5EC1B

Kcsa with v76ester mutation
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
209
structure length
209
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
molecule tags Membrane protein
source organism Mus musculus
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
total genus 47
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ec1B01
4QHMB 1KIQA 3L7EB 3BXNA 3GMNA 3DX8A 1BMGA 5INDA 4PJHE 1SMAA 5EN2B 3GI9L 1PKQA 1OQOA 3D2UA 4XX1E 4KKBC 3G6JE 2P5WA 1LNUA 3P9LA 1I9EA 5B3JF 1IM9A 3F7YA 1BFTA 1YEKL 2DQJL 1JZ5A 3KYKL 4P2RE 25C8L 3RIFK 3QSKB 5CWSB 4XNYH 1GAFH 1O7VA 5IVXB 1FL3B 5T5NG 5DK2B 1S5HA 4J3UA 2H6PA 3MA7A 3O3BA 5T33L 4PGDB 2EDWA 4LOUD 5EUKA 1YC7A 1RK0A 1SEQH 3ARDB 2HLFC 2AJYL 2AEPH 2IPKA 4F2MA 3CU7A 4YDKL 5HHMD 4YXHL 4DQOL 5IW1A 2GUOA 5T1LD 5GJSH 2Z4QB 2VZSA 3RKPA 3L5HA 4RMVA 2X5PA 3RGVD 5TDNA 12E8L 1YY8B 2Y7QB 2V7HA 1G84A 4R7NA 1X7QB 5EC1A 3CIQA 1BVZA 4P5TB 3P9WB 3QDME 1JF1A 1TXKA 1CE1H 2W0FA 4N9GB 1RZJC 3L3GA 1DEEA 4GSDH 1H8SA 4KKAD 3RTQD 3WNLA 1FPTL 3Q6FA 3H3KA 5JHLL 1ZLVH 4IJ3B 3TN0B 4K8RC 5HHPB 1ZVHA 1Z9SA 1P7QB 2CLRB 1KXVC 2O5XL 1REIA 1JHKL 4DZBB 1S9YB 1WEJL 5I1EL 1J05A 4FXKB 4L5FH 4Y4KB 5I1LA 5GPRA 2R2EA 1MEXH 1I8LC 2OQJA 4GMSH 3NA4A 3G08B 1CDCA 2BJMH 2NY4D 4IDLA 4RX4D 3HMWH 4XPAL 4QXUL 2WP3T 4WV1B 4JPVL 5LGJA 4MD5B 3HC3L 3VGAB 1A5FH 5LWYL 3ULVL 1Q9WA 1EXUA 1FNAA 1MHHB 5FUCC 3D0LA 2WUCH 4OZGB 2R0LL 4KUZL 5ENWA 2PO6D 5HYJB 1RZKH 1KF9B 4GRMB 5CSZB 3R4DA 4GW5B 4HKXA 1NCAH 2CIIA 3BPLC 1EHLL 2FEDD 3HPLA 4ZUTB 1JI2A 4BSVA 3RZCC 2XT1B 4RDQG 5DEGB 1ZHBB 2XWBB 3QO1B 1H5BB 1KJ2H 3GM0A 4L3AA 4EVNB 3MBEB 35C8L 4ZOEA 4O2EB 5EBMB 4WUUA 5CGYD 