J42A 4R8CA 1JVMA 4Q6GA 1JR9A 1Z5VA 3OEHG 4W4KA 3SYAA 4DR2B 1R3KC 3MDSA 2BSKB 2RQ6A 3TCUA 1OCZC 3G6EV 1L1FA 2Y48A 3FX7A 5H6RA 2YDEA 4FLVA 4X66B 4LF8B 3K0DA 4QIWF 3JSNA 4Z1MG 2Y0PA 3OMIB 2ZKOA 3G6BA 2UUCB 1IVSA 2Q7HA 3L72H 3K57A 3OR7C 4B3MO 4DR3B 1EZVH 4UXNA 2AGAA 4RUFA 1SQFA 1AB3A 4I55A 2E5LO 1AR4A 1XNRO 5CBHA 2HVKC 2C2AA 1WN7A 2JGDB 4BIOA 4K0KO 2Q67A 4FM1A 1PPJH 1FXKC 5J2UA 1WP8A 1F51A 3SGIA 3CC7V 3EFFK 3N2GA 1BMFG 1VARA 1M93A 5LMNO 4LWSB 1XEQA 1P49A 1V54B 1COWG 4DR6B 2UXBB 1IZ3A 3ASOC 4P2ZA 3ETQA 2P90A 3OM3B 5L3DA 4G27B 4PDMA 1W2BU 4FLYA 3K04A 2IH1C 2Q6AA 2W0FC 1W0KG 1HNZB 3ASNC 1VQNV 2JRIA 3H1HH 4YXWG 3W7UA 1NI8A 3GWOA 2EX3A 1BHAA 1NVPD 1SQXH 4E4EA 4IHJB 4K3AA 3ZRXA 1HR0O 2UXDB 1YZBA 5EBWC 1I94O 1WLEA 4NB5A 4JI5O 1MNGA 4DV4O 4I5SA 4J9YB 3CMAV 1NR1A 2PYLA 4JAVA 2Z3YA 5TISZ 3LSSA 2RJZA 1ZAUA 2F66C 3OMAB 3EHBB 5EZYB 1K7DA 1SQQH 2HKOA 4A5UB 2ODMA 3AG4C 3JAWB 1VQ5V 4JGSA 4CS2A 2QTSA 1AI4A 3QG5A 3RFRA 3ABMC 4H44B 1X4TA 3BABA 3UKMA 2NLJC 5L3FA 2DMXA 1S5LZ 4DW1A 1Y66A 1QR9A 4HAMA 2OCHA 3HB3B 3BCCH 1M1KW 1GN6A 1G4YB 3SPGA 4P9PA 2V1DA 4LFBB 5EC1C 3FFQA 5DECA 4JI6B 3CCEV 3JAMN 2F4VO 4MVUA 1WNSA 2LO1A 3H1LH 3ZRVA 4PA7A 1RP3B 2GBOA 5JCOA 1SC5B 2YXHA 1AJQA 3VQWA 3JAKA 5KLVH 2WLLA 1R6NA 3JD4A 4I55B 5B3SB 5LOVA 3ZHVA 4FLUA 4X1YA 3THOA 3K5MA 2VWJA 5DN6G 5LMUB 1WA8A 2LW1A 5J2UB 4BR6A 1MSWD 4UFZA 2CTWA 2BOBC 3N2GB 3TK1A 1R6KA 1TVKA 4YIPA 4NVPA 2A9HA 5CMUA 1KUQA 4B08A 3GB7C 3AK1A 2CDYA 3BA9A 1PV0A 1THZA 5EBLC 3CRAA 3STLC 1X59A 4DV0B 4TV9A 4X65O 3D8CA 4MVOA 3R66A 2V7QG 2P22C 1VIBA 2P6JA 3RYFB 5CA0A 3CXHF 1TUBB 2EIJB 4B3SB 1W0JG 3EXAA 5CA1A 1G6UA 1SRYA 3JD3A 1SZXA 1H2MA 1ORQC 4GKKB 5CA3A 3BAAA 1I08A 5JQGA 3IAYA 1PNLA 5BZBA 2OYQA 3ZN1A 4JYAB 4YIOA 1M4UA 2OWOA 4CH3A 3FYIB 1VF6C 2P67A 3IC7A 2F23A 3AG3B 2OCCC 1PP9H 2HJFC 2JS3A 2E75B 5JJNB 5B1NA 2JGUA 3W7TA 3K3WA 4UV8A 2IU3A 5BXZA 4BW9A 2Q7GA 4H0LB 1JA8A 4KHPB 1GN2A 3W7SA 2PGGA 4PDVA 4JI4O 4MW8A 3VOUA 3DC6A 2ARHA 2QR4A 3MD0A 5LGNA 1ZL8A 3AG1C 1XREA 5LA6A 4DR5B 3SDLA 4TUYA 1KC8W 2JIZG 1HW7A 1FD9A 3OE7G 2RDCA 2ZXWB 4EFBA 4JPRA 3JAKB 4E2LA 2ZE7A 3G67A 4RWUA 3BPZA 2H3OA 3WB0A 1OCRC 3NR7A 1NTZH 2EILC 1KECA 1EN5A 3ABTA 4DV5B 3CD6V 3OUSA 4LFCO 2WLMA 5LOVB 1O9GA 4JV5B 3W7XA 4PELA 4X1YB 1HNXB 1FXVA 3N2KB 4FM0A 3BHPA 1WA8B 3RT3C 3MHSC 4XBFA 1Q5OA 2WLJA 3ICXA 1XILA 1N34O 4AILC 5KHHA 1TVKB 2XOKG 3OTOB 3ABUA 1GK9A 2UU9B 4R6ZA 1AJNA 1FPOA 1SQBH 1J95A 1Q7YW 3OGCC 3T1HB 4X88A 1K34A 3KG2A 2EJ7A 4TV9B 2E76B 1FXKA 4DRXA 2ADPA 3ABLB 4JI7B 3QO8A 5BMVA 2O57A 3B8NA 5CA0B 1M9NA 4MTFA 1XL6A 4DUYO 1AJPA 2WLHA 5LHGA 5LXTA 1P7BA 5KMGA 2CGNA 5GTHZ 4JYBA 5CA1B 4HZ3A 4B3RO 1RSOA 1VF7A 4RQEA 2B5UA 1V9PA 4EB6B 2UUAB 5E1AC 4RUEA 2ADQB 1RM1C 4LP8A 5IT9N 3STZC 2QKAA 5JQGB 4B7EA 4LFAB 1N36B 1S5HC 1Q86W 4X9QA 4LF7B 5IDJA 3JCZA 5BY1A 3CRCA 1IBKO 1XMOB 4PI0A 3K0GA 1AILA 3JASA 1GAXA 2XT9A 2P4KA 2PI5A 3F7YC 4MVRA 3SYCA 4LH7A 1V55C 1OV9A 1WB8A 4QPJA 2ZDIC 3LDDA 4I4TA 2VQEB 4DR2O 2A3QA 1ZL8B 3ZMSA 3K08A 2DYRC 4U3FH 4TUYB 2IJKA 1DF4A 2QWNB 1GKFA 4NTYA 4X66O 4LF8O 3M99B 2Y4TA 2E3CA 2UUCO 1GN4A 3ZN0A 2QE7G 1F23A 1WP7A 4FJCC 2ZNIA 4H37A 4CZZA 1SETA 3UT5A 3F7VC 2VS0A 3B4SA 3SPCA 2EINC 1Q82W 4DXWA 2YXYA 3OUFA 3UO3A 1YSCA 1Z5WA 1YJNV 4AQYB 3VQXA 3BRCA 4I7ZB 1N32B 4F6EA 1L8DA 3CRQA 4IL6Z 1JCHA 4IYIA 4ZIBA 3RVYA 2RN9A 1D5AA 1IBMB 3RN4A 3OFNG 4DR6O 3SYPA 4N21A 2UXBO 5FNVA 4XDKA 1SESA 1R6TA 1XNQB 1D2DA 4DRXB 4GLXA 1QBZA 1HNZO 3B8MA 1LUVA 3CCQV 5LHHA 1B04A 1VP7A 1YCIA 1I7FA 5BMVB 4JI2B 3BY6A 2UXNA 5JJJB 1M57C 4EKWA 2F1MA 1AP6A 2AHZA 4FFBA 3ZRSA 2UXDO 3L9DA 2X0LA 1S5JA 5KMGB 1KB9F 4DUZB 4G2KA 1AROP 3FB6C 3LSQA 2Q4PA 3ZBHA 2VWKA 5EBMC 4FLWA 1RSOB 2Q68A 1BQ0A 4FVMA 2IJIA 3KCYA 2Q73A 1R1BA 1YDXA 3ML0A 5KHIA 3TETA 2MK3A 2ZCEA 3HKEA 3A0RA 3UO2A 5JJEB 5B1BC 1FAFA 1AR1B 3ETGA 3DXRA 4KP4A 2XAFA 2ZE8A 5IJ9A 4YY3B 1FFXA 3JASB 4NXMB 4IIJB 5KHJA 5IYCO 4MVQA 4X89A 3I56V 5K1PA 2AW9A 3BFRA 2CTQA 4F4LA 4WFAV 4NTWA 1YIJV 3O65A 4O2BA 2WA3A 3ZHRA 1F4MA 1DTOA 1OJHA 1R73A 4LFBO 4GX5A 5IY5B 1VF6A 2GHYA 1SQVH 3GVMA 3WG7B 4JI6O 1S76D 4PA6A 3ABMB 3QVNA 1QVFU 3P30A 2YS8A 5FPOA 1GN3A 1H8HG 4LNUB 3OT7A 4D7SA 3K9AA 4NXNB 4U3JA 3E8FA 2Q0OC 2YIBD 1QHTA 2QM8A 3UT5B 4EFEA 4F6RA 1Y76A 3APQA 3F5WC 3QO7A 4FMTA 1HWYA 2DWDC 4KFMA 4ASUG 5LMUO 1VQ4V 4FK5C 3X2QC 3FAVA 4QGPA 2F43G 1M5IA 2DQ0A 1PNMA 2W0XA 1MOFA 3A0HZ 4IGGA 2XAQA 4ZI7B 3K79A 4L87A 5GTIZ 1VQOV 4WF9V 3T1CA 2BOCC 4NTXA 5FNVB 1S3JA 1YVWA 3CPWU 4L8JA 4DV0O 2HR3A 2DOSA 5BR8B 4ZHQA 1EM1A 3A0BZ 2E74B 4JI0B 3E8GA 1FXHA 1SERA 1I5YA 4JAAA 1GM9A 1NU1H 1B06A 2DYSB 2WAMA 2FTKA 2MW2B 4LCUC 1BE3H 1UPGA 4GKKO 2GSMB 3CCRV 1BL8A 3FB5C 3HKEB 4QNHB 4LF6B 2HJDA 3ZMTA 4JYAO 3PN1A 1KP3A 3DXRB 5IJ9B 1FFXB 4R50A 4RQFA 2HEPA 4GT1A 3QNEA 5JVDA 3ETEA 5LP6C 5ITZA 3SJCC 1YJ9V 3QTCA 4BIUA 1Q6IA 4UUJC 4Z1VA 1QVGU 3L70H 3D36C 2A7WA 4MVMA 4O2BB 4KHPO 3ZX6A 2JEUA 3CC2V 2LGWA 2PYJA 4P30A 4MVSA 1HNWB 1QLEB 4R7CA 3RWRD 4UCTA 1A32A 1OCCC 2OCCB 4DR5O 3FB8C 1YTFB 4J9ZB 4U3JB 3ZJZA 2HLDG 2HHHB 1DLBA 1SQPH 3J80N 3AEIA 2XAHA 4DV5O 2PUSA 3J7AU 3CRMA 4PA9A 4F6RB 4PHZA 2HP8A 2ZDIA 4OXSA 4JV5O 3BVOA 1NS1A 1HNXO 1OCOB 4O4HA 4PJ0Z 3C90A 1XDCA 1SA0A 1E1QG 3JYCA 