5EC1A

Kcsa with v76ester mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 36
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1A02
4IIQB 3NH7L 3QNXA 1A3LL 4CJ0A 1ZANL 3LH2H 4NNYA 1Q9KA 1NDMB 2VERN 3DXAA 4L4TD 5IEKA 4HF5L 1CGWA 4J3TA 2RBLA 3OF6D 3PV6B 5DR5L 5FFLA 3HG1D 1NC4B 4KKLD 5F96L 1INEH 1KJ3L 4M02A 3IDXL 3S34L 2FGZA 2PXYB 2F53B 4ORZC 3LRGA 4JZJA 2DAVA 1I1CA 2P24B 4R4FL 1U91A 1P6AB 3QFDB 1KJMA 1H0DB 3VE0A 5KAQG 1E6OH 1N6VA 1UVQB 4KAQL 4N0RA 2I24N 2HMID 5CSBA 1IGIH 2VKWA 5CKGA 5F1IA 5LGJA 4KMTH 3CDFA 4MXWL 5HGAB 5I8KH 3C87A 1FNGB 1XF1A 5EBLB 5I15H 3C5JB 2XQYK 4G6ML 4NO5B 3F5WB 4JFXB 1RZKH 4CDHA 4X6DB 5HYJA 5K9KA 1A1NA 1RZ7L 5DI8A 1S5HA 5K9JH 1ZLUK 4W4NA 4PRPA 2FRGP 4PRAA 5DK0B 1T21A 2BSSA 3G6AA 4H88L 3V6OA 4E9LA 4YUEH 2IQAB 4O5LL 4KMQA 3SDAC 4CNIA 4F37F 4U2ZA 4IMKA 3WN5B 3QISA 5TQ2H 3D18B 2CRYA 5DSCB 4ONOA 2R29L 4YXKL 1IMHC 5AZEH 4KJQD 1N0XL 3G6DL 4YO0A 4ZFZA 4LQ1A 2R4SL 4TSAL 3ZTJG 4XMLL 2XN9E 1FZJA 4M6AA 3H3KA 4O2EB 5I1JH 3MOBL 2B1AH 2JKXA 3MA9H 5IK3A 3QHTC 1CICC 3DX9A 4GKNA 3FN9A 1KN4L 1JHKL 3EDJA 4Y4FB 3NIFF 1OAXL 3I75B 5I66B 1NFDF 2FD6L 1OB1A 1ZOXA 3FJTA 3LN5B 4ZSOB 3L6FA 2YD3A 3IDIB 2WQRA 3IJYB 2Z31A 1BX2A 1WWCA 2HRLA 4PJAE 5BRZE 5GS0C 1HN1A 4JGJA 4JDTH 1JUFA 4KJWC 4MNGE 3KPSA 2AJUH 2MCG1 1BD2A 4NSKB 1PQZB 4QF1A 4HLZG 3RWHA 4YBLB 4KK8D 3S3SA 3QPXL 5ICZB 1TJHL 3JWOC 3DYPA 4ELMB 4WI3A 1YEFH 3WIIL 3WO4B 3Q0HA 2D7QA 1ZVSA 4YDKH 1BBDL 5JW4N 1QRNE 3BESR 4L3CA 3QH3A 1QHPA 4K3JH 5IBUG 4IOFD 4J3VA 1RZJL 35C8L 3V5KB 2HLFC 1U8MA 4NJAL 3P30H 4WWKB 1I3UA 5KN5B 4ZUTB 2R0LL 1BEYH 1ZHKA 4QXGH 1YMHA 2C7UB 1F42A 1F6LL 2HT2D 1W0VB 3VGBA 2JB6B 4Y4KB 4L8SC 2VQTA 2GK0A 2O61B 5D2NE 3P4OA 2VUOA 1U0QA 2HP4A 3M1BA 1INQB 5IEHB 3S36H 1PEWA 4ZOCA 3VI3E 5E6IC 2VR9A 5D1XB 2VXUL 5A43C 4G9FD 3TBVA 4HJ0C 5SWZA 4MJ6B 5GRUL 3RKPA 4Y2DC 5B39G 1QYGH 1OTUC 1C1EH 1IM9D 2QTEA 1OW0C 3KVQA 5MEND 5IQ7L 4LPXA 1DFBL 3MPCA 3FO0H 4X6CB 4PG2C 1YUHB 2NY4C 2XT1B 1YNLL 5M94B 3GSVB 5CBEA 4OF7A 3B9KD 4NWTH 5IG7B 2GCYB 3CFCH 1XCQB 3BMWA 1WCQA 1OAKH 2I27N 5EZOL 3ULVL 2PW2B 4X4XB 4XNXH 3RVUC 3S35H 4Z7WB 4M5YH 3AMKA 1ZGLM 5IMOB 1DQMH 4ORGB 4JO4H 1HOCA 2OI9B 2X4TB 4V2BA 3FQTA 3EO1A 3W82A 2EIZB 5JMRA 4QKXB 1LK3L 2AGJH 3C5SA 4EDXA 3MFFA 1R5WB 4ZXBB 3T04D 3Q48A 4P2OD 3OG4B 3WL9B 3QULA 1OHQA 4Q9RH 4PJ7F 3UTTB 3EDDA 1TVHA 5CEYB 2H1PL 4AM0B 2J88H 2AJYH 5IHUH 2C9AA 1T0NA 1G0YR 3GK8L 5I73B 3V6OC 4Z5RB 5LQBL 3LQAH 3MRDB 4M62L 3RWDB 1AQDB 2PO6B 5FGSA 4X99A 5J57B 1ADQL 2AVGA 3QBTB 1VGEH 4LCWA 4YHLH 1Q0YH 3S35X 3GRWA 1MI5D 2FWOA 4Z7UB 4N9OB 4YZFF 3P9MA 1F97A 1SYVA 3PWPD 1UGNA 4OT1L 3H9HA 2NY2C 5HHXL 1MHEB 5C8JB 4PLOB 2FGWL 3Q1SL 3HC3L 2HFFB 4MWFA 1BIIA 5DMIL 4HWBH 4MA7H 1JPFB 1T1YB 4KV5F 4FN0A 3HE7A 4WFHD 4FXGB 5DRZA 1L6ZA 1NLBH 4IMLB 3KPLA 3OAZK 3WKMH 1S9YA 2BY0A 3GDBA 5CEZH 1R3LB 3KYMB 3FAXA 4G6JH 3VI4F 2Z31C 1A3RL 1XGTA 5GISL 3U83A 3NACH 4FXKA 2A1WL 5I1HL 1B4JL 2IWGA 1CFTA 4ETQA 5I8CB 1RZFL 3MV8A 2PYEA 2BHZA 3L3JA 3NIFE 1HKLH 3EFFB 3O8XD 1NFDE 5JZ7C 1AP2B 5IP4A 2DYPD 4KTDL 5T5NF 5JW5B 3PWUA 3QDJB 1YPZF 2AV7B 1LILA 4OM0H 1EGJL 3ILPB 5T1KD 1NCDH 5FCSH 2WLZA 1C5BH 4YHOH 4Q9QH 5EO9A 1I9IH 4HD9A 5IBTL 4L4JA 4DGYL 4XCCH 2X4SA 1MIEL 3R0MA 4R7DA 2AKRB 3N1QC 5D6CB 1FIGH 4OFIA 3RVTD 1KJVA 3S5LB 2OBGA 3SY0A 4M48L 1V3LA 5FM5M 4XCFH 3O6MH 1C12A 4FTVD 4GBXD 4OQTL 4R96A 3QNYA 1FLRL 5JTWA 2P44B 3I9GL 1X7QA 2DLEA 4PV9B 3ALPA 5LCVH 3P4MB 1AXTL 4R26H 4XI5D 3U4BL 2ZUYA 1AGBA 1FN4B 5CIPB 3N0PB 4WUKH 4ALAH 1JCKA 1HH9A 4GXUN 3CMOL 3U9PH 3PNWA 3TNMB 5L7XH 1U8IA 3K8LA 1JNLH 1TPXB 2ZUTA 4FG6C 5KBNC 3STZA 2R1XA 2YKLH 3O0RH 5EC2B 3QCTL 5ALCH 5J89A 4RX4A 1FGNH 2MHAB 3QP3A 1N7ML 2Q76B 4F9PA 1D6EB 3O45B 12E8L 1TVBB 3EDKA 4LPCA 4KXZI 5EORH 2Y6SD 1XFPA 1T6WA 3IS0X 1HEZB 3QXDA 5FKAA 4XP5H 4LSDA 4PJ9A 2JIXA 4M1DL 5MEOA 1II4E 1W8OA 3T0ED 2EE6A 3MRMB 1MFCL 5GIRB 5E08H 3WBDA 1DQDH 1AD0A 5C2UB 1QNZH 4HGWA 4AEHH 4ZUSA 3D2UB 1L9NA 3DO7A 5C08E 4W6YB 4ODUB 3B5HA 4OIIH 5HYQB 4JRWA 2D7MA 2VLRD 4HUUA 1RU9H 2HG5A 4IHOB 1DE4B 4E5XA 3J8F7 1JMXA 1T7YA 1V8HA 5EBMA 3MSPA 2Y06L 5CP3H 2OZ4A 3VXNA 5C0BD 1FJ1B 1OGAE 4P2QA 5C71A 5C0IA 4JM2B 3ARBA 1DBBL 3VXSD 3PXJA 4HS3A 4HK0B 4PB0H 2Z35A 4PJ7E 1T7ZA 1E4XL 3OZ9L 5CEZE 2R23B 1FIEA 5A2KH 2VR5A 4UT7L 3ARZA 1LO2H 2KQMA 3HRPA 5A40E 5I16B 4NHUB 1G7MB 1YN7A 5I17B 1VADB 3HE7C 3ZO0A 4KI5D 2X4RB 2AW2A 2HAZA 4EDWL 4K7FB 3RTQC 1LO4H 2ZNWA 4DN3L 4O9HH 4EI5D 1U8PA 3QEUB 2FATH 1QO3A 5BOPA 5EN2A 3MO1B 4YZFE 4UTAH 5KANI 2H32B 5ESVA 3SDYH 4O51B 1PDKA 1MHHB 3TJEL 4V2CB 5CBAA 3MLSH 1ZHLB 4GMTH 1MCHA 3OKKB 2HT4D 3O3UN 3FRUA 1T3FA 4KV5E 3QXVA 1QFPA 5KG9B 5EBWA 2YD7A 4DKFL 1NH6A 1YY9D 2R2BA 3CMGA 1BGXL 1O7SA 4OFPA 3KYAA 5D9SA 3T0DA 1G7PB 2Q3AA 1XGUA 3VI4E 3MX0A 2W0KA 2Q20A 4LSUH 4GLRH 4U1NA 5I76A 1J8HD 5I1CL 1UJ3B 2Z93B 5DEFA 2AJSH 2EYRB 2F74B 4UILL 2VXTH 1X5GA 3RJDA 1YEDB 3UJIH 4XWOD 2H45A 4JFFE 4Q9BA 5C09E 4LCCA 4M7LT 4WFEE 3RZCB 4NQCA 1AO7B 3T2PA 3VD9A 2YXMA 4V1DD 5E8OB 1A14H 3OBAA 5AEAA 2YC1A 1PLGH 3KS0J 1DQLH 4L5FL 4HIEA 3EUUA 1CFNB 5E03A 3RZWA 4XHJC 