3AVEA 4LF3B 5JPMB 4G6FD 2P1YA 1XR8B 5ITBH 3BP7A 1RURH 2G5BA 4JDTH 1DN0B 3IDIA 5GGVL 1MHPH 3OAUH 1QBBA 5DRXB 3MJ8A 3VRLF 3GSQB 4NQEB 4RMQA 1ZANL 2Z8RA 4R0LA 5GSVA 3RVUC 15C8H 4WRLA 2NY0D 4LBEB 3WIHH 3IXTA 4LASL 1NBYA 1AHWC 4FFVC 4KHTH 1LVEA 2NNAB 3MUGA 1A14H 2BOBB 4QNPE 3QHTC 3DRQB 1G7LA 2QHRL 1QRND 1QPXA 1KB5L 1U3HA 4PUBL 1BIHA 2ICWJ 4MCZB 2J5LC 1HI6A 4FP8H 1DDHB 4MNGA 1I8KA 1EFQA 1B0RB 5DFVC 1YMME 1KN2H 1KGCD 4KK6D 1HWHB 3PWNA 1QLFA 4QRPE 3HA0A 5D7IF 2P8LA 4P99A 2UUDH 4LSQL 4V1DB 4ZOCA 4YFEA 3GMRA 4D9LH 5E2VL 5KANI 1OAZL 3EDJA 5IG7B 4D0CA 3SDCA 3DVNB 4I0PA 1DE4A 4M62L 3OKLB 2B4CH 5EOQL 1SHMA 4LCUA 4U0RC 5J89A 1UXSA 5FUOH 5HI3C 4KKBD 2V2XB 3QFJD 3O4OB 4YHYB 2ESVE 5SV4A 1K6QL 5C0DA 3M45A 5HSFA 3TBWB 3QXDB 2DKSA 2BVPA 3LKPB 4X9IA 2DQDL 3HNTH 1IEAA 3NCBB 3J8F7 3MRFA 3MLXL 4R9HA 1BQLL 2GITB 4WNQA 1QFOA 4Y2DC 5EO1B 5C07B 4EUPG 4RNRB 2NZ9D 4JPIB 1L9MA 5EBGA 1MAJA 3RPIB 1R5IB 1ZTXL 3JWOC 5MI0C 1FG2A 4WWKC 2PTTB 3QQ4A 3WJLA 3B5GA 1AO7B 4WW2A 4X6DB 5C07A 1JYXA 3QXUA 5CMAA 1A7BA 2O5ZL 4L9LC 5FYLL 1V3KA 4R8WH 3V5HA 1LO4L 2CIKA 5T1KB 4K3HA 1INQB 4D8PB 2EH8H 1R3LB 4KK9C 5ICZA 2VQ1B 4UB0H 5DHVH 3TIDA 3SKOA 2FB4L 4HZLB 2VLRE 1KBGH 2AAVA 1IL1A 3DVFA 5FGRA 3GBNH 4TUKH 2EKSB 4A6YA 4BSWA 3Q2CA 1JZ4A 1WBYB 3QUYD 3WV0A 4KY1H 5I1HH 5ID1A 4MS8D 4PJFA 4QHLB 4NKIL 4U1HA 3RJDA 4NM4H 2NY4B 3TT1H 1U3JA 2IBZX 1FCCA 5FHBH 1KTDB 4MQ7A 3QHFL 3HC4H 1UKQA 5I75B 4JKLA 2BMKA 2EXWC 2OZ4H 2F74A 3NFPA 4GKSB 1CFQA 5J1AB 5ETUA 3H9SD 1LWRA 5ICYB 1XCQB 3IDXH 4WU5A 4TUJB 1OP3K 4M5ZL 3EDDA 6FABH 5HI4D 2DJ4A 4RGND 5J9PB 3IAPA 2VXSH 2ED7A 2OYPA 4X0KA 3VCLA 4HS8H 4AH2A 1T21A 2VISA 4Z7UB 3SE9H 2ORBL 