1NTMH 3FAVB 1AI5A 5LYJA 3CJHA 5CB4A 4FPPA 5E79Z 3OTOO 3HKBA 2GTAA 1HP8A 2UU9O 3DTUB 2QSAA 5HFLA 2M6YA 1K97A 3JD2A 3FKSG 3T1HO 5C93A 4ICGA 4IYHA 4J41A 3AK3A 4X62O 1DF5A 5EYPA 2Q7EA 2FMLA 2QM4A 5J2TA 4MT8A 1KYOF 4JI7O 4JI1B 4ZHQB 2EIKB 4FM2A 3OGIB 3E22A 4GX1A 1FJGB 4DR1B 2Q5ZA 2PI4A 1V54C 1IDSA 1FYJA 4DV3B 1XI1A 2YXLA 3C3TA 1NH2B 3L71H 1K3EA 2FKXA 2QWRB 4OX9B 1BGYH 3O9OA 4MTOA 3P3NA 2UUAO 4HBNA 1L0NH 1J5EB 1XMQB 1MMMA 5B66Z 2IH3C 3C3SA 3RYCA 4ZKIA 3CMEV 4JASA 4LFAO 4UCOA 3CCJV 1N36O 4UB6Z 4O2AA 4LF7O 4TWKA 4DO2A 2LFSA 3ZMVA 3T1YB 2XASA 1XMOO 3U10A 3CCLV 1VQMV 1M90W 2QWQB 3E2EA 1Q81W 5JVDB 3G71V 2EJRA 4UCRA 5ITZB 3SYOA 1YXBA 1PL4A 1GO3F 1YITV 4D7TA 1QQCA 3ZHQA 4NR1A 4CC6A 4WCEV 2VQEO 2PF4E 3CCSV 4JI8B 1M56C 5H6QA 1RPRA 3WU2Z 3ZIAG 3ZEDA 1BS3A 3M8AA 4DV4B 1VF5B 3SPHA 3AG2B 3CSXA 3ABKB 1PKXA 1JJOA 4FIPC 2KSDA 4FLTA 2FL4A 2EULA 1Y67A 4GX0A 2BCCH 3K58A 1MZEA 1SA0B 2OIGA 3CB2A 4LF4B 4PA3A 5CB4B 5LYJB 2WLLB 4DR4B 2IM9A 1N32O 3ZHUA 1KBHA 2JK5C 4GYCB 5A9GA 5L3EA 2ETNA 3HKBB 3HPLC 3TXSA 2RNBA 4CH4A 1IBMO 4JAUA 2ZM6B 5B3SC 1XQ8A 1JMKC 2EINB 5EYPB 4WFHA 5J2TB 1XNQO 1CPYA 1DGSA 1WPBA 2X7RB 1G8MA 4CH6A 4DV7B 1JJ2U 4JI2O 3E22B 3S3XA 3VQVA 1H2GA 3JATA 4DV2B 1VQ7V 4O4IA 2P7TC 3CX5F 4DUZO 5C8YA 2Y0IA 2QTOA 3CRRA 1BZKA 4JTAB 4MS2A 1K4CC 1WAZA 4O2AB 4J7KA 2OTJV 3W7WA 3F5TA 5B1AB 2EIJC 2PTMA 2XUMA 4YY3O 4JTCB 4NXMO 3B40A 4JYCA 4BAYA 1R3IC 4GKJB 2ZIOA 2Q0AA 2F93B 3EVKA 2QA4V 2EIMB 5H2FZ 4JI3O 3T2MA 3K5LA 2G38A 3OD4A 3E86A 5CN0A 2UXCB 2GV9A 2OTLV 4UVAA 3AG3C 2JDIG 4YHHB 2ZE6A 4I0XA 1ZWIC 4JZGA 3KCXA 2CAZC 4HYOA 3L74H 1ZLZA 4D6TH 1Q43A 2ZINA 2B1GA 3WFVA 1VQLV 4NXNO 3TJTA 2BE3A 4ZBMA 3LDCA 5LA6B 2KG7A 1IXBA 1R3LC 3RVZA 2N05A 1MA1A 4LF5B 3L73H 5FLXN 1K5SA 3ETDA 4UVBA 2A79B 4DR3O 1YHQV 2ZXWC 5JCOC 1U97A 4ZOLA 1OCZB 2YI8A 5KUKA 1KKCA 1IBLB 1VQ8V 1PD3A 5A2QN 1QR8A 2CGOA 3BA8A 2JS5A 5B1OA 2QDOA 5KAFZ 2AZ2A 1NBMG 2YIDA 3QF7A 2Z0AA 2FYUH 3RYHA 4G28B 5L3CA 5BR8O 1PM9A 3UQ8A 4DW0A 3HR0A 3MAQA 4WFEA 1GMGA 3CE2A 2LQTA 3P3PA 4JZ2A 1MABG 1Y4MA 4JI0O 3JATB 1FXKB 4O4IB 5JWPA 3OR6C 5C8YB 4GX2A 4U7NA 4FLZA 2KKWA 3ABLC 1E79G 1N33B 1VEWA 4XDLA 5LXTB 2GDSA 3SR2C 3ASOB 1NQTA 2KB1A 4LF6O 1MG1A 1ZUQA 4FZ1A 2ATKC 4Z2WA 2R9RB 4KXRA 1SZTA 4DV6B 3ASNB 2L35A 4MW3A 1KD1W 4Q20A 3JCUZ 4DK0A 4TQFA 3ZMUA 1F4NA 3BEHA 2A0LA 4TV8A 2YUAA 3VBBA 1N0JA 2ITDC 2VRZA 2YC0A 3P32A 4X64B 4WFFA 1ROPA 1HNWO 3B09A 3OAAG 4K35A 4I0XB 4DV1B 5LL6Y 4B3RB 5DM6V 1GM7A 4I4TB 2ZNJA 2P4VA 5IYZA 3AG4B 5KAIZ 1S72V 1P7GA 1QNMA 1Y74A 4U7OA 3OMNB 2HHHO 4UV9A 2ZIMA 2A06H 4MSWC 2R72A 1BSMA 3H9VA 2JEXA 2WA4A 1S0VA 2QJ1A 3ZHSA 5KHGA 2YIBA 3JAWA 1FS0G 1KU9A 1BHBA 3AG7A 5EC2C 4YJ2A 2Y69C 1OHHG 1ENVA 3PJSK 1SQGA 3KKYA 3WB2A 3CCVV 1XHZA 2UUBB 4QE9A 1K9MW 4ZOLB 4HNAA 1QU7A 1N0NA 4NYKA 4CBCA 2IW5A 4JYYA 2B9ZA 4UB8Z 1GRJA 4LC1A 4B7KA 1E1RG 4FZ0A 1YTFD 3S3WA 1Q6HA 2ITCC 2R9IA 4TSFG 1H8EG 3RYHB 3ZRWA 1U96A 4I9WA 2ZE5A 2YI9A 5L3GA 1K4DC 4JI1O 3LDEA 3N27A 2X6AA 4FLXA 1FJGO 4DR1O 1CXZB 3TGUH 1NJIW 2DW4A 2M7WA 5DEDA 4DV3O 2CE4A 5KA6A 1G1XB 2W6IG 1F7YA 4QE7A 5IJ0A 2WSSG 3UM7A 4FFBB 4OX9O 1J5EO 4OPAA 1XMQO 1AI6A 1LUWA 2D2CB 2OT5A 4B3SO 4X1KA 2NNUA 3SJAC 3SYQA 3SJBC 4WBNA 5LGUA 4DR7B 3CXCU 3T1YO 4I9QA 1BT8A 4BWAA 2XTAA 2IBZH 3E89A 1VQPV 5B5EZ 1BQZA 4TOIA 3OEEG 4BIZA 4TV8B 3CS5A 3JARA 2CTPA 3G80A 2KQXA 5J9PC 1WB7A 1AVMA 2YICA 3RYFA 2K9PA 4PA4A 2DQ3A 2L6LA 1NH2D 4J80A 4W4LA 1TUBA 3CYOA 1Q6UA 1JQ0A 2VQFB 4LBEC 4JI8O 5LGTA 2WWWA 1YEWA 3LNMB 2R9AA 4EEQA 2P5OA 4UCSA 5IYZB 5H5NA 5IWAB 1Y74B 4CS3A 1SS3A 3IC9A 2GTSA 1N4CA 5LBQA 1RPOA 2N74A 1XOUA 5IY5C 2JJ2G 3WG7C 3FD9A 4YJ2B 4B3TB 2QWPB 1H2LA 1M56B 4LF4O 4UVCA 3M7MX 4DR4O 1JX9A 2LJ2A 2NR5A 1NR7A 4YJ3A 1Y76B 1O9HA 4HNAB 2CUGA 2PY5A 1BCCH 5LHIA 3AG1B 4DYLA 4LF9B 3T4DA 3JSLA 2AXTZ 4PI2A 2ZM6O 2LP7A 2Y4UA 1T5EA 2XNDG 4CH5A 1OCRB 3ZRWB 3WB1A 2EILB 4J10A 4X1IA 3A2FA 3NXSA 2IJHA 1GTOA 3JD0A 1PL0A 4CS4A 5KA5A 2DJVA 4DV7O 1K73W 4LH6A 5EK0A 2DWEC 2IU0A 4GCZA 3K9SA 4DV2O 1YI2V 4KUMA 1H38A 3N2KA 2BTOA 1KQSU 5IJ0B 4XDJA 1FKAO 1TUEB 1YJWV 3JALA 4P9OA 4B3MB 1CP9A 3AK2A 3JD1A 4X8AA 2HVJC 1B6QA 1NVPB 3H1KH 3CC4V 4X1KB 2E5LB 2V4DA 1XNRB 4WBNB 2F95B 4K0KB 4WFGA 4MVZA 1UJWB 2ILMA 4C7UA 2DYSC 4TT3G 3SPIA 4O4LA 3CP1A 5GONA 5LMNB 3U0ZA 3JARB
chains in the Genus database with same CATH topology
1AROP 3FB6C 4YXWG 3LSQA 5EBMC 2OTJV 3W7UA 3W7WA 1VQKV 2K1EA 2EIJC 5B1AB 3GWOA 2Q68A 2IJIA 2WPDG 1NVPD 1BHAA 4JTCB 3ML0A 3ZRXA 1I5XA 2MK3A 3TETA 2QM7A 3A0RA 1K33A 4JYCA 5EBWC 1WLEA 5B1BC 4BAYA 1R3IC 1RM1B 1AR1B 5KUMA 3ETGA 5IYDO 4KP4A 2XAFA 2QA4V 2EIMB 2ZR3A 4I5SA 4J9YB 3CMAV 5GW7A 1NR1A 4JAVA 2CK3G 5IYCO 2Z3YA 3T2MA 4MVQA 4X89A 3LSSA 3E86A 5CN0A 3OMAB 3I56V 3EHBB 2OTLV 1K7DA 4UVAA 2HKOA 3AG3C 2JDIG 4JF3A 3AG4C 1ZWIC 1VQ5V 4F4LA 4JGSA 4WFAV 1YIJV 1QLEC 4HYOA 1AI4A 4H33A 3ABMC 3UKMA 1F4MA 2B1GA 2NLJC 1DTOA 5L3FA 1R73A 2WLIA 3WFVA 4GX5A 1VQLV 1V55B 3E8BA 1Y66A 1S77D 5IY5B 4ZBMA 2GHYA 1QR9A 3LDCA 3WG7B 1S76D 4PA6A 3ABMB 4HAMA 3RBZA 1QVFU 1R3LC 3HB3B 3RVZA 3P30A 1M1KW 1G4YB 1WPXA 3SPGA 4P9PA 2DYRB 3D3IA 1H8HG 1K5SA 4QPKA 2H94A 2V1DA 5IYBO 3K9AA 5EC1C 3FB7C 3ETDA 4UVBA 1CEZA 2A79B 3E8FA 1OCOC 3CCEV 1YHQV 