5EC1A

Kcsa with v76ester mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1A02
1R6VA 3MFGB 4MD0B 1K85A 1GGCL 5M7QA 4PJXA 3RVTD 2DRUA 3DXAD 4LHQB 1IL1B 5DJCB 3WNLA 4F33B 3U4EB 4A2MA 1U3YA 1FDLL 4OI7A 2AGJH 4JREB 4KKBC 2CIIB 1EO8L 3SKNA 4PJAA 2WBWB 3TBWB 2DTML 1FNLA 4JFOA 5DI8B 3ELAT 2A74B 1JE6A 3ZTNL 5IG7A 3DVGB 4MXVF 1T1YB 3FKUS 1YECH 4TTGA 3VXMD 3VXUB 1RURH 1WCBA 5I1DB 1YY9D 4LEXL 3NA9L 2AQ2A 3EFFB 4F2MA 4F80A 1J1XH 1NCCL 4I0CC 1CDCA 1A6WL 1OQXA 2I5YH 4N8VA 1W0YT 3E6HB 2AQ3A 1HSAB 4I3SL 4GW5A 3FO9A 4ISVA 4HH8A 2X4TA 1AGBB 3OQ3B 4LLVB 3LS4H 2H8PA 4O4YL 2VO5A 4N5EC 4JHAL 1VADA 3QO1B 4HKBA 1LEGB 4HWBL 3WFEH 3RIFK 2VN7A 4R0LC 2X4OA 5JOEA 1B0GB 4UOJA 1ZAGA 3GK8H 3O4OC 4WGVB 3CLEH 4NZRL 3STZA 1FC1A 4HFUL 4L8CB 1EFXB 3J7HA 1B0GA 3IDGA 4WUUA 1ZT4B 3IGAB 2PXYC 1EUTA 4KPHH 5BXFB 4HK0A 3PHQA 4BQBA 5IVXF 4TPRH 5SWSA 1XGPA 4IIQC 3D39D 5ID0A 1UCBL 1X4ZA 2G60L 5EUOF 5FHBH 3EYOB 3LQZB 3LS5L 5D93C 1WTGT 3FQXA 2YUWA 4DOHE 4DKEL 4N0CD 1X5YA 5BQ7A 1EMTH 1CGUA 4U1SB 1HQ4B 4WFFE 4OCRL 1G7HB 3U4BL 1DQLL 1F11A 1V7ML 3GB7B 3P11H 5FYKU 4LQFH 1CLYL 3K2UL 1IMHC 1DVFD 4NZUL 1DBKL 4KZEH 2EDJA 3REVB 2LAGB 2W07A 3KYNA 4KKAD 2EKSB 5J8OA 1G7LB 5DQJB 3JSSA 5DHVA 3WS3A 2XG4A 4XPHH 5A43C 3E1F1 3TN0C 4LLUA 4CN4A 1MLBB 3BZ4B 3WS6C 1SEQH 2C26A 3GRWA 4R4FH 3VWJB 4OZHF 3SPVA 1P2CA 3QDMB 5FM5O 4HT1L 2BXZA 4LF3A 1P4LA 2RR3A 4U1HA 1QACA 2JCCE 2OXHA 2BXYA 2NNAB 2CJUH 3QAZB 1IGML 1QYGH 3DSFH 2OZ4A 2AEIT 5ANMA 4WI2A 1JF1B 3PWPD 4Z0BL 3BKYH 3AAZB 3FT3A 3OKNA 3TBSA 1FNGB 5TE7H 4EDXB 5EUOE 5DC9B 5CD5C 1IGTB 3TH2T 2YD4A 2EDDA 1ES0B 4WTXA 5CUSH 3PQYD 1PW3A 1UM5H 5H8DA 1PGRB 1RULH 5TE4L 4JN1L 4L4TE 4PS4H 2P5WE 4GRWH 3WE6B 4K3DL 1OAZH 1REIA 4LIQL 5BJTA 4TTDD 2GITA 3PHSA 4A6YH 5JW4M 4X6FB 5TFSL 5L0QB 2OL3L 3CVHH 1HXMA 5FCUH 1R5WA 4Z77B 4DGIH 2JB5H 1BFVH 1B0WA 1BQSA 4TSAH 1SMAA 1BZ7A 1I3RA 1TZHA 3HUJE 3O4LB 4WWKB 5IEKB 2Y7QB 1A02N 4Z77A 5EZOL 1JPSH 4JRYD 1Q9KB 4NZUH 4XTRD 1ZHKB 3UBXB 4JQIH 2BY2A 2AXFB 2E9IA 4ZAKB 3ZKMC 1JPFA 3QNXB 1BHGA 1LO5B 3U2SB 1BREA 3T2QA 5L7XL 4AT6A 4WO4D 4G6FB 4WUUB 5IJKC 1E4JA 1GHFH 4G80B 4DN4H 3DIFB 1JTTA 1DE4B 3P0GB 2ED9A 4L8SC 4EI5A 3RL1B 2HJKA 4V2CB 3G6DH 5JW4Q 4MZ3A 4FTVD 4M8VA 3L3HA 4GW4B 4YNYB 4LSSH 4MD4B 2BVOA 3QXAA 4KUCD 4KAQH 5CCKH 2VDRL 3BIKA 1S7WA 3P4LA 3EJJX 4GUPB 4FQQB 2R4SH 5T3XH 4K3EL 3E8UL 2H26A 4LVOB 4XRCA 3AUVA 4WEBH 4KGJA 4WTZA 4AEIL 2VMFA 4RMTA 1WUNT 3F5WA 4IBLT 3LV3A 4NIKB 3ZKNC 1DQMH 2YRZA 1Q0YL 1P7QB 1RZIA 1S7TB 4X80H 4WENB 2FIKA 1CBVL 1V7NL 3VFVB 1J05A 3VXNB 5BMFL 1BLNA 1IAIM 4QRRE 5CD3B 1P5UA 3VFRA 1AGDB 5HSFA 1BF8A 3BN9C 2EEDA 4M7JH 5HYJD 2DMBA 5HVFB 3QNZB 3KWWB 3PP3H 3WO4B 3H7BA 2EDXA 1NMBH 43CAB 5D1ZA 4QY8B 3S97C 1KIPB 3PQYB 4C56D 5HYIA 3E2HC 1MI5D 3IJHA 4X4ME 1WBYA 5D7SL 2YMXH 3RVWC 4OZHA 2XPGA 1GZPB 4HMDA 5IW3A 2X4NA 3X17A 4L3AA 5EULV 3U79A 4GXVH 3LKQB 2IH1B 2JF1A 4FXGB 1CFSB 3NCJL 1ZGLA 5EOCH 1T6VN 3F58L 4KVCH 4KVNL 4QTIL 5EU6D 5LBSL 3DMMD 1LK3L 5IMMB 2F5BL 2NX5A 3UTZB 1G84A 5L6YH 1YEHH 1VADB 3QO1A 2G9HB 2VDOH 4CL7A 5D2LB 5E00B 1NAMA 2PO6B 4ODHL 1NGWA 3O9WA 3I2CL 5C9KA 2HRLA 4L3ED 2GJZB 3P4MA 4Z7NE 4XCEA 2D0FA 4WHTA 1AXTH 4S1SL 4AEHH 5EORH 1RZGB 1GGCH 4W70A 1UM4L 1VFBA 4FMFA 1F4XH 5BMFH 2ADFL 5HHQA 3QWRD 3G9VA 5EO9A 3WL9A 3QDJB 4RNRA 1H15B 4R7DA 3D3VB 5J57B 4MB3A 4AENA 1N59B 2NY0D 3QIUC 3GMQA 3G5YA 4I48B 5JW5B 3MA9H 4U7MA 3WO3B 5DRWB 1S9XB 3CX2A 3NIGE 3U7WL 5F9JB 1GIGL 3LZFH 4QHNB 3HI1A 3QQ9C 4RAVA 3FAXA 4NRZA 3TZVB 4OLXH 4RGNE 4Z7QF 3MRQA 5JPNB 1JGVL 4WI6A 2OX5A 2DLGA 3G6DL 1LVEA 1MFDH 4I3GA 5E7BA 2YN3A 1D6VH 1Q9LB 4BZ2L 3DRTA 4EN3B 2IMNA 4OLYH 3PGCB 4HEME 5HHNB 1TZGL 4MGXA 2R4SL 4QXWA 5T3XL 2HLAA 3DRTB 4KFZC 3GZKA 1UEMA 4NN6C 4LLDA 1JUFB 1RUMH 4R4BA 3PGCA 2H32H 1R3JB 3BO8B 2O61A 4JZNA 3KNBA 4NFDA 5INCA 3RI5K 1J0KA 3KPPB 1UADC 4Y1AE 4NZTL 3ARFC 3L95B 2OK0H 5DC0A 3LKPB 1RU9L 3BT2L 5GGRB 2I24N 2WBKA 5B8CA 2VZ1A 1I3GH 3QUXD 2P5WB 3T08A 3V95A 4JLRA 4QHNA 4TNVK 4UIMA 3QIBD 2J8OA 4FQHA 4IJ3C 1RUQH 3UYOD 3M45A 1M71A 3TYFA 1OOAA 2EECA 1G7IB 4IIQA 4JFEE 1KPRA 2QSTA 3OKKB 4RFNB 3VD3A 5M94B 4KTYA 1XGRA 5GGUB 4ZDHB 4DFHA 1NL0H 3BJ91 2W0FA 2Y9RT 3WO4C 4LPWA 5DUBA 5GGQL 1U93A 4N1HB 4IMLB 1IEAA 5TH2A 2V7NA 5EC1B 4QOKE 5IVXE 4PGJA 5CWSB 1NGQH 5GXBB 1FZOA 5EB9A 3TNMA 3LKNB 1FBIH 1YPZF 1RJLB 4PREB 3E2HB 2GFBA 3OJVC 1GC1L 1B4JL 3NABL 3RRQA 1HXMB 4CN6A 4DVBB 2NY6D 1J10A 4OT1L 3ULUE 3B6SA 2Q7YB 3NCMA 4X9BA 4XMPH 2DWDA 4WV1B 4EUPG 4QYOB 4LDLB 1T5XA 4I5BA 3RDTB 4P5MB 4JKWA 1NUNB 1LK2A 3D2UB 4FFYL 2VZOA 2DIJA 3P73B 1JNJA 3DECA 3FQUA 2QHRL 3VE0B 2AK4D 1TDQA 4U1NB 4XC3L 2IAMC 2E7MA 5BS0D 3LHPH 5EN2A 3IJHB 3FN3A 3OR7A 1JP5A 4TN9A 1C16B 4GKNA 4H26A 2WINA 2ZUSA 3TA3B 1CIUA 3MRHA 3BPOC 2E6QA 1FN4B 3Q6FA 4L8BB 5SWQB 3N0PB 5IMLA 2G75A 5B3NA 1DLHA 4OI9A 1YMMB 2R56H 5DJAA 1WWBX 1JN6A 3NIFF 3O2DA 1NFDE 3T0EA 4M1GH 2XI9A 5FDWB 1VESA 3HC0A 4UT6L 4ERSH 5EUKB 1E6OH 1KLUA 1KF9B 3P77B 1FJ1B 2XFXA 3F5WB 1C7TA 4AY0A 2I60L 3P11L 5I1JH 1AD9B 3MLXH 2Q86A 5T5FL 4U4BA 1MI5B 5BZWA 3M17A 1OTTC 4R0LA 3VFOA 3MV8D 