4YGVB 1NGPL 4YDJB 4YXLL 2F5AL 1X6LA 5D7KD 5DD6A 5BXFA 4IS6B 1I85A 1MAKA 3LIZL 3QIBD 5F3BB 5D1ZC 4QRSB 1FC2D 3O11B 4KK8D 4X8JA 4FXGA 2P4AB 3EOBB 1EGJH 1BM3L 4WEBH 4UT9L 1NDMB 4W4OC 3TF7C 3RI5F 5HPOA 5E00B 4GAJH 1DQJA 2PYFA 5E5UB 1CD9B 1CXHA 4I3RL 3M1BA 1QEWB 3NPSB 3CSGA 1OPGL 2X10A 4LDLB 3VXTA 1FYTA 4OAWA 3NGBC 3MRPA 4UAOC 1QQDB 3IAQA 3BX7C 4BH7A 3RGHA 1JGLL 4M7LL 1EAPB 3JXAA 3LKNB 1GL4B 1S78C 4UUJA 3N1QC 4LPUA 5F9AC 1T03L 4WTWA 1UB5A 4L8BA 5I73C 1IKNA 2VMFA 1EFXB 2DQUL 3SPVB 5T1MB 1YJDL 4Y5YA 1I7RA 5DMYA 4S1RL 1HHKB 2YK1H 5TF1L 2X41A 4IM8A 3OV6A 4H25A 4Q0XH 1CFNA 3WFDH 3CFEA 3T1FA 1JBJA 3MRRB 5D5MB 4ZFOL 1YDPA 3O2VH 3C5ZC 4M48L 4BFBD 2NTFB 4K8RH 1JL8A 3CCHB 5I9QC 2BNQA 4OGZA 3LS4H 4Q9RL 3OJ2C 4R7DB 5ISZA 4DGIL 2OP4L 3IDYC 5LGHL 3AU1A 2C4FU 3MACL 1IEAB 3MROA 2OR9H 2JJTA 1WTLA 4JKPH 1YY9C 3HAEA 4F8TA 2P24A 1UCBL 3EZ8A 1QVOA 4PLOB 4K7PH 3EYVA 5T3ZE 1UXSB 2CUIA 1IM3B 4NGHL 1SYSA 1QBLL 3PWJA 5LGKA 4Y5XB 2IC2A 1CXEA 1KPRA 3O2WL 3QPXL 4M1DH 4I0PB 4HXBL 1FL6B 1WWBX 2XA3A 2YHGA 4PRHA 3UJTH 3QXDA 2JELH 2G2RB 4JG1L 1H15A 3O6KH 4K7PY 4KI5D 4JFED 1J12A 3HZKA 5J4MA 2DIJA 1BVKA 1IQWH 1CQYA 4WIQA 1YEEH 2W65A 4OF7A 1XGUA 3WL9B 3CK0H 5IGXL 4X7DC 4OZ4A 4PJAB 3SOBL 1IC5L 2IJ0C 5CJ8A 2IADB 1RJZA 3ARGB 3UP1A 3HE6A 3LH2L 5J8OA 2HFFA 1JWMA 5GGVY 4OCLC 3U1SH 3MJ9A 3BO8A 2VLMD 1GZPA 3TN0D 2DBLH 2UV3A 3GJEA 5CMAB 1KLUB 1K4DB 1BAFH 1F8TH 2XKNA 1QLEL 3CZFB 5F9JA 3I84A 5KSBB 3SE3A 4LVNB 5SWZA 4HC1A 4Y19B 1PDKA 3PDOA 4OLZH 3MLYH 2UZYB 2V2WA 4PJDA 2O5YL 3ELAT 1PQZA 5AWNL 4XNUL 1PKQE 4PJEA 3H8NA 2ZWLT 2Z8VC 1NQBA 5IT2L 3MRNA 2FEEL 1FRGH 2XACC 1ZHBA 2XWBA 4JVPA 4BZYA 5DRXA 3MLRH 4NNXB 3ULUD 