2MCPH 4NN6B 4NDMA 3GMMB 4X6FB 2ZUQC 2WBWB 4M9PA 1OAZH 3O6LL 3PP4L 4R90L 3ARFB 5IFJB 1NC2B 2EDQA 4JRXE 4LL9A 3PE9A 1I7TA 5C0DA 4PJ5D 5FM5O 5IB1B 4PJEB 3OB8A 1DANT 2AEQL 5EUOB 4YFLI 1T03L 4JDZB 4HJGB 5IW3A 5H94B 3KPOB 2EDJA 3DECA 4XVJL 4PJ9C 4YWGL 3GNML 3PIQA 1IEAA 1SBSH 4WW2B 2FBJL 1KJ2B 2VYRE 2D7PA 5D7IB 2R56H 2B0SH 3SKUD 1J0KA 1S7UA 3NZ8B 4OZHA 4OD2A 1JFQH 1VACB 1AKJB 2OXGA 4XVSH 5DJYA 1I1AA 4G5ZH 1KG0A 4AQOA 4YC2C 3L3HA 4GAGH 5EB9A 4Z95H 5GRVK 5TPWL 3BIAX 3FB6A 5IF0A 4OAWA 5D72L 5INDB 3HZVA 5T1MB 5KOMC 2AI0H 1BOYA 4G8GA 5GS0H 3L5WB 4DZBB 4JHZA 5KSAB 3BPCA 2ZOLA 3BAEH 4FQXD 3VFMA 1UKSA 3V0VA 1LVEA 2EZ0D 4X98A 3FT4A 3OKNB 5I75C 3IRZA 4YHPA 1IILE 2B4CH 4D8PA 3B2VL 5I8EB 1A6WH 1DQJB 1I3RB 3DVGB 3LZFL 1NKRA 4IRJC 3AREA 2HJFA 4HFUH 1UQSB 3RHWK 1M6OB 2LU4A 3AFLA 3O2VL 4JFQA 5FYKH 4YK4C 4KROC 3T1FA 3T65A 6CGTA 4OZFH 5IKCA 4FQCL 2VDKL 1CF8L 3AS3A 3OX8A 4MJ5A 4U7KA 5CUSL 1NC4D 2VZSA 4QRPE 4BFEA 2PXYD 2F53D 4JR9H 4ZS7H 3H9SB 1GIGL 1NSNH 5DUBB 2IMMA 1DQTA 1G9NH 3CUPB 3CX5K 1K3ZA 4MJIA 4HFWA 1SVCP 1NBZA 2NXYC 3CGTA 3P9LB 5DQ9A 3RL2A 4KUCD 5FYJE 4D3CH 5GGQL 4NC2B 1QSFB 4JVPA 3GSRA 1NGYB 4PRHA 5IW1A 1PAMA 1X6LA 4OUUA 3HMXA 3CPLA 4NZUH 2DM2A 4QRRB 1ZGLP 2IF7A 3QRFM 1F4XH 2XKSA 4YHML 3RDTB 1REIA 1JZ7A 4LCCC 3QEHB 5C2BH 1T22A 4ODSL 5C7XL 1JWUB 4RGOL 4XGZA 3MRLB 4LLQA 4N90E 3QJHB 2DI9A 5TDNA 1FNEB 4NQEE 4AH2B 1NCTA 1A6VL 1S7RA 2G5BA 3SOBH 1YMMB 1J1XH 4APQA 5IVXA 4BSWB 4NFDA 2EXYC 3PWJB 5HI3C 5DTFA 4MCZA 4IDJL 4M43L 1QBLH 3C08L 3MUZ1 1B9ZA 2DQIH 1CVRA 5EZLA 2DIJA 5I1AA 3B5TA 3UYRL 4WU5A 1F2QA 2A74A 4DN4L 1UFUA 5KS9A 1SY6L 3VRIA 3TF7C 4KKCC 4DJMA 5K9OB 1KLFA 2YPLB 4XC1L 1R3KA 2WBJB 4Y4FD 1F4HA 4PTTB 5CGYC 3S3PA 2YK1L 3RVXC 4ELKB 3BEVA 3QWRA 4BFBD 1WF5A 2DL2A 4G3YH 2B20A 1FAIH 1Q94A 2BHYA 5DZLA 3SJVA 5I9QC 5JIHA 1CFSB 4P9HL 5KVFL 1BJMA 3IDNB 2XFXB 3MR9A 1P2CA 5IV2B 1LEGB 4LAQL 4MX7A 1IEBA 1W72A 1JZ3A 2HKHH 4LNRA 4WW1A 5IFHL 3BQUB 4FP8H 4GFTB 2CQVA 2VSDA 4HMDA 3RUGB 1U95A 1FORL 1F58L 4WUUA 4JY4A 4HXAH 1BVKA 1ACYH 3OHXB 4M3KB 1GGBH 5E9DB 3AC0A 3ZKSD 5DWUL 4MD0A 4XVUD 2ZPKH 3HZKB 3DUHA 5E8NA 5B8CC 1CFQB 3TPUA 2VDRH 2DQFA 5FYJL 3TZVB 3O6KL 4WWKD 3VCLA 1P7QA 3ZE1F 3G5VB 1X5FA 1DUYB 1RJYA 2BNUB 3EYUL 3C6LB 3IGAA 5EC1B 5HJ3A 4Y19B 4JFYA 3T2OA 4PIRF 4NWUL 1OARL 2APWA 2NY1C 1N8ZB 1T4KB 4Y4KD 1Z9MA 1AIFA 2VZVA 1A2YA 1Z9LA 1I1RA 2DTSA 2L0DA 5ECJE 4DUXA 3VG9B 1H9VA 1XH3B 1QR4A 2CDFB 1IC4L 1OLZA 2XPGB 1FNSH 1ZT1B 5D1XD 1N5AB 4KK6C 4EUPH 1ZLSL 1FL3B 1CGTA 3EBAA 3VXRB 2GT9A 1ETZA 1TETH 4LMQI 4LCUA 4G6AC 1BVLA 3D85B 3GBMH 4NCC2 1NEUA 3O4OB 3BO8A 5ALBL 1A4KB 1UCBH 5F96H 2J12B 3IDXH 4ZO9A 1HYSC 4GMSL 1VCAA 2VUYA 3X3FH 2W07A 3QIBD 3BIKB 1E28B 3VMPA 1JHLH 2VABB 4GKSA 4QTHB 3DJ9A 4Z77B 5ICXA 2ITDA 4YHZL 3PHSA 1I9RH 1XZ0A 4ZXBD 2QQQA 2GTZB 4X83A 5DDHA 3BKCH 1NGXB 2GTWA 4X7CC 3UTTD 1JPTH 4G6MH 3LQZB 2MPAL 3LS5H 4L8DA 5JQ6L 2XN9B 1U8LA 5HYJE 1KB9J 5ERWA 3PWLB 4P46A 3CXHK 5IGXL 4GSDH 1KEMH 4RIRA 4N0YL 1T04A 2PO6D 2DJSA 4PRPE 4ERSH 1FV1B 3D1MC 3N1FC 5EU6B 5JPNA 4DUWA 3V6OE 3C9NB 3I3BA 4P5KA 3DRQA 4ZUUB 4RGNC 4B53A 4JHAH 3QG6A 4HC1A 1A9BB 5F1SA 4R97B 1M1SA 5F8RC 5GGRB 2C4FU 4YXKH 1MVUB 1OD9A 4M61A 4KKNA 4PJAB 3UPRB 2RCSH 3MACH 3QO0A 2V7NB 5FM4A 3SDDD 5BRZB 5H2BA 2BVOA 4MNGB 2HH0H 4AT6B 5F97E 3NN8B 4GW1A 3R1GL 4AIZB 2L4OA 5BZWB 4NKOB 4A6YH 4MJ2A 5JOPE 1KN4H 2CLZB 1BQLL 4XPGH 2CKBH 3NTCL 1RUKH 1QRNB 4LHUD 4K3DL 2FLBT 4NOFA 1ZA3A 4YHKH 5CEXA 4LLWB 1ZHBA 3MRHB 2H6PB 1G7IA 3KPSE 5TDPB 4K55A 1VPOL 5A2JH 3WDHA 2UVEA 2E9BA 5DC4B 2DD8H 4OF5A 4X7SH 3G6JA 3P73A 5CZXD 1TJHH 5D2NB 2V2XB 3IDJA 4OCWH 4D2NA 3D0VA 2Z4QB 4HZLB 3VWJB 5JDSA 3MCG1 5JHLL 4HCRA 4U1GB 3JV4A 1HIML 5CMAB 4F2MA 2IC2A 3MCLH 1B0WA 5F3BA 2NY3C 4IRSA 5C0CA 3RIFK 5L2JB 2F54A 3DROB 3CXHJ 4B0MM 3INUL 4C83A 4HWNA 2ATKA 4ETYA 1I7RA 3PXHA 2BSED 2XTJB 4X9GA 3V7AG 4AENA 4MNQA 1IAOA 3KR3H 4WRLA 3ZE1E 3HNVL 1BFTA 4KVNL 4DWHA 1MCLA 4L1DA 3KWWA 3I3DA 4H5SB 1ZEAH 2CLVA 4ZUWA 3B8SA 5SWZE 4HV8A 4Y0GA 1QEWB 3MRIA 5BCAA 1HHGB 1VFUA 3KLHD 1SJXA 2EKSA 2BDNL 2PCPB 4I0PC 4UB0L 5EIQA 3TWCH 3DRTB 4PGZA 4XP9H 5EFIA 2K1MA 4ODTL 2ZG2A 1CT8A 1PVHA 4QRUA 3UYOD 3NBNA 3HUJA 4M6OH 5GPRA 4AIOA 5F7UA 3QPQD 2Y4SA 5EZOH 4FQ2H 3ULVH 3LB6C 5F9OH 3QUYA 5FUOL 1A5FL 4CN1A 4BH8B 1LEIA 1ZHNB 5KW9L 1EBAA 3DX6A 3L7FA 1QKZL 5C0JB 4Z78A 5FA3A 1NGWA 3GMLB 3WCYA 1P4LB 4XT1C 1T2QL 5K59F 2JCCA 4BUGA 1KB5H 3EYVB 5M95B 3PGFL 2NZ9C 4S1DC 4WNQB 3T08A 5ESQA 3RAJL 1FDLH 3REVB 4U0QB 2J8UA 7FABH 3BUYB 2YRPA 5FYJU 3ZKMD 4WHYG 4JM2D 1NQBA 3GJEA 2NQCA 4M62H 3MRCA 4TULH 1D9KD 3ELAT 4LCWE 4RGMB 1N6QL 1XR9A 2EE2A 4I9WD 4Q74A 1KIUA 4CMHC 1NAMA 2XQYG 1DVFA 3GMOB 3QCVL 4ZPVB 3DGGB 3BPNC 5EU4A 5CD5C 5IB3A 3UTPD 4G8FA 3WLBB 1MCFA 2R2EB 1GC1L 1NFDB 1HXMA 1PZUB 3DETC 5FA4B 1G6VK 5ANMA 2APVA 4UBDD 1G0XA 3TVMB 3MXWH 3JWDL 5B39B 2EH8L 1GZQB 5JNYA 3SBWC 4ZAKB 2XWTA 4HUWA 4G8EB 2CD0A 4MD5A 1NMCC 5DMYA 4OM1H 1DL7L 4O2FB 1B6UA 1RURL 2R0KL 4L8BA 1HKFA 3ARGB 1BOGB 2A1WH 4J4PD 1TZHA 2AK4D 4OFKA 3ZZ1A 5I1HH 3HTLX 3K0WA 4X0KB 1EEZA 4S10A 2OR8A 3L3GB 