2ZXWC 2LFRA 2QM8A 4MVUA 1OCZB 2XAJA 3F5WC 3ZRVA 3QO7A 4FMTA 1VQ9V 4PA7A 1FFTB 1HWYA 3E8HA 2DWDC 4KFMA 4ASUG 5KUKA 1AJQA 2Q69A 5FL7G 1VQ8V 1VQ4V 4FK5C 1PD3A 1QR8A 3X2QC 5B1OA 2WLLA 1R6NA 2F43G 2WLKA 3JD4A 1NBMG 5B3SB 2DQ0A 1PNMA 1MOFA 2XAQA 4G28B 5L3CA 3K79A 1N8RW 5DN6G 4L87A 4WFEA 1GMGA 1VQOV 4WF9V 5CBFA 1MABG 3T1CA 1K5QA 1MSWD 1Y4MA 2BOCC 1JPXA 4JTDB 1S3JA 2BOBC 3CPWU 3TK1A 1FXKB 2EIKC 1R6KA 3OR6C 5CBGA 2HR3A 2YSUB 4GX2A 4U7NA 2EZOA 2A9HA 5CMUA 2IJJA 3GB7C 3ABLC 1E79G 3E8GA 1THZA 4XDLA 5EBLC 3STLC 1FXHA 1SERA 1I5YA 3ASOB 1NQTA 2KB1A 1M57B 1GM9A 1MG1A 2DYSB 3B77A 2QKSA 4MVOA 2V7QG 1QLNA 2WAMA 2ATKC 2ZD9A 2QEXV 2R9RB 2FTKA 3OW2U 1SZTA 2YEVA 2H8PC 2P6JA 4LCUC 3ASNB 2AHYA 4MW3A 1KD1W 4Q20A 2GSMB 1VQ6V 3CCRV 1BL8A 3FB5C 4QNHB 5L3BA 2EIJB 3CCUV 1W0JG 3ZMUA 1F4NA 3ZMTA 1K8AW 3BEHA 3SPJA 2A0LA 1KP3A 1OZ0A 1JOYA 3VBBA 1SRYA 3JD3A 2ITDC 1ORQC 4R50A 4RQFA 2EZPA 5B1BB 1EBOA 4GT1A 5CA3A 2Z5UA 3P32A 3QNEA 4WFFA 3ETEA 4MTXA 2XAGA 1ROPA 2X6BA 1PNLA 2W6JG 5BZBA 3ZN1A 1YJ9V 3OAAG 4BIUA 3ZMZA 1QVGU 4UUJC 1KKDA 3DGEA 3FYIB 3T4ZA 4MTGA 4MVMA 2P67A 2JEUA 1GM7A 5DM6V 3CC2V 3IC7A 3AG3B 1QCEA 2WLIB 3AG4B 2OCCC 2HJFC 1S72V 4U7OA 4P30A 4MVSA 3D36A 3OMNB 5B1NA 3ZCCA 1QLEB 2UXXA 3K3WA 4UV9A 4R7CA 3W7TA 4MSWC 4UV8A 2IU3A 2JEXA 1S0VA 4RO2A 1OCCC 2OCCB 3K03A 3AG2C 3FB8C 3IFXA 3W7SA 3ABKC 1YTFB 4PDVA 4MW8A 1FS0G 3VOUA 2B1IA 1BHBA 5EC2C 1XL4A 2Y69C 4J9ZB 3ZJZA 1OHHG 1ENVA 3PJSK 4PDRA 2HLDG 2WLNA 1AI7A 1DLBA 1IXMA 3MD0A 5LGNA 3AG1C 3AEIA 2ZR2A 2XAHA 3CCVV 2X6CA 2Y69B 4PA9A 3R65A 1KC8W 2JIZG 4QE9A 5HFMA 1K9MW 2ZDIA 4OXSA 3OE7G 4CBCA 1OCOB 2IW5A 3E83A 2ZXWB 4JPRA 3JYCA 1E1QG 4E2LA 4PDLA 4LC1A 1OCRC 4WFBV 1AI5A 2EILC 1E1RG 1KECA 3ABTA 3CD6V 3OUSA 1PNKA 1YTFD 1KP2A 2WLMA 1EZJA 2ITCC 4QJFB 2R9IA 3W7XA 4PELA 1LNQA 1H8EG 4FPPA 1FXVA 4TSFG 2HG5C 3X2QB 3ZRWA 4I9WA 3DTUB 5L3GA 1K4DC 5HFLA 3LDEA 1K92A 3MHSC 3IGAC 3QO5A 4XBFA 1K97A 3JD2A 3FKSG 2WLJA 5C93A 2X6AA 3RW0A 1NKDA 1NJIW 2DW4A 2M7WA 1DF5A 2XOKG 3ABUA 4N23A 1GK9A 4MT8A 3LUTB 4R6ZA 5KA6A 1AJNA 1Q7YW 1J95A 3OGCC 2W6IG 2EIKB 4QE7A 2WSSG 4GX1A 4X88A 1K34A 3UM7A 3KG2A 1EFRG 1R3JC 2PI4A 1AI6A 1V54C 2OT5A 1FXKA 3ABLB 2NNUA 3SYQA 2EBOA 2D3OW 1NH2B 5LGUA 3G4SV 3QO8A 3E35A 3CXCU 2YEVB 1K3EA 3B8NA 4MTOA 1M9NA 4MTFA 1XL6A 3E89A 1VQPV 1AJPA 2IH3C 2WLHA 5B1AC 4ZKIA 4JASA 5LHGA 3CMEV 1P7BA 3CCJV 3OEEG 4BIZA 4TWKA 4JYBA 4DO2A 4HZ3A 2LFSA 3ZMVA 2XASA 5J9PC 4RQEA 2B5UA 3CCLV 1VQMV 1M90W 3E2EA 5E1AC 4RUEA 1Q81W 1RM1C 4LP8A 3G71V 2EJRA 2HFEC 3STZC 5H9CA 3SYOA 4PA4A 2DQ3A 2EIMC 1NH2D 3CYOA 1JQ0A 1S5HC 1Q86W 1GO3F 1P4RA 5IDJA 3JCZA 4LBEC 1YITV 5LGTA 3H01A 2WWWA 3LNMB 3K0GA 4WCEV 5LBQA 3FYEB 2ZQMA 3CCSV 2PI5A 1M56C 3F7YC 5H6QA 1RPOA 4MVRA 1RPRA 3SYCA 3ZIAG 4BW5A 1V55C 3MHHC 3SJQC 5IY5C 2JJ2G 3WG7C 4QPJA 2JJ1G 1M56B 2ZDIC 3LDDA 3SPHA 1OCCB 3I55V 3CCMV 3AG2B 3ABKB 3ZMSA 1PKXA 3K08A 4FIPC 4UVCA 2DYRC 1JX9A 1NR7A 1GM8A 3K06A 2IJKA 1DF4A 4RAIA 1GKFA 5LHIA 4R8CA 1JVMA 3AG1B 3M99B 4GX0A 3T4DA 3OEHG 3SYAA 1R3KC 3ZN0A 4PA3A 2QE7G 1F23A 3TCUA 2WLLB 2LP7A 1OCZC 3G6EV 4FJCC 1L1FA 2Y48A 2JK5C 4H37A 2XNDG 5H6RA 5L3EA 4CZZA 1SETA 1OCRB 3HPLC 3ZRWB 2EILB 3JD0A 2IJHA 3F7VC 1GTOA 3K0DA 3NXSA 2EINC 4QIWF 3SPCA 3OMIB 1PL0A 4Z1MG 1Q82W 5KA5A 4JAUA 4DXWA 3OUFA 1YSCA 5B3SC 1YJNV 1K73W 3OR7C 5EK0A 4UXNA 2EINB 4RUFA 2DWEC 4WFHA 2IU0A 1JCHA 4GCZA 1YI2V 1CPYA 4KUMA 1H38A 3RVYA 5CBHA 2HVKC 2C2AA 2Q67A 2X7RB 3OFNG 1G8MA 1KQSU 4XDJA 1JJ2U 1FXKC 3SYPA 1TUEB 4N21A 1YJWV 4P9OA 1CP9A 1F51A 3JD1A 4X8AA 1SESA 4XDKA 2HVJC 1B6QA 3CC7V 1NVPB 1H2GA 3EFFK 3CC4V 1VQ7V 1BMFG 1QBZA 3B8MA 2P7TC 3CCQV 5LHHA 1V54B 1COWG 4WFGA 3BY6A 2UXNA 2QTOA 3ASOC 4P2ZA 4MVZA 1M57C 2P90A 3OM3B 4JTAB 4EKWA 1UJWB 5L3DA 4G27B 2DYSC 4TT3G 4PDMA 1W2BU 4MS2A 1K4CC 2AHZA 3K04A 3SPIA 3ZRSA 2IH1C 2Q6AA 2W0FC 1W0KG 3CP1A 2X0LA 3ASNC 1VQNV 4G2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOC C;  3FB6 C;  4JTD B;  5EBM C;  4CBC A;  3E83 A;  2BOB C;  2K1E A;  2EIJ C;  2Q68 A;  2EIK C;  1M56 C;  3F7Y C;  3JYC A;  4JTC B;  3OR6 C;  4PDL A;  4MVR A;  5CBG A;  3SYC A;  1OCR C;  2EIL C;  4GX2 A;  4BW5 A;  3TET A;  1V55 C;  3SJQ C;  5IY5 C;  2A9H A;  3OUS A;  3WG7 C;  5EBW C;  2WLM A;  3GB7 C;  2ITC C;  3LDD A;  5B1B C;  1R3I C;  3SPH A;  1LNQ A;  5KUM A;  3ABL C;  2HG5 C;  4I9W A;  3E8G A;  3K08 A;  2DYR C;  4XDL A;  5EBL C;  3STL C;  1K4D C;  3LDE A;  2KB1 A;  3IGA C;  3K06 A;  4J9Y B;  4MVO A;  4RAI A;  2QKS A;  2WLJ A;  3T2M A;  2X6A A;  3RW0 A;  4MVQ A;  1JVM A;  4R8C A;  4X89 A;  2ATK C;  2ZD9 A;  3E86 A;  4GX0 A;  2R9R B;  3T4D A;  2YEV A;  3SYA A;  2H8P C;  4LCU C;  1R3K C;  3AG3 C;  2AHY A;  3AG4 C;  3LUT B;  1ZWI C;  4MW3 A;  4PA3 A;  4R6Z A;  4F4L A;  1BL8 A;  2WLL B;  3TCU A;  1J95 A;  1OCZ C;  1QLE C;  3FB5 C;  3OGC C;  4HYO A;  4QNH B;  4H33 A;  2JK5 C;  3ABM C;  4QE7 A;  3UKM A;  4H37 A;  2NLJ C;  4GX1 A;  4X88 A;  3BEH A;  3UM7 A;  3KG2 A;  2WLI A;  3HPL C;  2A0L A;  3SPJ A;  1R3J C;  4GX5 A;  3E8B A;  3K0D A;  3F7V C;  3SPC A;  2EIN C;  1V54 C;  4ZBM A;  3LDC A;  4PA6 A;  4DXW A;  2ITD C;  1ORQ C;  3OUF A;  4R50 A;  3RBZ A;  1R3L C;  5B3S C;  3RVZ A;  4WFF A;  3SYQ A;  1G4Y