2BX5A 4ONGH 3ZMRA 1A1OB 1HXMB 1DN0A 1CG9B 3FFCD 1TVHA 4UINL 5EPMA 1B6DA 4EKXA 3TN0C 4BELD 2CDEB 4XNYL 1UKTA 1F3DH 1MCJA 1ZA3B 3T0EE 5IMLA 3FONB 4PBVC 2CKBL 4X80H 4H0IA 1CLYH 2DD8H 4YO0B 3TA3D 3TA3B 4U6XA 1CICD 2IAMB 4M6ML 5JORB 5GZNC 1T1YA 4HG4K 1CL7L 3GUTA 4RX4A 2DL2A 3VU2A 1BD2E 1QFWI 3B9KA 5GJSL 3K4AA 1L7TL 2KUTA 4RFOL 2OK0L 2BSED 3OMZA 1B2WL 3IYLW 4JRXD 4P9HC 4A6YH 4EI5D 4F8QA 5I1LB 3N1PC 5FYLE 1TJGH 4BQCA 4PV8B 1RZFH 4XXDB 1DUYA 1ZGLP 3KPRD 3MCKB 4G8FB 4GG8B 4PRPB 2E7MA 4JO1L 4Z95L 3KYNB 4WWKD 1DR9A 3VA2C 1FNFA 3JVGC 1UVQA 3GMLA 2DWEA 4UV4H 4UTAL 3C09C 5C70A 3L3OB 5FUCE 2ARJB 3U7YL 1FORH 1EUTA 3L3JB 1FPTH 1CT8A 4UIMA 1ETZB 4ZAKA 3VWKD 4PRBB 3NCFB 2JKXA 1FYHB 2EDRA 5DJ0A 2QSCH 1OAKH 4MXWL 2GHWB 3CH8A 1MFNA 5ISZE 1DSFL 1WBZB 1U8IB 4JFDE 5FAAA 5FO9A 3S4SG 3P0YL 3TP4A 1ADQH 3BKYL 4CU6A 4NO5A 4CJ0A 1CT8B 3O3AB 4UIMB 5F7FA 2BJML 4H26B 1YMMA 4F7TA 3FHAA 3VGBA 4JHBA 1BVLB 3DMMA 4X7TA 1G7PB 3WNPA 1MUJB 4F9PC 5HYSG 5D72H 3FT4B 4N8VA 4GLRI 1Q9WB 4FZEH 2X4TA 3FQTA 4KRMB 5HVHB 1HK6A 4GAGH 3LRSA 4XBGA 1FFPB 3PGCA 1KIRB 2NY6D 5CEYA 4KK5D 1LD9B 2YZ1A 3OHXA 2CDEA 1WIOA 3V5KA 3N85L 4WDIB 2DAVA 4O2FB 2VQTA 3F8UB 5DVOA 1A4JB 1EEYB 1CG9A 1QACA 1SY6A 3CD4A 3U36B 4XC1H 4TRPL 4YO0A 3V4VL 2PUQT 3C5SB 1N8ZA 5ITBL 5BZDB 2AJXH 2QKIA 4Y16D 3LKQB 5J3HD 3ARFD 3VE0A 2FL5A 4UIKH 3V4PH 4PJ5E 2X7LA 2B2XL 3KPNA 4XWGH 2D7NA 5DVLA 2JE8A 1YEHH 3LN5A 2EDJA 4KZDH 5F7WC 4YDLC 2PXYB 2H26A 1I1YB 1M6OB 1T3FB 5E6IB 5TF0A 1JNJA 3F7RA 3K1DA 4ZUUB 3QIWC 2FX9L 1BJ1H 2PW1A 1FVEB 4LFHD 3OKMB 3TPKA 4G9FE 1QPPA 4PFEA 5CLWA 3LN5B 2QHRH 3JV6B 3P11L 2EO1A 5F88A 3QEHA 1JV5B 1A7OL 3MLSL 4NQUA 3UX9B 1ZHLA 