3T2NH 2F5AL 3MV8E 4XNYH 2N4IA 2PYEE 3ULUC 3C60A 1T6VN 1FVDB 1CIDA 4AIXA 4EOWL 2NY0B 3B4NA 2Y5TB 2RAMA 2Q3ZA 2ZJSL 3X11A 4NYLB 3LD8B 4HLJA 4KJPD 3DTXA 4KTYA 4S1RH 3SQBA 5GGUA 1FRGH 4K8RL 4OKVB 1CD1A 4X6BB 2GSIA 1QFOA 1E4WL 3OSKA 3MLYH 1HCFX 4HKXB 5CJOH 1AC6A 3L3DB 1IC7H 3ZTJH 3WFBH 1D5ZB 3RZCD 3OB0H 1BFOA 1AO7D 3WDIA 4M48H 4QWWC 1IGML 3CFJA 3KJ6L 4YEFA 4UMGA 4LSVL 5T3ZD 3FN0H 3STBA 4NPYA 2IAMA 2DQCL 3REWA 2AJXL 5DXWA 1PG7X 3RY5A 1AGEA 4IRZH 4IEFB 1DDHA 2P7TA 1CL7L 1GGIH 4JFDE 1UXSA 3BE1H 2P8MB 3CZFA 1LDPL 1V3JA 3MRFA 3MBEB 3RPIB 1AR1D 1WBYA 4U6HA 4UIMA 5FF6A 3FKUS 4S2SA 3ARFD 3ZKXC 1NC2D 4P99A 3N1MC 1T1XA 1RUPL 2Q7NA 5J11B 2CRZA 3TO4A 4OZHF 2M1KA 4P4KA 5LAXA 2V5YA 4JREC 1J86A 1JRHL 2X1PA 1BJ1H 5C08B 2CXKA 4HLZH 4LLAA 3TLRA 1G7QB 5IESL 1IKFL 1QR1A 5FO8A 3UAJC 3QUYC 4ZO6A 3OTTA 2GY7B 2Z91B 3RFZC 4EN3C 3C2AL 2G75B 2F5BH 1OGAB 3JV6A 4PGCB 1AKJD 2VDNL 2A6DB 4HS8H 2GEEA 2J6EA 4PJ7B 5JXED 3FFCD 4LLMB 4XRCB 1FFPB 1RK0B 2BVQA 4PR5B 2FIKA 3V79C 5LJYH 4JY5H 5CP7B 1RJCA 5E4EC 4M7JL 3LAFA 1EJ6A 2FJFB 1OSZA 3HPLA 3ZYZA 1T89A 4X80H 3GIZL 3JXAA 1V7ML 5SWSE 1RD6A 3W9EB 2XA8H 4EI6B 3IB4A 5J0BA 5DHVB 5D1QA 1N64L 5KSAD 2Y06H 4N0UA 4HUNB 4P2QE 5K59E 1BWMA 3IETB 1JZ4A 1I3GL 4HX1A 1UT9A 3G5XB 4MA1B 4MJ4A 2OSLA 2VQUA 1A8JH 3K7UA 1YY8A 2MJWA 4MCYA 2Y36L 3U0PB 4L8CA 5FUZH 4ESKA 3RKDC 2X4NA 2C1OB 4F57H 3QXTA 4HDIB 1MCSA 2OL3H 1KTDB 1PGRB 5DFVC 5F7NC 4UDUA 4Y88A 1IKNC 2ADJA 1KSRA 1U8OB 4R0LA 3TBWB 5DK2B 2ADIB 2DM4A 1P84J 1Z5LA 2CK0L 5DHYB 5DRNB 3TCLB 4M6MH 5FOBB 4UNUA 1A6AA 3UC0L 5AG8A 1JK8A 4MXQC 1BQHG 3CFIC 1BMGA 1F90H 2EYSB 3H9SD 3IDGB 3AMLA 3UBXI 1VKXA 1S78C 4ODWA 1TQBC 4JZOA 4JB9L 4ZYKB 4HH9B 4Y5XA 4ENED 3MMEA 2R1YA 4XAWH 1UZ8A 4JFFB 4CBPA 5GZOD 1YPZB 1FC1A 3CXDH 1AR2A 2EEDA 5F70A 3T4AB 2X7LA 1MCNA 2JTDA 5IMMA 1B90A 4XCYA 1QSFD 1QG3A 3TH4T 4FA8A 2JELH 2OCFD 5JQHC 2IPKA 1PY4A 4AMKH 3NFSH 4ZFOL 3U46B 5HY9B 2FZ3A 4S0TD 3LKPA 4JPVH 5ETUA 1F3JB 1BWWA 4QRRD 1KPUA 3GI9H 1CFBA 1JPGA 3CVHL 3HZYA 5IVXF 3RDTD 1CBVL 4HBQA 5I1CH 1S7VB 3Q3GA 2DS4A 1NUNB 1QD0A 1R5IB 4M1GL 1GGUA 4PRIB 4W6WB 3N9GL 1SM3H 4L29A 3TA3B 4JRXB 2Q8AH 4JY6A 4U6YB 1R5VB 4PJHA 2IAMC 4OD1L 3G04B 4NQCE 3IFNL 3ZLQC 3H7BB 1ZS8B 4N5EC 2NY5L 4U3CA 1YMMD 3C09B 2FIRT 5KS9F 3TN0D 3TV3L 4LCIL 4NHCL 3BKMH 1QA9B 3LKQB 1XGPA 4KRMB 1FZKB 4DZ8A 3ZDXF 2OZ4L 3D3VA 2VLJE 2IPUK 2X4OB 4XWGL 3QUMH 2QHRH 3VJ6B 3LHPH 4Q58C 4BQ6A 1QZ1A 1BHGA 4LCYB 4DTGH 1WFTA 3GSXA 4GAYA 3TO4C 3PJSB 4M9OA 1HSAB 3ZHDA 2OTUA 2WBJD 3LKSA 1EO8L 3VG0H 4D94A 5KJRL 3AUVA 4HUXA 1VFOA 2AJ3B 4QCIB 4J3WA 2ZKHL 3TIEB 1PG7L 4YR6A 1B2WH 1H8SA 4CVXA 2DRUA 32C2B 3MA7B 3BQUD 4ZDHB 4CVUA 3AVEA 4M4PA 5DQJA 2B7DT 4WEBL 4MA8L 1IFHL 5H37G 4YFDB 4OZHE 3QI9A 1FYTD 1IEHA 3HCVB 3HC0B 4XMPL 5J6HA 1U3YA 2D0HA 5E9DD 3RGVA 4OV5B 2IMNA 3QIWA 5E0QA 1T89C 4MDJA 3FCTA 1YC7A 2VDLH 1C8PA 4PTUB 1YECH 2XI9A 3BUTA 5D7JA 4FQQB 1BZ9A 2EXWC 5EIVA 5IWLA 1MLCB 1XR8A 3O3EB 1DJSA 3TZVD 5MI0C 3UO1H 4I4WA 4G8GE 1CFVL 3RWIA 3C6LD 5LGHL 2J1KA 4Y19D 3ARDC 1IC5L 5F21B 3LV3A 4OGXH 2G9HA 2WQ8A 4WTZG 5TH2A 2V7HA 1MJUH 4GAJL 1XCTB 4QRPB 3UTZB 1I1YA 3EO0B 3B2VH 3U4EB 3FL7A 3RWFB 4C56A 3EOTL 3KS0H 1FVEA 1P7KB 5JIIA 1JNHB 3FHQA 3P2TA 3BZFA 4G6KH 2BP3A 4PP2B 3BZ4B 3VXRD 2BVPA 4RNRA 2A9ML 2DQGH 4LU5H 1GOFA 1KCRH 1WEJH 4GRMA 3ZKNC 2HTLD 1AXSB 4U1IA 3MYJB 1I4FA 4D9LL 1F8TH 3HNSL 2B1HL 4K71B 1KOAA 4BZ2L 5IUSA 4OV6F 3ZTNL 1T0MA 1JNJA 4Y4HB 5IM7B 2DKMA 3TESA 2YMXH 1HI6B 1WWBX 5D2LA 4PLJC 4G43B 2UY6A 3PUCA 4FXLA 3T8XB 1EAJA 3M8OH 2E7MA 3VD3A 4Z76A 5FDWA 4LEOB 4MJIE 3QUXB 1CXIA 3X13B 4UV7H 1JL8A 4DGIL 2PF6A 1Q8MA 4FZEH 1NEZA 4QHLB 4PGBA 4FQJL 5C0EB 2R8SH 3NCYP 3GKWH 1MH5B 1H8OA 1E4XI 4YHIB 3U7YL 4OF8A 1XIWC 2HJLB 3SKJH 2YBRB 3OWEA 2MKWA 4PRHE 3BZEA 5LXGL 5HHNB 1I8MA 3VH8G 3W11D 1M4KA 2APBA 4PJIA 4R3SB 2AABH 5T33H 2LTQC 3SEPA 3IVKB 3RWCA 1HHIB 1IAIL 2UVFA 3C8KA 5GQBA 2ZZUT 1QBAA 1B0RA 4YDIH 2F8OA 2DQEL 3P9WB 5EOTB 3ULVD 2WSKA 4OD3H 1JZ8A 2D9QB 4ODSH 4GXVH 5C7XH 5EU6D 3PDOB 4WCYL 2FLRT 5DD1L 2HRPH 1CICB 1KFAL 1MJJB 3DMMA 3MREB 1A6VH 1WBXA 1Z2KA 1J1PH 5IVXE 1F3DJ 4HHAA 4RGNE 4NNPH 1ED3A 3P77A 5F7DB 4DCQA 4QHUA 4LVNB 5BRZD 1JPSH 1MWAL 4M43H 4LNVA 2GJJA 1BF2A 4N9GB 2X4PA 3IXTB 4MXVF 1ZT4A 3LKRA 1DBML 1UWGL 1EMTH 4E41A 5D1ZD 4NKDB 3SDCC 4JO1L 5CCKH 1QPPA 1Q9WB 3GO1L 1NL0H 2YOCA 3GJFA 4DN4H 1SY6H 4YE4L 1KCVH 3D39E 2GHWB 3ZDXE 4HT1L 1GZPA 4KPHH 4LSQL 4MD4B 3W9DA 3JSSA 3F58H 1A7NH 3D25B 4JJ5B 3SJVE 3G6JF 3ZE2F 1RK1B 1U42A 5TE7H 3GSNH 3RIAF 5GSVA 4XP1H 1GGCL 3EYFB 1HQRB 4LAQH 3IDYB 1RJZA 4XX1G 1PYWA 1MHPH 1RHHA 4H8WC 3FQRB 2DWEB 1QBBA 4JJHA 2X70B 1Q0XL 2DWDA 3RGVC 3V4VL 3QIWC 1L7IH 4WUUE 5B38A 1A21A 1OT2A 2NLJA 2V9TA 5DYOA 3L3KA 3GGWA 5D7JC 1CGUA 1BM3H 5EO1B 3GMNA 1FCCA 1MCIA 1FO0A 3K1DA 3TP4A 1MF2L 4BQ9A 3VWJD 3IYLW 1V5JA 3IF1B 5MHSE 1NGQL 1QLRA 2OTWA 2VL5B 3LVEA 1E27A 1KPVA 3EYQD 3QNXB 4U0RB 1I85C 5I1DA 4U7MA 2DJ4A 5GRJH 1UG9A 3RWEA 1CDJA 1G6RH 2SEBA 1CGSL 3KLAA 3LN9A 3O3AA 1V7NH 4NNYB 4NRYA 1Q9KB 3DXAB 5IEKB 5IB4A 1Q1JL 1UWXK 4L1HA 3ULUH 4UIKL 4K7PH 3FHAA 