3HA0A 3VGEA 2GAZB 4N0FA 2HLAB 1CICA 4HLJA 4Z7NF 5L0QC 2CRYA 4P5TB 5DJ0B 1RMFL 3JTTA 5DD1L 1ZXQA 1JYNA 2FZ3A 4DWHA 1GGYA 2ZUUA 3B2VL 3D39B 5GISL 2A6JB 5FYJH 1XF2B 1Q9OA 4QGTA 3SO3C 3DJ9A 1UA6H 1S9YB 5JW3L 4XI5D 1I75A 1TIUA 4C59B 3UJTH 4IOFD 2Y25A 3HE7D 4ONFH 4OCLC 1YC7A 4PJHB 5HDLA 2VQTA 2PR4H 5MEOB 4LLMA 1CTOA 2Q3AA 3HMXL 4H20H 3SE9H 3QI9B 1YA5A 1RUQL 3EO1A 3ZYZA 4KY1L 3KPLA 4K8RC 3GHEH 3QHTC 2YRLA 1HQRA 5HXMA 3HZVB 5JOFB 3CZJA 4WFHE 3M07A 4P5TC 4Q6YA 4ZPVA 4XXCA 1YEFH 5TGBA 4XB8A 3I9GL 1T1ZA 3G5XA 2B4CL 3MV8B 2GFBB 3W81A 1KLFA 3EDDA 5GRZA 1U0QA 5IEKA 5KSAA 5AAMA 3D18B 1TZIB 3G6JF 4M7KH 5TQ0H 4KTEH 1VEOA 1IC7H 1OF2A 1WQVT 3DUSB 3C09B 5L6YL 1EV2E 1L7TH 1Q0YH 1JFQH 1EDQA 5I15L 1V3KA 3OX8A 4IRSA 1J1PH 2HMID 2R0WL 3ULSA 2Q8AH 3RP1A 1Y18B 4YPGA 3VFGL 4PR5A 1JMXA 3BZEB 2XY1A 1F02I 3OWEA 2WSKA 4LK4A 2APXA 1MCSA 4HKZA 3GMOB 5C0EA 5FUCE 4XC1L 3OJ2C 2FSEB 3N85L 2R0ZL 2P1YA 1A3QA 4OFKA 2X6MA 4LLMB 4N0RA 4OB5H 4Y4KC 3TA3D 5HY9B 2E27H 4O58H 4N0UE 3VXOA 5J6GB 1QA9A 2H32B 4YHYC 4QRTA 1YPZA 2Z91A 4OZIE 5CINL 5IB3B 3GI9L 2GJ6D 1T1WA 5F1IA 4YHKH 3FQTA 8CGTA 4GW4A 2VL5B 5IHUH 5ESQB 3T3MF 2P48B 3VI3E 3QNYB 4ZFGH 4MMZC 5C71A 4I4WB 5FO8B 3UO1L 3Q6FB 3ILPB 4L8BA 5SWQA 5DSCA 5MEPB 4ZUVA 5SX4I 5HDOA 3BVNB 5FHAH 2UZIH 5D7KD 5EWIL 5ADOL 5LXGL 4PJGA 2AJSL 4L4VD 4OGAD 3GSWB 1V3MA 1AXIB 4DKDC 4AEIH 1J11A 1FYTA 5D2LE 2FIKB 3KJ6L 4X9HA 3P73A 2NY6B 4TNVF 1U8NB 2HLFC 1BZ9B 3BW9B 5C0BE 5DC4B 5FF6A 2FECI 1IT9H 1T20A 3LQMA 2NR6C 1LP9F 5C8JA 4PJ5E 4U49A 1OSZA 1T7XA 4Z7VE 1XF5B 4AH2A 3DI2B 4CVWA 1ZHLB 2EEBA 4HS3A 3MRJA 2DQFB 3CZFB 4MX7A 5IWLC 4JO3L 4DCQA 1BOYA 4JQXA 4X7TB 5GSVA 3VXME 1XF5A 4ZS6D 3UEZA 1FN4A 3VXPA 5E9DA 3H3KA 5FYLD 4ODSH 2Y36H 2HTKD 1CICC 4NT6B 3D9AH 5AZ2L 4TTDC 3T2PA 3MA9L 4ZDHA 3LB6C 5CJQH 3TZVC 4PTUA 4D0DA 2DWEA 2GTWB 3CSGA 4ZFOB 3CC5A 3VXRD 1WC7A 1XF1A 4JCLA 3VDCA 3MC0A 3MLPA 4LCCA 5FKAA 5FO7A 3ARGD 1RY7B 3DV6A 3LKSB 2X1XR 3LRGA 4OZFH 1WBXB 5D96B 3GJFA 1F90L 3O4LE 4RMSA 5GS2D 5GSRA 1KCUH 3RUGE 2UZIL 1T66D 1XEDA 5ACZB 3GI8L 2VDOL 4EN3D 4UINH 3HI6H 3U0TB 1LDSA 2VDLH 5AEAA 1J0YA 4OGYL 4WGWB 2QHLA 3CMOH 4AIXA 3TN0D 4OZGF 3KLSA 4PJ8B 3QI9D 1U8QA 4XWGL 2XTJD 5KVFL 3E8UH 4Y2DA 5HGDA 5BRZE 43C9B 4YHNA 4O5LH 5L2JA 4XBEL 5ALBL 3KPTA 1CGYA 3F7VB 1IAIH 1AIFA 2ICWA 1F5WA 5TE7L 1U3ZA 2XQYG 2YC1A 3V6BR 1S3KL 5TF1H 2IALB 3QDGB 4RIRB 1BQHG 3VFMB 1QSED 4TVPH 4HULB 5JO5A 1E4XH 3L3DA 3VXUE 4NPYB 3TZVA 4LHUD 3SCMB 2VLLB 2UVFA 3T04D 3T77A 2EH7L 1C5DB 2KUTA 2FX8H 3CFJB 5D7LD 3QQNA 5C6PB 4PJXB 4R3SB 2CIKB 3F8UB 4KTEL 4K7PH 5DFVD 4AQOA 1FFOA 5DQDL 4MVBC 1YN7B 4JJHA 2ADIB 3ZTJH 5EU3A 5GS0L 3MNZB 5IQ9A 1G7QB 4TVPE 4FFWC 5F8RC 3X12A 3FB7A 2J6EA 2DQDL 5GIRB 4OLYL 1XGPB 5DURB 1JUFA 2EXWD 4F7CA 3LRSB 3OGCA 3O6KL 2OTWB 3UXFA 3PL6D 4QOKB 5IVXB 4ELME 2C3VB 3CDGB 5F1OB 1IC5H 1UWEL 2O5XH 4POZD 2KQNA 4X5WB 5DR5H 1JPGB 4UUJA 2IAMB 2Q7NA 4AEEA 4MAUL 4EQ2A 5C0AA 2X9WA 5E1HB 2NY2C 1INQB 4HIJB 5I1IL 1PKQA 3BT2H 1WAAE 3MCLL 3TBVB 1X44A 2FGWL 4OZGB 5C09B 3HMXA 1KUMA 1F3DH 1HHJA 5K33A 1QNZH 5TF0A 5J1TC 3CLEL 4NZRH 4JHWL 1MELA 2OMBA 3IKCB 2ESVD 4M48H 4O51B 1GOFA 5FDYA 2NXYC 3ZE1E 3BSZL 4HAGA 3AREA 4JPIB 5JW4R 1QFPA 3GRWL 3PWLB 1NUGA 2A1WL 1I3RB 1I85A 1TZHB 3O4LA 5DD5H 3RY4A 3JV6A 4XXDA 2VXSL 4OIIL 3O45B 1QBBA 4PLJC 5J3HD 1XH3A 4WU5B 3FRUB 1DQJA 3RNKA 1C5BH 2V7HB 4D0BA 5DQDH 4DKEH 4JFHE 5C0FA 3UBXG 2B7DT 4G9FA 1ZVSA 2IGFL 2WUBH 1DCLA 1FH5L 4JAMA 4NM4L 1X6LA 4UV4L 1V7MH 2GTZB 3TIDB 1D6VL 25C8L 4WFED 3U30B 5DUPL 1MFCH 2AJXH 1KELH 2VDQH 2VXUH 3DYOA 4LLYB 3QXAB 4FQIH 3WUWA 4X83A 4E5XA 1T80A 1RUAH 4UT7H 5DMIH 4H88L 1MFEL 3BXNA 4KHTL 1YMMA 3BKCH 4NKDB 4BKLB 4G42A 2EZ0D 2R0KL 5C0BA 2CXGA 1JN6B 1LP9B 4PLKC 1OARL 4L3EB 4YUEH 3IDJB 4UINL 3CCHA 1SMOA 3M8OH 5C07D 3DX8A 3OL2A 5C0BB 2VC2H 4KMLB 1WFOA 2XWTA 4UV7H 5IEHB 5DJCA 5BO1L 3UJJL 1GGBL 1MVUA 4FTVE 2IH3B 3T65A 2PETA 3TH3T 2VE6A 3FO1B 3DHJA 5EIIB 4JFZH 1QVOA 1S9VB 1BVLA 1OM3H 3VXUD 2J3SA 3FB6B 5BW7A 5C09E 2VL4A 3TNNA 4HJGA 3RTQB 4GKZB 2E6JA 5E6ZA 5ID1A 5F6HI 3O81A 4KZDH 1CU4L 3EYOA 1ZHLA 2FD6H 5DWUH 3NGBB 3FQXB 5C6TH 1FCGA 4Y8AA 3MJ9A 4HWNA 5HDQH 3QUMA 4JO3H 4LP5A 4JM4L 3S88L 3RAJL 3MFFB 4M1DL 1R3IL 1VSCA 1HXYA 4PY8I 4P99A 4N9GA 3A6BH 4OM0H 3UTPE 4RFOL 4MNQA 5AG8A 1FO0B 3CC5B 2FJGB 3OXRA 5DJXB 2QQKL 3FB7B 1U95B 3OV6A 1J1OH 5A3ID 3HKFA 4NQEE 3KDMA 5TDNB 2OR7A 4RGMB 1ZHKA 4YFDB 1HSBB 3CSBA 2R23B 2VDNL 2EDEA 2HFEA 1WTLA 3QDMA 3CD4A 5E7FA 5GGRA 5GRJL 3QIUB 1LQSR 2CUHA 1QSFD 5JQHC 3U36B 3EO9L 1I3VA 3FQRA 3CZFA 1PQZB 2AI0H 3BDBA 4HV8A 3FO0L 1PLGH 5C0DB 3HB3D 1NAKH 4CUCA 3PGFH 5DRXB 2EDHA 4Q97A 1WCBB 1WVZA 5GS3A 3BQUB 3ZYIA 4Z7UE 2R69H 2R0WH 1A9BA 3QT2A 2ICWB 1QLRB 5DJDA 3I3EA 5KVMC 2GJJA 3HFML 1A7QL 1E4XI 4UIKL 3I50L 5F7DB 1A3RL 3L9RA 5L2KB 1MEXH 4MA3B 3RPKA 4OI8A 1JRHH 3EO0B 5F1NB 3TYGH 2DMKA 4NN6B 4KK6D 1YEJH 1NGWB 1T03H 1WF5A 1Q9LA 4O02L 3L3OA 1DQQB 1FVEA 4MQTB 4NUJA 3U30C 1YEKL 1MJUL 3V7AG 2CIKA 5E4IA 4NYLB 4U1HB 3X14A 3FRUA 4JRXD 1TPXB 4P59L 4IHOB 4BSWB 1DLFL 1BF2A 4RGOH 1PKOA 4B53A 1SVCP 2HH0H 