3HAEH 3RU8L 4ETQB 5F44A 4DGYH 2E7HA 4LFHG 5AYQA 5EIIA 4MJ5A 4YK4C 2YA1A 5HHNA 3MV8D 1RK0B 3ARDA 3HE7D 1IQDA 1HHIA 4U1KA 1EDQA 1VPOH 1I1AD 2DKUA 3W9EB 1VEMA 2NW3B 4YUEL 3B5HA 2XTJE 3CDGA 3W0WD 5HYFA 4QGYA 3G04A 2DIBA 3IFOB 3HI5L 3RL1B 3W5NA 3W2DL 4G9FD 4ETYA 1BP3B 2P48B 4IOFD 4NO5B 3NIFE 1FIGH 1A6TB 3DRTA 5IB1B 4V1DD 3RX7A 3U0PA 4OI8A 3HFML 1DBML 2UWEB 3LN9A 1K8DB 3SGDI 3E6HA 1DBBL 3OKDB 2F8VA 5GSVB 4LKXA 3VXSD 2HFGH 2Q76B 2JCCB 5JPNA 2WWKT 1XGYL 4QY8A 2MWCA 5I19H 1P84K 5JDSA 1NGQH 1HQRA 4Q6IB 1DQQB 1HIML 2DQTL 2PXYD 4OCWH 3KJ4C 3P9MA 2VDOH 1JPGB 3PXHA 5CZXD 3U2SA 1NAMB 1LO2H 2HWZH 1OB1A 1G1YA 1V05A 1RIHL 1GIGL 2AP2A 2EXYD 5CJXA 1A4JA 4PY7B 3DMMC 5D2LF 2DICA 3JV5A 3RUGF 2FDBP 2I27N 3RY6C 3VGAC 3DGGB 4U1SA 2IPUK 3HUJE 3E2HC 3U48A 4XBEL 4UILH 2J5LB 4WWID 3BVNB 2J7LA 2X4OB 4ZS6D 4IMLA 1P69B 4XPGH 2JF1A 4CU7A 2FJHB 2APFA 3RZCB 5HHME 4F7EB 3TPUB 2R0ZL 5TFSH 1HQ4B 1A6VL 2CK0L 4NZJA 5TH2B 4X7TB 1A7QL 4OLWH 1V7NH 4YFLI 5GS0C 2F58H 2VDQH 5IR1A 2OR8A 4MDIA 2XXCB 3MRCA 1ZT1A 4JFXA 1U8IA 4RWHA 1BIIB 2VITA 5F1SA 1AGEB 4HH9A 5FA3B 4ZNEE 1KEMH 3S7GA 4F37K 4MNGE 4FN0A 1QEWA 4XVUC 1JWSA 4RA3A 3A6BH 3RPKA 5L8LB 3GK8L 2XIDA 4YXKH 2XZCL 4KC3B 3QUZC 1BIIA 3PQYB 5E8NA 3PGFL 3ZKXC 2EDBA 2AKRA 3RKDD 4P2QD 5FM5O 3VFMB 3F12A 1JNHA 2X89D 4APQD 2FBJL 4L3CB 1A9BA 4YH6A 2RCSL 4LK4A 1OSZA 2VLKE 4PRNA 5F6HI 3UJIL 3JV4A 4X98B 3HE6D 3FOMA 4HIEA 5SWZB 3BEVB 3D2UD 1JNLL 2YD8A 1QYGL 8FABB 4BZ2L 3WN5A 4LRNL 3P30H 1FL3A 3RGVB 1MRDL 1G0DA 2A9ML 4PJ5A 5B8CB 2MKLC 3LEYH 4JCLA 4ODBD 5ILTH 4PPTA 2I9LA 5DC9B 1CE6A 2F9BT 3IRZA 3KNBB 1AXIB 3O6LL 1OY3B 2V2TB 1H3PH 1KTDA 1KCLA 1WWCA 2NY5C 3MPCA 1TJIH 2XY2A 