4U1LB 2PTTA 4F7PA 3IU4H 4UV4H 2XTJD 2RB8A 3OF6A 5HPOA 3MV11 4J8RA 4UNTA 5CGMA 2NY4B 3A6OA 4QRSA 3EYSL 3NABH 4JZJB 4TSCL 5KVGH 1ITCA 1U91B 3QJFA 4X4YA 2O5XL 4I2XE 2BCKA 2CR6A 3HUJF 4HIJA 1KJMB 3VE0B 5I1KH 2UZIL 5DJXA 2CJUH 1MCOH 1R3IL 5C6TL 1Q9LA 1KCSH 4Q2ZA 5LGJB 5IVOA 3IFPA 3EYOA 4BFGA 3FO9B 2OJZL 1JZ6A 4Y2OA 4ONHA 3RVVC 1N6UA 3BPLC 4ZFGH 5JXAL 1LO0H 4ISVA 5HYJB 5K9KB 2JCCF 3MOQA 1A1NB 3CFKA 4GKZA 4OF3A 1S5HB 1JMZA 1BFSA 4TNVK 2A77L 4PRPB 1UA6L 4DEPB 4L3AA 5FV2A 5CINL 4PRAB 2BSSB 3G6AB 2I60H 3I6LE 4CJ1A 1DLHA 2J8UF 2ED7A 3FMGH 3JUYA 2FX9H 4CNIB 1WC7A 4QHMA 1GAFH 4YDLC 2NZIA 3SO3B 2YPVH 5AG9A 4HIHA 3K4ZA 2APFA 3CC5A 1A7OH 3BGFB 4ZFZB 4M93C 4KY1H 1MRCL 3VWKA 1FZJB 3HMWH 3K46A 5FK9A 2NY2B 2DLFL 4YDJA 5IK3B 5A16A 5TF1L 2OK0L 3DX9B 4FZ8H 4YPGA 4WHTA 1F6AA 2WW8A 4J2XA 1OP5H 2A0LD 2UUDH 2HN7A 1VGKA 3PQYB 3PL6C 1OB1B 4OLYH 3KPPA 3L6FB 4I3SL 1Z3GL 2FX8H 1HNFA 4OIBA 4Y16A 1BX2B 2VXQL 4F3FA 1OPGL 4QRQA 2X40A 4NP4H 1JUFB 1A64A 5E70A 3JWNC 4HWUA 4X9IA 3WYRA 3CZJA 4O58H 1BD2B 2DQUH 5TDOA 1JGLL 4QF1B 4R4ND 3D6GA 2NXZC 3O6FC 3RWHB 2YA1A 4U1JA 3TVMD 1PFCA 3B3IA 4KDWA 3QDGB 2HWZH 2X4QA 4ZAKD 4LEXL 1UCTA 4KQ4L 1ZVSB 4MXVE 1NAMH 1DBJH 2QADC 1U8HA 4L3CB 3QH3B 3ARGD 2VJXA 5E7FA 4OBRA 4QHNA 2DBLH 4K3DH 2HFGL 1U8MB 2EKJA 2P8LA 2FR4A 5GJSH 1KN2H 4YX2L 5E2TH 5D7SL 1ZHKB 4TQEH 5F6HJ 2NY0D 1VPOH 2L7UA 1WWAX 3WNNA 4M5ZH 3ULUE 5F7MC 1QSZA 5DJ8A 3G6JE 5TE6L 3ZE2E 4TPRH 2GK0B 3IAQA 3P4OB 4Y89A 1FP5A 3H0TA 5D71L 4BH7A 1BAFL 3ABZA 1OY3B 3S88L 1K2DA 1NAKL 3TBVB 5SV4A 3BKJL 4G9FA 5HYSG 3VFNA 5C0CE 5KVEH 1RIVH 4O02L 2VISB 1K9TA 4PD4J 2F54E 15C8L 2HTKD 5L0QC 2DBJA 2DTML 3PG2A 4KKLC 3BD5A 5FECA 3LY6A 5CBEB 5I1LA 4HPOL 1OSPL 1DP0A 5HHVH 3DPBA 4MNQE 3B9KA 1MRFH 1OGTA 3GHBH 2GUOA 4LDLB 4FFVC 1MFEL 1P1ZA 1HOCB 5ID1A 2HMIC 2R9HD 4HC1L 3FQTB 3EO1B 1JI2A 3D9AL 1JE6A 5J06A 3ARTA 3C5SB 4TOYL 5IHZA 4HXBL 5HDQH 4EDXB 3MFFB 3EJZD 1CR9H 1KUMA 4UB0H 5DT1L 5C08D 2YN3A 1YDPA 3SGDI 3UP1A 3QULB 4ODTH 4I48A 2NYYC 4OLVL 1NGPH 1TVHB 3A67L 3KJ4B 4NN5C 1J12A 1I1FA 5AYQA 1PJ9A 4XAKE 4DGVL 1T0NB 3CSGA 3S6CA 4P9MH 2G60H 5EZIH 4JKPH 1OGAD 3SE3A 4I18A 3VFUA 4X99B 4N8CL 5KW9H 5HI4D 4LCWB 2MNUA 4QOKE 4W81A 5AYUH 2FWOB 4KJQC 2JCCE 3P9MB 3VWKC 1ZKAA 4M8QA 3OJVC 1SYVB 1T2QH 4F37K 4FFYH 5GRVL 5KTEH 3H9HB 4ZUVA 3PGFH 5J9PA 5ADPH 2XKNA 4LARH 2AQ2A 2R2HB 1CXEA 4JE4B 3QG7H 4JQIL 3W0WD 4MWFB 2J8UE 3F62A 2R1WB 3U9UA 1BIIB 3TT1L 4CN4A 3EAKA 1VDGA 2CIIA 3HE7B 5DRZB 3E1F1 4I3RH 2YUXA 3KPLB 3VRLF 1HWHB 2RJMA 4K94L 1FL5A 3WHE0 2ED8A 1HHJA 5J1SC 2J4WH 4N8VA 2HVJA 3N85L 3HFML 4HCRL 3OKLA 3ZDZF 1XGTB 4P0DA 4DVRH 1FPTH 4ODVH 5HGHA 4FXKB 1A7BA 5C0ND 1JN6B 1CFTB 3X14A 4ETQB 1CD9B 2ADFL 4UT9L 1MEXH 3QCVH 4LPWA 3MV8B 2PYEB 3L3JB 2VXSH 4PUBH 2ORBL 1T1WA 2FX7H 3MJGX 3V4UL 1GPOL 4KK8C 5SX5K 3WJLC 2NX5D 5ANME 4OI7A 3AGVA 5BV7C 3H9YA 5SV3A 4QXTA 5D93B 3BIBX 3V95A 4PJDA 1CGVA 1EEUA 3MV7A 5KANG 3QO1A 5EO9B 2R2CA 2C26A 4CGTA 4IOFC 4PJGB 4X7FC 4JQXA 5I8OH 1C7TA 1QP1A 5LGKA 3B9VA 2X4SB 1F4YH 3JTTA 2QLVB 4R7DB 4W4OC 1S9VB 4OI8A 5IMKA 4JFFD 2C4FT 3QHZH 2IH1A 1KJVB 3RIFF 2Q7YA 4WFED 3SY0B 1QFUH 1FFOA 2F5AH 5IHLB 1EX0A 4JFEB 5FKPA 5FHAH 2HT2C 1QFWL 3H8NA 4R96B 3QNYB 1I9EA 3WFEL 4HBCL 4EOWH 4FTVA 1C5CH 4GBXA 1X7QB 2JJSA 4PJHF 1MAMH 2DM3A 2ZJSH 3DO3A 1NLDL 1CLYL 5C9JA 1AGBB 4K2UL 4OCSH 5F1NA 4M7LL 1HH9B 3PNWB 2D03H 4PRID 1U8IB 3BEWB 4BKLB 1HHHA 2YEZA 3TA3D 5D8JL 1AFVH 4JRXD 3STZB 2R1XB 5I30H 3BX7C 4GUPA 4TN9A 2ZUQB 4ZNEA 5HVHC 1A4JA 3VGAC 5GXBB 2VO5A 4G7YH 4Y5YB 2AEWA 3RWGA 4F8TA 4OCXL 3QUZA 1ACZA 3Q2CA 3B9KC 1N26A 3KYOA 3PP3H 1Y6NR 3RRQA 4GW4A 5IVZA 1CQYA 1YEEL 5AD0A 4NQSA 4I77L 3QXDB 5AAMA 5FKAB 1QTYT 1JHTA 2JIXB 4Q97A 3U7WL 2P1YA 4HAFA 5DJ0A 3QHFH 5EIIB 1MAKA 2MTPA 3H9ZA 4K3EL 3P0YH 5J1TC 3UEZA 1IT9H 3DI3B 1MHCA 1Y6KR 3T0EA 3BMVA 4P2OC 1AD0B 1HCVA 3U7AA 5TE4H 4HGWB 3SGKA 3DO7B 1N4XH 3WXWH 1JRHH 3HAEA 2EH7L 4LIQL 4HUUB 1BLNB 3FB8B 4I18C 2HG5B 4NO2A 3ULSA 4JM4H 4E5XB 2H26A 4GG6A 2R4RH 5EBMB 1KELL 4K3GA 1FBIL 3RP1A 3VXNB 5ELIA 3MLUH 4P2QB 5C0IB 4KRLB 1B3JA 3ARBB 3HI6H 3CX2A 5C0BA 2VDPL 3CFDA 4HS3B 5KSBA 1TDQA 2VDOL 2Z35B 3VXSA 1AY1L 3K1KC 2W9EL 2YWZA 1CLZL 5I75B 1PD6A 2MWCA 3HE6A 3BD3A 5DJZA 3QEQB 1RZ8B 3X12B 4JPWH 4BK5A 1MJ7L 1PSKH 1S3KL 2Q8BH 5BVPH 2EYTA 2EC9T 3M17A 1X4ZA 2GQHA 4PJ8A 5LKNA 4G6FD 2K7QA 1X5AA 3TNNA 1CLOL 1U8PB 1QO3B 4TSBH 1K6QL 4H0IA 4N0UE 4H8WH 5FIEA 5ESVB 5TGBA 5I1GL 4OB5H 5CBAB 5B22A 3O9WA 3U6RA 2A38A 3LPFA 2X2YA 5EZJB 3IKCA 3FRUB 1T3FB 3BKYH 4P4RA 4IJ3B 3S96A 3EJJX 4N0FA 4HPYH 3VRLE 2EDXA 5D2LF 3VXMB 1H15A 3O8XC 4KK5D 5FYJD 5D9SB 1T66D 1XGUB 3ZDZE 4Y4HD 5LBSL 1QHOA 4JQXC 4U1NB 1AGCA 4TVPL 1DSFH 1TQCC 1A02N 2W1NA 3BOVA 3WS6C 3UC0H 5I76B 2YZ1A 3U1SH 5DEFB 1YJDC 4HJJH 4OGYL 1IVLA 3QUXD 4ONFH 4PJIF 5ICYA 4N90D 2E7LA 2IGFL 4LCCB 2YPKB 3R06A 4NT6B 2BSRA 4NQCB 4GBXC 2A6JB 1INDL 5DHXB 5F6IC 4GRWH 1YC8A 3C5ZD 1CN4A 1U92A 4WI5A 5HPMA 4XI5C 1MOEA 2YC1B 4MSWA 3C6SA 5ADOL 4YHNB 4HS6A 4JZNA 3GHEL 3QYCA 3GI8H 2E6PA 1UKTA 1A7QH 4RFNC 4NDMB 3WFHA 1RQ5A 1NMAL 2NTSP 3CVHH 4CU8A 