B;  3OR7 C;  5EK0 A;  2X6B A;  3SPG A;  4P9P A;  5BZB A;  4RUF A;  2DWE C;  4WFH A;  5EC1 C;  3FB7 C;  4MTO A;  4UUJ C;  4MTF A;  2A79 B;  3E8F A;  1KKD A;  1XL6 A;  3E89 A;  3RVY A;  5CBH A;  2HVK C;  4MTG A;  3T4Z A;  1OCO C;  2IH3 C;  4MVM A;  2Q67 A;  2WLH A;  2ZXW C;  5B1A C;  4XDJ A;  3SYP A;  1P7B A;  2WLI B;  4MVU A;  2OCC C;  2HJF C;  4P9O A;  4TWK A;  4P30 A;  4MVS A;  4HZ3 A;  3F5W C;  4R7C A;  5J9P C;  4X8A A;  4XDK A;  2HVJ C;  4MSW C;  4PA7 A;  3E8H A;  2DWD C;  3EFF K;  4KFM A;  5KUK A;  5E1A C;  4RO2 A;  2Q69 A;  4RUE A;  1OCC C;  4LP8 A;  2HFE C;  2P7T C;  3K03 A;  3AG2 C;  3FB8 C;  3IFX A;  3STZ C;  3X2Q C;  3ABK C;  3SYO A;  4PA4 A;  4PDV A;  2WLL A;  4MW8 A;  4WFG A;  2EIM C;  2WLK A;  3VOU A;  5EC2 C;  1XL4 A;  2QTO A;  1S5H C;  2Y69 C;  3ASO C;  4P2Z A;  4J9Z B;  4MVZ A;  1M57 C;  3PJS K;  4JTA B;  4PDR A;  3ZJZ A;  2WLN A;  4EKW A;  4LBE C;  4G27 B;  2DYS C;  4PDM A;  4MS2 A;  1K4C C;  2AHZ A;  3K04 A;  3LNM B;  4G28 B;  2IH1 C;  2Q6A A;  2W0F C;  3AG1 C;  3SPI A;  3ZRS A;  3K0G A;  2X6C A;  4WFE A;  4PA9 A;  3R65 A;  3ASN C;  4QE9 A;  5CBF A;  3T1C A;  4OXS A; 
#chains in the Genus database with same CATH topology
 3CHX A;  4GKJ O;  2QGN A;  1VQK V;  3KZI Z;  1B3Q A;  2K1E A;  4X20 A;  2WPD G;  3VQY A;  4K8Z A;  5JH7 A;  1I5X A;  4K8X A;  5EIB D;  2QM7 A;  1K33 A;  3K5N A;  2UXC O;  1RM1 B;  4KL1 A;  5KUM A;  4GZR B;  5IYD O;  4YHH O;  1H2N A;  1AP5 A;  1JFF A;  2ZR3 A;  1HDJ A;  1I0H A;  4J7J A;  5GW7 A;  4EB6 A;  3OTF A;  2CK3 G;  1HR0 B;  4IT5 A;  2LW7 A;  1I94 B;  4ABM A;  3J81 N;  4DK1 A;  4JF3 A;  4JI5 B;  2DN9 A;  1KMI Z;  4H13 B;  1QLE C;  4H33 A;  1XHX A;  4LF5 O;  4CC5 A;  2DE0 X;  2WLI A;  1V55 B;  3E8B A;  1S77 D;  4YJ3 B;  3L75 H;  2ZT9 B;  3RBZ A;  3K59 A;  1NT2 B;  4O4H B;  1WPX A;  2DYR B;  3D3I A;  5F2V O;  4QPK A;  2H94 A;  4UCU A;  5IYB O;  1CEZ A;  3FB7 C;  3CJH B;  1VMG A;  4AQY O;  1IBL O;  2OIE A;  2RMK B;  1OCO C;  2LFR A;  1SF9 A;  4X1I B;  4J11 A;  2XAJ A;  1VQ9 V;  1FFT B;  3E8H A;  4UCV A;  1EN6 A;  2Q69 A;  5FL7 G;  5K1X A;  5D5P A;  3CEI A;  2RCV A;  1NTK H;  4I50 A;  2WLK A;  2F4V B;  3Q4H A;  1US6 A;  1ZX3 A;  1ZSP A;  1H2S B;  1URF A;  1N8R W;  1GH6 A;  3JAL B;  2YIA A;  4OGQ B;  5CBF A;  1K5Q A;  1JPX A;  4JTD B;  3GWK C;  1N33 O;  2FB5 A;  2EIK C;  1UFI A;  5CBG A;  2YSU B;  1Q3E A;  4TQD A;  2EZO A;  1IUR A;  2IJJ A;  4O4J A;  4NKG B;  4DV6 O;  3RYC B;  4O4L B;  4X62 B;  1L0L H;  5GON B;  1Z2G A;  1M57 B;  3HKC A;  2CH7 A;  3B77 A;  2QKS A;  1QLN A;  2JVD A;  4J7Z A;  2ZD9 A;  2QEX V;  2AZ0 A;  3HKD A;  4X20 B;  3OW2 U;  2NN4 A;  2YEV A;  2H8P C;  2AHY A;  5JH7 B;  3APO A;  1VQ6 V;  3H1J H;  4AHC A;  4X64 O;  3K5O A;  5L3B A;  1WJZ A;  4X65 B;  3CCU V;  1Q8I A;  1K8A W;  3SPJ A;  3U11 A;  4DV1 O;  1OZ0 A;  5KHK A;  5KX5 A;  1JOY A;  1JFF B;  2QWO B;  4OPH A;  3UCS C;  1SKV A;  2EZP A;  5B1B B;  1EBO A;  2Z5U A;  1XUQ A;  3H1I H;  4MTX A;  2XAG A;  2BTQ A;  3D3Q A;  2X6B A;  2W6J G;  3ZMZ A;  1KKD A;  3DGE A;  3RYI A;  3T4Z A;  2Q8V A;  4MTG A;  5LP6 A;  2GUZ A;  1TGO A;  1YF2 A;  1QCE A;  2WLI B;  4IIJ A;  3D36 A;  3ZCC A;  2UXX A;  5FPR A;  1MSD A;  1W59 A;  5AG2 A;  1TAE A;  2Q9L A;  4RO2 A;  3K03 A;  3AG2 C;  3IFX A;  2UUB O;  3ABK C;  2N04 A;  2B1I A;  1NZ6 A;  1XL4 A;  4PDR A;  2WLN A;  1AI7 A;  1IXM A;  1LR1 A;  3RGB A;  2ZR2 A;  2X6C A;  2Y69 B;  1XBL A;  1H2K A;  2CTR A;  3R65 A;  3ZHT A;  5HFM A;  4JI4 B;  3E83 A;  3ZS8 C;  1P84 F;  4LNU A;  4PDL A;  2BSK A;  4FFK A;  4WFB V;  3LSU A;  4I50 B;  1PNK A;  3Q4H B;  1KP2 A;  1EZJ A;  2QKC A;  4QJF B;  1LNQ A;  2HG5 C;  3X2Q B;  1K92 A;  3QO5 A;  3IGA C;  4PD4 F;  3CWB H;  3RW0 A;  4LFC B;  3B2E E;  1NKD A;  1EN4 A;  1Q90 D;  4N23 A;  3LUT B;  3A8T A;  4O4J B;  2JGD A;  4ZI7 A;  4DR7 O;  4PV1 B;  5EIB C;  1N34 B;  1EFR G;  1IX9 A;  1R3J C;  5IE9 A;  4GUN A;  3HKC B;  2CH7 B;  2EBO A;  2D3O W;  1RFY A;  4LWS A;  3G4S V;  3HKD B;  3E35 A;  2YEV B;  5D5Q A;  1DK1 A;  5B1A C;  5KX5 B;  2VQF O;  2LGQ A;  4LR3 A;  3DSQ A;  3DC5 A;  4DUY B;  1MZF A;  2HFE C;  2BTQ B;  3LNN A;  4IHJ A;  5H9C A;  5IWA O;  1AR5 A;  2EIM C;  2R70 A;  1P4R A;  3RYI B;  3H01 A;  5LP6 B;  2GUZ B;  1TA8 A;  4B3T O;  4AI8 A;  1D5N A;  1ZTE A;  2XHB A;  2KG7 B;  3FYE B;  2ZQM A;  1IBK B;  5EZY A;  4BW5 A;  3I5D A;  3MHH C;  3SJQ C;  2JJ1 G;  4LF9 O;  4JI3 B;  3CCM V;  3I55 V;  1OCC B;  2P06 A;  3IJ4 A;  2PZS A;  1GM8 A;  3K06 A;  1Y6X A;  4RAI A;  3TXQ A;  4J42 A;  4R8C A;  1JVM A;  4Q6G A;  1JR9 A;  1Z5V A;  3OEH G;  4W4K A;  3SYA A;  4DR2 B;  1R3K C;  3MDS A;  2BSK B;  2RQ6 A;  3TCU A;  1OCZ C;  3G6E V;  1L1F A;  2Y48 A;  3FX7 A;  5H6R A;  2YDE A;  4FLV A;  4X66 B;  4LF8 B;  3K0D A;  4QIW F;  3JSN A;  4Z1M G;  2Y0P A;  3OMI B;  2ZKO A;  3G6B A;  2UUC B;  1IVS A;  2Q7H A;  3L72 H;  3K57 A;  3OR7 C;  4B3M O;  4DR3 B;  1EZV H;  4UXN A;  2AGA A;  4RUF A;  1SQF A;  1AB3 A;  4I55 A;  2E5L O;  1AR4 A;  1XNR O;  5CBH A;  2HVK C;  2C2A A;  1WN7 A;  2JGD B;  4BIO A;  4K0K O;  2Q67 A;  4FM1 A;  1PPJ H;  1FXK C;  5J2U A;  1WP8 A;  