4QXTB 4P2RB 3KXFB 4WJ5B 3C6LA 4HGKC 1QBLL 4PR5B 1ZEAH 1IAII 2FATH 4I48A 4GO6B 4CVZB 5JW5A 1NSNH 4KTDL 5CJOL 4Q9QL 1U92B 4DZBA 5IMKA 2Z9TA 1NUFA 5B39G 2BOBA 2VJXA 4KY1H 2DJUA 3TIEA 1R3HB 3B9KC 3O3AA 4X6EA 1LO3H 1YEIH 3BQUD 4JR9H 4P48A 2DYPD 1UJ3B 4O2FB 4G8EB 2VUOA 3ARDC 3TZVD 4PRBA 3S37H 5IR1B 1DBBH 1UWEH 1KN4H 4ODUA 4PV8B 4R7NA 4UILL 1U3HA 3OGOE 1ROWA 2J4WL 4M61A 4R90L 2GITB 5TQ0L 5TE4H 4XGZA 4M7KL 5DZLA 2BP3A 2QL1A 3N50A 4ZS6C 1KT2A 4MVBD 5CZVL 1MCWM 3OR6B 4YXLL 2X4PA 4Z8FL 5C0JA 3GO1L 5GS2H 5DK0A 1U8NA 4MNQB 3ARXA 4M6MH 1YQVH 2XZCH 3E0GA 5GGTL 5GS1A 3GMPB 3RVUC 4YHOH 3KXFA 4MSWA 1EVUA 4PBVC 3N9GL 2QSCH 4YDJB 2HLFD 5DRNA 1QEWA 3C6LC 2DKUA 3RWFA 4NN7C 4ONHA 3GM0A 5I75C 1ZT7B 1QRKA 1S9YA 4EUPB 2XTJC 3BUYB 1UWGL 2BDNH 5K59E 4PPTA 1NFKA 1D3CA 1A8JH 2H45A 3RHWF 5DZNA 4ZUWB 4JM2F 4X4XB 4RCAA 3GBMH 3VCLA 3VMPA 1IC5L 5F9OL 3MLRL 3QXDB 1G6RA 4JR9L 4PGDA 3SCMD 5T5NG 3REVA 4EKXA 5D1QA 3C2AH 3DOSA 5A3IC 4LASL 5K93A 1HZHH 3WIIH 3ULVL 4M62H 4FXLA 3CFBA 4K7PX 4XGZB 3UCRA 1IGYA 4F9PC 3VD4A 4Y2DC 5HDBE 2KH2B 1NC4D 3MGTB 4Y88A 1U2HA 3SDDB 5CLWA 1P1ZB 4K7FA 3B2UD 2OYPA 2DBLL 5ICZA 3MV8E 2L0DA 3D3VA 4LFHG 3OZ9H 3PDDA 4G3YL 1OTUD 1PEWA 1JHTA 4PP1C 2JKXA 3CU7A 4KQ4L 3WFZA 3CK0L 1MCQA 3QULB 4M43L 1G7IA 1JHKH 1CLZH 3DX9A 5E2JA 1MFDL 3MLWL 4OQTL 2G5BB 4YBLB 4M5ZL 4CJ1A 3OKDA 5J89A 4N8PA 4GKSB 2YPLB 1MIML 4F15B 4Q9QH 2YEZA 3PXJA 2BSED 5DEGA 1OP3K 4P57A 4NT6A 1YMMD 1LEGA 1VEMA 1RIVL 3GI8H 3MYJB 1WFUA 3D3VE 4DTGH 3NCBB 4JY6A 3MGTA 1NC4B 5LJYH 3WFBL 1OPGH 2MCPL 5IK3A 2P7TA 1KJVA 4I2XE 3FT4B 3K3QA 1S9KC 4NRXB 2AJYL 3BDXA 3RWEA 1DEDA 2R8SH 2EDQA 4AM0B 4H1LH 1YNKL 2EDNA 4Q6IB 4H8WH 5DRZA 5EG6C 4IRJA 3EOTH 5EBGA 2FGZA 2W9DH 5L9DL 2CIIA 1KTKE 1S7RA 2VABA 3QUMH 4OD2B 5D2NA 2X09A 3L95A 2GCYA 5F9JA 4FQJH 4P23A 4QHLB 3DNKA 4Z9KB 5FV2A 1MRFL 2R0LL 4HLZH 1N6QL 1NGPH 3O41A 1IM9A 1BBJA 1B6UA 1D6EB 5E8OB 3LS5H 5C0GA 2YD6A 1N0XL 4J12A 5A2JH 2Z91B 4LPCA 2V9RA 4YK4C 3RDTC 1T0NB 4FQCL 2OP4L 1J9CT 3AVEA 4JPVH 4FQ2L 1EO8H 2LAAA 1KCSL 5I1EL 3OTTA 4LARH 4HUXB 3B9AA 1S9WB 4F7EB 5IF0A 2IPKA 3D2UA 3UTZA 4ONGH 3A6BL 2R0KH 4YFLF 1XMWA 1HKLL 1HNFA 1DUYB 1NDGA 1YYMH 2DWDB 4WV1A 3UC0H 4EDWH 2FX7H 5HHXH 5ESAB 5DK2A 2F58L 1FLRH 4HX1B 5L8KB 4X99B 3D1MC 4QCIA 3MGOB 4AT6B 3P9MB 4U6XA 4MNGB 5SX5K 1G1CA 4PGBA 4TUKH 4XAWL 1UG9A 4H26B 5GJSL 2M2DA 5E6IB 1HINL 5HYEA 3PL6C 5IJKA 3V79C 2E8ZA 2P5EB 3ZT7A 3MBED 5E6IA 1M71B 3TYFB 2IQAA 4YQXL 2H9GA 2GI7A 3ESVF 4V1DD 5D71L 1LHZA 3OKKA 4PJHA 4LFHD 4JGMA 2MNUA 1R5WB 1RI8A 2KQMA 4FFWD 1LO2H 2R1XA 3BKML 2NX5B 4Z6AT 2GEEA 1A6AB 2BVQA 2VXTH 3FB8A 4YBLC 4NUJB 5CZKA 1MJ7L 2GT9A 1IC7L 4G6AC 1RMFH 4NYLA 5SWZB 4NKMA 4NJAH 4N1EA 2WAHA 3HG1A 1P4IH 4HDIB 2VXTL 3QR2A 3EOBA 5DT1H 5L88H 2R4RL 1NMAL 3C8KB 3LRSA 1DQDL 2PO6C 5GRXG 4EJ1C 2D7MA 2OR8A 1OAXH 5E8NB 3ZDXE 2ADGA 4PJ8C 1CTNA 4LARL 1BWMA 1BVLB 2LVCA 3ARVA 5EDXA 1J1OL 1OB1B 3QCUH 4YJZL 4U1GC 3HLAB 5IW6A 3Q48A 3SE9L 1OWRM 1T7YA 3BPCB 4OLVL 5E9DB 5F3BB 4NO3B 5L2KD 2IAMD 3H7BB 1QHPA 4I77L 4JKKA 4NRZB 3VWKA 2XZQL 4QRSA 4GBXA 5CEZE 4JPKL 1FIGH 2MQCA 3P3YA 2WWMC 2MJWA 2VDMH 4PJ5B 4GBXB 4ZD3L 4MJIB 3ZE0E 1MJ8H 4PJGF 5IHZB 1D9KC 2E9JA 3VFMA 2FYYB 1J8HE 3LV3B 4H1LG 4WW2C 2VLRB 5SWSE 1QBAA 3G5VA 1NFIA 3O11B 3TLRA 4XVSL 4PS4L 3MUZ1 4QWWD 1SJEA 5CEZL 2ZUQC 1X7QA 3K1KC 5IT2L 1BJMA 1BQHB 2I9LB 2MKLC 1YZZA 1J5OH 2CQVA 2W9EH 2M8XA 4WWKA 3BX7C 5E5UB 4KJYB 4XMLL 2XIDA 4U1GB 3WSQL 5I8CB 2FR4B 1NAMB 2PO6A 1INDL 1G7JA 5CP3A 2WNGA 1B2WH 4MNQE 1KCLA 5F88B 5C0FB 4NQSB 5C3TA 3RDTA 1UZ6E 2C3XA 2MQ3A 5DMGD 3WSQH 4D9RE 3RHWK 4CVXA 3BESR 2ARJB 2BNQD 1CXHA 2XZCL 5CBEA 4ZTPH 1UFUA 1Y0LA 1FORH 2X4SB 3OAZK 5AWNH 5IFJB 5F7YC 1FFPB 4G6MH 2UY6A 5KSVB 4P3CL 1NLBL 2D03H 3AGVA 3OHXB 2DQHL 2NR6D 3I6KB 2IH1A 4FXGA 2NTSP 1U9KA 4EI5C 1GHFL 4MXQD 4WCYH 5AWNL 4U6YA 3LHPL 4YHPB 2FYYA 3U0PB 3CVIH 4M9PA 2XQBL 1IAKA 2Y72A 12E8H 1QFUH 4I9WD 4PJ7A 1ZWIA 3SOBL 3QEQD 1A1MA 3EYSL 2CMRH 1EJ6A 2ICES 3O9WB 3D87B 5FYKL 5DS8B 4ODVL 1K9TA 3S35X 4XCFH 2M1KA 1DUYA 4BSVB 1ED3A 3DVNB 3T0AA 3NTCH 2XWJB 4JDVA 4JY5L 4KKLC 5IT2H 4L3EE 2OJEB 1UACH 3PHOA 2C1OB 1R3JA 1X5HA 3SDDC 4OJFL 4XNUL 5DJYB 5KSUA 1UJ3C 1NKRA 3QQ9D 4XNYH 1YQVL 1TVHB 3KLHD 4JN1H 3LN5B 4ODTH 4EVNB 5KW9H 1UT9A 3RWJB 1G0DA 3L1OL 4WDIA 2DQGL 5CJQL 5JXEA 4LCIH 5IBLC 4HIHA 3CAFA 5C0CE 2XN9D 1KIRA 1KB5L 1U58B 4XXCC 3I85A 3QNYA 4QRTB 3TVMA 1GGUA 1O0VA 3IDYC 1C5DA 4KDTC 4M1CD 3L5HA 5JMOC 1T1WB 4I0PD 4TUOB 2ZG1A 3LRHA 2XKNA 4LP4A 2IWGA 4XP9L 1KCUL 1G7LA 5A40E 5C9JA 2B1AL 2QQNH 3PWLA 3MLTA 3NA4A 4P5TD 3VFVA 2DQDH 5GZOC 2Q86B 4N5UA 4NO5B 3X13A 4AM0A 2X4OB 3G6JE 5HYJA 5LGKA 4LCWB 3NCYS 4XVSH 2BC4A 3FFCB 4F7TB 3OKLB 5D70L 2LQRA 4E41B 4Q74A 3VJ6A 2FBOJ 4ORZC 1HI6A 2J8HA 3CSYB 5D5ME 3HE7C 4EI5D 1Q38A 4OIBA 3BUYA 4QLRA 2ESVB 1KGCE 1S5HA 5ID0B 2RGSA 3UAJD 1X5GA 4PY7B 1KN4L 1WAAA 5JHDE 2XA3A 3QUZD 1DBAH 4QOKA 5IVXA 5DUMH 4XHJD 2OK0L 5ISZA 4DKAA 3SO3B 1YY8A 5BJTB 4IRZL 4X7DC 3TIEB 5D2NC 3NFNA 2VLMD 4WW1B 4JM2D 3KYKH 4MB5A 2PKDA 2NZ9C 2L7UA 4Y4HA 4KDVA 4KJWD 1EXUB 3CUPA 2X4RA 