5EO9B 4ZXBD 1S3KH 3TIDB 5IW6B 1XGUB 4H8WH 1WSST 5DGQA 1IAKB 5DRWB 1TVHB 5JOPD 5E6ZA 3IDUA 1FBIH 2D03L 5TF1H 1KFAH 1R5VA 1C08B 5DRZB 1BJ8A 2XWJB 3PWVB 4Q9QL 5IF0A 5TQ2L 3RWHB 2JB5H 1A6AB 3IDGB 1XF5A 4J4PA 2AABH 4JN2B 5DEFB 4HUWA 2AQ1A 3ZDZE 3K4ZA 3O8XD 2E6QA 3QWOA 2PTTA 1IEHA 5C86A 2DIAA 2D9QB 2ZJSL 2VERN 1F13A 3WFEL 1F2XK 4K94H 3U7WL 2JIXA 3FTGB 1T1WA 3D39A 4G6AC 2XZQH 2XOTA 2O5XH 1CWVA 3LOWA 1K9TA 2FATL 3HNVH 1IRAY 2BP3A 3T0BA 1LO3H 2C3GA 4WVRA 2AXFA 3U9PH 2GTZA 3ZTJG 4C83A 3BO8B 3MRFB 4GMSL 4EIGB 4XWOC 4XPAH 4MSWB 5C7XL 1C16A 2BOCB 1P6AB 1IQDB 2BNUA 2BSRA 2JELL 1I1AA 5LAXA 4JO2H 43CAB 4LDEB 5L0QB 3CVHB 3WNOA 2R4SH 2W65B 3D0VB 5E8PA 4X9BA 4XPBL 3H9HA 1FNGB 3QISA 3WJLC 2ADJB 2W0LA 2FZ3B 2WUCL 4GBXB 1AI1L 1NL0L 2J8UE 4MAUL 1YPZE 4MD4A 3GMRB 2UUDK 3QULA 4OJFH 2GI7A 1CICC 5H2BA 1FZJB 2ADIB 1N2RA 2AK1L 2ZUWA 2FO4B 3L5XH 1X4ZA 3QPQC 4F7PB 1BD2A 2OXHA 2IFFL 4IMLB 5GGSA 5GIRB 5K93A 3F6IA 1KV3A 3O3EB 5MENB 1RU9H 1K5NA 1PLGH 3DRQA 4Z7UA 2QQLH 5GGVH 4JKMA 5HDOA 3WN5B 1DQDH 3C5ZB 4JG0H 3OAUL 4JN1H 1QSFD 4L4VA 1AD9A 4F7MA 1MJ7L 4P4KD 1KLGA 1JF5A 4RMUA 2HT2D 5I15H 4LASH 2EYRB 1V5JA 4KROD 5DJ6B 2V17L 4WU7A 3C6LB 4CNIA 3JWNC 4OGAC 2GJJA 1XCTA 3SCMA 3VWJA 1FN4B 1FYTD 3W39A 5E08H 3LN4B 2YD3A 4RWYH 5SWSD 3MO1B 4IDJL 4JM4H 1PEZA 3MRMA 4FFVD 4AG4H 1CBVL 1PYWA 3V79C 2X1QA 3BDXA 4CMMA 1U93B 4U0QB 4LSQH 1KOAA 5JLZA 1NMAL 4P2OA 2Y4SA 3QR2A 5GGTH 3MRPB 1YEFH 2FHBA 4Y2OA 4EEEA 1ZT1B 1LP9E 2WBWB 3PV6A 5IFAL 5C0FA 1JZ6A 1YMMD 1A6WL 2VZ3A 2W1NA 4RFOH 1CGYA 2E27L 2ZCHH 2VDLH 4ZTPH 4JPKH 1OTSC 1A1NB 1T5XB 4XMPH 3WS3B 1OM3L 2IPTL 2GK0B 4ZXBA 2EIZA 3QQ4B 4PD4J 3QNZB 4N1HB 5DZOA 2DYPB 