5EC1B

Kcsa with v76ester mutation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 47
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1B01
3GSXA 5F9JB 1DANU 1T3FB 1NCDH 1MFDH 3DVFA 3L7FA 3PWPE 1UM5L 1A6PA 1Q9LB 3X14B 3QHZL 1JZ2A 4G9FE 4TVPE 2ZOKB 5MERB 4NQSA 3IJHA 5DQ9A 1CE6B 1J12A 1CWVA 3Q3GB 2VH5L 2QSQA 4JRYB 1EUUA 1WCBB 5C9KA 5CSBA 5DEGB 1LO5A 3UTSA 3SGEI 3LZFH 4P2RA 1MCFA 1U3ZA 2VTFA 3KLAA 1AR1D 4QNPF 3DUUB 3NAAL 4P2OA 5IMKA 1F8TL 2J6EH 2VRAA 3OB0H 4HQQL 2IG2L 1J10A 1ORQA 1TJIL 1AY1H 4UDTA 1H8NA 2J8UB 2HFGH 4XH2A 1A1NA 1A8JH 1H15B 3RIAK 1A4JA 4NNXB 5FYLL 4J1UA 3WXVH 3UBXG 4Z7WB 3MFGB 3X13B 4CN1A 2N4IA 5D2LB 1BREA 2CLVB 3JWDC 3KPSE 2DQFA 4GBXD 4PGCB 3UBXB 3QNXB 1T2JA 3IDUA 4X6EA 5DMIL 1B4JL 2D03H 1NLBH 4KC3B 5TF1H 5TE6H 3WIIL 4PJ5A 2P5WD 2W91A 5GS0D 1TJHL 4PGEB 3KYMB 2FECL 2AEPH 5GIRB 4KAQL 5CD5C 3L3JB 2EH7L 5ANME 5BVJB 3CFKB 1UM6H 2BY3A 2XG4A 3MACH 4ZXBA 4LBEB 4XAKE 2P5ED 2M8XA 2GJ6A 1DVFA 3ROLA 2XN9A 2P8LA 1BWMA 3FO9A 5DZNA 1YC8A 3ZYIA 3WNKA 2VC2H 3KPMB 1I4FB 1MVUB 1FLRL 4JRWA 2BSTA 5C0IB 5TQ0H 3NZHH 1BZQK 4GG8A 1HWHB 2IQ9H 4M1DH 1MEXH 5HDQH 1OTSC 1S7RA 1BQHG 1RZ8B 4C83A 4XRCB 5IUSA 1OT2A 2AXFB 3MRLA 5IMLA 3CC5A 3RBGA 2DQCH 1BQHB 4XGZA 4XBGA 1Z6JT 5KSAD 1DBML 2XYCA 4ZYKA 3VJ6A 3SN6N 3BD3A 2W9LA 4X9IA 5EZOH 3ZSTA 3NOIA 3PWPA 4E41E 1JF1B 3ZKMC 1X5GA 3NTCL 1R6VA 3MBEB 3S98A 1F58H 4G6AD 2Z8SA 5D2NA 1U6AL 5J12B 4L4TB 2DJUA 1ZVSB 4G6ML 2YMXL 3FO0H 1ZHNB 2VZVA 3QCUH 5GGRY 4JJ5B 3PGDB 3NFSH 4JM2F 1KPVB 4AEIL 2BSRA 2EXWC 1HEZB 1LP9E 3DSFL 3L5XL 5IFAH 1X5AA 2W38A 4AIZA 3FB6A 2YRZA 2ZPKH 2VLRE 5BMFH 1Q9WB 4PJGB 3QG6B 4HKJB 1G0YR 1TZGH 2IPKA 4K55A 3WFDH 2LV4A 4J3OC 3NFPB 1CG9B 4M61A 4RBPH 3FONA 2DQHL 4ZPTB 1YEHL 4DZBB 4UT6L 4TUOA 1NCBH 2R56H 5DUBB 1ZLSH 2AQ2A 4GW1A 5JA9A 2AJZA 5T33H 1HZHL 1JCKA 3QUYB 3LKSB 2DD8H 1WCQA 4P2OC 3KLHD 3RWHA 3ROOA 4FZEH 3VRLE 4DW2L 2RQ8A 3MUJA 3K4ZA 1QNZH 5T3XE 3BMWA 5IJVA 1OCWH 2ZCHH 2CRZA 4O2CB 3WUZA 3OKLB 1VFOA 3QUZB 4FABH 4L8BB 4FZ8H 2WBKA 3F7PC 1INDL 3NCEB 4UQ2A 5KW9H 4JDTL 3ZE1E 5E2UH 2ZUWA 5E1HB 2OZ4L 1HYSC 4K9EL 3CFEA 3QEGH 4KQ3L 3ARTA 3S37H 4ZFZB 4ZDHB 2DM7A 4M1CD 4WTZA 3O4LB 2FDBP 3MV9B 1NDMA 3T0BA 3SKUD 3ZYOA 3WLBA 3TLRA 3GKZA 1C12A 4ZXBC 5D96B 4MCZA 4TRPH 5DJXB 1W72A 1DVFC 4HJGA 3QIBD 1CL7I 4BFBD 1TITA 4FNLH 4QF1B 1QBAA 3WIHH 2CRMA 3ZT5A 4S1DD 2P8MB 3KHOA 1TCMA 4UTBH 1CBVL 1CD8A 1HHKA 3SDAA 3FJTA 1EMTH 4G8FA 5E9DE 1YUHA 4UINH 5JPNA 4ERSH 4MCYA 5K9KB 3OKMA 2JB5L 1OAYH 4PRHD 5C0AA 5KVGL 2AJXH 2YC1B 1FIGH 1KC5L 2NXZD 3TBSA 2DLIA 4XNUH 4OD3H 2FEEL 3SKOB 4PJ9A 3LD8B 5DS8A 1UB6B 1ED3A 4IM8A 3KYNA 2CK0H 3TYFB 3NMEA 5D2NC 2K9UA 3QNZB 5CEXB 1JYVA 5CGTA 3AXLA 3B9AA 1KG0A 3T0AA 2DM2A 4CVZB 15C8H 5F93C 5B3JF 5KBNC 3BPNB 3P30L 3ZT7A 1JGDB 1XF3A 2IALB 1JNJA 1UXSB 2P5WB 4P57A 2HP4A 3ARSA 3MLRL 5ALBL 5E94A 3VCLB 1RUKL 4PB9H 2P5EB 3ILQC 1P4IL 2H1PL 2NY3D 3T8XB 1JGLH 1T89A 5J1SC 5EULV 3NA4A 3VMPA 1OTTD 4D9QE 3MLUL 1YN6B 1C08A 5AAMA 3U36A 4QY8B 1J05A 4PJXE 1Q1JL 3RGVA 2HRLA 1FO0A 1P4LB 3GSQB 1AQDB 5C2BH 4MB4A 1X7QB 1V3JA 3FQWB 1E28B 2BNUA 2NX5A 3KPOB 3KPQA 2MHAA 4OM1H 4UBDC 4OGYH 4BKLA 5I8EA 2Z8RA 3GMLA 5KSAB 2NYYC 5F97E 5C3LD 3NIGF 4MDIB 4Z77A 4JHAH 1SY6A 3VXRE 3KWWB 5IIEA 5JR1L 3O2WH 4HPYH 2FIKA 4KK6C 3AS0A 2VLLA 3U9UA 4YHYC 4HGKC 1SMOA 4KJYA 2ICWJ 1FGVL 3DV4B 2MMXA 4IRZH 2HAZA 3C8KB 4LLQA 3GJFK 3W0WE 1P7QD 3VFMA 4M7ZC 2J6EA 1GC1H 3QO0B 3X12A 4ONFH 1IM9A 4HIIA 3FT2B 3SDAC 4HPOL 2YR3A 2BHUA 1MWAL 4I4WA 4W6YB 1EO8H 1SEBA 4N8PA 5I18H 4RGOH 1JUFB 1FIEA 2LAAA 1YJDL 1D9KA 3HA0A 2PTTA 3V6OA 1P4BH 5C07A 3ULUC 3H42L 4XCFL 5C0CE 1NAKH 4R97C 4HH9A 5HYSA 4WFFD 1V7ML 3DIFA 2B1AL 3QWOB 1DE4B 2F9BT 3UXFA 4PJ9C 3HG1A 3STBA 5IK3A 4AL8L 1UB5B 4GRLA 4JHZA 2DQGL 2XA3A 2ADGB 5F1NA 4F7TB 3QPXH 2W0PA 3QUXA 1JPSL 2XTJE 1J18A 1JHLL 4JPIA 2M26A 4ODHL 2DQDH 3F6LA 5GGTL 1ZHLA 5DVNA 3O6MH 5E2WL 1KEML 1UZ6E 3FQUA 3MV7E 1TVHB 1DQLL 5FM8A 4OLXH 2R1WB 2P8PA 3IDIB 4I77L 5K93A 1CFVH 1OB1B 3PWVB 5BQ7B 2GI7A 4HLJA 2JIXD 1U8HB 2R39A 4LDEB 1I3RA 4FTVA 3QHFL 5I76A 1KIUA 2V2WA 1DQJA 5CSZB 4GAYA 1T66C 1X5JA 2HLFD 5CWSA 3QIBB 4ZTPH 3HE6D 3FQXA 3RHWK 2ITDB 3N06B 4ODBD 1T89C 5MEPB 3OXSB 4YDLC 2MSPA 3OPZL 1JYXA 4F9LA 1X5ZA 5A2FA 1P7KB 3O6FD 5DQJB 2AXJA 3L5JA 4KI5E 3W9EB 3RGVC 3LMJH 3EO9L 2EYSA 4RFEA 4ZO6A 4PRHB 3I50L 4X4XA 4YNYB 3FT3A 2E6JA 3LEVH 5IOPA 5KANI 3LDBC 4L8DA 4UAOB 3Q0HA 3QEQD 2NXZB 5L0QC 4U1IA 5L2KB 4LLYA 5SWQA 2O5XH 3BD5A 4CVUA 3I6GB 2ESVD 3VXSE 1J1OH 3EO0A 5IQ9B 1P6AB 4FQLL 3F12B 3H9SA 4LCCA 1RY7B 4Y88A 1YEIH 4X83A 5DUMH 2IPTL 1NKOA 4KRMB 3DTXA 5DJDA 4G42B 2VXUL 5BVPH 3VXQB 4PUBL 4XBEL 5HI4D 1PG7L 2DLEA 1XF2A 4RGNB 2OTWA 3JWOL 3HE7A 4XP4L 1EO7A 4OCLC 3IFPB 4EJ1C 2C7UA 1UWGL 3FO1A 4P46A 1KEGH 5F7DA 3DBXA 1XMWA 1AP2A 1WFTA 2FNBA 1V8HA 3FHQA 4R96A 2BHYA 3MLSH 3QXWA 3K4DA 1DBKH 5JDSA 1D9KC 4LPYA 3IDYB 2WSKA 3V6OC 2NY3B 1BZ7B 4GKZB 4CVXA 4LVHB 3PP4L 1E6JL 1KPUB 3CLFH 5FDYA 3GJFH 1ETZA 3R1GL 1NC2D 4QXTA 2XZCL 5J06A 2DIBA 4GMSL 5JOEA 4M48H 5EU7E 4J8RA 4GRLC 4PB0L 3U4BL 4F3FA 1KPRB 2X4RA 