1F51 A;  3SGI A;  3CC7 V;  3EFF K;  3N2G A;  1BMF G;  1VAR A;  1M93 A;  5LMN O;  4LWS B;  1XEQ A;  1P49 A;  1V54 B;  1COW G;  4DR6 B;  2UXB B;  1IZ3 A;  3ASO C;  4P2Z A;  3ETQ A;  2P90 A;  3OM3 B;  5L3D A;  4G27 B;  4PDM A;  1W2B U;  4FLY A;  3K04 A;  2IH1 C;  2Q6A A;  2W0F C;  1W0K G;  1HNZ B;  3ASN C;  1VQN V;  2JRI A;  3H1H H;  4YXW G;  3W7U A;  1NI8 A;  3GWO A;  2EX3 A;  1BHA A;  1NVP D;  1SQX H;  4E4E A;  4IHJ B;  4K3A A;  3ZRX A;  1HR0 O;  2UXD B;  1YZB A;  5EBW C;  1I94 O;  1WLE A;  4NB5 A;  4JI5 O;  1MNG A;  4DV4 O;  4I5S A;  4J9Y B;  3CMA V;  1NR1 A;  2PYL A;  4JAV A;  2Z3Y A;  5TIS Z;  3LSS A;  2RJZ A;  1ZAU A;  2F66 C;  3OMA B;  3EHB B;  5EZY B;  1K7D A;  1SQQ H;  2HKO A;  4A5U B;  2ODM A;  3AG4 C;  3JAW B;  1VQ5 V;  4JGS A;  4CS2 A;  2QTS A;  1AI4 A;  3QG5 A;  3RFR A;  3ABM C;  4H44 B;  1X4T A;  3BAB A;  3UKM A;  2NLJ C;  5L3F A;  2DMX A;  1S5L Z;  4DW1 A;  1Y66 A;  1QR9 A;  4HAM A;  2OCH A;  3HB3 B;  3BCC H;  1M1K W;  1GN6 A;  1G4Y B;  3SPG A;  4P9P A;  2V1D A;  4LFB B;  5EC1 C;  3FFQ A;  5DEC A;  4JI6 B;  3CCE V;  3JAM N;  2F4V O;  4MVU A;  1WNS A;  2LO1 A;  3H1L H;  3ZRV A;  4PA7 A;  1RP3 B;  2GBO A;  5JCO A;  1SC5 B;  2YXH A;  1AJQ A;  3VQW A;  3JAK A;  5KLV H;  2WLL A;  1R6N A;  3JD4 A;  4I55 B;  5B3S B;  5LOV A;  3ZHV A;  4FLU A;  4X1Y A;  3THO A;  3K5M A;  2VWJ A;  5DN6 G;  5LMU B;  1WA8 A;  2LW1 A;  5J2U B;  4BR6 A;  1MSW D;  4UFZ A;  2CTW A;  2BOB C;  3N2G B;  3TK1 A;  1R6K A;  1TVK A;  4YIP A;  4NVP A;  2A9H A;  5CMU A;  1KUQ A;  4B08 A;  3GB7 C;  3AK1 A;  2CDY A;  3BA9 A;  1PV0 A;  1THZ A;  5EBL C;  3CRA A;  3STL C;  1X59 A;  4DV0 B;  4TV9 A;  4X65 O;  3D8C A;  4MVO A;  3R66 A;  2V7Q G;  2P22 C;  1VIB A;  2P6J A;  3RYF B;  5CA0 A;  3CXH F;  1TUB B;  2EIJ B;  4B3S B;  1W0J G;  3EXA A;  5CA1 A;  1G6U A;  1SRY A;  3JD3 A;  1SZX A;  1H2M A;  1ORQ C;  4GKK B;  5CA3 A;  3BAA A;  1I08 A;  5JQG A;  3IAY A;  1PNL A;  5BZB A;  2OYQ A;  3ZN1 A;  4JYA B;  4YIO A;  1M4U A;  2OWO A;  4CH3 A;  3FYI B;  1VF6 C;  2P67 A;  3IC7 A;  2F23 A;  3AG3 B;  2OCC C;  1PP9 H;  2HJF C;  2JS3 A;  2E75 B;  5JJN B;  5B1N A;  2JGU A;  3W7T A;  3K3W A;  4UV8 A;  2IU3 A;  5BXZ A;  4BW9 A;  2Q7G A;  4H0L B;  1JA8 A;  4KHP B;  1GN2 A;  3W7S A;  2PGG A;  4PDV A;  4JI4 O;  4MW8 A;  3VOU A;  3DC6 A;  2ARH A;  2QR4 A;  3MD0 A;  5LGN A;  1ZL8 A;  3AG1 C;  1XRE A;  5LA6 A;  4DR5 B;  3SDL A;  4TUY A;  1KC8 W;  2JIZ G;  1HW7 A;  1FD9 A;  3OE7 G;  2RDC A;  2ZXW B;  4EFB A;  4JPR A;  3JAK B;  4E2L A;  2ZE7 A;  3G67 A;  4RWU A;  3BPZ A;  2H3O A;  3WB0 A;  1OCR C;  3NR7 A;  1NTZ H;  2EIL C;  1KEC A;  1EN5 A;  3ABT A;  4DV5 B;  3CD6 V;  3OUS A;  4LFC O;  2WLM A;  5LOV B;  1O9G A;  4JV5 B;  3W7X A;  4PEL A;  4X1Y B;  1HNX B;  1FXV A;  3N2K B;  4FM0 A;  3BHP A;  1WA8 B;  3RT3 C;  3MHS C;  4XBF A;  1Q5O A;  2WLJ A;  3ICX A;  1XIL A;  1N34 O;  4AIL C;  5KHH A;  1TVK B;  2XOK G;  3OTO B;  3ABU A;  1GK9 A;  2UU9 B;  4R6Z A;  1AJN A;  1FPO A;  1SQB H;  1J95 A;  1Q7Y W;  3OGC C;  3T1H B;  4X88 A;  1K34 A;  3KG2 A;  2EJ7 A;  4TV9 B;  2E76 B;  1FXK A;  4DRX A;  2ADP A;  3ABL B;  4JI7 B;  3QO8 A;  5BMV A;  2O57 A;  3B8N A;  5CA0 B;  1M9N A;  4MTF A;  1XL6 A;  4DUY O;  1AJP A;  2WLH A;  5LHG A;  5LXT A;  1P7B A;  5KMG A;  2CGN A;  5GTH Z;  4JYB A;  5CA1 B;  4HZ3 A;  4B3R O;  1RSO A;  1VF7 A;  4RQE A;  2B5U A;  1V9P A;  4EB6 B;  2UUA B;  5E1A C;  4RUE A;  2ADQ B;  1RM1 C;  4LP8 A;  5IT9 N;  3STZ C;  2QKA A;  5JQG B;  4B7E A;  4LFA B;  1N36 B;  1S5H C;  1Q86 W;  4X9Q A;  4LF7 B;  5IDJ A;  3JCZ A;  5BY1 A;  3CRC A;  1IBK O;  1XMO B;  4PI0 A;  3K0G A;  1AIL A;  3JAS A;  1GAX A;  2XT9 A;  2P4K A;  2PI5 A;  3F7Y C;  4MVR A;  3SYC A;  4LH7 A;  1V55 C;  1OV9 A;  1WB8 A;  4QPJ A;  2ZDI C;  3LDD A;  4I4T A;  2VQE B;  4DR2 O;  2A3Q A;  1ZL8 B;  3ZMS A;  3K08 A;  2DYR C;  4U3F H;  4TUY B;  2IJK A;  1DF4 A;  2QWN B;  1GKF A;  4NTY A;  4X66 O;  4LF8 O;  3M99 B;  2Y4T A;  2E3C A;  2UUC O;  1GN4 A;  3ZN0 A;  2QE7 G;  1F23 A;  1WP7 A;  4FJC C;  2ZNI A;  4H37 A;  4CZZ A;  1SET A;  3UT5 A;  3F7V C;  2VS0 A;  3B4S A;  3SPC A;  2EIN C;  1Q82 W;  4DXW A;  2YXY A;  3OUF A;  3UO3 A;  1YSC A;  1Z5W A;  1YJN V;  4AQY B;  3VQX A;  3BRC A;  4I7Z B;  1N32 B;  4F6E A;  1L8D A;  3CRQ A;  4IL6 Z;  1JCH A;  4IYI A;  4ZIB A;  3RVY A;  2RN9 A;  1D5A A;  1IBM B;  3RN4 A;  3OFN G;  4DR6 O;  3SYP A;  4N21 A;  2UXB O;  5FNV A;  4XDK A;  1SES A;  1R6T A;  1XNQ B;  1D2D A;  4DRX B;  4GLX A;  1QBZ A;  1HNZ O;  3B8M A;  1LUV A;  3CCQ V;  5LHH A;  1B04 A;  1VP7 A;  1YCI A;  1I7F A;  5BMV B;  4JI2 B;  3BY6 A;  2UXN A;  5JJJ B;  1M57 C;  4EKW A;  2F1M A;  1AP6 A;  2AHZ A;  4FFB A;  3ZRS A;  2UXD O;  3L9D A;  2X0L A;  1S5J A;  5KMG B;  1KB9 F;  4DUZ B;  4G2K A;  1ARO P;  3FB6 C;  3LSQ A;  2Q4P A;  3ZBH A;  2VWK A;  5EBM C;  4FLW A;  1RSO B;  2Q68 A;  1BQ0 A;  4FVM A;  2IJI A;  3KCY A;  2Q73 A;  1R1B A;  1YDX A;  3ML0 A;  5KHI A;  3TET A;  2MK3 A;  2ZCE A;  3HKE A;  3A0R A;  3UO2 A;  5JJE B;  5B1B C;  1FAF A;  1AR1 B;  3ETG A;  3DXR A;  4KP4 A;  2XAF A;  2ZE8 A;  5IJ9 A;  4YY3 B;  1FFX