3T8XA 2EXYD 4XBEH 5ALBH 4NZDA 3ES6B 2JJTC 3H9SE 1MCPH 1XCQA 3L3IB 1EHAA 2FDBP 5FOBB 2H2PC 3MV9B 5C6TL 3VG0L 3WYRA 3RU8L 4MJID 2DLFH 5HYSA 2GYSA 5CGYD 4NRYA 4XVTL 1LO2L 1A0QL 1QBMH 1FL6A 1IAOB 3DPBA 4G8GE 2YD8A 4MJ6A 4HZLB 5I1EH 3LEVL 4Z7WF 3CDFA 2Z8SA 4RQQA 5D72L 1J8KA 4C56B 4G7YL 3CDGA 1AGCB 1AGFA 5E4EC 3BZEA 3HS0B 1AKJA 1O7SA 1G0YR 1C08A 2AKRB 4JANA 5BV7L 2JTDA 5E2TH 2AJXL 3DVGA 1AKJB 1CFBA 2QADB 5DUPH 3GFUA 3VXRA 1HQ4A 3GIZL 2R39A 4J3OC 4YR6A 4WEBL 1GVIA 1QLEL 1J86A 5I66B 3GSRA 3GM8A 4NP4L 1KIRB 1RZ8B 5DUML 5E8OA 2XNAA 4YHLH 3F7YA 3MV9A 3RGVC 1MRFH 2P8PB 2XTJE 4N8CL 3AROA 1KN2H 1XCTA 3U1SH 1BBDH 2J12B 1CF8L 4ZUSA 2XKSA 4O2EA 4FQCH 4GAGH 4L8CA 2D7QA 1MCPL 1S8DB 3GMNA 1ZT4A 3IGAA 4XNXH 1QOKA 1OM3L 1A7OL 2IGFH 1BJ1H 3CFKB 4M1GL 4YDKH 2VQ1B 3MBXH 4ODXB 1AGFB 4GAGL 4C54A 3C08L 4ZFZB 2MFNA 1WEJL 1LK2B 4XVTH 4OZGE 4MWFB 1V05A 1KJ2B 5T1LA 1CWVA 3QEQB 3U6RB 4J4PC 3BMVA 1N64L 4GAJH 5CD5D 4L9LC 1FLRL 3E6HA 1N2RA 4YHZH 4OV6F 4Z7WB 1VACA 1Q72L 4KHTH 5FYJL 3VFGH 4JRXE 4NDMA 5HPOA 1FNSL 5FA4A 3SQOL 1P84J 1RZ7L 2VLRA 2VLKE 4KJQC 1ZE3C 2YPLE 2D7NA 2MCPH 3N85H 4U1IA 4E0RA 5KOVC 1KOAA 1YNKH 4QRUB 5JLZB 3DURB 2RCSH 1HK6A 2VRAA 2OZ4H 4G6JL 2FHCA 5LWYL 1HXYB 1KIQB 1UM4H 4LVNC 5I73B 2EDBA 3BDYL 4YDIL 3BVNA 1KGCD 3PL6A 3CXDH 4G7VL 3MLZH 2P44B 4NCC2 4OM1H 3BKYL 1VFMA 2IC2A 1WBZA 2Y4SA 1JPTH 1JZ4A 4JZOA 4UT7L 2AV1B 4LKCB 5CSZB 1GOHA 4M8QA 4QRRA 3O2VH 4HF5L 5LGJA 2C9AA 1YJDC 2UYLB 1UC6A 3LY6A 1P4LB 3SDCC 3PP3K 2IANA 5DWUL 1RULL 3MRPA 4KHXH 2I60H 2BNRE 3BIBX 4TNWK 5I1JL 1LMKA 4UAOC 5D7IF 5BVJB 4BH8A 1LO0L 4YDLB 3C09C 4DGVH 1TVHA 5DLML 5AZEH 3NZ8B 3HAEA 4RMWA 3EYFB 5I1DA 1U8HA 1V5JA 4N0UB 3NFSH 2HFFB 3ZHLA 3SY0B 2ZUYA 1MHCA 2VITB 4G43B 1PD6A 4Y1AB 1CGVA 5EZJB 3IVKB 4X4XA 4QXUH 4ZOAA 1CXKA 4Y4KB 2SEBA 1QPPA 3MCG1 3P2TA 3V52H 1CLCA 1CFNA 4PJ9C 3DBXB 1BLNB 3QI9C 3C87A 3O6ML 2GK2A 4OZ4B 5J11B 3WLWC 1WZLA 4X6DE 4MD0A 1PAMA 5DD6B 4FZEL 5E8NA 1QBLH 3LEXA 1LO4H 5DMYA 1T66C 1S8DA 4JQVA 4QO1A 2MTPA 3RWGB 4JFDA 1PEZA 3STLA 4V1DB 2HN7B 4U2ZA 3QUYD 4XPBL 1JPGA 3MV7A 2WZPD 2FWOA 1CDYA 1HHKB 3VFPB 4QHKJ 2ZNWA 1OTUC 3G5ZA 5CILL 3BHBB 5HVGB 1NGQL 3GKWH 3GSNL 5LGHL 3CLFL 2FX8L 4I13B 5D1XB 5KW9L 1RU9H 1QO3A 5DVNA 5CWSA 4YFEA 1DANT 3MRNA 5DLMH 3CK0H 1I4FB 1NCWH 1CR9H 1NLBH 2D03L 5D7IB 4GXUN 3QO0A 4GAYB 1IGYB 3IJYB 4KGLA 1RZFH 3QDHA 4FS0A 3D9AL 4PJ9A 5EUOA 4P0DA 3MUGA 4Z76B 5I0ZA 3CFDB 2ADFH 2BMKB 1RD6A 4HC1H 4NO0A 3V52L 4BSWA 4F7PA 3Q1SL 2H6PA 1FFOB 1H5BB 4LLQB 1DEEA 2WBJC 5DK2B 3TBWA 2WLYA 4Y4FC 3O6MH 4GQ9H 1BD2D 1FL6B 3RU8H 2CDEB 3HR5A 3U0WL 3PJSB 1AE6H 1J88A 1HDMB 1LILA 2O61B 2BDNL 4PTTA 1G6RL 4MAUH 3G5YB 1CFTA 3IS1X 3S4SA 4HKJA 2CKBA 1EHXA 1ZS8B 3MRBA 3T2OA 1SM3L 5IHUL 4OFYD 3TA3A 5SX4H 1GZQB 5EOCL 1ZLVK 4DK3A 4PB9H 4UQ3A 3RNQA 4ETYA 3LIZH 5ACMA 5DURD 4JG0L 3VFUB 4JFFE 1D6EA 1IM9B 3O0RH 3ILPA 2CK2A 3BH8B 3MCKA 3B5GA 2B0SH 3TCLB 1LEIA 4XWGH 4LDOB 2APVA 8FABB 1D5ZB 2GT9B 2N4IA 4XTRC 4DVRH 4NKMB 4S1SH 1AXTL 3AM8A 1A6ZA 1ZA6A 4G8IA 5F96L 1YJDL 3N9GH 3FT2A 1NDMB 4ZS7H 4LHUB 3MOQA 1DEEB 2EDTA 2HMIC 5IOPB 2HRPL 4Z76A 1T1XB 1TJHL 3FFCE 3RWIB 2VH5L 3H8NA 2DQUH 4IJ3B 2AABH 3L5WA 1KENH 2UVEA 2GK0A 3T1FB 4LSTL 4JDZB 2CLVB 5E94B 3T3PE 5D96C 4LAJH 3VA6A 3VA2C 4UU9A 4V2BA 3FQUB 5GSVB 1DQLH 1W0VB 3P9MA 4JRWA 5HGAB 5ISZE 3ARGB 2BFVH 5FV1L 1F42A 4HIJA 4U31A 3F58H 1GAFL 4UDUB 1ZSDA 1IC4H 1SY6A 4D8PA 3VFPA 4HW6A 1CT8B 4BFGA 4P57B 4ZFFB 1GC1C 4Z7QE 1BVKA 3QDJE 3HRZB 4WUUD 3LIZL 3QG6A 4OCXL 4EIZC 4U7KA 2PUQT 3HRPA 1QLEH 3PDOA 4X98B 3Q5YA 2MMXA 4TUJA 5JIKA 3TT1H 1XGYL 1KPUA 4HIEA 4MA3A 4KKAC 3VGAC 4HCRL 5IB1B 4LLDB 3MJ7B 3EOAB 1Y6MR 5I15H 3EOTL 3IS0X 4UIKH 4LCYB 2Z31D 4JRYB 5J4MA 2OR9H 3HE7B 4JQVC 2AEPH 2V6HA 1JIBA 2Q8AL 2WP3O 4CMMA 4QRQB 1AP2A 3LOWA 3MNZA 3DX8B 1ED3B 2DYPA 1Z3GL 2F19H 3QUKA 3LEYH 4Z7OF 2Q87A 5DJ0A 5B8CB 2FRGP 1AC0A 1U42A 5DD5L 1QBML 3REWB 5CS7A 3DO3A 1OT1A 5C8JB 1DVFA 2Z8RA 3VFTA 2YSSB 4LSTH 5A1AA 4HUUB 4NNPL 3PNWB 4KU1A 4PV9A 4AL8H 1NMCB 2VR4A 3GMQB 2AJVH 3PF2A 1CDJA 4UDTB 3SDCD 4HIXH 5JXAH 5BV7C 5BV7H 4IEFB 3VXMB 1RURL 4NC2B 4F7MA 4Y0GA 4Z7VB 5KJRH 3BIKB 3V5KA 3MNVB 4GRLA 4U0RC 5E5MA 2OBGA 3O3EA 2H41A 3EYQD 2VDNH 4RDQG 1D5MA 2UZYB 4PLOB 1BFSA 2JCCB 5DD1H 5EU7E 5L9DH 4AEFA 1QYGL 3U0WH 2JJSC 4IDJL 4MYWB 5E4EB 4OLZL 1OL0A 4KRNA 4ZQKB 3HZMA 1W0WA 4S2SB 3JV6B 1RUKH 4NKIL 5SWSB 4D9LL 5IM7A 1S7RB 4ZPTB 4JO4L 4QHUA 3PIQB 5FYJE 3EYVA 2Q76B 4BFBD 1JHTB 3NPZB 1YYLL 5IM7B 3MLUH 4JY5H 2I25N 1W72H 1M7IB 5EU5B 3L5JA 3QDJA 4RNRB 2AV7B 3F12B 1EX0A 2Q1EA 3FN0H 5I1AB 4OLEA 3FO2A 2YXFA 1MUJB 5CEYB 1Q1JH 4HBCL 1JYXA 3ORJA 43CAA 5TFSH 4R96B 4Z95L 5IR1A 4NGHH 4HUNB 1JGDA 3IJSA 4PV8A 1T0PB 5JHDB 4LSQH 3IF1A 4H5SA 3V5KB 4JVUA 1UB6A 1JRHI 4UAOB 1ZA3B 4I18C 3O3EB 1I7UB 5CP7A 4JFXB 1PG7H 5T1KD 5IUSA 3SKJL 1S9WA 2R1WB 4XHJC 1NFDF 3QXUA 4JRYE 5I30H 1P7QA 1S7TA 3H6JA 1I1FA 4LHJB 5D1QB 2FEDD 4YZFE 2ZOLB 1QRNE 2WM0A 1MI5A 3CFEB 3P4NA 4FFYH 3CFKA 2OCFD 2AK1L 3SBWA 5GS0C 1KLUB 3ARFD 1F6FB 5IQ9B 1TZGH 5BOZG 1BP3B 5FYKH 1I1CA 4NKQB 3JTSB 3B4NA 4OM1L 