4GRMA 1NGQL 1QBML 3P77B 5D1ZD 3QUXC 3FZUC 1HE7A 1DQTA 4X9FA 1NLDL 3P4OB 4QTIH 5FOBA 1B2WL 3ECBA 1IBGL 3TT3L 2BNQD 5HYQB 4X6BA 3VWKA 1AH1A 5EOTB 1B0RB 1G9EA 1Y6MR 3IFNL 3W81A 3DO3A 1GSMA 4BH7B 1MJ7L 1HNGA 3OWEA 1LK2A 5KVDL 4K7FA 5MI0C 4PRIE 4CAGA 4ORZC 3GO1L 3WHE1 3U1SL 3O11B 5FF6B 4KRPC 1AI1H 1P69B 5IBLC 4NKOB 3OR6B 1P7QB 3RVVC 3TBVA 5GZNC 1PKQE 1JWUA 4GW4A 4JFQB 4P2QE 1HDMB 4F9LC 4MSWB 2CR6A 1UT9A 1S7XA 3BO8A 2QJDA 3RY6A 5ICXB 4EIZC 3S6CA 1MRDL 5T1DL 3AGVA 2F74A 4OCRL 4I8DA 3QCVL 5ADOH 1VKXA 4ISVB 4FQXA 5IBTH 3IDGB 3DVGA 1BZ9A 4MZ3A 5JHLL 3EO1A 3RA7H 1IGTB 4AH2B 2R69L 1YMMA 2APXA 1KN4L 3BKJL 5F7EL 5H35B 3VH8A 3WHE0 4CU7A 4LCCC 3EIFA 2VNCA 4GKNA 4HGMA 4KPHH 2JELH 4KKLC 5K9JL 5C0DB 4OKVB 1J0KA 3ULVF 4H1LB 1WWBX 1P6FA 3QWRA 3I02A 3WJLA 5IQ7H 2Y07L 3GI8L 5HVHC 1CGWA 4OZHB 2V6HA 3HE7C 1KB9K 1R5WB 2YA1A 1Z9OA 3MLWL 3NZ8A 1GZQA 4CGTA 4OF5A 4OI7A 1MPAL 2JIXB 4OLEA 3A6CL 4P46C 1RVFL 2OJEB 3BSZL 3HZVA 3IU4L 25C8L 5JW3L 1N64L 1VFBB 1OAXH 4YR6A 5C8JB 1RUML 3FB8A 4JY5L 4MJID 1E27B 4OLWL 3CZJA 3VD3A 5J1AB 2NY7L 1FNHA 1T2QL 3B9KD 4X6DB 2EECA 4N0YL 5LKNA 3RIFK 4OD2B 3IETB 4LRIA 5HYIA 1ZA6A 3S88L 4JFFD 1HKLL 3VGGA 1EDQA 1NBZA 4PRIA 1QFWI 4XPFH 5D6DA 3F8UB 4JY4B 4PG9A 4YHOL 2YD7A 3DNKA 3VI3E 2HT2C 3MJ7A 2BSSB 3UX9B 5D8JL 3TNNB 4GAJH 1V3LA 5E7BA 4LPVA 2X1WL 3QEQB 4M6OL 4QOKE 4I1NB 1U2HA 1FNSH 3BN9D 1NMBL 4K8RH 4O58L 5I0DA 4EN3B 2JKXA 5FUCE 1X6LA 2ESVB 1WBZB 4NNPH 3VA2C 4NJAL 3VWKC 4NC0B 3BAEH 1FJ1B 2OQJA 2CLZB 5I8OL 1KJMB 5DYOA 1S7UB 1NL0H 2BHZA 4NP4H 4Y4HD 1INEH 3MROB 4Z7QE 4PFEA 2Y36H 1GHFL 1QO3B 3ARDB 1Z5LA 3L3IB 4BUHA 1I9RH 1YDPA 3D85A 4B5EA 2YD4A 2R1YB 1BWWA 4H26B 4O2FA 1CVRA 4XWOC 5C09D 1MCIA 3QUMB 1SBSL 3ARWA 1TLKA 2F8OA 2YA2A 3UEZA 1M6OA 4BK4A 3RY6C 1RU9H 5EO1A 3KHQA 4UT9H 3D9AL 1VPOL 1L7IL 5IV2A 3DX7A 3S34H 4Y16D 5DA4A 1BVZA 3NCYS 3SDXA 4X4YA 3D3VE 5BRZE 4FQXC 4HIJA 4KJQD 2AABL 5DJ0A 5KJRH 2FR4B 2YRLA 2XACC 1XGPB 5I75C 3GDBA 2UYLA 3SGKA 4NQXB 5K59F 4EZMA 4JFOA 2BZDA 4P5MB 4XPBL 4C4KT 4PRAA 3S36H 1AO7D 5DI8B 4JFDD 2HG5A 3AB0B 5E95B 1RK0B 1MJUH 5EWIH 3I6LE 3KR3L 4J7RA 4HSQA 4PJEF 3WJLC 2BNQB 2Q3AA 1JJUA 2J8UE 3MV8A 4JHWL 2FX7L 1HQRA 4PJAE 2HN7A 1GGBH 1BP3B 4Z7WE 1U8MA 1WT5A 5EU7C 4BSJA 1NMCB 4N0CD 4Z95L 4JO2H 1OM3H 1SVZA 2NLJA 3KDMA 3D25A 3F7QA 3B9EA 1AGDB 4KRLB 3MLZL 1IEAB 4HULB 3GM8A 5DLML 1RZKL 3TH2T 3EYOB 1FORH 1X4YA 5DMGC 1F90L 4G8GB 3H2WA 1HI6B 2VDOH 2A83B 3EYQD 1C1EL 1KELH 5GS0H 3P4MA 2X4OB 3ZDXE 3CH8A 2XZQH 4KKBD 2EE6A 3V2AR 1T5WA 2CQVA 4LRIC 4HCRH 4XHJD 5HGDB 3W2DL 4WWKA 4X7SH 3WFBH 1CLOH 4OLYL 1A7BA 4J3VA 1AC6A 4L5FH 5EG6C 1MRFH 3DROB 3IRZA 4WHYH 4BSVB 5D6DC 1FFPB 4M1GH 3B5GA 4OGXL 4PY8I 4DN4L 2DLGA 4PGDB 3QUML 3JUYA 4FQHA 4I3RL 2EYTA 1IC4L 3OKKA 3MXVL 4J3UA 1BFVL 5KAQG 3WO3B 2HT4D 1J0JA 1U8OB 5LVEA 3L9RB 4HWEH 5EZJB 4QXUL 2ADJA 3OAZK 3FCTB 5HHQB 2FJGB 3CMGA 1ROWA 2BC4B 5F9JA 1T3FA 1D5IH 4MNGB 3G5VB 2VDQL 3EYVB 2X4QB 1ZXQA 1AGFB 2GCYB 1Q9LA 3DMMD 4DTGH 3X14A 3AU1B 1MQ8A 2ZOKA 2AXHA 5MERA 4JEGB 1CE6A 5MHSD 3Q3GA 4L4TE 2MQ0A 5FGCE 4JRYA 1WCBA 2D7OA 5DEGA 1D6VL 2IBZY 3TC9A 3OPZH 4NN7B 4R90H 5SX4I 4BH8B 1HXMB 3DUUA 2ED7A 4G6JL 2UZXB 4DN3L 4OZGB 2FBJL 4MJIB 2CGRH 2WBWB 1MY5A 4MA7H 3S5LB 2J8UA 5D1XB 3O41B 4PJGE 1H15A 4NNXA 1RIHL 4WUUD 1R3LB 3HC4L 4BZ2L 3B9KB 3SJVB 4OB5H 4Z7WA 4ONHB 3X13A 4CMHB 4DVRH 5D2LA 1F4YL 2CLVA 3EAKA 1DQML 2DKUA 4PGCA 2DL9A 4HUMB 3SGKC 3UBXA 3QNXA 1CVSC 4FN0A 2ID5A 3QG7L 1SJVA 3KXFE 4PGEA 3KYMA 2KZWA 4Y2DD 5GIRA 2DWDB 3FAWA 3L3JA 2GIYA 5ACZB 3CFKA 5BVJA 4LBEA 1QKZH 1F4AA 1BGXL 1QBLH 4RFOH 1JZ7A 1LK3H 1PD6A 3VXPB 5L6YH 1WT5C 2IF7A 3KPMA 4ZG1A 4ZFGL 5EUOE 1I4FA 2Q86B 1MVUA 1A2YB 4Y4HB 5C0IA 2I27N 1E0OB 3BP5B 3UP1A 3O4LE 2XNAB 1RZ8A 1U3JA 4X8XA 4XRCA 4DQOL 2AXFA 5FUCC 2OZ4A 3RWEB 2A6IB 5F96H 5DZOA 1RZJH 3U82B 1BQHA 4FQJL 5C09B 1L0QA 1QYGH 1YN7B 3GI9L 5DFVD 4WWKC 1N0LA 5CZVL 4UB0L 3S97C 1JF1A 1FYTE 3WKMH 2Z93B 1PSKL 3TJHC 1TJGL 3MBEA 1CK0H 2FH8A 5F6IC 2ZCKL 4U3XA 4Z7VE 3RDTA 1ZS8B 1OAKL 4L4TA 4YWGH 1ZVSA 1UKTA 3NH7H 2PW1B 3S3JA 3WXWH 1ZHNA 4JJ5A 3PGDA 2EDXA 4PS4L 1F13A 5I1LB 1RHHB 1KPVA 1RZ7L 1HEZA 4QYOB 4YFLI 3CPLB 4X8JB 1AO7B 2EDOA 4JFDB 4LSSH 1Q9WA 2DI7A 4PJGA 3VFRB 3QG6A 3MJGX 4HKJA 4OF8A 1KV3A 1QACA 4JKMA 1A6TB 1CG9A 3LV3B 3NFPA 4O5LH 1JNLH 1EH9A 4U6VH 4ZPTA 4B7IA 1GOGA 4DZBA 5DUBA 1Z9MA 2EDRA 2AKRB 5HPMB 3O2DH 3U0WH 3OAZH 4P0DA 4BUGA 3NABL 3QUYA 3LKSA 1IMHC 4KU1A 5HYJD 2NZ9D 1EUTA 2VDPL 3OF6D 2P5WE 1OL0A 1TTFA 1DDHB 3N1QC 4JB9L 2UZYB 3SOBL 5T5NF 3CK0L 5KZCB 5DQDH 1KCKA 3U7YL 3HI1B 1QLEL 4O2CA 3VFGL 3OKLA 3QUZA 2XOTA 4K94H 2M2DA 4L8BA 1PY4A 5BCAA 4JO4H 1NGYB 1U8JB 5BJTA 3SKNB 1BJ1H 2J4WH 4NN6B 4XP5H 4ZDHA 4ZFZA 1J0IA 1N6QH 4ELMF 3O4LA 4HH8A 3DURB 3MV9A 3BE1H 4JFED 1LO2L 5LJYH 2V7NB 2X4TB 2E6PA 2R2BB 3LRSB 3LIZH 2R9HC 1EHXA 5FHAL 2J8OA 4QF1A 2QQNL 2EE3A 4WEMB 2DI9A 2P8MA 5F70A 4I3SL 4HT1H 1CD1B 2V7HB 1V05A 1S7WB 4F80A 1A9BB 4RAUB 1S7TB 2DBLH 1A5FL 5K9KA 5EU6D 1QSFD 4WEBL 4J3WA 3ZE2F 2VZTA 3VFVB 43CAB 3VFSB 2GJJA 4U1MB 1U42A 1TVBB 4YDKH 1I1YB 2YC1A 1KFAH 3SQOL 4QHKI 