A;  3JAS B;  4NXM B;  4IIJ B;  5KHJ A;  5IYC O;  4MVQ A;  4X89 A;  3I56 V;  5K1P A;  2AW9 A;  3BFR A;  2CTQ A;  4F4L A;  4WFA V;  4NTW A;  1YIJ V;  3O65 A;  4O2B A;  2WA3 A;  3ZHR A;  1F4M A;  1DTO A;  1OJH A;  1R73 A;  4LFB O;  4GX5 A;  5IY5 B;  1VF6 A;  2GHY A;  1SQV H;  3GVM A;  3WG7 B;  4JI6 O;  1S76 D;  4PA6 A;  3ABM B;  3QVN A;  1QVF U;  3P30 A;  2YS8 A;  5FPO A;  1GN3 A;  1H8H G;  4LNU B;  3OT7 A;  4D7S A;  3K9A A;  4NXN B;  4U3J A;  3E8F A;  2Q0O C;  2YIB D;  1QHT A;  2QM8 A;  3UT5 B;  4EFE A;  4F6R A;  1Y76 A;  3APQ A;  3F5W C;  3QO7 A;  4FMT A;  1HWY A;  2DWD C;  4KFM A;  4ASU G;  5LMU O;  1VQ4 V;  4FK5 C;  3X2Q C;  3FAV A;  4QGP A;  2F43 G;  1M5I A;  2DQ0 A;  1PNM A;  2W0X A;  1MOF A;  3A0H Z;  4IGG A;  2XAQ A;  4ZI7 B;  3K79 A;  4L87 A;  5GTI Z;  1VQO V;  4WF9 V;  3T1C A;  2BOC C;  4NTX A;  5FNV B;  1S3J A;  1YVW A;  3CPW U;  4L8J A;  4DV0 O;  2HR3 A;  2DOS A;  5BR8 B;  4ZHQ A;  1EM1 A;  3A0B Z;  2E74 B;  4JI0 B;  3E8G A;  1FXH A;  1SER A;  1I5Y A;  4JAA A;  1GM9 A;  1NU1 H;  1B06 A;  2DYS B;  2WAM A;  2FTK A;  2MW2 B;  4LCU C;  1BE3 H;  1UPG A;  4GKK O;  2GSM B;  3CCR V;  1BL8 A;  3FB5 C;  3HKE B;  4QNH B;  4LF6 B;  2HJD A;  3ZMT A;  4JYA O;  3PN1 A;  1KP3 A;  3DXR B;  5IJ9 B;  1FFX B;  4R50 A;  4RQF A;  2HEP A;  4GT1 A;  3QNE A;  5JVD A;  3ETE A;  5LP6 C;  5ITZ A;  3SJC C;  1YJ9 V;  3QTC A;  4BIU A;  1Q6I A;  4UUJ C;  4Z1V A;  1QVG U;  3L70 H;  3D36 C;  2A7W A;  4MVM A;  4O2B B;  4KHP O;  3ZX6 A;  2JEU A;  3CC2 V;  2LGW A;  2PYJ A;  4P30 A;  4MVS A;  1HNW B;  1QLE B;  4R7C A;  3RWR D;  4UCT A;  1A32 A;  1OCC C;  2OCC B;  4DR5 O;  3FB8 C;  1YTF B;  4J9Z B;  4U3J B;  3ZJZ A;  2HLD G;  2HHH B;  1DLB A;  1SQP H;  3J80 N;  3AEI A;  2XAH A;  4DV5 O;  2PUS A;  3J7A U;  3CRM A;  4PA9 A;  4F6R B;  4PHZ A;  2HP8 A;  2ZDI A;  4OXS A;  4JV5 O;  3BVO A;  1NS1 A;  1HNX O;  1OCO B;  4O4H A;  4PJ0 Z;  3C90 A;  1XDC A;  1SA0 A;  1E1Q G;  3JYC A;  1NTM H;  3FAV B;  1AI5 A;  5LYJ A;  3CJH A;  5CB4 A;  4FPP A;  5E79 Z;  3OTO O;  3HKB A;  2GTA A;  1HP8 A;  2UU9 O;  3DTU B;  2QSA A;  5HFL A;  2M6Y A;  1K97 A;  3JD2 A;  3FKS G;  3T1H O;  5C93 A;  4ICG A;  4IYH A;  4J41 A;  3AK3 A;  4X62 O;  1DF5 A;  5EYP A;  2Q7E A;  2FML A;  2QM4 A;  5J2T A;  4MT8 A;  1KYO F;  4JI7 O;  4JI1 B;  4ZHQ B;  2EIK B;  4FM2 A;  3OGI B;  3E22 A;  4GX1 A;  1FJG B;  4DR1 B;  2Q5Z A;  2PI4 A;  1V54 C;  1IDS A;  1FYJ A;  4DV3 B;  1XI1 A;  2YXL A;  3C3T A;  1NH2 B;  3L71 H;  1K3E A;  2FKX A;  2QWR B;  4OX9 B;  1BGY H;  3O9O A;  4MTO A;  3P3N A;  2UUA O;  4HBN A;  1L0N H;  1J5E B;  1XMQ B;  1MMM A;  5B66 Z;  2IH3 C;  3C3S A;  3RYC A;  4ZKI A;  3CME V;  4JAS A;  4LFA O;  4UCO A;  3CCJ V;  1N36 O;  4UB6 Z;  4O2A A;  4LF7 O;  4TWK A;  4DO2 A;  2LFS A;  3ZMV A;  3T1Y B;  2XAS A;  1XMO O;  3U10 A;  3CCL V;  1VQM V;  1M90 W;  2QWQ B;  3E2E A;  1Q81 W;  5JVD B;  3G71 V;  2EJR A;  4UCR A;  5ITZ B;  3SYO A;  1YXB A;  1PL4 A;  1GO3 F;  1YIT V;  4D7T A;  1QQC A;  3ZHQ A;  4NR1 A;  4CC6 A;  4WCE V;  2VQE O;  2PF4 E;  3CCS V;  4JI8 B;  1M56 C;  5H6Q A;  1RPR A;  3WU2 Z;  3ZIA G;  3ZED A;  1BS3 A;  3M8A A;  4DV4 B;  1VF5 B;  3SPH A;  3AG2 B;  3CSX A;  3ABK B;  1PKX A;  1JJO A;  4FIP C;  2KSD A;  4FLT A;  2FL4 A;  2EUL A;  1Y67 A;  4GX0 A;  2BCC H;  3K58 A;  1MZE A;  1SA0 B;  2OIG A;  3CB2 A;  4LF4 B;  4PA3 A;  5CB4 B;  5LYJ B;  2WLL B;  4DR4 B;  2IM9 A;  1N32 O;  3ZHU A;  1KBH A;  2JK5 C;  4GYC B;  5A9G A;  5L3E A;  2ETN A;  3HKB B;  3HPL C;  3TXS A;  2RNB A;  4CH4 A;  1IBM O;  4JAU A;  2ZM6 B;  5B3S C;  1XQ8 A;  1JMK C;  2EIN B;  5EYP B;  4WFH A;  5J2T B;  1XNQ O;  1CPY A;  1DGS A;  1WPB A;  2X7R B;  1G8M A;  4CH6 A;  4DV7 B;  1JJ2 U;  4JI2 O;  3E22 B;  3S3X A;  3VQV A;  1H2G A;  3JAT A;  4DV2 B;  1VQ7 V;  4O4I A;  2P7T C;  3CX5 F;  4DUZ O;  5C8Y A;  2Y0I A;  2QTO A;  3CRR A;  1BZK A;  4JTA B;  4MS2 A;  1K4C C;  1WAZ A;  4O2A B;  4J7K A;  2OTJ V;  3W7W A;  3F5T A;  5B1A B;  2EIJ C;  2PTM A;  2XUM A;  4YY3 O;  4JTC B;  4NXM O;  3B40 A;  4JYC A;  4BAY A;  1R3I C;  4GKJ B;  2ZIO A;  2Q0A A;  2F93 B;  3EVK A;  2QA4 V;  2EIM B;  5H2F Z;  4JI3 O;  3T2M A;  3K5L A;  2G38 A;  3OD4 A;  3E86 A;  5CN0 A;  2UXC B;  2GV9 A;  2OTL V;  4UVA A;  3AG3 C;  2JDI G;  4YHH B;  2ZE6 A;  4I0X A;  1ZWI C;  4JZG A;  3KCX A;  2CAZ C;  4HYO A;  3L74 H;  1ZLZ A;  4D6T H;  1Q43 A;  2ZIN A;  2B1G A;  3WFV A;  1VQL V;  4NXN O;  3TJT A;  2BE3 A;  4ZBM A;  3LDC A;  5LA6 B;  2KG7 A;  1IXB A;  1R3L C;  3RVZ A;  2N05 A;  1MA1 A;  4LF5 B;  3L73 H;  5FLX N;  1K5S A;  3ETD A;  4UVB A;  2A79 B;  4DR3 O;  1YHQ V;  2ZXW C;  5JCO C;  1U97 A;  4ZOL A;  1OCZ B;  2YI8 A;  5KUK A;  1KKC A;  1IBL B;  1VQ8 V;  1PD3 A;  5A2Q N;  1QR8 A;  2CGO A;  3BA8 A;  2JS5 A;  5B1O A;  2QDO A;  5KAF Z;  2AZ2 A;  1NBM G;  2YID A;  3QF7 A;  2Z0A A;  2FYU H;  3RYH A;  4G28 B;  5L3C A;  5BR8 O;  1PM9 A;  3UQ8 A;  4DW0 A;  3HR0 A;  3MAQ A;  4WFE A;  1GMG A;  3CE2 A;  2LQT A;  3P3P A;  4JZ2 A;  1MAB G;  1Y4M A;  4JI0 O;  3JAT B;  1FXK B;  4O4I B;  5JWP A;  3OR6 C;  5C8Y B;  4GX2 A;  4U7N A;  4FLZ A;  2KKW A;  3ABL C;  