2LU7A 3TBYA 1TVDA 1XGYL 1R3JB 2J6EL 4YIQA 3V6ZA 3VGHA 3ARQA 5LWYL 1WFOA 5SWQB 3N9GH 4PJHE 1I7TB 4LRNH 5C0DB 4P23D 3R0NA 5I0ZA 3MRNA 5HXMA 1AC0A 2D31A 4F7MA 3TJHD 1CICD 4PJ5A 1E6JL 5J12C 1ZLUH 1A1MA 2NY5H 1F3RB 1K8DA 3WIFB 2Y6SC 2I25N 3DV4A 5I1EL 4NHCH 2P47B 1LP9B 2IBBA 4EBQL 5IJKA 3NCBB 3RX5A 3D3VE 3PIQB 4UAOC 3S5LG 4U1SA 5CAYB 5JHDB 4RMUA 4NM4H 2W38A 3LQMA 2CLRA 2FB4L 4R6UA 3BGAA 1S7UB 4OZHB 3JVGA 4R8WH 2HJKA 1GVIA 4OD2B 3T0EC 4TRPL 5DJYB 1I1AB 4NJ9H 4MS8D 1KG0B 3QFJA 3SGKC 3L3HB 3HI5H 5E2UH 5BXFA 2IANA 4U31A 1Z6JT 3EFDL 3FB6B 1EO8H 5IF0B 4OAWB 4UQ3A 4JPKH 1NUFA 3HZVB 3BJ91 1QFHA 4P5TD 3V0AC 1WZLA 3MLXL 4XBEL 2RHEA 4G8GB 2CDGA 1MWAB 3QCUL 5I19L 2D0GA 1KTRL 2ZOLB 3BPCB 1A7PL 3V0VB 4ZNCD 4X98B 4RCAA 3FT4B 3TYFA 1CL7I 4YHPB 4PGDA 2W59A 4QO1A 2D7NA 4D8PB 3LS4H 2FYYA 2I5YL 3WXVH 5T1LB 3AREB 1YEIL 4JFHE 2UYLA 3DX7A 2HJFB 4L3EE 4KI5C 1U2HA 4D9RD 2VLME 3ECBB 4XBPA 4JFQB 5AZ2H 4EI5C 3BPOC 4ODHH 3DXAD 4MNHB 3T65B 3TO2A 3PWVA 4OCNC 3I2CH 2V2TB 2VH5L 1DLFL 3OX8B 4MJ5B 3L3OA 4EIGB 4FQ1L 5BS0A 4A2MA 1I7ZA 2HT4C 5CZVH 4BZ1L 4N1CA 4C56E 3QDAA 2K7PA 2XWJA 4YJZL 4D9QE 2Z8WC 5J6GA 1YYLL 1H3GA 4MJIB 4KU1A 1NBZB 2AAVA 1YY9C 3QFDA 2E6JA 5DQ9B 1EFXB 1DANU 3CLFH 3RL2B 3IFLH 2EEBA 3GB7A 3BISA 3E2HC 4X7TA 3GSRB 1DBKL 3H3PL 4PRHB 2B1HH 5HGAA 1OTTD 1OP9A 5E1HB 4OUUB 4YQXH 5E5UB 3CPLB 2BVYA 1I9JH 4NQUA 3KPNA 3ZKQD 5D2LE 1IGJB 1IAKA 5HYJD 2Y07H 2E7LC 2R15A 4XWOC 3NGBC 4PRBA 1UM4L 1MY7A 2X1XR 1T22B 4CU6A 2CDEA 1T5XA 4LLQB 4PRPD 1RIUH 2NNAA 5TDNB 4DGIH 2ERJC 3U30C 1IQWL 1S7RB 2G5BB 3WIHL 4APQB 1ZVHA 5IVXB 1T83A 3WN5A 4RGNB 5DTFB 4MCZB 3MV9A 2XQBL 3S7GA 2Q87A 1OAUH 4OLZH 3OKEB 3MQIA 3NVQA 5EZLB 4HG4K 4WU5B 1CXKA 3P4LA 2A74B 5KS9B 4OSUL 3VRIB 5T5FH 3D69A 4M7ZC 5F7EL 1R3KB 4WIQA 2ED9A 3T0WA 2YD9A 4OZGA 3FZUD 5JOPD 3ZE0F 3HC4H 3MRPA 3BEVB 3PQYD 4WDIA 3DWTA 5IJKC 2ESVB 4WVRA 1Q94B 3SJVB 2A9NL 2VLKA 4I3GA 3MODL 3WUWA 5GGTL 3MR9B 1P2CB 4MX7B 1A1OA 1IEBB 1W72B 4FFZL 3JVGC 2Z0BA 4LNRB 1EV2E 4WW1B 1NBYA 3VFWA 5DD6B 4E41E 2APXA 4LP4A 2XTLA 1JIBA 1UWGH 1M7XA 1BD2D 4M8VA 4JO1H 2EDOA 4GRLB 1KIPA 3GO1H 4NSKA 4HWBA 2W9DL 4JY4B 3EHBD 1QQDB 1WWWX 3AB0B 1QVOA 3QDGD 5DMGC 3ZYIA 4AK1A 2PYFA 4YE4H 1P7HL 1UM5L 4JFZH 3ZDYF 3N1PC 4Y1AB 4MZ3A 5E8NB 4RWHA 2ATPA 2DQFB 3T3MF 3V5KA 2IPUG 1IM3A 4LSTH 2YD8A 1P7QB 3VCLB 5HSFA 2ENSA 4TUJA 1RJYB 4FQXC 4WWKA 5KN5A 5IFAH 3IGAB 5HJ3B 1CDBA 2EZ0C 4JFYB 4Z8FH 1CCZA 1FQ9C 2NY3B 4AEIH 5C0RH 2DLGA 3FT2A 3MOAH 1TZGH 2FCBA 1A2YB 1ZMYA 4HWEL 1UYWH 1JP5A 4YXLL 5BV7H 4WFFE 2AEPL 2EDNA 1MF2H 1NCCL 5D1XA 5C6WH 1CZ8H 4HQQH 1ETZB 3VFTA 4U1HA 3TYGL 1WZ1L 5IJVA 2H2PC 4LCUB 1BVLB 4UUJA 4L4TE 2ZCKL 4ZD3L 1RUMH 2XXMB 5F89A 2PXYC 4RWYL 3BO8B 3WFDL 1NANH 3GSQA 3QDHA 1W0WA 5F9JA 1WBZA 1MCBA 4K8RD 1LNUA 2YRLA 4Z7WA 5A2FA 5DJ6A 1QLFA 2F58L 4F15C 1IE5A 2IPTH 3KG5A 2FECL 4KVCH 2HKFH 4GKSB 3QIBA 4RA3A 2EIBA 1RVFL 5ICXB 2ITDB 2X4TA 5I74B 5C09A 1XZ0B 2FSEA 4PFEA 4QYOA 2EIZA 5ENWA 25C8L 4KQ3L 5DDHB 4G8IA 3LKNB 1YEJL 4QGYA 2GTWB 2N56A 5T3XL 1G7LA 4L8DB 1U8LB 4PG9A 4AM0A 1OF2A 1U3HA 5ERWB 1HWGB 4P46B 4RIRB 4LSSL 1T04B 3HB3D 3VDAA 1D6VL 2MMXA 3LSOA 1RMFH 3MRDA 4JG1L 4LCWD 5JPNB 3DRQB 3WN5C 8CGTA 3QG6B 4EQ3A 2C4XA 1E4KC 3FO1A 1IGCL 4BSVA 4HUVB 1R0AL 5HHQA 2XXCB 4UT6H 3P11H 3S37H 1PG7W 1I8IA 1MPAL 4M61B 4F33A 3QO0B 4UTBL 1MCPL 2BVOB 3SDDA 3MRQA 4X9BA 4GW1B 4XNUH 3RU8L 1KBGL 2ZSWB 3ZL4H 2DLFH 1XAUA 1JPFA 5ITBL 1CD0A 5CP3A 2X9WA 1JGUH 4Y4FC 3VGDA 2A2QT 2OK0H 1FO0L 4LBEB 4JKKA 5DGQA 5ACZA 3P0VL 3CVIH 3TCXA 5I6XB 3BRGC 4CW1A 4LHUA 4PJDF 5CEXB 1ZHBB 3LEVL 1AQKH 1U93A 1C5DA 1G7IB 5I8CA 2PYED 2UZXB 3ZE0E 2PR4H 2XV6B 4YBLC 5DD3H 4H1LH 2ZCHL 4CL7A 2W9LA 5DF0A 4F9LA 3HLAA 4OJFL 4PB9H 3WO4C 1H3PL 3G6JB 4U7SA 3P73B 4TUOB 4JHWL 3DSNA 3QA3A 4K23H 3CAFA 1EXUA 3IDJB 4XVUC 3D0VB 1CE1H 1DBAH 5JDSB 4G7VL 5L88H 3JV4B 6FABL 4WWKC 3OAYK 1U8JA 2F19L 4F2MB 4KFZC 1MAJA 5E7BA 4JEGB 2BNRA 2QSCL 2AKRA 5F3BB 5I1IL 4MB5A 2M2DA 4IRSB 5C0CB 4NZTH 4OZIA 4JFED 5DQDL 1VEOA 4L9DA 3ZDYE 4C83B 1LWRA 3F6LA 3OJ2C 3SPVA 5JW4Q 5KZCB 1I7RB 4KJYA 3RA7L 4AENB 1IAOB 3T3ME 3ZT7A 2XZCH 5D1XC 5C0GA 2ZSVA 5CIPA 4RMTA 3KWWB 1YJDH 2CLVB 3NCYS 4ZUWB 3S88H 3FQWA 4U6VL 2I9TB 4HV8B 1T1ZA 1D5IL 4G9FE 4LVHC 2QEJA 3X17A 1VFAA 3T0VA 3H42L 2XZAL 4LQFL 2EKSB 3ZKXB 1F11A 5EFIB 3O2WH 2FO4A 3MBXH 2Q6WA 4QRUB 1CT8B 2I26N 3WFZA 1WICA 2YHGA 3HUJB 3A6CL 1RIHH 2FHBA 4JREB 2OP4L 1N0LA 4RRPA 4NM8H 3V0WL 4TNVF 2B2XH 3QIBC 4RDQF 2JIXD 2OI9C 1AE6L 1SYSA 4NBXB 3I6GA 1A6UL 1Z9SA 3PGDA 1LEIB 1G9ML 4AYFA 3CCHA 1IGFL 3DX6B 4GG6F 5D6DA 4Z78B 3D9AH 5FA3B 1NGWB 3OR7A 4NQEA 2EE3A 2V5MA 3CNKA 4HXBH 2AEIT 4BFIA 3IAPA 1P6FA 5KSBF 4F58H 5DC9B 5ESQB 5HYQA 4IOIA 1WZKA 1BFVH 3SDAA 1ULVA 5I73C 4P59H 3A67H 2J8UB 2PO6C 1WGOA 5GZND 2AXFA 1OAQH 3BT2L 5MP6H 4P2QD 3NA4A 3ARBD 3GJEB 4DQOL 4X5XA 2NPLX 3MRCB 1U41A 3U0WL 2WM0A 5D5MA 4N8CH 4LVOB 4Z0BL 2F9BT 1D9KA 3ESUF 4KI5F 2XZQH 3HNTH 4HK0A 1UM6H 5KOVC 3QEQD 4XXCA 4MAYB 5EDXA 5KVDL 2XRAL 3SDDC 3MLRL 3WFCH 1DVFB 3PWPE 3E0GA 3HN3A 5EU4B 2VLLA 4YH6A 5I17A 4DKEL 5IB3B 1KPRA 3I50L 