2AK1H 4ZTOL 2YUWA 4WENB 4URTB 1YPZE 3SKOA 1CLYL 5E7FA 4O2EB 1UB6A 3LS5L 4BZ1H 1V5JA 2O93L 4ALAH 1MUJB 1A21A 3RWGB 3TYFA 3MBEC 1T0NB 3CFJB 5HBBA 2W0LA 2NTSP 4WUUB 3W9DB 4WEUD 3DHMA 3QNZA 5J12C 1H3PH 3SCMD 5CEXA 4L3AA 3GHBH 4HUUB 4PJDB 5I0ZA 3TT1L 4CVZA 12E8L 2VAJA 4XT1C 3PGFL 3MOAH 1B88A 4NGHH 1REIA 1AD0B 1JGDA 4WI3A 2IALA 4TUKH 2MCG1 5FYKL 2CIIB 3H9HB 2KH2B 1UXSA 2DQTH 5GSVB 2R1XB 2DQEL 4F37K 2P5WA 1LQSR 3MCKB 3TYGH 3AAZB 1T5XB 4HIHB 4ZUSB 1UM4H 2BXZA 4JM4L 3VCLA 5C7XH 5T3ZL 3KNBB 2P5EA 3T8XA 2J12B 1JE6A 4QRTB 4AT6B 5ICYB 1S3KH 4XNYH 2PR4H 4Y89A 2MWCA 1ULVA 4HUWB 1W2KT 1YN6A 4IOFC 1MHCB 1S7SB 3GMPB 3NPZB 5GGTA 1YYLL 3KPLB 3QUYC 5L8KB 4M7LL 2C1PB 4QY8A 5C0NC 5IFHH 2FLRT 1O5DT 1P4LA 3GSQA 1AQDA 4PIRF 5EZIL 3UTTA 1X7QA 3M1BB 4ODXB 4FP8L 1YNKH 3FQWA 4LVNB 1E28A 1MJ8H 3NCCB 2L0DA 3KPOA 2ZCLL 4DK6A 2VABB 3TWCH 3QUZC 5KSAA 2O5YH 4WTXA 1CD9B 4MDIA 1QQDB 4GXVH 1JGUH 1A7PH 3KWWA 4UZGA 1U92B 4U0QB 4JFHD 5E8PB 3IS0X 4HGWB 4IRJD 1RPQA 1FVCB 1NAMH 1YNTA 3DV4A 1T20B 3DETC 1MF2L 4PRHE 5D96C 3C8KA 1BOGB 3CFCL 2J2ZA 4LPWA 1XT5A 1L6ZA 3TF7C 3P9MB 3MBXL 5B8CB 4OSUH 1FRGL 3QO0A 5DK3A 5EOCH 1R3HB 1X5LA 3EJYD 3FT2A 1FBIL 4RMWA 5B38G 4JE4B 4MS8D 2E9IA 3FAXA 1Z3GL 4KK5C 1JUFA 2BK8A 3I75B 1MFCH 1A3LH 4RA3A 4DCQB 4K3JL 2WBJB 2HVJB 4P9HH 1C5CH 3VU2A 1UGNA 4S1SH 2NR6D 3DJ9A 3AM8A 4V2BA 4X4ZA 5I15H 3QWOA 1DE4A 3ALWA 1U3HD 1DR9A 4LPTA 1AR1C 3MUHL 4KVNH 3LD8C 1UB5A 2ENYA 5HYJB 2VAAB 2ADGA 3AY4A 2OR7A 4PJCF 4TSBL 4F7TA 2DL2A 2YN3A 2Q3ZA 3P3YA 2X42A 4MJ5B 2K7PA 3MNZB 5HDBF 1HOCB 3ARPA 4ZS7L 1I1RA 1TVHA 4ORGB 5I19H 1G9NL 3LAFA 3RBSA 3BPNC 5J3HD 2R1WA 3IDIA 5IB3B 2CLRB 1OB1A 1YJDC 3PWVA 5BQ7A 2OCFD 3H3BC 3E6HB 4JFPB 4JPKH 5IVXE 1U8HA 3LH2L 4XX1G 4HFUH 2V9TA 4NC1C 5KSBF 4OF3A 5CSZA 4Y19E 1JPTL 1CDUA 4O4YL 3QIBA 2A77L 3GBML 4OQTH 3O4OB 2ITDA 4RDQF 1UH2A 4ZPVB 3SKMB 3VE0B 3ILPB 5MEPA 2WWKT 3OXSA 1JWMB 2VUYA 3DXAB 1A02N 3VDBA 5JQ6L 4L3EE 5J7CC 4L4VD 3CX5K 4NWTH 2JCCF 4LQFH 1P7KA 5DQJA 1XF1A 2FHCA 2YK1H 4HK3N 5DWUL 3WHXB 3W9EA 5EU6B 4ZD3H 1Z0NA 1KCSL 2HJFB 2ORBL 4YNYA 2R0KH 4OLUL 2BXYA 5IGXH 4PBWD 3E8UH 5L2KA 2F54D 1A6VL 3MODH 1CL7H 5I1GH 3I6GA 5E4EB 5FO7B 5KSAC 5E08L 2HKHL 3MRQB 1VHPA 1X4XA 4WI8A 5IQ9A 4IIQB 3F12A 3FQTB 2VJXA 1GAFH 5C08D 2X4UB 4G6AC 1CDBA 1CZ8L 4DGVL 1KCRH 2R0ZH 4F57H 3HPLB 4NQCD 5I8CB 4G42A 4JG1L 3O2DA 3VXQA 1N2RB 4YBHA 1P84K 3EYFB 4KMLB 1YEJL 5TGBB 1LO0L 2LU7A 3IFPA 4NO5B 3LVEA 3GHEH 1A14H 1DJSA 2WANA 3LHPL 3VGFA 4PV8B 4GLRH 3CVIL 5F7FA 3JWNC 4UV4H 1BZ7A 4GKZA 4N5ED 5K9OB 1AHWB 2Q20A 3RWCB 4XNXL 4IDJL 3UZQA 1KPUA 5F1OB 3AM8C 4HW6A 2UWEB 2EDTA 1VEMA 1XIWD 2PXYD 1CIDA 3KLHC 4EVNB 1KPRA 1T1YB 3AY4C 1KB9J 3P77A 5E24E 3JWOC 3MLYL 3RAJH 3CFBB 4YHPB 4D9LL 3P4OA 3WNNA 1DP0A 3U6RB 3TFKC 4XPTH 5HYQA 2VQ1B 2CUMA 5ETUB 5EOTA 1B0RA 1RZ7H 4H5SB 1MCSA 1K3IA 5HI5C 4MD5B 4U1SA 4JGJA 4BH7A 1JGVH 2XZZA 4M5YH 1R3IH 2IEPA 5ALCL 1H3UA 1DBBL 2MFNA 4EI6B 2XI9A 2V2TB 1IM3B 2C4FT 3TV3H 5ACMA 3O11A 5FF6A 3QULB 2A6KB 4NKOA 3OR6A 1P7QA 2DQIH 5E6ID 4OCYH 3N1FC 3QIBC 3QEQE 4WI9A 3QXDB 1E4XH 5CBAA 4S1DC 4KV5E 3T3PF 3H6JA 4TQEH 2ICCA 4JFQA 4PP1D 4G7YH 1HDMA 1Q9KB 4MSWA 5ICXA 3EOTL 4H0HB 4S10A 5B21A 4AEHL 2QADD 1TDQA 1XR8B 5ID0B 1MHEB 1J88A 5CZXC 5HYEA 4NBYB 5EORH 3S96B 4HEPG 1YEEL 3C08L 5AD0B 3IDGA 4UAOC 1S78C 2NXZC 3KYKL 2BJML 1FH5L 3FFCD 2V17L 1IGTA 2P1YA 4NQDB 4AH2A 1CXFA 2KL6A 3VFNB 3TZVD 5H35A 2Q76A 4XP9L 4YUEH 4CN6A 5FM5O 4M6MH 5GISL 3RX5A 1ZA3B 5C0DA 4OKVA 3BPLB 3KPRD 3EDDA 4H1LA 4JRXE 5FYJD 1MAMH 3KJ6H 4NZJA 1OW0A 1KJ3L 4OZHA 4RGNC 1N5YH 4QHLB 5DA0B 1YEDB 1OGTB 4J12A 1OTUD 2NY4D 1R5WA 4KQ4H 2VB5A 4ENED 4OIBA 1J8HD 4JDZB 3C5SB 5B4MD 3ZDZF 4GH7B 2JIXA 4WGWB 5DT1H 4W81A 1JF5A 1A7RH 2OJEA 4PJHE 4X6CE 2E7HA 2MCPL 3WYRA 1VFBA 4K94C 3IDYC 4LLUB 4P3DB 4B41A 5C8JA 1E27A 1A3RL 1KJ2H 2NY3C 2BNRD 4YZFF 5J1AA 4DOHE 4Z7NE 3VWJD 1NFDE 5C92A 4LVHC 1OSPH 1GIGL 3CDFA 1XGQB 5ABDE 4X6DA 2BNQE 1KTLB 5E5RB 2YZ1A 4N0RA 3A67H 4XC3H 4OD2A 3L3HB 3IETA 5D93B 5EPMB 4L4VB 4OCMC 3EYUL 3DX9B 4LASL 5I1JL 1LP9F 4JY4A 1WSST 3UZEA 3RU8L 1HINH 4POYA 2BSSA 4NFBA 1IGMH 3TNNA 2HVKB 1FE8L 3P73B 1RFDL 5C0BD 3QEQA 3DI2B 3IGAB 4HK0B 2ZUXA 1U2CA 4EN3A 4KK8D 4F58L 2ESVA 1WBZA 3OJVC 4X80H 4JQIL 4UILL 2CLZA 5JA8B 4HWZB 1KJMA 5DJZB 1S7UA 1UH4A 1ES0B 2QBWA 1GRWA 1KB5H 4Y5XB 2X05A 3MROA 4UMGA 3T2NL 4XMPL 3T3MF 1M71B 4JHBA 3BWAB 3VRLF 1QO3A 3WSQL 1IQWL 3SY0B 3ARDA 5DK0A 4XB7A 3L3IA 3WLWD 1QA9B 4UTAH 4NQUA 3GNML 2HH0H 1CFBA 2KQMA 2R1YA 4Z8FL 1Y18B 2IH3B 7FABL 4H26A 1FCCA 4YFDB 5D4QA 2I60L 1T7VA 2VXSL 4YX2L 3TPUB 4YXLH 1BM3L 3QUMA 4LMQI 3CH1B 1EBPA 4BK5A 1G84A 3RVUD 2R23B 4FFZH 3QQNA 1CU4H 1T1ZB 1T80A 5FCUL 4H20L 3HI6H 1UYWH 2FR4A 1LVEA 4HJJL 1X5FA 5DXWA 4LHJB 1XGPA 2A38A 2KZ1B 4NQXA 1XIWB 2PXYB 5EOQH 4N1HB 1QHPA 3MNVB 2JF1A 3U2SB 2LU4A 2EC8A 2XQBH 2H2PD 2O61B 2Q7NA 1MHHB 5HJ3B 3ULSB 1CF8L 2VDNL 4P5MA 4KZDL 3H3KA 4LCIL 5DI8A 1XGUB 4NQEB 1BJ1J 1RK0A 4M02A 3QJFB 4YQXH 1EEQA 2BNQA 1OW0C 1O7VA 4JGMA 4X7TB 3L95B 1S9XB 1FVEB 1AGDA 1XFPA 4YHKH 2IBZX 5GRZA 5HHNB 4EBQL 4JFFE 4BFIB 