5DR5L 3DMMA 2HFGH 3MV7D 3CXDL 1J0JA 1H0DA 1H8SA 1K8IA 3MNWA 3VFSB 1A4JA 1VERA 4BQ8A 2ED7A 3QJFA 3ZE1F 4JHZA 4GMSH 5IWLA 1UM6L 3TBYA 3QPXH 3VXOB 2RJMA 1NCAH 5E2VH 3WJLA 3BISA 5J6GA 1T83A 4WHDA 2GCYB 2NY3B 3QCTL 3ZKXC 3QDGA 1CS6A 1ITBB 4RIRA 5GGVH 4OD1H 4P46B 1QLRA 4I0PC 4XNUH 5DK3A 3MLUL 3OR7B 4DN3L 1EAPA 4U7SA 4JO1H 2HFFA 1C8PA 5F7NC 4DEPC 1NAKL 4ZSOB 4PG9B 2CLRB 5IV2A 2DQTH 4M6ML 3QUMB 1T89A 1IILE 2CLZA 4NQCA 4NO0D 2H26B 4MA1C 4KRLB 5GQBA 4LEOA 4QYOA 1Z3GH 2F19L 2DTMH 1OGAD 3MYJA 4NQEB 2NLJB 4F57H 1PG7L 2EXYC 2PYEE 1I8KA 1KXQE 1N6UA 1SHMA 3QUKB 1TCRA 2YPKB 1JI2A 3OF6A 3S34L 3SJVA 1NBYB 5ICYB 4HFWB 5JPMB 3UYRL 5HYFA 2J88H 4JCMA 1QVOB 1S9VA 3IU3A 1X5AA 4DZBB 5ESVA 1NMAH 5ACLA 2CRZA 4JFOB 4S0SD 5DI8A 2GSGA 3OHXA 3RZCB 4TSBL 1S7XA 5DD3H 3KYOA 3MRRB 1NSNL 4KTDH 1XGQA 4YE4L 3EJZD 3B83A 4UIMB 2WLZA 4LSVH 5IFHH 1AGEA 3OJDB 4GMSL 2QSVA 4MXQC 1WICA 1CFNB 1WCQA 4NQDA 1UXWA 4MMXC 1T2QH 2X4TB 4EXKA 1P4BL 1C7SA 3DXAA 3BN3B 5DQJA 1MRCL 3WNMA 2IFGA 4Q6IC 5DFVC 4LCWA 4PRIE 3STBA 1MQKH 4UI2A 4Q0XH 4YX2H 4UT9H 2FLBT 4XBGA 1X7QB 5I8KL 1GCFA 3NPSC 5GGSB 1AO7E 4F9LA 3BW9A 1CF8H 1A3LL 3VRIA 1MFBH 4JDVB 5GGSA 4Z8FH 4XPTL 3SDAD 4G8GD 2ERJB 5F44A 1B0RB 4D0CA 1LP9E 2J5LC 3C8HA 2P24A 4Z7VF 3LDBC 2VLRE 3KJ4C 2GSIA 1DDHA 3R8QA 1FZJA 3P30H 3C5SA 4ZFGL 4P46D 4P9ML 3U0PA 2NMSA 3WXWL 1NCBH 2CXKA 2EEAA 5D1XD 1QTYT 2D9QB 3DV4A 2APTA 3H9ZA 4M43H 1SEBA 4P2RD 4HWZB 4NN5B 4TUJB 5HHME 4ALAH 3GSNB 1JWUA 3R0MA 4HIEB 4OZGA 2KKQA 2UZXB 3UJJH 5BO1H 4PRDA 4WNQA 2YMXL 3ARGC 5DJ6A 5MENA 3LSOB 3UJIH 1HH9B 3HZYA 4I2XA 4J8RB 1FG2A 1RJYA 4FTVB 2F74B 1KYOK 1C5CL 4JKLA 5T3ZL 4XAKD 3CDYA 2PYEA 5KSAB 1R5IA 1HI6B 4TRPL 3OKLA 1C5CH 2NY2B 1A6VH 3LQZA 3W11D 1EJOH 5EOQH 1I7RB 4FQXD 5T1KB 4JFDB 3B5TA 2VIRB 3IDYB 5T3XE 4G9DA 4POUB 2MQ0A 4LPUA 2F53A 5IB2B 1OD9A 2FO1A 1YQ2A 5C0AE 4HUVA 4MB4A 3TCXA 3LCYA 2F53B 4PIRF 5FM4A 1BFVL 4GG6F 1A1NA 1I1AA 4Q9BA 4JFED 7FABL 4YXKL 1KEGL 5H2BA 4PP2A 5C9JB 5E70A 4JZJA 4LRIC 1CG9A 2FL5A 3FZUC 4APQA 3T4YA 4FFZH 1NGPL 1IZKA 5JQ6H 4I2XB 1AD0B 1I1YA 4OGAC 3BOVA 3ZLQC 4EDWL 5MEPA 3U7YL 5EA0H 4LSPH 4PUBL 3MLVL 3ECBA 3QUXA 3S3SA 1N8ZB 2BY0A 4RAUB 1XGTB 3IDUA 2HVKB 3V5HB 5BS0E 5F89A 4MSWB 4DFIA 3EOAA 1TTUA 4F7CB 3UJIL 4DUWA 1QR1B 4OM0L 4CNIA 5LXGH 1CDGA 5F89B 4P2OA 4BJLA 5EPMA 4CU7A 4DTGL 4XP4L 1QRNA 1JK8B 3SE4C 1A5FL 4NKOA 2C1OA 3JZ7A 4HLZG 4FP8L 3DWTA 1XAUA 1FLTX 3HMXH 4QHLA 1AGCA 1CFTB 3DYMA 1FFQA 1QSFE 1UEYA 4LSVL 1JWSB 5IFHL 4GG8B 4UDUA 2FGWH 2VZ3A 3V6ZA 1YEGH 3QFDA 4WW2B 4FRWA 2DLHA 2R56L 4PRID 4M62L 4XP6L 1QD0A 3P0VH 5DYOA 2G2RA 3V6FA 2PW2A 2X7LA 4PJ8D 1TNNA 2NZIA 2L7JA 4MAYA 5CUSL 2QQLL 3O2DH 1I8IA 4QRUA 4LCIL 1FVDB 5J1SC 3UPCA 1J0ZA 1EIBA 4FZ8L 4UBDC 1F11B 1O5DT 4PJDF 2UWEE 2VXSH 4JN2B 4OIIH 4R6UA 4LCYA 4MXWL 3UDWA 1I8LC 4RGOL 3Q5OA 1EAJA 2NY3D 1E4WH 1FL3A 4LRNL 3QEGL 2A6KB 1X5KA 2HJFA 3ECBB 3QUXB 3WUZA 3SDXE 5I30L 3ZTJG 4NWTH 2K7PA 1OVZA 2BY3A 4S1RL 1U8LB 1MOEA 4G5ZL 1YUHA 4XCFL 1A6UH 5B3JF 3AS2A 2ZOKA 1R24B 1S5HB 3KNBB 2ADJA 2DDQH 1U8LA 3MRMA 5DF0A 4OBSA 4TOYH 4ZFZA 4KQ3H 3RVVC 5B38G 3ARBD 3JV0A 5INDB 5HI5C 1JGLL 1G9NH 1FGVH 5F9OH 4X6CF 1RZ7H 3P9LA 4G8FB 3F7PC 3S36H 2D9CA 5KS9F 1IKNA 15C8L 3QXVA 4WFHD 5CGTA 3TVMC 5D6DA 4YHPA 1HZHL 3VXMA 4F7MB 1C1EL 1EGJA 1WV7T 3VXPB 5EU6E 3PUCA 2AJUL 5DSCB 1VEPA 1IEHA 1XCTB 1JZ2A 4K3GA 5FECB 4PJ5A 3HNVH 3ABZA 5GGVL 3I75A 2XOTA 5F9WC 5DJ2A 1KJ3L 4LLUB 1AO7B 3HPLB 2IPTL 3V2AR 3C08H 1A47A 2AGJL 3T0DA 1Y6KR 1DZBA 3Q3GB 1L7IL 6FABL 4YBQD 4PRIB 3VXTB 1JBJA 2G60H 3G04A 5IIEA 5AD0B 3HE7A 2CDGA 2DD8L 4CMMB 5FGRA 4O00A 4UNVA 3B2UC 4L4VB 1N5YL 1E4WL 3UMTA 3ULVC 1AQKL 5E95B 2JIXA 4H1LA 2VKXA 3NFSL 5GRYA 4PJ7F 1HHHA 4JFQB 3DROA 2GTZA 3TIDA 3S4SB 3RKDC 3SQOH 1IM9D 4RZCA 3VXSB 3RBGA 3DUUA 4KI5F 5IVZA 1U8IA 4KQ3L 5ALCL 1S5IH 2M26A 4FP8H 4AZ8A 5CEZD 2B4CC 5I18L 3QWQB 3DO7B 2IQ9L 2BVPB 3GSRB 3KYMB 3DURA 1YPZB 5JZ7D 3TT3H 2ZCKH 1RUPL 3QDAA 4DVBA 3MUGB 3KYAA 3UTTB 1JCKA 5AYUL 3SDCB 3D0VA 1P7KB 4C58B 4EOWL 3OPZL 3EFDL 4ZAKA 4JPWH 2VAJA 1EK3A 2ICCA 4IOIA 1JPFB 1TFHA 4M4PA 2HKFL 4P2OC 4L4JA 5GJTL 1S78D 2VLJA 3EO9H 3UTQB 1NAMH 4X99A 1DBJL 1IGJB 3F65A 1FGNH 2A6DB 1TCRB 2YPKA 4HG4J 5J3HC 3FFDA 3I02B 1YEFL 4NQXA 4PJ7E 3W0WE 3JTTB 3MV7B 4I3RH 1JWSA 3FTGA 1L4IA 2LU3A 1T20B 4LSQL 2KPNA 3SBWC 2GUOB 5GGQH 3S37L 3SGDI 4QXUL 3QWOA 4XCCL 4BFEA 5I1AA 1JRHL 3TYGL 3VI4E 1LEIB 1F3JB 2R2BB 4KKNA 4HWZA 4Y19B 1U36A 2ENYA 3INUL 4BZ1H 4DGVL 1X5LA 5MEOA 1KB9K 3FRPG 1CK0L 2ZCLL 5C2BH 1KIUA 3QFJA 2V17H 1F90H 4GQ9L 3P0YL 2IBGA 1Q0XL 1R5VA 2OI9B 1WBZB 3GJFH 4KVNH 4QTIH 1MHEB 5EBLB 2DM2A 3MYZA 4OAWA 3SKMA 3UO1H 3QXTA 4WEUD 1YMME 1UGNA 5JR1H 1LDPH 3S37X 4R4ND 4JPWL 3OMZA 4WW2F 3TT1L 4LNRB 4FQXA 3BH9B 5D1XC 3LN5A 4Q2ZA 4M6OH 3VG9C 3HLAA 5IW6B 3RGHA 4CKVX 1QSEA 2VSDA 5IB2A 2YUVA 4U1MA 2B1HH 4HJ0D 3MRKA 3VMNA 4KAQL 2DL2A 3ULSB 3NN8B 2NY0C 3V6OC 5D7LA 3HC4H 1A14L 3TESA 3TO4C 3WN5C 2IBZX 2F54B 3KLDA 4DGYH 4APQD 3IU4L 3BHBA 5CBAA 5FECA 3BP6A 4YNYA 2NXZB 3S9DB 4FOMA 4U0QB 5C92A 2ID5A 2AJZB 4P2YA 1KTLA 3D6GA 3MREB 4G6KL 