3SQOH 4U1MA 3L5XH 2QBWA 4WFGE 5GS1A 1HXMB 1MCDA 1AI1H 4OGZA 4WFHE 5ANMB 3MRBA 3VFGL 1HINL 5E5MA 1VEPA 2DQTH 2QQKL 2H32A 1RFDH 5JNYB 2XWTB 4HUWB 4O51A 4MD5B 1DEDA 5DA0B 3S4SG 1D5BA 4YXHL 4XPHH 3N85H 3TM6A 4XBGA 4Y8AA 4LKXA 4L8BB 3FOLA 5F9WB 1SQ2N 5GJTL 5I18H 1TZHB 3LEYL 3VXMD 5DEGA 1EEZB 2DQHL 2AK4A 3BW9A 4F9LC 3EOYG 2R0WL 3C60B 2V5TA 2E27H 1SEQL 4U05A 3VI3F 2AXGA 3V4UH 4XPTL 5FO7B 5CGTA 5CZXC 3X11B 1K8IA 3NA9H 4OZFA 3DTXB 4XPAH 1ZLVK 5FYLE 4PJDE 5GGUB 5HVWA 2BJMH 3WDJA 1CD1B 2ICWJ 2GSIB 1K4CA 2GITA 2Z93A 1H3WM 4L8SA 1FZMA 1WT5A 4Y8DC 3UBXG 2X89A 4X9HA 1A6ZA 3NFPA 3RPKA 4NQCD 3SE9L 3WD5L 2D2OA 5E6IA 3T0BA 3CFJB 2COQA 4JG0H 4JO2H 4FQHA 1TNMA 4E0RA 2IAMB 3REWB 1FE8L 4FTVE 2ZG3A 5EWIH 4PJBA 1AGEB 3EGSB 3CK0H 1WITA 4Y2DA 1DDHB 1DEEA 1OW0A 4WWID 1UXSB 1F4WH 1CDIA 3OKOA 3CZFB 5HI3D 3SKOA 4ZTPH 3MRFB 4PG2A 5IMLB 1TPXC 3ET9F 3LRSA 1WBYB 1YEHH 4HZAA 4U6HB 4UIMB 4KHXL 5FF6B 4S2SB 4RAUA 3MJ9H 4BM7A 3ARFA 3KLHC 1T1XB 4ZNEE 2WINA 4QXUL 2FJGA 3QQNA 5GGVH 1MREH 4P4KB 5LAXB 1MFBH 1UH4A 3DV6A 1U8QA 1QR1B 3GM0A 4J6RL 5FO8B 4JDZA 4QRTA 2DI8A 3QPQC 5EU5A 2OJEA 2AK1L 4DW2L 5JHDD 2R0ZH 3P4NA 1NUGA 5D6DC 3MRKA 3JV6B 2EDHA 1U3JA 3BDYL 4NRXA 1NUDA 5DRWA 3MNZB 3QAZB 1I1AD 3NZ8A 5FO9A 2MQ3A 1ONQA 3I84A 1R6VA 4MGXA 5IB2A 3T0EE 4DAGH 4FQLH 4K7PY 1XF3A 3FFCA 4JDVA 4WY7L 2FIKB 4H0HB 3RNQA 4MZ2A 1LE5A 3O2DH 5E2WH 5AUMA 4QTIL 3EO9H 3SDXA 3A6BL 4NGHH 1OSZB 1ZTXL 4LIQH 5J1AA 5A3IC 1FG2A 2VLRE 5ID0A 4GG6E 4G8GD 4ZPTA 3ZKMC 2CUIA 2LQRA 4JM2C 2ZG1A 1S8DA 5D1QB 1JVKA 1D9KC 4N0UB 5DUML 1C08A 5FYLL 5C0BE 2YD2A 4HX1B 4OLWH 5KSBE 4KGJA 4XXCC 1NCUA 4KZEL 1U6AL 3VXSE 2VDOH 3WSQL 4K9EC 1VESA 4U4BA 1L9MA 5T1LD 1EEYA 1CLZH 3ARED 3HZMA 4L8CB 3CLEH 1AHWB 1UB5A 5E94B 2X4NB 5HHPA 3THMH 3AXLA 4YBQD 5GS1C 3ILQC 3IU3A 4MQTB 1EJOL 2ADJB 5DD5H 3MLZH 4KI5E 5CD3A 4TUKL 4UOW0 4R0LB 4NKMA 4UBDC 1LMKA 4EIZC 1CLOH 1FH5L 1Z5LB 4W68A 5HHMD 2B4CC 3OMZA 4JGUA 1JK8B 5EA0L 2VNCA 1VKXB 4GQ9H 4ODWB 4JZOB 2AQ1A 2ICES 1BVZA 4J4PC 5DJAA 1KT2A 3OB0K 4MJID 4PJFE 4Y5XB 3CSYA 3MMEB 2R1YB 1UZ8B 1J5OL 1EFXD 3MLVH 1M7IA 2VDQH 4HW6A 1FAKT 4KXZH 4NKIL 4EUPA 1NBVH 5FGRA 4YLQT 2K3TA 5IMMB 4ONGH 1DQQB 4XCYB 3MUJA 2ZNXA 4KJPC 2IPKB 3X3GH 4PRHD 5FEBA 2IALA 2FZ3B 3LKPB 4KHTL 1NGYA 4RAVA 5BO1H 3SE8L 1YQVL 1LGVA 3IJHA 5INCA 1KCUH 3K80A 3V4PL 1WT5C 1JPGB 3HZYB 5FGCE 1G9NC 3Q3GB 3NAAL 4N68A 3DUSB 2LTQB 2MKLC 3QEHA 3RZCC 4JY6B 4PJHB 3R8QA 2IGFH 4RFOH 3MRGA 1HZHL 2UZYB 1INDH 4APQD 4NC1C 3KLDA 5MERA 4FQIL 3TN0A 5CILH 4Z7VA 5EOCL 1XGPB 4OZGF 5H35A 5IHBA 5EUKA 3SKNB 4DZ8B 1AR1C 2FJHB 4KUZH 1RUQL 3D3VB 4DOHE 4XMKL 3ARFC 4P2YA 1JJUA 1TFHA 4HMCA 5F3HA 2CUMA 2D0FA 2W91A 1WLHA 3GSXB 1XGYH 4GAYB 1NMBH 2C3VB 4HIXH 5GGSY 2CO6B 2OTUB 3LKSB 1GHFH 3S36X 3K2UH 5EOQH 4PJ5E 5JOFA 3HRZA 1H5BA 4S1SH 5LVEA 2NR6D 4HUXB 2ESVD 3CH1B 4KZDH 2LVCA 3SJVD 1PW3A 2H3NA 3OAUH 1ZLWK 4OCMC 1G7JA 3BP7B 1TTGA 4DUVA 1FZOB 2A6IA 5I1EH 4YR6B 4CMMA 2ICWA 1P4IL 4CVXB 1LEGA 2YD4A 5DQJB 3WEXA 3B2UD 2XG5A 1QFWI 3BQUA 1YZZA 4QT5A 1U9KA 3IDUA 2WUBH 3QI9B 4GRLD 5CFHA 3F6IA 1MCQA 1E4JA 3CJJA 5JXEC 1FYTA 5J6HB 3QFJE 1FNLA 4H20L 3WJJA 3BHBB 3RGVB 2IANE 3QIWB 3L1OL 1OM3H 1SHMA 4MDJB 1JNNH 3FCTB 4A6YA 2W0LA 2ZCLH 5IR1A 4Y1AD 5D7JB 5EPMA 1BZ9B 2IEPA 4XPBH 1XR8B 3LKOA 1YYMH 2CKBA 5HHOB 1TZIA 2GAZA 1CFQA 4I4WB 1L4IA 3TZVA 1P7QD 5KSAC 3RWIB 5BQ7B 2DICA 1YEKH 3LH2L 4XNZB 3NMEA 5I19H 4Y19A 2G9HB 2YUWA 1CTOA 1C7SA 1NFKA 5TH2B 1J88A 2V7HB 1MVFA 1T4KA 3RTQA 1I1YB 1INEL 4YHYB 1BJ1J 1RV6X 4C56B 1FVEB 3UPCA 2F8VA 2CDFA 4HH8A 3BZFB 3KPQA 1D5MA 1BF8A 2CIKA 2YUVA 1ZT1A 3IJSA 3Q6FA 1E6OL 2BVPB 4RNRB 5E1AA 1NCWL 3VXRA 1IGIL 4GRMB 4U1IB 1I4FB 4KMTL 3SCMD 4Z7WF 1FGVH 2VH5H 1YQ2A 5I15L 1T0MB 4KTEH 1DLFH 1XF5A 1ND0A 1RZKL 3IFOA 3QZWA 5BS0E 3H3BC 5ISZD 5D2LB 2BSTA 2QQLH 4ENEC 5FDWB 2NTFA 4X5WA 5GZOC 3QSKB 5K9JL 4Q0XH 3L7EA 1SJEA 3HHRB 3Q5OA 1NEZB 3WKNA 3C2SA 3LB6D 4JN1H 4PGBB 1E28A 4JAMA 4YUEL 2YD6A 3A0OA 4P2RA 5E99H 3LDBC 2V2WA 5TQ2L 3BZEB 5AZEL 1F45A 4L4VD 1UZ6F 1I8MB 3QIUA 3VXUD 3K3QA 4PJIB 3FRPA 3RDTC 1CXFA 2PTUA 5EU7C 4S11A 4JFDA 3C8KB 1F00I 3GKZA 4P46D 4XCNA 1B0RB 1UEMA 1ES0A 1I8KB 1GOHA 3K2MC 3MA9L 5IOPA 5T1DH 1JPST 2OQJA 3UTSD 4YGVA 3MUHL 1L7TH 3TN0C 3DMMB 3LIZH 2FH6A 1TJIH 4F7EA 2DQJH 2P5WA 1I8LA 3AY4A 4HUMB 4JPIA 5IQ9B 2P45B 3P77B 3MV9E 1KB5A 4QHUB 2XQBH 5T5NG 1MVUA 2WUCL 2X4PB 4JDTL 1ZT4B 4O4YH 2PUQT 4XVTH 2AJUL 3F7PC 4X5LA 4E41B 4XPFH 1N3NB 5F7KC 2P46B 2BXYA 5D1ZA 4NZJA 2WBJC 5CSZA 4AIZA 3GJFB 1H5BC 5B4MD 5L6YH 1XGRA 2Z92A 1XF4A 4OZGE 2Y9RT 4OCYH 4NKOA 1YEFL 3W9DB 1GZPB 2EIDA 4YDKL 4K3JL 2VLKE 3AAZA 3BQUC 5GSVB 2QADB 5DD0H 3P30L 4NRZA 1YNTA 1RJZB 5SWSA 2MQ0A 1PYWB 3WLWC 1RHHB 5TQ0H 3WJJC 4QXGL 2EDDA 5TDPA 2DWDB 1JYWA 5KSUA 5B38B 2NLJB 2WIIA 3L3KB 5FOJA 2CUHA 3BN9D 3GGWB 4OZIF 3G5YA 1KCLA 3GMNB 1FO0B 4FHBD 1YEGH 1TMCB 3S36L 2QQNH 3MLTA 3UTQA 3TZVC 4CUCA 2P43B 1QLRB 2OTWB 5CSGA 1E27B 1KPVB 5I1DB 4IRSD 3RWEB 4IRJA 5C0CD 1QYGL 1C1EL 2SEBB 1OTSD 3KLAB 1RULH 3O3AB 4NRYB 1J0IA 5FXCH 3W2DH 4O2CA 3OQ3B 4JGMA 5L2JA 5IB4B 4GG8A 3FO0L 4ZOAA 