1IEAA 1RUAH 4PLNC 4R3SB 4HHAB 4DGYH 2Y06H 3EYOA 3GJEB 4G8GA 1HI6A 2YOCA 5IHUL 2A83A 3PABB 3RQ3A 5E6IB 3MLTB 5FO9B 3ZE0F 2X4OA 3PNWB 5GGVY 4YE4L 5KS9B 4P3CH 4K3EH 5HGDA 5CLTA 3V4PL 4GAGH 3DROA 4BSVA 1FFPA 3HUJB 2QADB 4WDIA 3HR5A 4Y5YB 3L3GB 4PGDA 1YZZA 2OSLB 3GSNB 1IKNA 2DLFL 4JM2D 1PGRB 1MCOH 2HTKD 1MI5D 3FFCB 3M8OH 1YC7A 1TQCB 1U8OA 4EN3C 3L9RA 5EZJA 4MAYD 3DX8B 1MCPH 1RZKC 1N5AB 2OTUB 3FCTA 5HHQA 2FJGA 4OJFL 5DVMA 1T1XB 5C09E 3DV6B 1A6WL 3E0GA 2BC4A 5LBSH 3PV6B 1ZLUK 4LLVB 5D72H 4MNGA 3ZKMD 2R29L 3G5VA 3HNSL 5HHXL 3EYVA 2X4QA 4PJXF 1AGFA 2GCYA 3CDGB 4RMUA 4P59L 1YEFL 1HILB 1BQLH 3AU1A 3ARDC 1HSBB 4HUKB 5HI4C 1OAUL 4KTDL 5J13B 3QQ3B 2J7LA 1CXLA 5D7JB 2CXKA 2NY4B 3DPBA 1K9TA 1G0DA 1EJ6A 4GW5B 3E3QE 4BH8A 1HXMA 4GKSB 3U46B 4NHCH 3FKUS 4N8VG 1LMKA 4LU5L 4MQXD 4OZGA 2YS4A 2NQCA 4S0SD 5DO2D 4KHXH 1EBAA 1AO7E 4M43L 4MJIA 4N8VB 3PGCA 4OFVA 5EH1A 2R8SL 3S5LA 2BNRB 5D1XA 3O41A 3VWJB 5C6WH 1U8QB 1R3LA 1N6UA 3B9KA 3SJVA 3BDBA 4X7EC 5D5ME 4JO3H 2HRPL 2QSTA 3H3PH 1A1MB 4H8WL 4ONHA 3FOMB 3TGXA 3KJ4B 4RMSA 4NRZB 4OZIE 4AMKH 1TQBB 2B4CH 3F7YB 3NCFB 4JPVH 5INCB 5I1CH 1TETH 3C6SB 2MPAH 1KXTB 1L9NA 4JN2B 3UDWC 1F2XK 4LNVA 2FX8L 1RIVL 4U05A 2FB4L 2W9EL 2DWDA 5C0BB 1NGPH 1OVZA 1CXIA 1Q0XH 1RMFL 2H41A 2PTUA 2V5RA 3AB0C 4N0UB 5DHVH 5ACZA 3N85L 2JB6B 1VGKB 5DDHB 4OZ4B 2NY2D 1L6XA 1INQB 3GSNL 3VXPA 1FZJB 2QQKL 1NMAH 4YPJA 1NMCC 1G1CA 4LEOB 5K33A 5ILTL 4Y4KB 4G9DB 1I9IH 2Q86A 3HNVL 1SBBA 1QFWH 1A2YA 4Y4HA 3L5IA 3WFCH 4NFDA 3HRPA 5EOCJ 4HMEA 3BP5A 4LLDB 2UUDK 5MENE 3O6KH 2A9MH 4ZXBD 2XNAA 1A7QH 4UI2A 3RWEA 2A6IA 3FB5B 3MOBL 1UZ6F 4JJHA 5GGUB 5C09A 3ORJA 2HWZH 3V95A 4EOWH 2AP2A 1YN7A 2HFFB 4B7LA 2RAMA 3EZJB 4AIXA 1WEJL 3BZEB 1BVKB 1BBDH 2GFBB 2Z93A 1U8LB 3VD7A 4K23L 1IKNC 3QDMA 3SPVA 2XY1A 1ZS8A 1TENA 1EHAA 3RIAF 1JRHL 1MIMH 2PW1A 2P47B 1GGCH 3T2PA 1M7DB 2XQYK 5DFWH 5MHSE 5I1EL 1RURH 5I1LA 5GJTL 1RHHA 2C3HA 2V9QA 2VERN 5I16B 2X89D 4ESKA 4O9HH 4QYOA 1T4KB 1ITCA 3CPLA 3OSKA 2APBA 5D70L 5ISZE 4X8JA 4LAQL 1AO7A 1EEZB 4QT5B 4JFDA 5BXFB 5FA3B 3VFRA 5IW3A 4NKIH 1UZ8B 2OR9H 1JFQH 4MA3B 1NUFA 1A6TA 3HMXH 3LV3A 1H9VA 4WUUE 3T1FB 5LXGH 5E00B 4LPCA 4PJDE 4NN7C 2AKRA 1T7XA 3U4AA 5HPMA 2ZNWA 4G5ZH 3D48R 2E8YA 4OCSL 3UO1H 4FA8A 1ZLUH 3U83A 5M7QA 1DDHA 3MLVH 2F53D 5D1XC 5JHDE 1IC5H 5E99H 3HI1A 2B1HL 4RMQA 1JWSB 3B9KC 3RVTC 4CMHC 5F3HB 5CEZD 4I2XE 2YPKB 1NGYA 3MLXH 1UJ3B 1U8JA 3DO7B 1NH6A 3SKNA 3VW3L 3MGAA 5J57B 4KKCC 5IESL 4TULH 1O0VA 3MRMB 4FFYL 2EKJA 1W0WB 4G8IA 3PP3K 3DURA 4JM2B 2V7NA 3PUCA 2X4TA 4GT7A 2I26N 4P9MH 1MI5B 1NUGA 2R2BA 3LRSA 4UBDD 1CFQB 3BN9C 1EEUA 5IW1B 5HVGB 4X5WB 4MAYB 3U7WL 3FFDB 4QHMB 3LQMA 5TE7L 3TPKA 2AK4B 4Q0XL 1CD1A 1HQ4B 2V7HA 1S7WA 3O6LL 4Y4HC 1A9BA 4RAUA 1S7TA 5I8KL 1BOYA 1WAAE 4UNVA 3C60B 1BIIB 4HIEB 5IR1B 1AQKL 43CAA 3VFVA 4PJBE 3VFSA 1AGBB 1TPXB 1TVBA 4U1MA 1I1YA 3MJ9L 3U48A 5DD5H 4LSTH 1MFAH 1NEZB 2DMBA 3SDAD 1EHLL 1G6RB 4O2EA 4IBLT 1GGIH 1KENH 2Y72A 1XCQB 1MUJA 3RWGA 4OBRA 4OV5B 1T0NA 3CFJA 4Z0BL 4IHOB 5E2VH 1OARL 5C0AD 4WUUA 3W9DA 2UUDH 3AS2A 2D31B 4G7VH 4HUUA 4PJDA 5JOPD 3I85A 2YHGA 4XWGL 4P2YA 5E8DL 1PX3A 3FB7B 4MAUL 2DF3A 1YECH 1AD0A 2VUOA 4M8QB 2BVTA 3UTPD 1FLTX 2CIIA 3H9HA 4M6NL 3HC3L 5GSVA 2R1XA 1ZHBB 3IU3B 3MCKA 2X5PA 5HYJE 3AAZA 1T5XA 4F7MB 4L29B 3IAQA 1YEKL 2HKFL 4HIHA 4FQCL 4ZUSA 5HTSA 1NDGB 3WD5H 4ONGH 2ZP0T 3CVHB 5F44A 4YHIB 1RUQL 3KNBA 3VFUB 3BGAA 4QRTA 4AT6A 2NY2B 3M17B 5E2TH 5ICYA 5HGHA 1L7TL 4HUWA 5LQBL 4P48A 2EIDA 1ZLVK 2GW5A 2G2RB 4N0CC 1QUNA 4BJLA 4Y1AB 4WI6A 4XPHH 1S9VB 1MHCA 1S7SA 3GMPA 3CXDL 2J8HA 3KPLA 4NKMB 2C1PA 3LKRB 3AFLA 3LKPA 1A7OH 4CBPA 2ADFL 4UT7H 5I2IB 3CFIC 4OUUB 2P43B 3M1BA 3NA9H 3NPSB 4ODXA 2QSCH 4JFEE 4MHHI 4JDVB 3SDDD 2Y4SA 4XX1E 5HHOD 2J3SA 4XB8A 4KKBC 2V5TA 2VABA 4YHLL 3RZCB 5AZEL 2UZIH 4XHJC 1CDGA 3EHBD 3QZWB 5C71A 3TA3D 1QR4A 2Y1VA 4NN6C 3RGVD 1U92A 3GBNL 3LS4H 1QSEB 5E8PA 4HGWA 3RFZC 4XCCH 3CX5J 1FVCA 1QSFE 5EU6E 1T20A 1G6RL 3CNKA 3T04D 1IKFH 1BOGA 2HT4C 3THMH 1OD7A 3P9MA 5B8CA 3S4SB 1RHFA 2AJUL 4DKFL 1R3HA 4HIXL 3WNLA 4LSPH 5EDXA 5CAYB 3I75A 4OTXL 4DCQA 3T4YB 3QRGL 3LQAH 2WBJA 3PWLB 1IAOB 2HVJA 3A6BH 2A73B 3HS0B 3PP3H 4QXGL 2BFVL 3EOBB 2Z9TA 2BVUA 2VDKL 2D0HA 1HIMH 1I3GL 3WBDA 3CVHL 1IM9D 2DQJH 3AROA 1F4XL 3NGBB 4G3YL 4MXQD 1UA6L 3T0DA 2VAAA 5FHBH 3OF6A 1WZ1H 3WCYA 1P84J 5AWNH 1UACH 4FQ2H 4YHZL 5F3BB 3MRHB 1D9KD 2F53B 3BT2H 4Z7QF 3GK8L 1JMXA 2VXVH 5C07D 2EDFA 2R0LL 1OAZH 4MJ5A 3MNZA 1HOCA 1XGYL 4R6UA 1Q8MA 2A9NH 4ORGA 1QRNE 1JPST 5IB3A 3JVGA 4WCYL 4IS6B 2CLRA 4U2ZA 4YXHL 2NY5L 5EBMB 3E6HA 4JFPA 1CD0A 5FUZL 2ADIB 3FZUD 3I9GL 3V4VL 1MRCL 1VADB 5SWZD 5KVFL 4M9OA 3JTTB 3C9NB 3HC0B 3JV0A 1UCBH 5CP3A 2B0SH 5TE4H 2J88H 4CJ0A 4ZPVA 3SKMA 3VE0A 5IHZB 2L7JA 3ILPA 4WTZG 1JWMA 3DXAA 3EFDL 3ZSSA 4GXUM 2KPNA 4Z7UE 4D3CL 2ARJQ 3WHXA 3VGEA 5EU6A 3MTRA 4HBCL 1CICB 3SGDI 4JFHE 4FTVD 2HJFA 1G9NC 2CK2A 2VKXA 3G04B 2EE2A 4LVNC 4NM8L 2FATH 3B5TA 1HNFA 5GZND 1PEZA 3VXNB 4K2UH 2PYEE 2JTDA 4PJAF 5FO7A 1CQKA 5DFVC 3MRQA 5IEHB 2EEAA 1C7TA 4N1EA 1ZLVH 3ULVD 4IIQA 4PPTA 