1IAKB 3L3KA 2N56A 4Y4FA 1IGIL 2AK4B 2D31B 4AK1A 3X11B 3G6JB 3OKEA 5EOTA 3BKJL 3RWIA 1LO5A 1FO0A 4BM7A 1MNUL 2DICA 3Q5TA 5EOTB 1ONQB 2AJ3B 1NC2A 1EERB 4CADA 2QV2A 1G7QA 3FT4A 3UX9B 3LEXB 4OFIA 4R4NC 2AXFA 2VUYA 2KZ1B 4JQIL 1Q9WB 3EOYG 2NNAA 5EBWB 3RVWD 1P5VA 5DA0B 4TULL 3IFPA 3UTSD 1KPVA 4FABL 2XQBH 1JYVA 4PJHE 3SEPA 4Z78A 1I9IL 4ZXBA 3C2AL 5IKCB 5GZND 3GNMH 3AMKA 5DJDB 4ELMA 1IARB 1A7PL 2NTFB 2C4FU 4LCUB 2MHAB 2Z92A 4N90D 1SM3H 2VLME 4LKXA 4XCCH 4JN2A 2W92A 3QCTH 3GMLA 3QIBB 1XIWA 7CGTA 4LVEA 2O5ZH 5FDWA 3MOBL 5CZXD 1G7HA 3SQBA 4R2GD 3D5OF 1MWAB 1OP3H 3VFNA 3FT2B 4FQLL 3X11A 4PRNA 4IM8A 4TUOA 3MODL 3MXVH 3LN4B 4CDHA 1C5BL 1IAOA 3HZMB 4PJBA 4NQVB 3WHE0 3MOAH 1SBBA 4BUHA 3PP4H 4OLWH 4G8IB 1I9JL 1XR8B 4HXAH 1PYWB 4LGRB 2X05A 2HFTA 4P2QD 5D6DC 5I8CA 2FR4A 4PG2A 3PP4L 1H15A 4OQTH 4OLWL 4DW2L 1HEZA 4L3CA 3O6FD 1KB5H 5GS1B 5TQ2H 1I7TB 1KJMB 4C83B 4GLRH 3S5LG 4CN1A 5ABDE 4WHCA 1YNTB 4H1LB 3JV4A 1ADQH 3MRBB 5ADPH 1MJ8L 2QR0A 5C0RH 4G9FB 1F3JA 4ELMB 5I8EA 1SBSL 2DDQL 1QLFB 2YZ8A 5LQBL 2J5LB 1A22B 3WDHA 2Q8BL 4U1KB 2A77H 4FABH 4Z78B 1KCRH 3DTXB 1ZA3A 3HN3A 3GBLA 1G9NL 1U3HB 3JVGC 4WO4C 5DMJB 3L5XH 2QKIA 3FOMB 1I9IH 1EGJH 4D8PB 3GSNH 4XPHL 5DJ2B 5D7KE 4XP6H 1OGTB 2E3VA 3D0LA 4LQ1A 4XMLH 3QHZH 1IFHH 1YEGL 2CUIA 4RFNC 4Y1AD 1R5VB 4HGMA 4TQEH 4KPHL 3MV8A 3WFDH 4Y16D 1ZWIB 2F8VA 3ES6A 3HTLX 3RKDD 5IQ7L 3PV7A 3HPJA 3HNVL 3GSXB 5C09D 3RGVB 4JFFD 1FVCB 1KEML 1H3WM 4ZPTA 5IBUB 3BKJH 1E6OL 1MCFA 5GRUH 2BOCA 3HUJB 4ZUUB 2X4SA 4PY7A 4QOKD 3EDEA 1QFWI 5TPWH 2R2EB 2BNQE 2NXYD 3K1DA 1BD2B 2J8UE 1ZSDB 2ARJQ 2ZJSH 3K80A 2P42B 5F1IB 1MCIA 4MNQD 5CZXC 5CMAA 4JB9H 5TPWL 2F53E 4HHAB 5IP4A 3CPLA 3GHBH 1MAMH 1MPAL 3EBAA 2O5XL 2XPGB 3RX5A 2A0LD 4P9HH 3FQNB 5LQBH 3VXRE 1ZLVH 3IFNL 1IEAB 5TH2B 3BPNB 3W9EA 1XZ0B 1A7RL 2VLKD 2AK1H 1MNUH 1CE6B 2CJUL 4ZO7A 1OAXL 3NIGF 1BIHA 4LQFL 1VKXA 4MJ6B 2DQEH 1AHWA 1VGEL 1AI1L 5SWZE 1MFNA 2DB8A 5EBLA 1EZVY 1M05A 5F7EH 3BFOA 3GSQB 1U8OB 3TEUA 1LWRA 5I1HL 3BEWB 4X80L 4ETQB 2BZDA 1K8IB 3T3PF 4X7EC 4HGWB 1FIGL 3BPCA 5F3BA 5INCB 1UJTA 3O8XB 4XNMA 5EN2B 3ILQC 2X9YA 4MXVE 1FNEB 5HI4D 3RWFB 1U8HB 4N0UA 3O2DL 1A4KA 5DHYB 3WMSA 1SY6H 2R2BA 2OTUA 1A7QH 1CDUA 5HHOD 3KR3L 3MRLA 5HHPA 1IGFH 5C0CD 3HMWH 4FQPA 2LFGA 5JIPA 3CPLB 1NANI 1FAKT 2BFVL 1CCZA 3B9VA 3DLQR 1NEUA 3FB8B 2ZG2A 5DEGB 5DT1L 5L88L 2DJSA 5HI3D 3O4OB 4YHZL 1GGTA 1BIIA 2RHEA 4P59H 4MJ2A 2FX7L 5HHXL 3BRFA 4X6DB 1YYML 2HAZA 3TNMB 3KPSE 3NOIA 4ZO6A 4HJ0C 2IPUK 2EE3A 5HPMA 5HGBB 1CFVH 3OB0H 1UB5B 4KH2A 4ALAL 5I1LB 2ZCLH 3ARQA 1JPST 3ME0A 1AKJD 2QADD 5BZWB 3VFOB 3MLVH 3TBSB 5ESVB 5C7XL 4RGMC 2PCPA 5F21B 4MA8L 3PIQA 4JLRB 1FFPA 2YK1H 2VXQH 3X3FL 3IDNB 1AR2A 2EYRB 4K3HA 1T22B 5C0NC 2F54A 1FG9C 1RFDL 2FJHB 2P5WA 3ZYJA 4PBXA 1BWWA 4P4KC 4PGCB 5FOJA 5JHDD 2D7OA 5IV2B 4E5XB 2JJSA 5C08D 2N1KA 2WQ8A 3U7WH 4Y5YA 3LSOA 3RVXC 1D5BA 3H9HA 3FONA 3QB7C 2BNQB 4UT9L 1YEEL 5D5MF 2AABL 5IB1A 1FL3B 1MAML 3SJVE 5F70A 3H9HB 3CVHA 3ETBF 4F37F 1CD0A 4M02A 1F4XL 5F7UA 4EN3A 1MCCA 4FQXC 4WY7L 1BAFL 4DGIL 3FCTA 2AVGA 4NQCE 5JNYB 3B2VH 5GISH 2CGRL 2NXYB 2V2TA 1B4JH 3GJFB 3AXLA 4HC1L 4LF3B 1FZKB 1CBVH 1W8NA 2IMMA 2IF7A 4ZAKC 4D0BB 2PXYA 2V5RA 5C3LD 2EC9U 5KG9A 4D0CB 4YHKL 4Z18A 4UZGA 2CRIA 2NYYC 1Y18A 4J1UA 4WFEE 1J7VR 4U3CA 4Q9RL 1RUPH 5C0EB 3CXHJ 1UKQA 4JFFB 4KRPD 2R9HD 1CE1H 3K8LA 2Y5TB 4XCYB 2FCBA 1K3IA 4XRCB 2Y06L 1QO3B 3DVIA 1HCFX 2WWKT 2KZWA 1IAMA 3S4SG 2EIZB 3OJDA 1AI1H 5IBTL 1T1ZB 3G5XB 4NUGH 1KTDB 2X1OA 3UDWC 5IB4B 2BVQB 3ULUF 5E6YA 5CGYC 4P2QB 5JORA 3HUJF 4FTVA 5B21A 4BH7A 3KPSA 3EJYD 1ZTXL 3HZYB 2DQTL 1ZLWK 4BYHA 3QIWB 4XNYL 2PF6A 5F88A 4L8SA 4RX4D 3LB6D 1BZ9A 5DRNB 3IDXL 1KC5H 1IVLA 4KJPD 3AY4C 1GC1H 2XACC 3WIHH 2YBRB 2YD2A 1SJXA 3MODH 3MXVL 4NBXB 4RAHA 5MP6H 4KJYA 2HTKC 3IDGB 2R29H 2EC8A 3QEGH 4K8RL 4PJCB 3G08A 2YBRA 3PDGA 1KEMH 2H3NA 4I8DA 2MPAL 1ZLSL 3RY6A 4ZTOH 5ISZB 1ZGLM 3C5SB 1J8HA 5T33L 2VIRA 1NBVL 3CFIC 1U58A 5CIPB 2B8OT 3V0AC 2P46B 4RMUA 1NCDH 1G0XA 4X7TA 4OLVH 3RY6C 2VLLA 4DZ8A 2YPLD 3WLBA 4KC3B 3HI1B 2YA0A 5DZOA 4IS6A 4TSBH 5C0RL 3WIFB 2Y5TA 1BIIB 4Y1AA 5EU7C 4QRPD 3UTPD 3D3VD 3JWDL 3IVKA 15C8H 3B43A 5J6HB 35C8H 3DVFA 5CLTA 1KCRL 2A77L 4NHCL 1MH5B 2IPKB 4PJAE 3RBSA 2CRMA 5GZOD 4HS8L 1T83C 5IROA 4MHHI 2A6IB 5SV4A 4RQQB 3HC0B 3NCEB 4MNHB 3QHZL 3EKCA 4M48L 1N8ZA 4RAUA 4HUWB 5CEZH 3HG1B 4HDIA 5MEQA 3MRPB 2EICA 2VXVH 3SHSA 2V2XA 3KPOA 4OSUH 3BN9D 3TA3C 4C4KO 1BMGA 4OFYA 4OLZH 3CLFH 4EI5B 1J8HB 1DDHB 7FABH 4HXAL 4B41A 4QGYA 4WI9A 2NXZD 5EU6A 3V0WH 2H3NB 3R0NA 4XX1G 4IRJC 4B7IA 1DBBL 3HFMH 3U82B 5EU5A 1KXVC 1TLKA 2CKBL 2J6EL 4WU7A 3GMOA 4FZ8H 4PP2B 3GSUA 5GGSY 1U8PA 1IGIH 4X6CB 3DX7B 3OB0K 3SN6N 2PYFA 1WBYB 4PJCF 4YGVA 1T4KA 4L4TB 1RJCA 4YFLI 3V5DA 5FA4B 3WEXB 4OZ4A 1CGSH 4MA7L 4JFXA 4LLWA 4XWOD 3D0LB 3MROB 4HKBB 1A1MB 2F5AL 4GBXD 3GIVB 1BZ7B 1A6UL 3SE4A 2VDLL 3SGDH 1R5IB 1BGXH 4JHAH 5TJWK 4BQ6A 5JQ6L 2HJFB 4KJQD 2LV4A 1Q0XH 1BX2A 1OTSC 1WBXA 2QQKH 2ZUXA 3LKRB 1N3NA 5E99L 3AU1A 4R8WL 1MF2H 1FNEA 5GS0D 2WWKO 1JWMB 3V4UL 2D7TH 3RZCA 2Y6SC 