1CDYA 4J1UB 4ZQKA 2PTTB 4F7PB 5KZCD 4OGAD 3VG9C 3KGRA 4NWTL 2E9JA 2VC2L 4J8RB 3UJJH 1EHLH 1NDGA 1OAKL 4LASH 4QRSB 4JO3H 3S35L 2E7CA 4M5YL 4POUB 3FFDB 4X4YB 2OR9H 2BCKB 1RZJC 4HIJB 4JO4L 3UZEA 3VXPA 5DJXB 3NOIA 3S97C 2HTLC 3VDCA 1Q9LB 4Q2ZB 4YGAB 4B7IA 2AGJL 4E42B 3IFPB 3O4OC 3TFKD 3EYOB 3GSUB 2PCPA 4CVZB 3QRGH 3E6FA 3MZGB 2WZPD 4Q9RL 3D87B 1GYAA 3PF2A 2LABA 5CIPH 2J88L 4ISVB 2AJYL 3W5NA 1S7SA 1K3IA 3GIVA 4GKZB 3O81A 5CS7A 4Z7WE 3LQAL 2IG2H 4D0BA 4M00A 2O5YH 4CAGA 2GJZA 5IBLD 3STLB 1CU4L 2Y7QA 1VGEL 4OTXH 3KPRA 1DLHB 1VSCA 3RI5F 4YHLL 1Q0YL 2OM5A 3QIUC 1WC7B 4QHMB 4QY8A 4DVBA 4KRPD 1IBGH 3W11C 5BMFH 4NBYB 3CC5B 5L9DH 4KQ3H 5D5MF 4HKBA 4ZS6D 1AJ7H 3LOWA 5DVOA 4KI1A 3IXAB 3VWKB 1GSMA 1MLBA 5FK9B 3ULVC 1ORQA 2VLJA 2QL1A 4HWBL 4MA7L 1PKOA 3JV5A 2BOBB 1NLBL 2APTA 4WI2A 1ORSA 4WHTB 1UZ6E 3EZJB 4JFOA 3P0GB 3WKML 1AH1A 1I8LC 2EDKA 3AY4C 4MHHI 4R97C 5CEZL 1H3VA 4PGEA 4XP4H 1VGKB 4P3WA 4G6JL 4WI4A 4MAYD 4NQTA 4C58B 2OS7A 3KPPB 9CGTA 3NACL 2CKNA 1RUAH 1EH9A 3V52H 1WCBB 4Y16B 1OWRM 1DVFD 4F3FB 2OX5A 1X44A 4QRQB 5D1ZC 2XACC 3GMOA 3VFPB 4RISH 4KDTA 1HKLL 5TDOB 2XG4A 4Q6IA 4U1JB 3GSWB 5FA4A 3B3IB 5K33A 4OM0L 4IS6A 4BQBA 1NCDL 1C5BL 3QDMA 4YHOL 4OFYA 2KH2B 5BW7A 1J1OH 4Q9QL 4K9EH 1KACB 1MFDH 4XCCL 2YA2A 1ITBB 4H26A 4QHNB 5J56B 1Y0LA 5HGBA 4RSVA 3O3DA 2P8LB 1FIGL 2FR4B 4NOBA 4X0KA 3C60D 3RIAK 5DVNA 2OL3A 3O6ML 3UDWA 3HPJA 3ZHKA 5B8CA 1J18A 2FEDD 2H32H 3BP4A 4ZOEA 2X5PA 3NIGF 2AJZA 1JGVL 5LCVL 2QKIA 4TTGA 1SBBA 2QR0A 5JW4M 2CGRH 4WUKL 1TENA 4U1GC 3H0TB 4ALAL 4TTDD 4BH7B 5C70A 5E8DH 4PJBF 3DLQR 3U9PL 3EYQC 5L7XL 1K2DB 1JNLL 3PGCA 4XNQB 4HKXA 5F1OB 2AJVL 2BNRE 2YKLL 3L3DA 3VFNB 1QBMH 2CPCA 2QSCH 4OZIE 2W60B 5ALCL 4PLKD 1KENH 3TEUA 2IAMD 2BY1A 1FGNL 2XTJC 1TJGH 3DVNA 2VDMH 5FECB 5I1LB 1OQOA 4HULB 5EORL 2Z8SA 3TT3H 3BJLA 5FCUH 4BQ8A 4TVPD 1OGTB 2P8MA 2GUOB 3SE4A 1CG9A 1P1ZB 5HDLA 1T0PB 4UNVA 2FNBA 4JVWA 5ID1B 4NQDA 1MIMH 3BSZL 4LOUD 5E08L 3H42H 4IBLT 5IHZB 1DQDL 4NZRH 1KEGL 5T3ZH 2CO7B 4P4KD 1QNZL 1UENA 4P5MA 1AGFA 4AEHL 4HGMA 1YDPB 4J12A 4OIIL 4I48B 1EZVY 2NY7H 2BVTA 1G7QA 3FO2B 1MFAL 4D0DA 4Z0XA 1V05A 1LDSA 5JUEH 3KYKH 1I1FB 4G9DA 4P2CG 2BNQA 3R4DA 4WJ5B 1EERB 1KCKA 1QLEH 5A1AA 4M6NH 4FNLH 3SDXF 3FQUA 4I18B 3VFUB 3QUMA 4N0CD 2CR3A 4PB0L 3OR6A 4NFBA 4HK3J 4M8QB 4LKCA 1GCFA 1A7RH 1LO3H 4POYA 1Y6MR 1SJHA 1LO2L 4ZUVB 1WTGT 5J9PB 3Q6GH 3FTGA 2XKNB 1QOKA 4HK3N 4MAUL 3W9EA 3U9UB 1KJ2H 5D1QD 3OPZH 1EO5A 1LO4L 3W0WA 3Q5YA 4O9HL 1F4AA 2CIIB 2FATL 4RGMC 2JLLA 3BT2H 3HA0A 5GRXG 1FL5B 1J87A 5D5ME 4U3XA 1HHJB 3SDYL 5JORA 1MNUH 3MLSL 3IDMA 4Z0BH 2HVJB 3D39A 2J2ZA 3FQXA 3OKLB 4GMTL 5HGHB 4RZCA 2WP3O 3U0PA 2NCMA 2FECI 1FSKB 4OF6A 4KDTC 3UROR 2XRAH 3MLRH 4XH2A 3NFNA 2DDQH 3BWAA 4HDIA 4Q6IC 4AG4H 4DKEH 5L2KA 5JA9A 3UTPE 2ZUUA 3I50H 1U8OA 3TVMC 5DK2A 4LSUL 4LLVA 5J8OA 2ADIA 5BW7C 4ZAKC 4OBSA 4QXTB 2NX5A 2EC8A 2XKUA 3MV7B 4JLRA 4MA3A 1MRDH 3QO1B 4XC3H 1KB9K 3QQ4A 1ZT7A 2AJSL 1BIHA 1TQCB 4OCRH 2VXTL 4RBPK 3JTTB 3UDWC 3UJIL 5IMKB 4EVNB 1WAAA 2W65A 2IH1B 3BRFA 4LSPH 2Q7YB 3LEYH 2AK4E 4F7TA 2NY0C 4LAJH 1JGDA 1FFOB 4MVBD 5FKPB 5FYKE 1MQKH 3QXAA 4F8QA 1OAYH 1A14L 1SEQH 1ZSDA 4GBXB 2DQDH 5F6IB 3ALWA 1PLGL 1DQLL 2AV1A 5C9JB 3NZHH 4ZTOH 4PY7A 3ARSA 4MQXD 4WEUD 1OAZL 5CJXC 4Z7VF 1R5IA 1HHHB 2YEZB 3FB7A 4I2XA 4GUPB 3NIGE 2NW3A 4J3SA 1A4JB 3KXFA 1R5VA 1UWEL 3KPTA 3NH7H 1IAIM 1A3LH 2XA3A 3QUZB 5T3ZE 1ZANH 4Z7NE 3KYOB 4PJBE 4PRDB 5CKAA 2N7AA 4HF5H 4GW4B 4NC1E 5IVZB 3SE4C 5AD0B 4I0PA 3QUKA 5E8EA 4GXUM 5DR5H 4NQSB 4U1KA 1KC5L 3GM8A 1SBSL 2BOCA 1KIRA 3S34H 1KJ3H 1BECA 3TBTA 1JHTB 2R56L 1H8NA 1OP3H 4D0CA 5DJ0B 3VJ6A 1JFQL 4R4FH 5J11C 4XVSL 3BVNA 4G5ZL 1J0JA 4BK4A 3C8HA 1HSAA 3EJZC 4GAGL 4Z95L 1MHCB 3T0EB 4KAQH 3VU2A 1Y18B 2WP3T 4WV1B 3HAEB 4MXWH 2WWKO 2IFGA 5ITFA 4NO2B 3ULSB 2AI0L 2H26B 4GG6B 1DN2A 3KPMA 3S4SB 1I3VA 5GS0L 3QI9D 1EO7A 2EDRA 3ARYA 5HI4C 1RZ7H 5C0BB 3DIFA 3JBG7 3CFDB 3MRJA 2B4CL 3CFBA 3RGVD 3QIWD 1SY6A 5F72S 1A6WL 1CQKA 3HE6B 1OVZA 3JWOL 3FFCE 4H88H 4O5LH 2X42A 3SDXE 4HFUL 5C07A 5JIKA 3LMJL 5HHOD 2DLTA 2R29H 2VLMD 3A6BH 1N0XH 3G6DH 1CGYA 3DHMA 2NY6B 3M17B 4PJ8B 5FYKL 3FAWA 3GSNA 2R4SH 4TSAH 4XMLH 4Z7QF 1TCRA 3DVFA 3MOBH 5TGBB 3UBXB 1KGCD 3PHOB 2W0PA 3QB7C 4LLUA 3O9WB 3AM8A 4JR9L 4C56D 3U6RB 3HS0A 3EO0A 4ZS7L 1JHKH 2FBOJ 1NSNL 4D9QD 3IKCB 5J3HD 5C0NC 1S7WA 1OAXH 4P4RB 5K9QI 1S7TA 3VRJA 3S96B 2FD6H 4N0FB 3SBWA 3D0LA 4JKMA 4KKAD 4N1EA 4B7LA 1H15B 3RBSA 4OCLC 4KK9D 4D3CL 1EJOH 1FVCA 1KXQE 1EBPA 2F15A 1AXSA 1G6RA 2HYMA 5IIEA 4OLXL 4PREA 3EDFA 3QDJD 1AGCB 1U36A 4NZUL 4GAFB 4R2GC 2G2RA 3QPXH 1F4XL 5FGCB 1X5LA 3H9SE 3WIIH 4J3XA 2EDLA 5C2BL 3DVIA 1BBDH 3OGCA 3X13A 5BVJB 3R06B 1RZJH 35C8H 2BSRB 3MJ7B 4NJAH 3SOBL 2R0LH 4PJXA 1J1XL 3M45A 2HJLA 3EJYD 5EU3A 1U92B 5HPMB 3ULVF 2WWKT 3MLWL 3C5ZA 1KV3A 1N2RB 3ETBF 1KLGA 4HS6B 1QBLL 1TXKA 4JZNB 4KHTH 2X09A 3SE8H 5F8QC 4POZD 4DOHB 4QRRE 3KHQA 3V4PH 2DQIL 5D7LA 1JGEB 3WFHB 4DK6A 3TA3C 1R24A 1KIQA 3TBYB 5EU7E 1NCNA 3V6ZB 4YIQB 3ME0A 4JRYA 4Y5VB 2VXUH 1WIOA 2FL5A 3NPZB 2D31B 4P23A 4F7MB 5GRUH 3DMMD 