3FQTA 4S1QL 4X4ME 5CLWA 35C8L 4E5XB 1V7NL 2E3VA 2X4UA 3BYYA 4FQIL 1IAIM 3MRDB 5C0AB 4HWBL 3HPLA 2ZUTA 3QSKB 5I8CA 5I6XB 1CR9H 3MMEB 5BS0B 4EKXA 1N2RA 5F1IB 1T2XA 1IGCH 1ZTXL 2EZ0C 1N26A 2WW8A 3LN4B 3EYFA 3D6GA 5B8CC 2OI9B 1P53A 5TGBA 1EJOL 4NO5A 4LRNH 3H9SD 3TO4D 1ADQL 4TPRL 5JO5B 3BPCB 3CMOL 4HAGA 5CEZL 1MCHA 4ODSL 2CKNA 1I7UB 3QDJB 4PV8A 2PF6A 4C58B 3RPIB 3T2QA 2FHFA 2WBJC 4Q6IB 4WHCA 2R4SH 5K9OA 1AHWA 4GS7B 3RWCA 4JKLA 5FYJH 3RHWF 2UWEA 2QR0B 4M62H 4KHTL 1B4RA 3DVNB 5A3ID 1IGIH 4EVNA 5BZWB 2NZ9C 2QL1A 1T1YA 1E4JA 4YEEA 4WJ5B 3CFBA 2Z92B 4Q9CA 4YHPA 4OM0H 4XMLH 3SDDB 5HHOB 3U6RA 2VQ1A 1BFOB 4E42B 1PJ9A 5ETUA 3H9ZA 3HHRB 4H5SA 3ARFB 3TA3B 3JVGC 4MD5A 3CJJA 5I1KH 4KI1A 3UAJC 4EI6A 2HT2D 3RJQB 4NO0D 3VXOB 4WV1B 1IM3A 4XPAL 3QULA 4FFWD 5GS1B 2F19L 2A6KA 3VG0L 4XXDB 3UJTH 3G6JA 3O4OC 3QXDA 2F54E 3VWKD 2OJZL 4OV6F 4XC1L 5HD8D 3GFUA 1Q9KA 1CGSH 1WF5A 2PO6D 4GSDL 1MFBL 4WWID 5C08E 4JVWA 1XR8A 2NY0B 3DGGB 1MHEA 3BEVB 5ID0A 4N5UA 3S96A 5DD6B 2VLJD 4RFNB 2B1HH 4NQCE 5AD0A 2Z91B 4L8CB 1KOAA 3ARBD 3QR2A 4XWOD 1NANI 4XCEB 2P7TB 2E9JA 4L1HA 5E4EC 1UVQB 4NQDA 3U79A 5D7IB 5FUOL 3VFNA 4IIQC 4MD0B 4OCXL 4QXWA 5EUOF 2Q8AL 3SDYL 3FN0L 1UG9A 3OAUL 4ZS6D 4HKXB 1ZA3A 5HYSG 2OR8A 5ITBL 3P11H 3QT2A 3EDJA 4DUXA 4RISL 4KTEL 4QHLA 5I73B 4LSUL 5GGSY 1YEDA 2D2OA 1J0ZA 1OGTA 2BOBB 1CFNB 3TBTA 5HDOA 5EB9A 1T1WB 1IJ9A 4JDZA 3GSWB 3C5SA 5D71H 1YMMD 3EJZC 1JNNH 1PFCA 3TCLB 3MX0A 3IS1X 5SWZB 3IVKB 1KTDB 1DTUA 4LLUA 4P3DA 2G9HB 3PWUB 3V0WH 2X41A 2E7CA 3D39D 5C0JA 1AHWC 3OJ2C 5KOVC 4NPYB 2CMRL 1XGQA 1UWEH 1KTLA 4QRRD 2Q8BH 4KZEH 5DUPH 1ZOXA 3L3HA 1VFMA 5EPMA 4L4VA 2IH1B 1SJEB 4XTRD 3JWDH 1FAKT 2G5RA 3DX9A 3VFPB 2NZIA 3KYOB 4U6TA 2C9AA 3BN3B 4Z7OE 2DKSA 2OTPA 1DBJL 2P4AB 1OARH 1JVKA 2HVKA 4JKPH 3P73A 4ZUVB 2WUCH 3G5YB 4D0BB 3BQUD 3IGAA 3IXAB 4HK0A 3HPJB 5F7HA 3V8OA 4QGYA 4FFVC 2EIBA 4PTTA 4KVCL 2VR4A 3G6DL 4ODTH 1DLFH 4HWZA 5DJZA 1QFPA 2UWEF 1FL5B 1ES0A 3X3FL 4Y5XA 1M71A 1AC0A 2OLDA 3BWAA 3OKNB 3SY0A 1DZBA 1MREH 1QA9A 4I18B 3FN3A 4BQCA 1EAPB 3EDFA 2ZJSH 4WGVB 1FNEB 5FGRA 5IB2B 1Y18A 2IH3A 4WHTB 3ZYJA 3TPUA 3UPAA 2WUBH 5FCSH 3X3GH 5DSCB 3TO4B 4Q9RL 3EJYC 3GKWH 4Z5RB 3CH1A 4MS8C 4PJFA 4QRPD 1A3QA 1CDHA 3WO4B 3ZHLA 2R23A 4MYWB 5DF0A 4FQ1L 3GB7B 3H7LA 4HXAL 3SKJH 4NRYB 4K3DH 2XICA 4AEEA 4Z76B 1OQOA 4S1RL 1T1ZA 4Z0XB 3KPRE 4WFED 4NZUH 4TTGA 5FYJE 3D85D 3HFMH 5GRJL 5FO8B 1DBAL 3RIFF 1XIWA 2VXQL 1Z9SA 2PXYA 3BKMH 1J8HE 3MNVA 3N9GH 3U2SA 3QP3A 4W70A 3G6JF 2O61A 1BF2A 3EKCA 1MHHA 2O5ZL 3BP7B 5HJ3A 3ULSA 4EEEA 1CN4A 1F4WH 3VD4A 1XGUA 4NQEA 8CGTA 5CUSL 3BPLC 4OQ1A 4OGAD 1JF6A 1RUPH 3QJFA 3BIBX 1MLCB 1NCAL 3R4DA 5J3HC 4X7TA 4X98B 3L95A 1YPZF 4MA8H 1S9XA 4NM4L 3BISA 4NWUL 1FVEA 4HXBL 5HHNA 4RSVA 1NCNA 4GRMB 1E4WL 1FVDB 4BFIA 4LCWE 4NO0B 4R3SA 1I7TB 4HHAA 3TN0B 4JFZH 1QPXA 4G6KH 4GQ9H 3ULVL 1W0YT 4LSVL 5FOBB 1R5VB 2VXTH 1LILA 2WWMD 3GJEA 1JHKL 3PABA 5CILL 5E6IA 3MLTA 5FO9A 1L0XA 3TBYB 3PNWA 4RIRB 5KS9A 1J5OL 4OLVH 4RQQB 4RWYH 4O02L 5D93C 3D87B 1MFEH 1DSFL 2OL3B 1N0XL 1DL7H 2RB8A 2PO6B 5FYLD 5FECB 3Q2CA 1MIEH 3HUJA 4Y5YA 3L3GA 4DFHA 1FG2B 2OSLA 3GSNA 4H88H 4LIQH 2VLJB 3MA9H 2B20A 1Q72L 4LGRB 2N1KA 3ARBB 5EA0L 3FFCA 3HAEG 1YQVH 1Z9LA 2YD3A 1RIUL 2VKWA 4QNPE 3V52H 3R8QA 3OZ9L 3PQYB 3TH3T 3QIUB 4OCWL 3DX8A 4R26H 4F33B 4PRDB 1N5AA 2OTUA 2AVGA 4RX4D 3HAEB 1T1XA 3UPRB 3DV6A 5B3NA 1A1OB 3PV6A 3AMKA 4LLVA 4PJEB 2FH6A 3TJHD 3OG6B 1WISA 4Y5XC 5I1IL 3CDGA 1RK1B 1HILA 1SJHB 3S35X 1HSBA 2FD6L 1ZT4B 4H0GA 3G6AB 4YDIL 5CCKH 1JZ8A 3O3UN 3QQ3A 5D7JA 2Q7YB 4MJ6B 4CDGC 4GW5A 4LEXH 2ICWI 4GKSA 3U46A 4OIIH 1J0HA 3PE9A 4KY1L 4WW2B 5CKGA 4WY7L 2QHLA 1NGWB 3B5HA 4N8VA 2BNRA 4N5EC 3RVWD 3VWJA 3D39B 4HS6B 1U8QA 5BOPA 4ZSOB 1JV5B 4JRYD 3UJIH 4NJ9H 1A1MA 4QRRB 3FOMA 2DQUH 2CKBB 4NRZA 2VZSA 4LDLB 4MHHG 3F7YA 1XIWC 5INCA 4YFLF 1RJCA 1F11B 2PXYC 3WEXB 3C6SA 2AEQH 5TPWH 3F7RA 4DGIH 4JN2A 2FJHB 3CSYB 2R2EB 4RZCB 4AG4H 4YR6B 1T6WA 4PRBB 5DHXB 3EDEA 2OL3L 5AZ2L 4PJFF 1SVCP 5C0BA 4N0UA 3BQUB 1RJLB 4V1DB 4MNQE 4Z78B 2JB6A 1NBVL 1VGKA 5DDHA 4TSCH 4OZ4A 1N8ZB 1INQA 1VFAB 1FZJA 4HS8L 5DJ6B 1E6OH 2IMMA 1XZ0B 4LEOA 4NNYB 4Y4KA 4G9DA 5JQHC 3HI5L 2LTQB 1A0QL 4H8WC 4LLDA 4PP2B 4F7CB 1BAFH 2PW2B 2Z0BA 3ZL4L 5CIPB 3RKPA 4OT1H 2I5YL 4DKEL 1G7PB 3OKDB 5E6IC 1S5IL 3FB5A 2XV6B 1MI5E 3BKCH 5GGUA 1JMZA 1ZANL 5MP6L 5F9OH 2HFFA 3OB0K 3WKNA 4QRPB 4IOSD 3MREB 4JO1L 3BZEA 1BVKA 1V3KA 4LAJH 2DKMA 4UIMB 2GFBA 2FGZA 1U8LA 2QADC 2IGFL 4Y5YC 5IVXF 3EYSH 1AFVH 2X7LB 4R8WL 3INUL 1AXTL 2ZOLB 2X10A 5DD1L 1I7RB 1M7DA 4U1GB 1TQCC 2GY5A 1G9ML 1HH9B 2MKWA 1W72H 5I16A 3JV6B 1FZMB 5EIVA 4X6FB 5L9DH 3IFLL 1T4KA 3QJHB 4FOMA 4F2MB 2ZKHH 1HKFA 3MJ9A 4HFWB 2E8ZA 1EEZA 4QT5A 2CKBL 2GHWB 3UJJL 5BXFA 3I2CH 5FA3A 1LO3H 3ABZA 3RDTD 1KIRB 3TH4T 6CGTA 2R4RH 2KQNA 4MA3A 3SGJA 3T1FA 5J13C 1YYML 5E00A 2ZUQB 1OTUC 2NY4C 4UV7L 3ULUH 2IPUG 3P9WB 2DAVA 1YNLL 3Q6GH 2CJUH 3UTSE 5L2JB 3B8SA 5DRXB 2E27H 3PG2A 5EFIB 2AJVL 1W8NA 4P2RE 3BJLA 2QHRL 2Z8WC 3KS0J 1XF5B 2AEIT 1WLHA 3BUYA 2I07B 2F58H 4KDWA 1KBGL 1OAQH 2XZAL 4WU5B 3ARGB 