3BQUA 4M6AA 5DD1H 1KIUA 4BFIA 5IJKA 3V5HB 4WHYG 1XT5A 5DJXA 5L8KB 4DKAA 5FYJD 4DZ8B 1AXTL 1OAXL 3LQAH 1MWAL 3DV4A 3MXVL 2FGWH 3SKJL 4LPTA 5EO1A 1JJUA 4PJCE 1IGCH 2R8SH 1QRNA 5JXAL 3ZTJH 4LP4A 3FO2B 5E94B 1V3MA 4LKCB 3HMXL 4NPYA 4Y19D 5E6ID 4K23H 5K9QG 3QG7L 3NH7H 3QIWB 2DLFH 4NQEE 1Z0MA 5ID1B 1AH1A 5D2NC 2Z31D 5DRZA 4J7RA 3ZSSA 1WISA 2H1PL 3GJFA 1T7YA 5FGCE 1MCWW 5DURB 1BLNB 2E8ZA 5D6CB 2DQGH 2VZOA 5L6YL 4HZLA 1NBQA 5JLZB 4QEGA 3VXQB 1YEDB 3BMWA 5A3IC 1CDGA 2H32B 1NGYA 4MCZA 1MCNA 3MYJA 4ZOAA 3B8YA 4OFYD 4KJPC 4JFEB 5AYUH 1NANH 4N8VB 2XZAL 3BP5A 4WJ5A 4X6CE 1T5WA 1A7PH 3QQ3A 3S35X 3IGAB 3QI9B 5D7JB 4DVRH 2XNAB 2G9HA 5CGTA 4MJ5B 1A6ZB 2C7UA 1FYTE 4BH8B 1D5IL 4JQXA 5FM5M 4IRSB 3RVWC 3NA9H 4XNXH 4TQEH 3N1FC 3QDJD 4I0KA 3NMEA 3UPRB 5KZCB 1O7SA 1K2DA 2GTWB 4JFXB 4JO4L 3HZVA 4KRPB 4NQSB 4BQBA 5D2LA 3T3PF 4CVXA 4WUKL 4G6MH 2PXYA 5DJ8B 4TTGA 1FGNL 4OZIF 1CGTA 3R1GH 4NJ9L 1TJHL 5DA0B 4ZSOB 4ZFGH 2AGJL 4XBGB 1TTUA 3QFJE 2CDGB 4NCDA 5DD0H 3VFWA 4MA8L 4NN5C 1XGTA 4WWKB 3TO2B 2W0KA 4EN3B 4X9GA 2UWEF 4LLWA 4O2FA 1HXYB 1FZMB 4FQLL 2D7MA 4KK5C 1S5IH 3VGEA 2E3VA 2IALB 4G9FA 3FB8B 4XI5D 3AAZA 3VWJC 1JYVA 3TO2A 3FO9B 2J4WL 3OAZK 4OCXL 1GPOL 1LE9A 4M7ZB 4XXCC 3CLFH 4DN4H 1QSEA 3GSNH 2HFGL 5C8JA 1QSFB 4PJIE 4FQPA 5ANME 4Q6IA 2VOTA 5D6DA 3D3VD 1ZVSB 2PETA 4MNQA 2DQTH 1AXSA 3MBEC 1G6RA 1P9MA 3CX2A 1RQ5A 3DI2B 1G9EA 3MACH 3E6HB 5BMFL 2CJUH 5J1TC 1RUML 3MJGX 3MV01 4NNPH 1DEEB 1G9NC 4JFZL 4ENED 1UVQB 2LAAA 3BPCA 4G7VH 2HJKB 5CEZL 5IFJB 2AEQL 2V2WB 4GO6B 1G9MH 4ERSL 1U6AL 4GW5A 1SJHA 5KBNC 4XHJD 3OPZL 4KMQA 2CRMA 1OP9A 5TQ0H 1BF8A 4ZFZB 4OD2A 5IJKC 4MAYA 3WFCL 1S5HB 3NIDE 4NQDD 1HNFA 