1E79 G;  1N33 B;  1VEW A;  4XDL A;  5LXT B;  2GDS A;  3SR2 C;  3ASO B;  1NQT A;  2KB1 A;  4LF6 O;  1MG1 A;  1ZUQ A;  4FZ1 A;  2ATK C;  4Z2W A;  2R9R B;  4KXR A;  1SZT A;  4DV6 B;  3ASN B;  2L35 A;  4MW3 A;  1KD1 W;  4Q20 A;  3JCU Z;  4DK0 A;  4TQF A;  3ZMU A;  1F4N A;  3BEH A;  2A0L A;  4TV8 A;  2YUA A;  3VBB A;  1N0J A;  2ITD C;  2VRZ A;  2YC0 A;  3P32 A;  4X64 B;  4WFF A;  1ROP A;  1HNW O;  3B09 A;  3OAA G;  4K35 A;  4I0X B;  4DV1 B;  5LL6 Y;  4B3R B;  5DM6 V;  1GM7 A;  4I4T B;  2ZNJ A;  2P4V A;  5IYZ A;  3AG4 B;  5KAI Z;  1S72 V;  1P7G A;  1QNM A;  1Y74 A;  4U7O A;  3OMN B;  2HHH O;  4UV9 A;  2ZIM A;  2A06 H;  4MSW C;  2R72 A;  1BSM A;  3H9V A;  2JEX A;  2WA4 A;  1S0V A;  2QJ1 A;  3ZHS A;  5KHG A;  2YIB A;  3JAW A;  1FS0 G;  1KU9 A;  1BHB A;  3AG7 A;  5EC2 C;  4YJ2 A;  2Y69 C;  1OHH G;  1ENV A;  3PJS K;  1SQG A;  3KKY A;  3WB2 A;  3CCV V;  1XHZ A;  2UUB B;  4QE9 A;  1K9M W;  4ZOL B;  4HNA A;  1QU7 A;  1N0N A;  4NYK A;  4CBC A;  2IW5 A;  4JYY A;  2B9Z A;  4UB8 Z;  1GRJ A;  4LC1 A;  4B7K A;  1E1R G;  4FZ0 A;  1YTF D;  3S3W A;  1Q6H A;  2ITC C;  2R9I A;  4TSF G;  1H8E G;  3RYH B;  3ZRW A;  1U96 A;  4I9W A;  2ZE5 A;  2YI9 A;  5L3G A;  1K4D C;  4JI1 O;  3LDE A;  3N27 A;  2X6A A;  4FLX A;  1FJG O;  4DR1 O;  1CXZ B;  3TGU H;  1NJI W;  2DW4 A;  2M7W A;  5DED A;  4DV3 O;  2CE4 A;  5KA6 A;  1G1X B;  2W6I G;  1F7Y A;  4QE7 A;  5IJ0 A;  2WSS G;  3UM7 A;  4FFB B;  4OX9 O;  1J5E O;  4OPA A;  1XMQ O;  1AI6 A;  1LUW A;  2D2C B;  2OT5 A;  4B3S O;  4X1K A;  2NNU A;  3SJA C;  3SYQ A;  3SJB C;  4WBN A;  5LGU A;  4DR7 B;  3CXC U;  3T1Y O;  4I9Q A;  1BT8 A;  4BWA A;  2XTA A;  2IBZ H;  3E89 A;  1VQP V;  5B5E Z;  1BQZ A;  4TOI A;  3OEE G;  4BIZ A;  4TV8 B;  3CS5 A;  3JAR A;  2CTP A;  3G80 A;  2KQX A;  5J9P C;  1WB7 A;  1AVM A;  2YIC A;  3RYF A;  2K9P A;  4PA4 A;  2DQ3 A;  2L6L A;  1NH2 D;  4J80 A;  4W4L A;  1TUB A;  3CYO A;  1Q6U A;  1JQ0 A;  2VQF B;  4LBE C;  4JI8 O;  5LGT A;  2WWW A;  1YEW A;  3LNM B;  2R9A A;  4EEQ A;  2P5O A;  4UCS A;  5IYZ B;  5H5N A;  5IWA B;  1Y74 B;  4CS3 A;  1SS3 A;  3IC9 A;  2GTS A;  1N4C A;  5LBQ A;  1RPO A;  2N74 A;  1XOU A;  5IY5 C;  2JJ2 G;  3WG7 C;  3FD9 A;  4YJ2 B;  4B3T B;  2QWP B;  1H2L A;  1M56 B;  4LF4 O;  4UVC A;  3M7M X;  4DR4 O;  1JX9 A;  2LJ2 A;  2NR5 A;  1NR7 A;  4YJ3 A;  1Y76 B;  1O9H A;  4HNA B;  2CUG A;  2PY5 A;  1BCC H;  5LHI A;  3AG1 B;  4DYL A;  4LF9 B;  3T4D A;  3JSL A;  2AXT Z;  4PI2 A;  2ZM6 O;  2LP7 A;  2Y4U A;  1T5E A;  2XND G;  4CH5 A;  1OCR B;  3ZRW B;  3WB1 A;  2EIL B;  4J10 A;  4X1I A;  3A2F A;  3NXS A;  2IJH A;  1GTO A;  3JD0 A;  1PL0 A;  4CS4 A;  5KA5 A;  2DJV A;  4DV7 O;  1K73 W;  4LH6 A;  5EK0 A;  2DWE C;  2IU0 A;  4GCZ A;  3K9S A;  4DV2 O;  1YI2 V;  4KUM A;  1H38 A;  3N2K A;  2BTO A;  1KQS U;  5IJ0 B;  4XDJ A;  1FKA O;  1TUE B;  1YJW V;  3JAL A;  4P9O A;  4B3M B;  1CP9 A;  3AK2 A;  3JD1 A;  4X8A A;  2HVJ C;  1B6Q A;  1NVP B;  3H1K H;  3CC4 V;  4X1K B;  2E5L B;  2V4D A;  1XNR B;  4WBN B;  2F95 B;  4K0K B;  4WFG A;  4MVZ A;  1UJW B;  2ILM A;  4C7U A;  2DYS C;  4TT3 G;  3SPI A;  4O4L A;  3CP1 A;  5GON A;  5LMN B;  3U0Z A;  3JAR B; 
#chains in the Genus database with same CATH homology
 1ARO P;  3FB6 C;  4YXW G;  3LSQ A;  5EBM C;  2OTJ V;  3W7U A;  3W7W A;  1VQK V;  2K1E A;  2EIJ C;  5B1A B;  3GWO A;  2Q68 A;  2IJI A;  2WPD G;  1NVP D;  1BHA A;  4JTC B;  3ML0 A;  3ZRX A;  1I5X A;  2MK3 A;  3TET A;  2QM7 A;  3A0R A;  1K33 A;  4JYC A;  5EBW C;  1WLE A;  5B1B C;  4BAY A;  1R3I C;  1RM1 B;  1AR1 B;  5KUM A;  3ETG A;  5IYD O;  4KP4 A;  2XAF A;  2QA4 V;  2EIM B;  2ZR3 A;  4I5S A;  4J9Y B;  3CMA V;  5GW7 A;  1NR1 A;  4JAV A;  2CK3 G;  5IYC O;  2Z3Y A;  3T2M A;  4MVQ A;  4X89 A;  3LSS A;  3E86 A;  5CN0 A;  3OMA B;  3I56 V;  3EHB B;  2OTL V;  1K7D A;  4UVA A;  2HKO A;  3AG3 C;  2JDI G;  4JF3 A;  3AG4 C;  1ZWI C;  1VQ5 V;  4F4L A;  4JGS A;  4WFA V;  1YIJ V;  1QLE C;  4HYO A;  1AI4 A;  4H33 A;  3ABM C;  3UKM A;  1F4M A;  2B1G A;  2NLJ C;  1DTO A;  5L3F A;  1R73 A;  2WLI A;  3WFV A;  4GX5 A;  1VQL V;  1V55 B;  3E8B A;  1Y66 A;  1S77 D;  5IY5 B;  4ZBM A;  2GHY A;  1QR9 A;  3LDC A;  3WG7 B;  1S76 D;  4PA6 A;  3ABM B;  4HAM A;  3RBZ A;  1QVF U;  1R3L C;  3HB3 B;  3RVZ A;  3P30 A;  1M1K W;  1G4Y B;  1WPX A;  3SPG A;  4P9P A;  2DYR B;  3D3I A;  1H8H G;  1K5S A;  4QPK A;  2H94 A;  2V1D A;  5IYB O;  3K9A A;  5EC1 C;  3FB7 C;  3ETD A;  4UVB A;  1CEZ A;  2A79 B;  3E8F A;  1OCO C;  3CCE V;  1YHQ V;  2ZXW C;  2LFR A;  2QM8 A;  4MVU A;  1OCZ B;  2XAJ A;  3F5W C;  3ZRV A;  3QO7 A;  4FMT A;  1VQ9 V;  4PA7 A;  1FFT B;  1HWY A;  3E8H A;  2DWD C;  4KFM A;  4ASU G;  5KUK A;  1AJQ A;  2Q69 A;  5FL7 G;  1VQ8 V;  1VQ4 V;  4FK5 C;  1PD3 A;  1QR8 A;  3X2Q C;  5B1O A;  2WLL A;  1R6N A;  2F43 G;  2WLK A;  3JD4 A;  1NBM G;  5B3S B;  2DQ0 A;  1PNM A;  1MOF A;  2XAQ A;  4G28 B;  5L3C A;  3K79 A;  1N8R W;  5DN6 G;  4L87 A;  4WFE A;  1GMG A;  1VQO V;  4WF9 V;  5CBF A;  1MAB G;  3T1C A;  1K5Q A;  1MSW D;  1Y4M A;  2BOC C;  1JPX A;  4JTD B;  1S3J A;  2BOB C;  3CPW U;  3TK1 A;  1FXK B;  2EIK C;  1R6K A;  3OR6 C;  