3VWJC 4YHMH 1JWSA 1WWCA 1I9JL 2OK0L 2EIZB 3K2UH 1NC4B 4K71B 5F3HA 3KJ4C 1TQBC 1I1AA 2YPKA 3HZKB 3RVXD 1UJ3A 3QUYD 3DO7A 3GIZH 5C0ND 2FO4B 1BIHA 3GSVB 3GMRB 5BV7B 5ADPH 4LIQE 3MRMA 2WQ8A 1LDPL 1SEQH 1W0WA 4NUGL 2OP4H 2R0WH 4PJ5E 4JM2A 2EO1A 1MHPL 5AG8A 2W0KA 4KK9D 1MI5A 4XBPB 4N1CA 4QRSB 1CFQA 1FAIH 2VDML 4KK8C 5IW1A 2GJ6E 4X5WA 4MAYA 2MTPA 2YPLD 4LVEA 3FFDA 4QHMA 1CLZH 5F7NC 3BDYL 5CJXA 5D1QD 2AK4A 3D69B 1HQ4A 4Y4KC 4QLRA 3QEUB 2XT1B 5E4IA 1N4XH 1MNUL 1GGTA 3K8KA 3VXTB 1K3ZA 1FDLH 2YN5A 3C60A 1BIIA 1NFIB 4HIEA 5B3JE 5IR1A 1S9WB 3WLWC 3DETD 1AGBA 3UC0H 1KCUL 3BH8B 3NIDE 3QH3B 3LN5B 4AQ1B 5MEQB 4BFGA 5T5NG 4DAGH 4Q7DA 1GGYA 3HMWH 1NEZA 1CE1H 4ZUWB 3E2HB 3FRUB 2GEEA 4X7DC 2GAZB 1G6RA 4M7KH 3WFHB 3RVUC 4KK5D 1XCQA 3GRWL 5CJOH 1SY6H 1RZFL 4OV5A 1IFHL 4XPGL 1QHOA 4IHOA 5D2NE 3RWJB 1QR1B 2B8OT 2F5BH 3UTOA 2D31A 3T4AB 1OQXA 3BOVA 3L1OH 2IAND 4GG6B 4I3GA 1MAJA 5LGHH 3FB7A 4ELMB 4HC1L 4M8QA 3QI9B 4ZUUB 2JJSA 4M4PA 3G5XB 4KV5F 1J1PL 3P0YH 1SM3H 2DDQL 2H2PC 5AG9A 1ZHBA 3IU3A 3V0AC 1I75A 4KUZL 2W9DH 5L88L 5CJQH 4L29A 4GAFB 4F7MA 4EXKA 4C56B 1TTGA 2FGWL 1NDGA 5EIIB 1LO4L 1DEEB 3CVHA 4YHIA 3VFUA 2F53E 1IGYB 5BV7L 2EEDA 1IQDB 3M17A 1NSNL 3SGJC 1CS6A 1Q0YL 1CIUA 3ZKXB 2G2RA 3HNTL 4Y1AA 2AGJH 4FHBD 1S9VA 4JFXB 2BERA 4XVTL 4NKMA 3S37X 4K07A 3LKRA 4U3CA 1U8PB 3RUGB 5I2IA 4OUUA 3F7VB 1JI2A 1VGEL 2OX5A 2IFFL 4JDVA 5HHVL 4X7FC 5GS2D 4M7LT 3O3BB 5GRJH 4GRWB 3C2AH 1MH5B 1P9MA 4XAWH 3RZCA 4I13B 1PAMA 3T77B 1EFXB 4KKNA 5EU5B 3QZWA 3RX8A 3NCJH 4PJ8A 1UJ3C 3MXWL 4TOYL 2BDNH 5DMKB 3PWJB 2E7BA 3MQIA 4YFEA 3CX2A 3I6KB 1QSEA 5I74B 3TJEL 3UTTD 3UYRL 3QEHB 4I9WD 2ICEB 4JM2C 5KSVB 3NACL 4A2MA 2BVEA 2BY1A 4M5ZL 1NCWH 4UIKH 2HTKC 1FGNH 2WNGA 4Z7NF 4M7JH 1T7WA 1DQDL 4PLOB 1N7MH 1IT9H 1NCCL 4MAYC 4KMQA 4CUCA 3GMQB 4LMQE 1A6UH 1WZMA 2X89A 4A6YB 3S4SA 1P5VA 1J1XH 1XF4B 3HCVB 4NQTA 5CJXC 2C1OB 1NBYB 4NWUH 1GOHA 1CGYA 3JV5A 1MVFA 5A43C 4F37F 1WVZA 1RULH 1RZIB 3CLEH 4LSQH 3RDTB 3T4YA 3MUZ1 1A9EB 1H3TA 1AE6H 3C60C 3PWLA 3ZKQD 4J6RH 1HHJB 1IAOA 2J5LB 2X1OA 5LCVL 2A73A 3HS0A 5DRNB 4XVJH 1KN2L 1K2DB 5C0AE 1TPXC 3ULUE 3EOBA 2HYMA 4HAFA 1D5BB 2ARJB 2VDLH 5JOPE 1Q94B 3D18B 4HF5L 1A7NL 4M4RA 1J9CT 1S9YB 4HWBA 4POUB 3MA7B 4C4KO 1W8OA 1B3JA 3UTPE 5E8EB 4MQXC 4G9FD 4TVPD 1G7JB 5DO2C 3O2VH 5F3BA 3MRHA 2F53A 4NZTL 2VIRB 1MCJA 1H3GA 4N8CH 5IP4A 4Q74A 4QKXB 4ZOCA 4TSAL 3GZKA 1VDGA 1ADQA 1UQSB 2W65B 3Q1SH 4DZ8B 4K7PH 3R06B 2DLHA 3T0ED 5I1HH 4RMTA 3EOAB 2YKLL 4KMTL 1KIQB 2JJSC 4EDWH 4IS6A 5GGQH 4LKXB 1C8PA 5EBMA 3P4NB 4WUKL 2AJSH 4YBQD 1FPTL 5KAQF 2ADIA 5IT2L 2QV2A 3BW9B 1VADA 2YD9A 5C6TL 3JTTA 5DURD 1BMGA 4MLSA 3C9NA 1PLGH 3HC0A 2IAMD 2EC9T 3TFKD 3U9PH 5J11B 2YPLB 2NY2C 3P2TA 4ZNCD 5HHOE 1FC1A 5IHZA 5D1QB 5HI5D 4PD4K 1K6QL 5BJTB 2X4PB 3LRHA 4YC2B 3I3EA 3K1DA 5HHPB 4EUPB 4PGJA 5C6PB 5EBLB 4A6YL 1EZVY 1CICA 1ZT1B 3CDCA 2IBGA 1NPUA 4XAKD 5L7XH 3NPSC 4LSRH 3G04A 5DJ2B 3TIEB 2NX5E 3VXNA 4MB3A 2NY5C 4PJCB 2K7QA 1P9MC 1PZ5B 3RZCC 4FS0A 5IEHA 2YPVH 2XRAH 3BI9X 2FO1A 3JBG7 3PDDA 4ZAKA 4M3JA 1BPVA 3KAAA 5FA4B 4E5XA 1FZKB 2XA8H 4OLZL 2GYSA 5GRUL 3MRDA 4U7MA 5CZXD 5KTEL 2A6DB 1CFTB 1T6VN 5L8JB 3MMEA 5DRWB 1S78D 2IANB 3OV6A 5E5MB 5BS0A 5L2KD 5F1IA 5IF0B 3LN4A 5DR5H 1DFBH 2DTMH 5BZDB 4X9HA 4R4FH 5KSBB 1IAKB 4RDQG 5JIHA 5JO5A 3BPCA 5I30H 1I7UA 3QDJA 2IPUK 5B39G 1SJXA 1T0MB 3RPIA 5F21B 2G60H 4Q6IA 3V6OE 1BEYL 5KVEH 5B39B 5C07E 1MWAB 2ZUUA 2JCCB 5H37H 1YA5A 4RGND 4U1JB 2WLZA 5TDNB 3V4UH 4XMKH 4FG6D 2QR0A 1LEGB 2YD1A 4ODVL 1I7ZB 3DVNA 3QB7C 2VLRD 2LVCA 4XP6L 3HG1E 5CINL 3NGBC 1F3DH 5BZWA 4PLJC 2X70B 2OBGA 2IBBA 1DUZB 1RAMA 2VR5A 4MX7B 1IAIH 5I9QB 4WJ5A 2Z92A 4YGVB 4OZFB 3SDDA 5AYUH 5HHOA 2UV3A 1MCWM 4PLKD 5K9QI 1BFOA 2P49B 1G9MH 4E42A 4MQSB 1FV1B 4HEME 3ARFA 3TA3A 3NN8B 3CFDB 4AZ8A 5J6HB 3F58L 4PJIB 4XVSL 3UTTB 4XP1H 1I8LA 3IT8D 2HFTA 1T22B 3VXOA 4WV1A 4DEPB 3SE8H 2AI0L 1RV6X 4FTVE 5GS1A 5BO1L 1ZEAH 4LARL 3K0WA 4XXDA 3QXUA 2AJYL 1BVLB 4TNVF 3S9DB 2P46B 1QFUL 3X17A 3WFEL 4OZIF 5F9DC 2HMID 1UADC 2PNDA 1UEMA 3AVEA 5DJAB 2RCSL 2D7TL 2FL5B 4XZUB 1KCVL 2VL4A 2B2XL 1CICC 1YNTB 4U1LB 4J3XA 3MSPA 2EDNA 3DGGA 3BEVA 4UOW1 5DD6A 2G75B 5HI3C 5MEOB 2ICWB 2Z91A 4L8CA 1NJ9B 2D7PA 1RQ5A 4XCEA 2P7TA 3L3DB 2V2XB 5E9DD 3LKNB 1UVQA 2KBGA 5C0RL 1W0VB 4X5XB 5D7IA 3NIFE 4YDJB 4MD0A 3H9SE 4G9FB 5DD0H 3FMGH 4JR9L 3CDYA 1M7IB 4JN1L 1MCQA 4HKXA 1RJYB 4JG0L 3P40A 5ENWB 4W4NA 4MXWH 5I6XC 1R0AL 2E9BA 1ZGLP 3T0EB 1FL6B 1IC7H 2BOBA 1CFNA 1T1WA 2OI9C 3GSWA 1EGJL 1S9KC 4F7EB 3QCTH 3WIFB 2ZSVB 4MDJB 4UOW0 3LPFA 3TCLA 4YIQB 5SWZA 4BA8A 3IVKA 1KTDA 3BKYL 4XI5D 5DURB 1YEGL 2VN4A 2IAMB 2G9HA 3NVQA 4Q6IC 32C2B 3PWUA 3KPSB 4GS7C 4NPYA 4U0RB 3LEYL 1MFNA 6FABH 4B53A 5IBUB 1G7HB 4IDLA 2IH1A 4DUVA 2AQ3A 3BP4B 1SJEA 2E7LA 2MKLC 5ANMB 3VFPA 3KYOA 1UM5H 3QHZH 5GJSL 4D0DB 4KGJA 3SO3B 4ZUVA 2VH5H 3G5YA 4D0BA 3SDDC 3IXAA 3HPJA 3G9VA 4NCDA 4MGXA 3HB3D 2G5BB 3EHBC 4XVUD 5GGVL 3NAAH 3RL1B 3BIAX 4GQPH 3ARFC 3TA3C 2EXYD 1F8TH 1QOKA 4HQQH 2IG2H 5LWYL 1FL5A 3LPWA 1TJIH 3ALXA 1I8LC 4WV1C 2ARWA 4JKWA 3OKNA 5FYLH 