4P2RA 1FFNA 2QR0B 4YQXH 1EA9C 2C7UA 4CVZA 1SYSA 5DYOB 4J4PD 3MLRH 2BX5A 1TQBC 4YHLL 1FV1B 1KLGA 3ULVF 3BEVB 3LAFA 2FH8A 5C0GB 1FE8L 2HT4C 4BK5A 2DBJA 3KS0J 1FP5A 1F8TL 4PJCE 4F37K 3NCCB 3F7YB 1HILA 2ITCB 1H3TA 4NNXA 1OTTD 4R3SA 5HYSG 1WISA 1CQYA 1BOGA 3QZWB 5I17B 1ZOXA 2VL5A 3LZFL 4YDKL 1BQHA 2I9LA 1A7OH 2W1NA 1IC1A 3S3JA 1GGIL 3P9WB 4XH2A 2XZAL 4WUKL 1XF3B 4BZ2H 2QTEA 3OR6A 1R3IH 3NZHL 3V5HA 1N3NB 4JPVL 3ARED 3C8DA 2KDGA 4BSVA 2FB4H 2IBBA 5BOPA 3MUY1 2AW2A 4KV5F 4NWUL 4I1NB 1QUNA 3SKNB 3PWJA 4PRAA 1UZ6F 3ESUF 1Q72H 5D7JD 1T22A 3TBYB 3ARDA 3RWCB 4OZFA 1ZT7A 2IQ9H 1RJZA 5HHMB 1L0QA 4FQIL 3SDAB 2QEJA 2IQAB 5GS1C 2EC9T 3IETB 2ICWJ 1MCNA 1KB9J 4HUVB 2NY4B 4TUKL 3ZT5A 2OJZL 4WW1A 2J6EH 2PO6D 2J8UA 5F9WB 5I1CH 2EIEA 3ARRA 3TBVA 2HG5A 4WV1C 4LSSL 4ZO9A 1A3LH 2VC2L 3RI5F 2R8SL 1T04B 2DBLH 4P2CG 2Y07H 4DUVA 3QIUD 3H3PL 2R1WA 4G6AD 1XGUB 3VW3H 2W0PA 3C60D 2H1PH 2PYEB 1P69B 5JPMA 5C0BD 4HG4K 3KPOB 3QEUB 4LPXA 1JNNL 1OWWA 2JK5B 5D1QC 1E0OB 4TSAL 4HMCA 1KG0A 5F96H 3GRWH 3UTQA 1QFWL 2H1PL 3H7LA 3K4ZA 2R0ZH 4M3JA 2OM5A 4Y19E 4HXBL 3TJEH 4E41A 4AIZA 3DI3B 4HJGB 1MUJA 4K55A 5D7LB 1KIPA 4MJ4A 5D7IE 1BFTA 3MRGB 1RIUH 3FFCD 4JM4H 3S88H 1U8PB 4ODWA 1NEZG 1HOCB 3VGFA 5MERB 2X42A 5E9DE 5ENWB 1G6RB 2MSPA 3KYMA 3PNWA 4Y5XC 5EZLA 4W4OC 5IHZA 3MA7B 2B1AH 4M03A 5I73C 1FGVL 4WFGE 1OGTA 4NQED 4AG4H 4HJJL 1T7VA 1M4KA 1EHLL 2DQEL 4NKDA 1P7QD 1WZMA 4MDIB 1NCAL 5E2VL 4U1LB 1LP9A 1DN0A 3L3OB 4A6YA 3M8OL 4LBEB 2JJWA 4QRPB 5J1AB 1S5IL 4M93B 1XFPA 3AS0A 3WUWB 4PRPD 1CQKA 4FNLH 5I19L 1IM3A 3B8YA 3CH1B 1LEKA 5D5MB 3BP7A 4X5XB 1S7VB 4OF5A 5GHWL 4R8WH 5DJXA 4RISL 1MCWW 2XN9B 5DJZA 1UXSB 1MRCH 4ODTL 5IJVB 2IANB 4MA1B 3EOBB 3M17B 4R0LB 4JKMA 1XGYH 3A0OA 3EFDH 4HKJB 1FQ9C 3VE0A 5B39A 4G6FD 4CRPA 1RK0A 3FL7A 4YPGB 3GKWL 4JAMB 1X3DA 4X4ZA 1H9VA 4OCRH 3U4BH 3HNSH 3U36A 4X6CE 3MXWH 2DM4A 4BFIA 5EZLB 3QRGL 3IAQA 3T09A 2B39A 1KBGL 3SDDD 3L3DB 1DSFH 1KB5A 5JDSA 5ENWA 5DO2D 4LEXH 4KZDL 1GZPA 4Y4HC 1NBVH 4G6ML 1XCQB 3L3IA 4NDMB 3L3KB 3MRCB 1ERNA 2I9TB 1C1EH 1NC4A 3Q0HA 2AJZA 3H0TA 4C56E 3UTTA 1MSPA 1OLLA 1G9MH 2ZSVB 3QAZC 5EC2A 2HTLD 1HIMH 2NY1C 3C8KA 1DBMH 2NY4C 3MROA 2J7LA 4W68A 35C8L 5IBTH 4CU6A 1OSPH 3AXLB 2LTQC 1P4BH 3VG9B 4O9HH 4F33A 3U7YH 2RAMA 5FKPB 2FEEL 5I6XB 2P45B 1Q9OB 3WCYA 2VLKB 1OSPL 3MJ6A 3RTQA 4WDIB 5HGAA 1INDH 4RWYH 5KVGL 4Q2ZB 3O0RL 1CR9L 1NCWL 5BVJA 1N5AA 1Q8MA 4JFQA 4N0YL 3HAEG 4XCYA 2O5ZL 2DLTA 3B3IB 2DF3A 1VGKB 2BK8A 4Z7UA 2XNAB 1EO7A 4NM4H 3MXWL 3BQUA 2CKBH 2VLJD 4HPYL 1DQTA 1E28A 3VGDA 3WJJA 1NGYA 5D1ZC 2NW2A 3ZZ1A 2DMCA 4MDIA 4Y2DD 5E1AB 4NQVA 3L7EB 4QWWC 4XXDB 1QQDB 3QDME 5JLZA 3VFRB 1PG7X 3L6FB 2EKSA 3ZKQD 1KJ2L 3D85A 1MHHB 5I2IA 4KK9D 5D2LF 5E8EB 3VH8G 2B5IC 5E9DD 5J0BA 5C1MB 1FYTB 1SYVB 4LAQH 4YC2B 3EGSB 4YDVB 1D5IL 4FQXB 2P8LA 1MCDA 3VRJB 2DJ4A 4C56A 5IFAH 5L2KE 4DN3H 1VFAB 3QFJE 3I02A 4NQXB 3MRMB 2YA2A 4EUPA 1NCTA 5CMAB 1X4XA 2BVOB 3ZL4H 5D1XA 1MRDL 3ULUH 1SQ2N 4GJTB 3BGAA 2DQCH 5CEYA 4ZFFA 4P23B 3MMEB 1T7WA 5ESQA 1L0XA 2BVTA 3UPAA 3W0WB 3ZKMD 2PTTA 4O5LL 3MOAL 4E0RB 4PRDB 2IJ0C 5H2BB 1P7KA 4G7VH 3QI9A 1UQSA 5AUMB 3KPRD 4ZNEE 2W60B 3IDXH 4AEHL 5EO0A 1TJGH 1OGAE 2PW1B 1GGBH 1W2KT 2BHUA 2GTWA 5K9OA 2GHWB 4NRXA 1JTOA 2AEWA 1FVCA 2R29L 1I1FB 5H35A 2QLVB 4S1DC 3ULVE 2EYSA 1GPOH 3ZTNH 4QHMB 3BEWA 4ETQA 5KSBA 2MCG1 3R1GL 4PJIE 4F58H 2DLFL 3VFWA 2Y07L 2DTSA 1HHGA 1NBZA 3QEUA 1YN6A 4F7TA 1V7NH 2HT4D 2IBZY 4LSRH 1YMHB 4P4KD 1P7HL 1A0QH 4UTBH 2HT2D 3X3GL 3VXRB 4FMKA 2Z0BA 1JNLH 5EU4B 4V1DA 4KVCL 1MHCB 1MCOL 4M6OL 5F93C 4UTAH 3IXTA 3QEHA 3O2WL 4HXBH 4OCXH 3RZWA 1F4YH 4M1DH 4ZUTA 1G7PA 5I6XC 2C5DC 1OHQA 3HNTL 4LGPB 4AYFA 1G9EA 4PLNC 5ETUB 5LG1A 4PB9L 4ODHH 3DXAB 3I84A 3UZQA 3ALPA 3WLBB 2BVPA 1K6QH 3HZKA 3V0VB 3QUYA 1TJIL 3EDFA 4PFEA 3ZYOA 2HP4A 2JELL 3TN0A 3ZSSA 2VXVL 4MQXD 4FA8A 1A7NL 4HF5H 3O2VL 3U7AA 2BJMH 32C2B 3QQ3A 3KDMB 3NCJH 1P2CB 4OCMC 5BZDB 2V5TA 3WHXA 2V7HA 3GHEL 4X6DF 1TJGL 3RDTD 2A6IA 1LK3H 3FAWA 1QEWB 3AM8C 3BKCL 4PJIF 4MNHA 2H6PB 2UV3A 3STZB 4N0FB 1AO7D 4U1NA 4WTZG 5FGBC 2VLRD 3C5ZB 4ZOBA 3WN5B 4KK5C 3KAAA 3KR3H 5JXAL 1OB1A 3DARA 3J8F7 4PV9B 4YHNB 5L2JB 2ZOKB 2E7BA 5HHQB 1KNOB 3BE1H 2R69L 5DRXA 5BV7B 3GMMA 4JO1L 3S96B 5C07A 4HHAA 4HKXA 4WI5A 5CJBA 1A2YB 2Z35A 1J1PL 1K2DB 4OZHE 4NO2A 3DGCR 4PB0L 4PRHA 1A6TA 4J7RA 5C2UB 5I76B 2WUBL 2ITCA 3WDIA 5KSBF 4S0TD 1E28B 5K9KB 4O2FA 1MJJA 5C0AB 4LCCC 3E3QC 3SE3C 1RVFH 4J3SA 4DJMA 3V7MA 1KFAH 5F6IB 5H37H 1HH9A 1TPXC 4XPAL 4UOW0 2A9NH 3DRQB 2ZZUT 3MRDB 3IDMA 4NJ9L 4YZFF 5F7HA 4N9GB 4EBQH 5IEHA 1EFXA 2ZCKL 3K4DA 4OCWL 1K4DB 4GRMB 2AP2A 1YEDA 4F9LC 1EH9A 3KPSB 3QG7L 4QXTA 1YUHB 5DD6A 5HD8C 2ADJB 4I5BB 1E6JH 1X5FA 3IFLH 1XF2A 3NCFB 1VCAA 2ZCHL 1WK0A 1IGFL 4PGEA 3RA7L 4LIQH 4TVPL 4NKOB 4QEGA 2UWEA 1YY9C 1F8TH 2R1YB 5JUEL 5E24E 4NO2B 4KI5D 2VABB 4OD2A 1K4CB 5HHPB 1NLDL 4UU9B 3VFUA 2V5SA 3K8MA 3R8BB 2EE6A 4X4MA 3NN8A 4YGVB 2CSPA 3F7VA 1QFHA 4KJWC 5FYKD 2YZ1A 5D8JL 1ZLSH 1NLDH 1FH5H 2X7LB 2PNDA 4B50A 1L6XA 5B3JE 2ZJSL 3UTTD 1MWAH 3MLXL 4K9EC 2J1KA 3AS3A 3TJHC 