5CBG A;  2HR3 A;  2YSU B;  4GX2 A;  4U7N A;  2EZO A;  2A9H A;  5CMU A;  2IJJ A;  3GB7 C;  3ABL C;  1E79 G;  3E8G A;  1THZ A;  4XDL A;  5EBL C;  3STL C;  1FXH A;  1SER A;  1I5Y A;  3ASO B;  1NQT A;  2KB1 A;  1M57 B;  1GM9 A;  1MG1 A;  2DYS B;  3B77 A;  2QKS A;  4MVO A;  2V7Q G;  1QLN A;  2WAM A;  2ATK C;  2ZD9 A;  2QEX V;  2R9R B;  2FTK A;  3OW2 U;  1SZT A;  2YEV A;  2H8P C;  2P6J A;  4LCU C;  3ASN B;  2AHY A;  4MW3 A;  1KD1 W;  4Q20 A;  2GSM B;  1VQ6 V;  3CCR V;  1BL8 A;  3FB5 C;  4QNH B;  5L3B A;  2EIJ B;  3CCU V;  1W0J G;  3ZMU A;  1F4N A;  3ZMT A;  1K8A W;  3BEH A;  3SPJ A;  2A0L A;  1KP3 A;  1OZ0 A;  1JOY A;  3VBB A;  1SRY A;  3JD3 A;  2ITD C;  1ORQ C;  4R50 A;  4RQF A;  2EZP A;  5B1B B;  1EBO A;  4GT1 A;  5CA3 A;  2Z5U A;  3P32 A;  3QNE A;  4WFF A;  3ETE A;  4MTX A;  2XAG A;  1ROP A;  2X6B A;  1PNL A;  2W6J G;  5BZB A;  3ZN1 A;  1YJ9 V;  3OAA G;  4BIU A;  3ZMZ A;  1QVG U;  4UUJ C;  1KKD A;  3DGE A;  3FYI B;  3T4Z A;  4MTG A;  4MVM A;  2P67 A;  2JEU A;  1GM7 A;  5DM6 V;  3CC2 V;  3IC7 A;  3AG3 B;  1QCE A;  2WLI B;  3AG4 B;  2OCC C;  2HJF C;  1S72 V;  4U7O A;  4P30 A;  4MVS A;  3D36 A;  3OMN B;  5B1N A;  3ZCC A;  1QLE B;  2UXX A;  3K3W A;  4UV9 A;  4R7C A;  3W7T A;  4MSW C;  4UV8 A;  2IU3 A;  2JEX A;  1S0V A;  4RO2 A;  1OCC C;  2OCC B;  3K03 A;  3AG2 C;  3FB8 C;  3IFX A;  3W7S A;  3ABK C;  1YTF B;  4PDV A;  4MW8 A;  1FS0 G;  3VOU A;  2B1I A;  1BHB A;  5EC2 C;  1XL4 A;  2Y69 C;  4J9Z B;  3ZJZ A;  1OHH G;  1ENV A;  3PJS K;  4PDR A;  2HLD G;  2WLN A;  1AI7 A;  1DLB A;  1IXM A;  3MD0 A;  5LGN A;  3AG1 C;  3AEI A;  2ZR2 A;  2XAH A;  3CCV V;  2X6C A;  2Y69 B;  4PA9 A;  3R65 A;  1KC8 W;  2JIZ G;  4QE9 A;  5HFM A;  1K9M W;  2ZDI A;  4OXS A;  3OE7 G;  4CBC A;  1OCO B;  2IW5 A;  3E83 A;  2ZXW B;  4JPR A;  3JYC A;  1E1Q G;  4E2L A;  4PDL A;  4LC1 A;  1OCR C;  4WFB V;  1AI5 A;  2EIL C;  1E1R G;  1KEC A;  3ABT A;  3CD6 V;  3OUS A;  1PNK A;  1YTF D;  1KP2 A;  2WLM A;  1EZJ A;  2ITC C;  4QJF B;  2R9I A;  3W7X A;  4PEL A;  1LNQ A;  1H8E G;  4FPP A;  1FXV A;  4TSF G;  2HG5 C;  3X2Q B;  3ZRW A;  4I9W A;  3DTU B;  5L3G A;  1K4D C;  5HFL A;  3LDE A;  1K92 A;  3MHS C;  3IGA C;  3QO5 A;  4XBF A;  1K97 A;  3JD2 A;  3FKS G;  2WLJ A;  5C93 A;  2X6A A;  3RW0 A;  1NKD A;  1NJI W;  2DW4 A;  2M7W A;  1DF5 A;  2XOK G;  3ABU A;  4N23 A;  1GK9 A;  4MT8 A;  3LUT B;  4R6Z A;  5KA6 A;  1AJN A;  1Q7Y W;  1J95 A;  3OGC C;  2W6I G;  2EIK B;  4QE7 A;  2WSS G;  4GX1 A;  4X88 A;  1K34 A;  3UM7 A;  3KG2 A;  1EFR G;  1R3J C;  2PI4 A;  1AI6 A;  1V54 C;  2OT5 A;  1FXK A;  3ABL B;  2NNU A;  3SYQ A;  2EBO A;  2D3O W;  1NH2 B;  5LGU A;  3G4S V;  3QO8 A;  3E35 A;  3CXC U;  2YEV B;  1K3E A;  3B8N A;  4MTO A;  1M9N A;  4MTF A;  1XL6 A;  3E89 A;  1VQP V;  1AJP A;  2IH3 C;  2WLH A;  5B1A C;  4ZKI A;  4JAS A;  5LHG A;  3CME V;  1P7B A;  3CCJ V;  3OEE G;  4BIZ A;  4TWK A;  4JYB A;  4DO2 A;  4HZ3 A;  2LFS A;  3ZMV A;  2XAS A;  5J9P C;  4RQE A;  2B5U A;  3CCL V;  1VQM V;  1M90 W;  3E2E A;  5E1A C;  4RUE A;  1Q81 W;  1RM1 C;  4LP8 A;  3G71 V;  2EJR A;  2HFE C;  3STZ C;  5H9C A;  3SYO A;  4PA4 A;  2DQ3 A;  2EIM C;  1NH2 D;  3CYO A;  1JQ0 A;  1S5H C;  1Q86 W;  1GO3 F;  1P4R A;  5IDJ A;  3JCZ A;  4LBE C;  1YIT V;  5LGT A;  3H01 A;  2WWW A;  3LNM B;  3K0G A;  4WCE V;  5LBQ A;  3FYE B;  2ZQM A;  3CCS V;  2PI5 A;  1M56 C;  3F7Y C;  5H6Q A;  1RPO A;  4MVR A;  1RPR A;  3SYC A;  3ZIA G;  4BW5 A;  1V55 C;  3MHH C;  3SJQ C;  5IY5 C;  2JJ2 G;  3WG7 C;  4QPJ A;  2JJ1 G;  1M56 B;  2ZDI C;  3LDD A;  3SPH A;  1OCC B;  3I55 V;  3CCM V;  3AG2 B;  3ABK B;  3ZMS A;  1PKX A;  3K08 A;  4FIP C;  4UVC A;  2DYR C;  1JX9 A;  1NR7 A;  1GM8 A;  3K06 A;  2IJK A;  1DF4 A;  4RAI A;  1GKF A;  5LHI A;  4R8C A;  1JVM A;  3AG1 B;  3M99 B;  4GX0 A;  3T4D A;  3OEH G;  3SYA A;  1R3K C;  3ZN0 A;  4PA3 A;  2QE7 G;  1F23 A;  3TCU A;  2WLL B;  2LP7 A;  1OCZ C;  3G6E V;  4FJC C;  1L1F A;  2Y48 A;  2JK5 C;  4H37 A;  2XND G;  5H6R A;  5L3E A;  4CZZ A;  1SET A;  1OCR B;  3HPL C;  3ZRW B;  2EIL B;  3JD0 A;  2IJH A;  3F7V C;  1GTO A;  3K0D A;  3NXS A;  2EIN C;  4QIW F;  3SPC A;  3OMI B;  1PL0 A;  4Z1M G;  1Q82 W;  5KA5 A;  4JAU A;  4DXW A;  3OUF A;  1YSC A;  5B3S C;  1YJN V;  1K73 W;  3OR7 C;  5EK0 A;  4UXN A;  2EIN B;  4RUF A;  2DWE C;  4WFH A;  2IU0 A;  1JCH A;  4GCZ A;  1YI2 V;  1CPY A;  4KUM A;  1H38 A;  3RVY A;  5CBH A;  2HVK C;  2C2A A;  2Q67 A;  2X7R B;  3OFN G;  1G8M A;  1KQS U;  4XDJ A;  1JJ2 U;  1FXK C;  3SYP A;  1TUE B;  4N21 A;  1YJW V;  4P9O A;  1CP9 A;  1F51 A;  3JD1 A;  4X8A A;  1SES A;  4XDK A;  2HVJ C;  1B6Q A;  3CC7 V;  1NVP B;  1H2G A;  3EFF K;  3CC4 V;  1VQ7 V;  1BMF G;  1QBZ A;  3B8M A;  2P7T C;  3CCQ V;  5LHH A;  1V54 B;  1COW G;  4WFG A;  3BY6 A;  2UXN A;  2QTO A;  3ASO C;  4P2Z A;  4MVZ A;  1M57 C;  2P90 A;  3OM3 B;  4JTA B;  4EKW A;  1UJW B;  5L3D A;  4G27 B;  2DYS C;  4TT3 G;  4PDM A;  1W2B U;  4MS2 A;  1K4C C;  2AHZ A;  3K04 A;  3SPI A;  3ZRS A;  2IH1 C;  2Q6A A;  2W0F C;  1W0K G;  3CP1 A;  2X0L A;  3ASN C;  1VQN V;  4G2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...