5GS1C 4I18A 4Q58C 4TVPL 1EAPA 5K59E 1FNEA 5IB2A 3MRBB 4L8SB 4EN3D 3LN9A 4WHTA 5CEYB 4E41B 1WJ3A 3L5HA 3LCYA 5DMIH 5DSCA 1B4JH 2W0FB 3TO4A 1DCLA 4Q9QL 4Z5RA 3L7EB 3WIIH 4NZRL 1TJHH 1ORSB 5FKAB 4KAQH 2F5AL 2EH7H 3GB7A 2C26A 4NRYA 8FABB 5DD3L 4Z76A 3K7UA 2NY0C 5KG9B 3ARDD 1I9EA 4Z0XA 1HK6A 1C5BL 1WIPA 2Q87A 4RFNC 1F45A 1LP9B 2OS7A 5FO8A 2VLRB 2Y6SC 3MUGA 1FFNB 4MXQC 1FLRH 5SX5H 3ZT6A 4MVBD 1YMME 3BP7A 4YXKL 4F9PA 1CDYA 1ACYL 3TJEH 4J3SA 1ZK9A 3BPOB 4WI5A 5IB5B 1RI8A 4LGPB 1OP9A 2FX9L 2ATKB 5IG7B 1P5UA 1MLCA 3D39E 1DBMH 5I73C 4X98A 5DZLA 3U30B 4U33A 4XNMB 4QRRE 2VDRL 3RTQD 1KCLA 4OD1L 1F2QA 3NTCH 5EC1B 1KYOK 1FVDA 5F7WC 3VXMD 2EYRB 4NO0A 5J0BA 1QLRB 1I7TA 5ESAB 3FOLB 1U6AH 3CZFB 4TUJB 5D7IF 5C86A 2FZ3B 3TN0A 2VR9A 5F6HJ 3MV7D 4G6MH 1R5VA 2YMXH 5LAXB 1OOAA 3TBYA 1U8IB 4RIRA 4AEIH 4RQQA 1HSAB 4U1SB 3DSFH 2FHBA 3L5XH 1IAMA 1XGTB 1LEKB 2OL3A 5EN2B 1AJ7L 2E7LC 2PO6A 5FECA 3SEPA 4P49A 3FHAA 3S35L 1FG2A 4F7PB 4G8GD 2VLJA 4IOIB 4GUPB 2DQHH 5CMAB 5TQ2L 2EH8L 3ARBA 3ZKND 1YEHH 4UT6H 1GJIA 5CBAB 5E9DB 3PQYA 1NCUA 3QIUA 3FT4A 1HZHH 4F33A 3L6FB 1F6FB 4PRDA 3DYPA 1UWXK 3HAEA 3MCLL 3UPRA 3ULVC 1IGFL 3IDXL 1A1OA 3ZTNL 4PJEA 3O9WD 4QRPE 4PRNB 4DW2H 3HN3A 5D6CB 2A1WL 1P1ZB 4P2CG 4I0CC 3D1MC 3B2VL 3KYAA 5JW4M 1RK1A 4JVPA 4JREB 2RIKA 1SJHA 1PX4A 5E0QA 4ETQB 4I18C 1ZT4A 5D7SL 3G6AA 4ODUB 5I1DB 1OPGL 3EJJX 3VXSD 4P3WA 4YEFA 1NANH 2Q7YA 1INDH 2EDQA 3BP6B 4MJ6A 4JDTH 3U0PB 3MNWB 3DYMA 2OZ4H 1K6QH 4K9EH 4KQ3H 3TO4C 1T03L 2O26U 5KSUB 1BD2D 1KF9B 2A6JB 4H1LG 1J11A 2Q76B 3LQZB 3OQ3B 2JLLA 2C3XA 4WW2A 3R0MA 3W5NA 1EERB 3WO4C 5A16B 3S36X 1G7MB 4Y4FD 5CP7B 1NGWA 1EVUA 3SDXE 5T3XL 3D39A 2YEZB 4HS6A 1LGVA 3OJMB 4ZSOA 1JV5A 4PRPD 2WMPA 1HHIB 1CGUA 5T5FL 4QRRA 3DECA 2A0LD 3QDGA 4EXPX 2CKBA 5JLZB 1CBVH 2AV7B 5A3IC 4ZMAT 1F11A 3MRIB 3WEXA 1I3VA 1BJMA 4PY7B 3P0VL 5GHWL 2FJHA 3CSYA 4F9PC 2R2EA 4RZCA 2JB5H 4NO3B 4PRBA 4B0MM 1QZ1A 5KVGH 2X9XA 1U95B 5D1XD 3BQUA 1RJLA 1FO0L 4V1DA 5FGSA 2WWKO 4Z78A 1KC5H 3QIWD 3RVTD 3SJVD 3MV8E 4D0CB 2H6PB 1L9MA 1N8ZA 1HYRC 5DVOA 1FN4B 3K1KC 1VFAA 2JJTA 2X4NB 4PJXB 5JXAL 4AEFA 5ERWB 2XWTB 5DJ6A 1XZ0A 2Z4QB 1MFDL 4NNYA 3ETBF 4KKCD 5DMYA 5GRVL 5FYLE 3STZB 2D4FA 3MRPB 1JYNA 4PP2A 1K4CB 3TN0C 4F7CA 4FFWC 2PW2A 5CIPA 1G7PA 5JZ7C 3OKDA 3P30H 3VXRB 3ELAT 3LSOB 5DMJB 3J7HA 3LZFL 2QTEA 4LOUC 1A6ZB 5HD8C 3EOYG 4QRPA 2J6EL 3MREA 1R3JB 2PO6C 4OFKA 3B3IB 4OF7A 3R8BB 1AY1L 3MLRH 4UIMA 4Q6YA 5ALBH 4U6YB 5F9AC 5T1KB 1RUKH 2HFGL 1WK0A 3W0WB 5DK0B 1P4IH 2H1PH 2P44B 2X7LA 4MD4B 3WXVL 4AENB 2GSIB 5C0EB 1VEPA 4LHUB 2ZOLA 4W68A 3ARBC 1I7RA 3MLUH 1HH9A 3QIUC 3OGOE 5CSGA 4ODWB 3JV6A 1FZMA 4X6FA 2D03L 4X7CC 3QJHA 1NLBL 1Q1JH 2F8VA 4UOJA 5TF1L 1AD9B 5TE6L 4F2MA 4ACPA 1N6VA 4HUVB 4HFWA 4ZS6C 2VZUA 2AEPL 5D7LD 2HJKB 5C0CB 4LKCB 3QDHA 2CDFB 4XCNB 1UM6L 3MACL 4N90D 3QDMD 1KIRA 3JXAA 5IB4B 3LEXB 5IKCA 4NKDB 4JRYE 3GRWA 1F6AB 2VC2L 3RTQB 5L2JA 5DRXA 5JR1H 5EFIA 2ZNXA 2XTJB 4OFIA 3NZHL 5TQ0L 1UWXH 3VXMB 1XF5A 1CT8B 1TTUA 2I07A 2IQ9L 4M1DL 3MV7B 1MEXL 5HDQL 1FGVH 1G9MC 1X5IA 4HC1A 4IJ3B 4WU5A 3ARGA 3LKQB 2DICA 2DQCL 2EIZA 3AUVA 1NC4A 5EU4B 5D2LE 3BWUC 5EZOL 3HZKA 4HPOH 1MWAH 5M94B 4XTRC 2FO4A 3ZE2E 3GSVA 3GMRA 2YBRB 3K80A 1F58L 1YJDH 1MY7A 1SYVB 1QVOB 1IVLA 3H42H 4TN9A 4XCFH 3QXVA 5KZCD 3BQUC 3FO0L 3WUWB 4WW2F 5FYKD 1ZVHA 4XBPA 1R0AH 5FGBA 1MAKA 3QCUL 4QRSA 1V7MH 2B1AH 3NFSL 1Y6KR 2LQRA 4KJWD 4RX4A 2WIIB 4AL8H 2JJTC 5IFAL 2DQGH 3D69A 5T3ZD 3O9WB 2ZPKL 1KNOB 4R4ND 5BMFL 3LOWA 3GMNB 4WDIB 3QEUA 3HR5B 1S8DB 1JPSH 1JHLH 4ODHH 2LTQC 4QOKD 5GGTH 3VXTA 1TZGL 4LCUB 3WFDL 1NFIA 5E2WH 1G7LB 1KEMH 2C3VB 1S9WA 5GRXG 1JZ6A 3VXSB 1DQLH 1OWWA 1K85A 4KXZI 3BH8A 3BMVA 2DJ4A 3QH3A 3LN5A 5MEQA 1NCBL 2R56L 1ZLSL 4I77H 4M3KB 5T33L 1BD2B 2DD8L 4ZUWA 1X5HA 3FRUA 4HK3J 2GAZA 3WFHA 4FZEL 3W39B 3DYOA 3QHFH 1QNZL 4HBQA 4Y4FB 1OCWL 3RWJA 1QR1A 4U3HA 2ZCHL 1BX2B 5AYQA 3T4AA 4PRPB 5F8QC 4FABL 4GG6A 4FZ8L 2NCMA 3IJSB 2GT9B 4U1GC 4ELMA 1HH6B 1ZVYA 5KW9L 2XFXB 2JE8A 5E2UL 3QI9A 4ZUUA 2XKSA 3G5XA 3QEGL 3S37L 1QFWM 5M95B 3S5LG 5K9QG 2E6QA 3EO9H 4OF0A 3UTQB 2ZG1A 3O8XD 1NEUA 3I50H 3D3VD 3PGCB 5BRZD 2NW3B 4PREB 2VWEC 4C56A 4OGAC 4TRPL 2N56A 5EIIA 1EO5A 4NFCA 1VFUA 1DEEA 4P99A 3QIWB 2X44D 3CAFA 1IGYA 2ZUSA 1IQDA 4QRQB 4FNLL 3WIHL 2ZUQC 2RBLA 4UTBL 4TYUA 3TESA 1A4KB 4FQLH 1EMTL 4AK1A 4Q9QH 4UINL 3W5MA 4JFXA 4ERSL 3DHJA 2IPTH 43C9B 1U8PA 3RUGA 2GQHA 2A74B 1OAYL 2Y23A 3DRTB 3F7VA 2WWMC 2AJXL 2VXUH 1FIGL 1G7QB 4PUBH 4XBEH 1PG7H 3ARGC 3JWOH 3UCRA 3O3BA 4XNUL 4XP4H 4OIAA 3HZMB 4OD3L 1MH5A 4K71C 3BIKB 1UWGH 3T77A 1EFXA 5EU5A 2VLMD 4R9HA 1X5XA 1CXHA 2WQRA 5DMKA 3PWJA 1XGRB 2CK0L 5BV7C 3I6KA 4QRUB 3QEHA 4PD4J 5F7UA 1PKQB 2ICEA 3MV9E 5KSVA 3PP4H 1E6JH 15C8L 5FGBC 3MRNB 4P2QB 5F89B 3R1GH 2XZCH 3GMQA 4S2SB 4GMSH 4A6YA 4PJCE 1EK3A 2BVPB 1XF4A 2NXYD 3HCVA 4PB0H 2C1OA 1NBYA 3U4BH 1NGQH 1QBMH 2H3NB 5D7LB 3V7MA 5IHBA 1RZIA 4RGMB 5HDBE 5J6GB 1NLDH 3QDMB 3SPVB 4HS3B 5IFJB 1A9EA 4PB9L 1B2WH 1HHJA 1IBGH 3TT3H 1JGLL 3G9AB 5DRNA 1K2DA 1ONQB 1EZVX 5TDPB 3BZDA 2EZ0D 1D5BA 2ARJA 1Q94A 