1UB6B 3HE6A 2VH5H 1EEQA 3U4EA 3SE8L 3D18A 2WP3T 3OG4B 5KSBB 2ZG3A 2JB6B 4J6RL 3VD9A 1IFHL 5E2UH 3PL6B 4YAQB 4GRWE 3DMMB 4PJBE 5DQ9A 3EW3B 2CMRL 5I1GH 4ONHB 3G9AB 3IT8D 3OKYA 3MLZL 3OAUL 3S36L 3R06A 3C5ZD 3PHQB 4QHUB 2NY4D 3L7FA 2FSEA 1N5AB 4YEFA 2OXGA 5KSUB 2B2XL 2HTLC 5C08B 4PJFE 1YY8B 3QH3B 4DAGH 4PJ9D 3JUYA 2J4WH 5CFHA 1ZLUK 5GGVY 4OUOA 5T1MB 4PJEE 2LU7A 1CDHA 2VSCA 4TULH 2FJHA 1I7UA 4PGCA 4HBCH 1OD7A 3QRGH 5IMMA 4H5SB 4PLJD 3WFCL 2BSRA 4HK3J 3CFCL 2J8UB 4Z7VA 1CD1A 2IFFL 4NWTL 5SV3A 3SGJA 3S3PA 3IKCA 3W2DH 4CAGA 4U3HA 4WTWA 3MRFB 1B9ZA 2AJ3A 4OCNC 4R2GC 5BXFA 2X1PA 5CJXC 5HPMB 4IRSD 2CDFB 2JE8A 3GDBA 4QKXB 1CIDA 4LVNB 1A1OA 2XWBA 4NSKB 3WD5L 4ZQKA 5HGHA 3DSNA 4YXLH 1MJUH 4KKLD 5FGSA 4Z7OE 5GS0H 3QJFB 2ZUVA 4PJAB 3IU3B 3O6FB 1BAFH 1B0RA 4CVXB 5E08H 3B9KD 3QP3A 1FZKA 2UWEF 4HQQH 1H0DB 1OCWH 4PJFF 1JGVH 1IKFL 3CX5K 3CVIL 4YIQA 4UMGA 1A4JB 5MHSE 4HK3N 4XP1L 2PTVA 2VDKL 2BSSB 2AQ1A 5DD0L 3FOLA 2EO9A 3FQTB 5ECJE 4Z7UF 3FQWA 1PDKA 1HE7A 1ZT1A 2VXQL 3ZDZF 1QA9B 2H32A 2RBLA 4ZUTB 5GHWH 1FIEA 4KK8D 3PGFL 2ITDB 3QBTB 1SJEB 3VDAA 1MH5A 4ENEC 1J5OL 4OCWH 5JR1L 5ANME 3QDJD 1X6NA 5CKAA 4HFUH 3P77A 2LTQB 4A6YB 2E7HA 2VWEC 1B2WL 1Q94A 5GSRB 3SKMB 4KK6C 2XWJA 5DS8A 3BKMH 3RNKB 1M05B 5C86A 3U1SL 2DQJH 1OT2A 1A9EA 3VG0H 1L6ZA 2XN9E 4F7PB 3DETC 2RB8A 5KAQG 3S7GA 4P4KA 1H5BA 5D1QD 3TO2A 1QFOA 1FFNB 1DQML 2ENSA 2X1QA 3DGGA 4Z95H 3U2SA 3TO4D 2VERN 5HGDB 2AJVL 2V2WB 1OAYH 1IEBA 2WK2A 4U6XB 4BH8B 1RZKL 3BPOB 3QCUL 2C1PB 3IYLW 4JFYB 2DIAA 3P9LB 1H3UA 3NFPB 5CJOH 5DMKA 3MV11 1I4FA 2HJLB 2FATL 3HC3L 1D9KD 4RWHA 5FM5M 5GJSH 4HQQL 4ZXBC 1J0IA 2UY7A 2P8MA 4UQ2B 1HWGB 1KTDA 4PJFB 1FVEB 4NOFA 1IC4L 2NY5C 5DHVH 2P8MB 5IF0B 1FHGA 2Q7YA 5F7EL 5T3ZH 3MNVA 4GRLB 3H0TB 2OQJB 3JWOH 5I16B 4HWBA 5IJVA 3VI4F 1K6QL 4NC1E 4PJGB 1PZUB 1I85C 1BBDL 2JJTA 3RIAF 5IQ7H 3R06B 3TP4A 1F6LL 5J11C 3RQ3A 3MGOA 4KK9C 5I0DA 1CICD 4P4KB 3JXAA 4PGBB 4UB0H 3MV9E 1JF6A 1U8OA 3GKZA 5IFJA 3T0EE 4BFIB 4DGYL 5F3HB 5DJ8B 3MLSL 4D9QD 2P24B 2YD1A 1KCVL 2XRAH 3FQRB 4I0KA 2D7PA 4YXKH 1KEGH 1A6TB 2HYMA 3WBDA 5DJ8A 3ROLB 2KBGA 3DUUB 1UYWH 4GSDH 3TCLA 1CL7I 4DVRL 1P9MC 4QTHA 1UH2A 3V5DB 1MCBA 1D5ZA 5DVMA 4GH7B 3ZE0F 1OAYL 1ORQB 1VGKA 3OAYK 1JNLL 2F54E 2R2CA 4WNQB 2P43B 4PJDE 5DD0H 1OAUH 4NOBA 5IB5A 5CP7B 3UYRH 1XGTA 1T0NA 2C4FT 4XVJL 1U3HC 2JJUA 4P23D 4WO4B 5I17A 5KBNC 4OAWB 3UAJC 1CI5A 1EVTC 1NC2D 1MF2L 2Y6SD 4G5ZH 4G7YH 1VPOH 4KKCD 4X9GA 3QIWD 2HFGL 1YN7A 32C2A 3QQ3B 5FKPA 5MHSD 4H88H 2W65A 5D6CA 5SWZD 2BJML 1DBML 1UZ8B 2F15A 4LLQA 5D2NB 1QSVA 4NQDD 4WEMB 3ZMRA 1OARH 4YUEL 1NC2B 5FXCH 4CADB 4HCRA 4TSCL 3ISWA 4YLQT 4AQ1B 1U8MB 2NX5D 2IPUG 4K94H 2BOCB 4GBXC 3W82A 4JVPA 2EIDA 4NFCA 3NFNB 4OZHB 2YC1B 1ACYL 4JANB 2J8UF 1WT5C 1KULA 2AXJA 2W0FB 3VH8B 3E3QE 2VOTA 3OZ9L 4TQEL 4ZSOE 5I74C 1H3PL 4M1CC 5J7CC 2D7TL 2QSQA 2C3GA 2EYTA 3QO0B 3S8WA 3S5LA 2PN5A 3I6KA 4GKOA 4U1SA 1A7BA 1INQA 2G2RB 3NBNA 4Q0XL 5JOPE 5B4MD 3HHRB 4LVHB 5AAWA 5E00A 4JY4A 1FNHA 3W9DB 1ZLWH 1AY1L 2GJ6B 4R97C 4LGSB 5FOBA 1AQKH 4KZEL 2OL3H 4OIAA 5FO7B 5H35B 4JJ5B 1J12A 3OGCB 5TDOA 2Y1VA 4OKVA 4GS7B 1FBIL 3N1FC 3C5ZA 2DI7A 1QR1A 4EI6B 4ONOA 2W59A 2EH8H 5GIRA 2GQHA 5KN5B 4NFBA 4CMHC 1NGZB 1LE9B 2BHYA 2VDML 3SGEH 4ZD3H 2Z4QA 4P9HL 1QKZH 4XZUB 1YNLH 2BRRH 3D2UD 2X44D 5ITFA 5IVZB 3O8XA 3HG1D 4XNMB 5HI5D 3MMEA 1WT5A 4TNWF 4MQ7B 4RZCB 1TTGA 1QFUL 4LCWD 4XZUA 4ODBD 4GAFB 4OGXH 5E08L 1NPUA 1TXKA 5D9SB 4XC3H 3T77B 1TNMA 1CL7H 1M6OB 2CLZB 3BXNB 3MRIA 2BERA 4RISH 4PGDB 5EUKA 5TF1L 4NM8L 1I8MA 3VXSE 3MRIB 1LD9A 1TCMA 5EUOB 1V3LA 3RWEB 3MLTB 5E8DH 4U2YA 1UXSA 1RZFL 4XH2B 2LE9A 5HGGS 3ZE2F 4HEPG 4N90E 4K71B 4R90H 3IAGC 1QQDA 4H0GA 2MKWA 1NH6A 4L8DB 3QDMD 1MJ7H 6CGTA 1T5WB 1J0HA 5EZOH 4O02H 5E6IC 1AY1H 1ZVSB 1IGJA 1H3VA 5D7JB 2JK5A 4J6RH 4JREC 2W9EL 2Z4QB 1MCEA 2ZKHL 4PJDA 2LABA 4MCYA 1I9JH 3FO2B 3C60C 5HTSA 1HHKA 1EO5A 5KN5A 5CHNA 5DEFA 1ND0B 4HJJH 1ZHBA 4QXGL 4A6YL 5GGUA 4BK4A 1GJIA 3N1GC 5J13B 1U8JB 3DX7A 1EUUA 4UOW1 3CIQA 1SYSB 5HHOB 4K94L 4W6YB 4XAWH 4ODWB 2B2XH 1I1AC 4ZTPL 2DI8A 3MFFA 1NMBL 2P5EA 2YKLL 1RPQA 2DWEB 3C9NA 1UWGH 3QYCA 4RMRA 4Q9RH 2WWMD 4MHHG 2AK4A 4JHBA 4PD4K 2APFA 4FZEH 1MJJB 4K71C 3BWAA 4ODUB 4X8XA 3IXAA 2PTUA 3V4VL 5EORL 3GIVA 3U9UB 4YO0B 1INEL 4YBHA 1IGMH 1DBJH 1T7ZA 1TZIA 1IT9L 1OLZA 2FLRT 1A5FH 4L8DA 5KS9A 2Q6WB 1G7JB 2P47B 4UILH 1FRGL 1PY9A 5C0IA 4LEOB 3C6LD 1WSST 4LVHC 4QNPE 1PY4A 3BZDA 5F6HJ 3L7FB 2AEPL 3L5IA 4FQ1H 2FH6A 1AFVH 1II4E 2HRPH 3EZJB 4MJIE 3RPIA 3NZ8A 4M3KB 5D8JH 1AR1C 3KG5A 4EQ3A 2A74A 3FT3B 4EDXA 5HDQL 5I9QC 4WW2A 5JA9A 2WBJA 3NVQA 2HKHL 2HWZL 3QA3B 3LH2L 4LDEB 2QQLH 2UWEB 1ND0A 2D0HA 3TJEL 3DO7A 3TGXA 2GY7B 4PY8J 2G75B 5GGRY 3X3GH 5FEBA 2BVYA 1FO0H 4GRLD 4TVPD 1KTRL 3BJLA 1MIEL 1NGYB 2IG2H 3AC0A 3H9SD 4JEGB 4MAYC 4Z7UB 1J1XL 4JPKH 1RZKH 1EHNA 1S78C 2E9BA 3MBEC 3U46B 4PJ9B 4KMTH 1AQDB 2E7LC 1HKLH 3O2WH 5IMOA 3OKMB 1F4AA 5C0ND 5E56A 5DK0B 4ZFOA 1BEYH 3H42L 3S35H 2F53D 2XN9A 4OCSH 3GGWB 4GOSA 4Q6IA 4X5XA 1G6RH 3HG1E 1U91B 5J56B 1RIVH 1YEHL 4M7ZC 5C0IB 1I1RA