1A1MB 2ZOKA 1K8DB 4G3YL 1FAIL 5IQ7H 3DV4B 1DFBH 4Z7VE 2ZUVA 1F6FB 1YNLH 5EOCH 2EC9U 2HKHL 4U1SB 3ES6A 3O4LA 5T3XD 3L5JA 4FP8L 4YNYA 2CLRB 2E7BA 2GSGA 1K4DA 4JFPA 2HJKB 3OV6A 3Q5TA 4EN3A 3QFJB 1VEMA 4HGKC 4HXAL 1ACYL 5BXFB 2IANB 4KMLB 4QOKA 2C5DC 4QGTA 1FC2D 1P9MA 4UQ3B 3ZHLA 3ZT6A 1X5KA 4LPVA 1LK3H 2ZPKL 3D2UD 1DUZA 3VXQA 1MCRA 4JJ5A 3IKKA 2VDRL 5KAQF 4MLSA 3OGOE 3BDXA 1P4IH 1ZGLA 4P5TA 2H1PH 1I7UA 3KYNA 5FB8A 2DWEA 3RUGE 3GK8H 3MGOA 4WGWB 3TYFB 3OKDA 1FYTE 2ARJA 4J3OC 1JWSA 1UJTA 4NQVA 2HT3D 4OFDA 4PGDB 1LEKA 5LQBH 2EECA 1O0VA 2FYYB 1ADQH 3CDYA 4HKJB 3F7QA 3RL1A 5J13B 2UYLB 1S9WA 3DX7B 1FNSL 4LHJB 5BJTA 4P9HC 3GUTA 4OT1H 4XBPB 2VL5A 2EDEA 5HHXH 1TETL 3J7HA 4KKBD 2FGWH 3Q1SH 3HC3H 3L95A 3PWVB 4GJTB 3TO2B 4MMXC 3GBML 4Y19E 3AM8C 5DMIH 5GGSA 3L3OB 4RQQA 1IKNA 4U1LA 2K9UA 5BS0B 1I7ZB 2FHFA 4P48A 1I75A 4I1NB 1UCBL 3QQ3A 2DJUA 2XWJB 4I0CC 3UCRA 1J05A 4Z7QE 3PABA 5J6GB 2HFEA 4U2YA 1A3RH 5GISH 2EDBA 3X3FL 4KK5C 5C3TA 1JHLL 2RQ8A 4FFVD 1BBJA 4B41A 1B4JH 1T66C 2H8PA 1D3CA 4K71C 1TTUA 3VXRE 3UX9B 4F15B 1I9RL 2IH3A 1RZFH 1NCWH 2EO1A 3GB7B 3CFEA 4X7TB 4Y4HC 2ADGA 1CDGA 2BVUA 3KLSA 3BKCL 3F7VB 4CRPA 3WV0A 1IL1A 3FO9A 1JPTL 1S7XA 4KTDH 3KPNB 2VMFA 3LS5L 2DMKA 5DMKA 5DRXB 1IAKB 1WQVT 1EGJH 2VE6A 3QUXC 2VB5A 5FDYA 2NYYD 2Q1EA 4GSDL 4PRBB 1KEML 2VZUA 3MNVA 2CDEB 5IBTH 1T5XB 4DGYH 1Z0MA 1KTKE 2NNAB 4ERSL 4H25A 3UZQA 4HIIA 1MIEH 4EEEA 3C5ZC 4JHAL 4NO0A 4WI9A 4G80A 4P2RE 4XNMA 3PHQB 4OKDA 3RNKA 4OQTH 3MV9B 1FLRH 5GSRA 4ODXA 1G1YA 3BH8A 3I9GH 3VWKD 3W81A 2RCSL 3MACL 4WEMB 4N1HB 1X9QA 2HH0L 1AXTH 3U4BH 3ARVA 1MSPA 4KH2A 5BOZG 3U2SA 1P84K 4P23C 3CMOH 2BXZA 5FYKU 3ARRA 3ULVE 3D69B 3TJHC 3GRWL 1Q9OA 4A6YL 3ALXA 4OZGB 5EU6E 3UXFA 4GOSA 3MRPB 4WDIB 5C0AA 5ACMA 3QCTH 2P5WE 3PQYA 2CKBL 4XPGL 1RUKL 4AL8L 4LVNC 3L9RA 3H2WA 2VLKB 4Y16D 3T0XA 3WUWB 4YHKL 1N7MH 4OZ4A 4XTRD 2VQ1A 12E8H 1A1OB 3GJFK 1T80A 5EULV 1NBYB 3VFWB 3KNBB 1MJ8L 2WUCH 5JPMA 1VFBA 1R3HA 2DLIA 4MS8C 1KIPB 4FFWD 2DD8L 3DYOA 3LPWA 4XXDA 2GKIA 4M1DH 4X7SL 1P9MC 1QVOB 8FABA 5HDOA 2PYFB 3VD7A 2J7LA 3QDGA 1FFNA 3OJMB 4OCWL 5DFTA 1MFCH 5IB5A 1DN0A 2VZ3A 4P5TC 3IDYC 1IGTA 2ATPB 4NC0B 5F6HI 3BYYA 3MCLL 2BMKA 3L3IA 1IM3B 1LE9B 1K85A 2I9LA 4TUJB 1SEBA 4UI2A 1HHKA 1LK2A 1ZVYA 3DUUB 3FT2B 1C16A 4WI8A 5GGVY 3KDMB 3BRDA 1DBBH 3ARDA 3KR3L 2CRMA 5SX5H 5E6YA 1E4XH 1QFWM 3OZ9H 3MCKA 3WS3A 2EO9A 4U0RC 4UT7H 2X9XA 1ZEAL 3H6JA 3VFTB 4U1HB 3WHXA 3ORJA 5IJVB 1CTNA 1DZBA 4LP5A 5DUPL 2VISA 4UUJB 2P5EA 4LVHB 3TWCL 2VAJA 4XP9L 4EDWH 2B5IB 3D48R 2A6KA 4DN3H 1PX4A 5F89B 4M6OL 4JZJC 3GSQB 2XTJE 2WK2A 2VC2H 1W0WB 5F9JB 3TJEH 1WBZB 3BZDA 4FQ2L 2WWMD 1LNUB 5F9OL 5DJ6B 1QLFB 3G08A 1FNHA 3GFUA 5TFSL 1IGYA 4U6XA 3QIBB 3VXTA 4WO4A 3QEGL 1MUJB 5C09B 5E4IA 3MUGA 1J0ZA 2FSEB 4QYOB 5HI5D 5D7KD 4DKFH 1OTTC 5ENWB 1BGXH 4PRNA 4G8IB 1KB5L 4JN2A 1IZKA 1XIWA 4Q7DA 1G7LB 3BXNA 4N8PA 1FDLL 4PG9B 1OF2B 1U3HB 1T5WA 7FABL 2AERT 4DEPC 3QWQB 1N5YL 2J8OA 1D5XB 4UILH 1NGZA 3LSOB 4TULL 3SO3C 3RBGA 4IMKC 3KPRE 3T3PF 1CU4H 2BVEA 3MGTA 3OKMA 2EDYA 3FO1B 3BGFC 4BSVB 3BP6A 5HHQB 1I8IB 2VITA 1TIUA 4NN7C 2Z8VC 4M1CD 4F33B 2QHLA 3I02A 4P3DA 4LK4A 2R2HA 4L5FH 4TNWF 3SDDB 3MRQB 3QT2A 4WFGD 2R1WA 4X6EA 3T77A 3G5ZA 1P4BL 4EKXA 3FZUC 3ARUA 1B0GA 3AS0A 3O6LH 3MXWL 3PP4H 4R90H 2YPLD 5ACZB 3SDCA 4EXKA 2X05A 4OM1L 3AU1A 2AEQH 4CW1B 2XOTA 1T03H 1SJVA 4LHUB 1N59A 1JN6A 1U93B 1C5DB 3T2NL 4LFHD 4XNYL 2X4UA 4XVJH 5DS8A 4YWGH 5C1MB 2AP2A 1A9EA 3LN4A 5DHVH 3GNMH 5ESAA 1CK0L 3EHBC 1WFUA 2FBJH 1WAAF 3CDGA 3ROOA 3HLAB 4S1RL 5FYLD 1LO5A 4MQSB 3MV7D 3QA3B 1CGXA 2BC4A 1FRGL 4A2LA 1EXUB 3QDME 1J11A 3MROA 2YS4A 2R69L 4HWZA 3F12A 3MLYL 4PJGA 5TPWH 1U3ZA 5CJOL 5D72H 1U8JB 1A6TA 4L3EA 1IC7L 3WFBL 2BNRB 1S9VA 5CWSB 4WI6A 3O3BA 3QWOA 4NUJA 4OZIB 4EQ2A 3FN0L 1GC1C 1HNGA 4PJCA 5DJCA 5E00A 4JFEA 3T4YB 1X5XA 1RAMA 1I85A 4IRZL 3SPVB 3V8CA 3JWDC 2VZOA 4KJYB 1GGIL 4PBVC 5HTSA 1JGVH 3BE1L 2GI7A 2N1KA 5C0GB 1ZWIA 2GIYA 2ZSVB 4MDIA 1P5VA 4XCEA 3LZFH 3FQWB 2EICA 3BEWA 2GJ6A 4BKLA 4R9HA 1T1ZB 1VFAB 2AJVH 4EXPX 2VWEC 1QSEA 2WBKA 3O2VH 4Y5YA 3QUZD 1F11B 1JV5A 3QXUA 2FO4B 3D85D 4QHKJ 2Q6WB 4YPJA 3DGCR 4FQCH 4FRWA 2VDKH 1CF8H 1XF2A 4K8RC 4P49A 5CUSH 4ZFOA 4WO4C 2F5BL 1LD9A 1SYSB 2VZTA 2NMSA 3E8UL 3I6GB 1GIGH 1NPUA 3PGDB 3CCHB 3CVHA 1U8KB 4NQDE 1S9XA 4HS8L 3TC9A 5EIIA 5MEPA 1KLUA 3BSZH 3OR7B 4NQEB 2HVKA 1KEGH 1VA9A 4BFIB 2FEEL 4JY5L 5GGQH 4WU7A 4QXWA 3KJ4C 1OT1A 3WE6B 2C3XA 3PWNB 3T2QA 2FHCA 4X80L 4IOIB 3SDAB 1MFAH 2XA8L 2BNQE 2XN9D 1BLNA 3FB8A 1IJ9A 1ROWA 3HB3C 5CHNA 43C9A 2AXFB 2RFXA 4YHMH 4IM8A 4X5XB 3O11A 4S0SD 5D5MB 1XGQA 4RGOH 1D9KB 4PP1C 3OJDA 4U3HA 3HE6D 5JLZA 1T2JA 1G84A 2IBGA 3QEQA 5FUZL 1RZ8A 3X12A 4F57L 2PW1A 2OL3L 2VLLB 2NY6D 3PL6A 4PJ8D 4IDJH 1KPRB 3C08H 5F7LB 3T3PE 4MAUH 5GRYA 4U1MB 1NJ9A 3W0WE 1IQDA 1V3KA 5GS1B 2J5LC 1BZ7B 3VFOA 3MRBB 3UYRH 4M6ML 5E5MB 1NCAL 3O9WD 5C92A 4PYGA 1F90L 2QJDA 4XC1H 1D5BB 4XBGB 1EUUA 4F7CA 3VFSB 3O6FA 2YK1H 1M71A 4LKXB 4XZUA 5DJ2A 5EZJA 3FOLB 1QRND 2WV3A 3ULUF 4PV8B 4XAWL 3BP5A 5DEGB 5L8JB 2AK4B 4P9HH 3CXDL