3IFNH 2IANE 3D18A 3QFDB 1MJ7H 1S9YA 3MA7A 5KVDH 1O7SA 5E6ZA 1GYAA 3E2HC 5E8EA 5D9SB 5C2BL 5KSBE 3GO1H 1G7JA 3U1SH 3VDAA 5F7YC 2WBJD 3RVWC 2VIRA 3IFOB 1WTGT 3KVQA 4OGYL 4YO0B 4ZNEA 3VFWB 1UQSA 2CO6B 2W65A 4DZ8A 2JCCE 3MRCB 3R06A 4JHAL 3EOAA 1KIQA 3QI9C 3O2WL 2EDYA 4HPYL 4LKXA 4RRPA 1MRDH 3P4NA 3CXHK 5T1DH 3TIDB 2HTLD 3I84A 2A1WH 5A40E 4OCRH 4W4OA 2FWOB 3BW9A 3QCVH 1QSVA 3UYOD 4IRZL 4C55A 5GGSB 4NC1E 5JHLH 2P5EE 3I3DA 2YPLA 1GC1L 1F02I 2E7MA 2NW2B 5KANG 4ONFL 2R69H 1B9ZA 5D1QA 1KN4H 3ZKXC 3BKJH 2DMCA 2X4PA 4FXLA 5F7EH 1EO8L 4GG6F 3BRFA 5I18L 4RGOL 3RKDD 5HHPA 4G8IB 4EUPA 4QOKB 3UAJD 5K9JH 5EBLA 3EGSB 1P4BL 1ZT1A 4G6FD 4W6WB 5HGGS 3O0RL 3UTTE 2Y07H 1LE9B 1WITA 4I9WE 3GI8H 5B22A 1NAKL 5DJ2A 3TIEA 2EDKA 4JZOB 2DIJA 2BVOB 5T5FH 3MLWH 4PJCA 3V6ZB 5H94B 1PZ5A 2YUZA 3DXAD 5HHMD 1MPAH 3K74B 3A6CH 1RVFH 3BSZH 3QPXL 3IU4H 1QRKA 1K8DB 25C8H 3WDJA 3QBTB 5JW3H 5FA4A 1N64H 1FZKA 3PDGA 5I74C 2DQDL 1RUMH 4JY5H 4OLWH 1FFRA 3O6ML 1OP5K 2A6DA 2NY7H 1CFTA 1T2QH 4G80B 4K9EC 4YPGB 5DRWA 2IANA 5E5MA 3RUGF 4LLMB 4OLXL 1OD9A 4N0YH 1DANT 1FCGA 5FB8B 5IF0A 1M05B 1CFVL 1KLGB 3S88H 1HKLH 2AQ1A 5BZDA 1FYTD 5KSBA 4L1DA 4PJ7A 4GRWF 1IAKA 2PTVA 3O8XB 4YHOH 3D3VB 1NBQA 3N1GC 5AUMB 5BRZB 3GJFB 5D8JH 1X3DA 3RDTC 1T0MA 3QAZB 4M6OH 3OHXB 1YMHB 2J5LC 3RWIB 4ZTPL 4O58H 5B39A 1NMBH 1MWAA 2JCCA 1J8KA 3BEWB 4NJAH 4U1JA 4ZOEA 5TDNA 3SGEH 3LKOB 1WBXB 3T0EE 1LEGA 1PYWB 4JVUA 2GITB 5I8OH 2IWGA 2I24N 4M93B 1I7ZA 1AXSB 3EJZD 1FSKB 3LMJL 3D2UB 4M03A 2D9QB 2X70A 4CMMB 1DUZA 1GHFH 2IJ0C 4TNWK 1JK8B 4MX7A 4JLRB 4PJAB 3LEVL 2HT3D 1JRHI 4YGVA 5E03A 5JMRA 4KWUA 4OZFA 1QLFB 1EGJA 3BFOA 1S7QB 5HGHB 3SE9L 4DKDC 3T3PE 2OM5A 2O5XL 4HKZB 4H1LH 1IE5A 1T04B 2WV3A 1IEBB 4I0PB 5IVOA 1J1OL 1SBSH 1FV1A 5SV3A 3RVXC 1ZGLB 1UC6A 3NN8A 3CFDA 3WDIA 3D9AH 5FAAA 1VPOH 1L7IH 3LKPB 5J6HA 1YEIL 3C5ZB 5DUML 3RJDA 4PJIA 1T22A 4W4OC 1VSCA 4KK9C 5BVPL 2AV1B 1MCKA 3JSSA 2AABH 4JZJB 3G08B 5J11C 3CGTA 1BVLA 3JUZA 4FFVD 2NXYB 2XPGB 5D1QC 1BFSA 1KEGL 4YC2C 3CCHB 4XPBH 1EFQA 5DJAA 2QQLL 3MLSL 3EDKA 4XZUA 2FL5A 1DBKL 3WJJA 5F7LB 3KR3H 4U1LA 4JHWH 2G75A 5JW4R 2FX7H 2GTWB 1OP3H 5MEOA 4D2NA 2ICWA 3CLFL 3T0WA 1NJ9A 5L2KE 3IAPA 3ZDZE 4Z95H 2V2XA 3L3DA 3LKNA 4M48L 1W0VA 4X5XA 3MLZH 2DLTA 2PYFB 1TXKA 4YDJA 5DLMH 1RZKH 4G9FA 1M7IA 1F90H 4YZFE 2NY1B 3WN5B 5FGCB 4DWHA 4R4BB 1RJYA 4QTIL 1C1EH 3QUKB 1SQ2N 1H5BB 5ENWA 4MZ2A 1DEDA 1IGJB 1SYSB 3FO2B 4MA1B 3T0EA 2BP3A 5FKPB 1FL6A 4RGNE 3IDNB 2VE6B 3W2DH 1QBBA 5IVNA 4NQDD 4OLYH 2AXGB 4F7EA 1ZWIB 3VGHA 3WIFA 4OGXH 2ZSVA 4MDJA 4DN4H 5J8OA 3QUMH 4YIQA 4JCMA 4I3RH 1TVDA 1IC4H 3MXVH 1AI1L 4Y5VB 3RI5K 4KKAD 4HV8B 1BFVH 2IAMA 32C2A 4QO1A 3KPSA 3GM0A 3MR9B 1OP5H 4X99B 4QXUH 4JFYB 1G7HA 5C3TA 1IILE 3GIVB 3KXFB 1DN0B 3Q6FB 3BP4A 3T3ME 3VI4F 4U1KB 2VDQH 5ANMA 3V6FB 3Q5TA 3OJDB 4G6FB 3NCBB 3VRIB 5I9QC 4PJ7F 4D0DA 5ADOL 5IB1B 5IBTL 5ECJE 1OSZB 3L3KB 1KYOJ 2L7UA 1D6VH 5EUOB 3RA7L 5HHMB 2G5BA 2MOVA 3RL1A 4G6JH 4DN3H 4KPHL 1NUNB 2JELL 2FBJH 1CYGA 3QHTC 3BXNB 4DEPC 1JNHB 5IQ7L 1RIHH 5JW4Q 3HC4H 4BZ2H 3O45B 1ACZA 1T21B 3V5HB 4J2XA 1PQZB 3QO1B 1F4YH 3RGHA 1DQMH 2FRGP 3MRBA 4L8SA 3BYTA 5CEYA 4E41A 1FYTB 1D7FA 2W0FA 3ZHDA 3QG7H 4B50A 1B90A 3L7EA 4Z7VB 5A2IH 1FNFA 4EI5D 1ORSA 5FKAA 4R2GD 5KN5B 4LNRB 1OAXL 2F15A 3WJJC 8FABA 4KFZC 5KG9A 2WK2A 3ARVA 4PJIF 1BGXH 5SWSD 1YY8A 4NOFA 2KUTA 1LP9A 2X1QA 4WFFE 2VLRA 4P5KB 4ZFGH 1FFNA 4H25B 1I1FB 4XPFL 4GLRI 5CFHA 4ZO7A 2XIDA 4GAJL 3SO5A 3ZE0E 4P23D 5IB5A 4DQOH 1BF8A 1X9QA 1FNSL 4K8RL 2ATKA 5IG7A 1I8IB 4GBXB 4FQJH 4NNPL 3T0EC 3QNYB 4OZHE 3BAEL 3GI9H 3NIDF 5CZVH 4UB0H 4XNMA 3MZGB 1NL0L 4LP4A 4NP4L 5EC1A 4YBQC 1INEL 1QPPA 1PSKH 1TJGH 2EYRA 3OAYK 2ZCKH 1QLRA 2Y36L 5ESAA 3FOLA 3CZFA 4TUJA 4NQED 1OAKH 2FZ3A 4NIKB 4WHYG 4HJ0D 4JZNB 1I9RL 2R2HA 5LAXA 2GJZB 2IAMC 2BRQA 1RSFA 4PS4H 4MMXC 4U0RC 1U8IA 1KJVB 3O3DB 4X6DE 4YDVB 1HSAA 4U6HB 1XGTA 1LEKA 5EN2A 4GKOA 1RU9L 3TVMD 3D0LB 4UT9L 3S34L 5LG1A 2Z35B 4NZDA 3V8CA 5CD3B 4Y19D 1KLFA 2AERT 2XKNB 4F7PA 3QXAB 4IOIA 2C4FU 3SO3C 4GUPA 5CMAA 1WFOA 5KJRL 1R5IB 1E4XI 3G6JB 4L3ED 2CR3A 5E9DA 4U1NB 1L0YA 1IZJA 2ESVE 3L6FA 3NABH 4LF3B 1TFHA 4UDUB 2VDPH 3A6OA 3S36L 4PRNA 5D6CA 5TFSL 1P1ZA 3RWDB 1MJUL 4JB9H 2VLKD 5DGRA 5EWIL 3SOBH 3CK0H 3VFTB 1YPZB 3C2SA 3U7YH 1QLEH 3VFGH 4ETQA 3IB4A 4BQBA 2Z8VC 4LL9A 4ODUA 5I1DA 1GGBL 3REWB 4L8SC 1CCZA 5C9JB 3BP6A 3D0VB 1AGEB 1X5YA 3MCG1 4JO2L 1OM3L 3MNWA 3U0PA 1Q9OB 3RY5A 5KSUA 3FQRB 2A6JA 3IF1B 2JJVA 4ZOBA 3LQZA 1FORL 5H8DA 1LO2H 5A16A 1G7MA 3O0RH 3VRJB 1J87A 2VDOL 5CP7A 2BY2A 1KELL 5GS0L 5JIIA 1TMCB 2YEZA 5FHAH 2GKIA 2XZQL 5D7JD 1HHIA 1JTOA 2QQNH 3TBTB 4WI2A 4FG6C 5J89A 5GSRB 4HCRL 5AAWA 1Y6NR 3DI3B 2JK5B 4I3SH 5JLZA 2AV7A 4X7SL 3BZFB 3WFBL 1CLOL 4WO4D 3MRIA 4EQ2A 4L5FL 1MRFL 4M1GL 1A5FH 4PY7A 4WEBH 3VXME 4NO3A 3FTGB 4HUNB 3BPOC 3SQOH 1U95A 5C0JB 4ZTOH 4EIGB 4PLKC 3ZDYE 3ULUF 3KPPB 4HWEL 4CNIB 4D0CA 2H6PA 3C6LD 1CLYH 2C5DC 1MELA 1FN4A 4PJXA 2X4NA 3U30C 5ERWA 2XWTA 4QTHB 3SBWA 3LS5H 1D5IL 2Z4QA 1LE5B 4D9RD 4DTGL 4MLIA 3STZA 3MRPA 1K4CA 3TT1H 4G8GE 4TTDC 12E8H