2NY3B 4Y2DA 4G7YL 4NUJB 2AV1B 4JFFE 1CZ8H 1TZHA 1IAOB 2GUOB 1GXEA 1YN6B 2Y07L 1BFOB 1L6XA 5EC2B 4TVPH 5E5MA 5GJTH 2F54A 5DZNA 3SGDH 4QTHA 3DNKA 3TVMC 1ZV5A 2ADFH 4HF5H 3VH8B 5F3HB 3SDDA 1SVCP 4K8RD 1KLGB 3CNKA 4LPYA 5DURD 4HT1L 1I1YA 1T3FA 4OLZL 4NIKB 1U91B 1Z9MA 3H0TA 3TH4T 1YZZA 1T20A 3KVQA 3BI9X 5E94A 1PQZB 1DANU 3O3EA 4GKNB 3BKJL 3HUJF 4EBQL 3PP4H 4XCFH 5CGMA 5EORL 2DB8A 3BYYA 5FA3A 2J6EH 1R3KA 5F7KC 1FRGL 4MA3A 4OIIH 2HAZA 4BKLB 3PJSA 1Z3GL 1GHFH 4JKKA 2YZ8A 5E56A 4GS7B 1E4XH 3QWRA 3RWJA 4GRWF 4BZ1L 5FYKL 5BZDA 4MDJB 2ESVB 4GXUM 3KAAA 4ALAH 1IGYA 2PTVA 2R29H 4MQXC 2P44B 4BZ2H 1ZHKB 2V9QA 3MRIB 4LRNH 4OBSA 2IMMA 1KSRA 5MEPA 3DECA 5EBWB 4NHCL 5DYOA 4TNVK 1YQ2A 1ERNA 4OZ4B 4PJAA 3O8XC 2NY1B 3ZSTA 3EOAB 2NLJA 3OXRA 5BJTB 1F4XL 5CUSH 3VDBA 3IS0X 3C8KB 2L7UA 1JWMB 2EDFA 3D25B 1G6RL 3H9SE 4E41A 3O4LA 1IAKA 4AJ0A 4X4ME 5BRZE 3H3BC 1X44A 2X4NA 4GAYA 3EOTL 3KPLB 4JO1H 4Z95H 3QEGL 1NFDB 5EN2A 3PWUB 1HYSD 1GOHA 2CSPA 4NZRH 1DQJB 1MVUB 1FO0L 1DANT 1NAMA 4MVBD 4LHUB 4EI5C 3VG9B 4LSPL 3M07A 4J8RA 4ODTH 2ARJA 4FQHB 5CEXB 4XP5H 1QHOA 4NSKA 5A16A 1HQRB 3T0DA 3U79A 4I4WB 2DWEB 5E6YA 3N1MC 3ESUF 3PGDA 1HCFX 1W8NA 5F3HA 2VABA 1FSKB 3C60A 4APQA 3OKDA 4U31A 4CVUA 2UWEA 5IB2A 1QSFA 4L4VD 2ZCKH 4YE4L 2MCPH 2MJWA 3IU4L 4PJ9A 4RQQA 2FHCA 1NBVL 5I1CL 2Z93B 1ZHNA 2E7LC 3ZDXF 5IB4B 4CMHC 2NY5H 3U9UA 4LVHB 4C55A 3LMJH 5E8OB 4KQ3L 3TA3A 4UBDD 4QXWA 4U1MA 2BC4B 4AENB 2DM3A 5CJOH 1SMOA 5A2JH 1HDMB 2G75B 4JQIL 3G9VA 3GUTB 1KTRL 1IC7H 1U8KA 4MAUH 4IIQC 3P3YA 4XPHH 3MZTA 5GISL 2VL4A 3KJ6L 3BUYA 1W0WB 3IFLH 4V2BA 4Z9KB 1JHTA 5DA4A 4AMKH 1Y18A 1NGZB 2V7NB 3PWLB 3PJSB 3D69A 4L8CA 1JNNL 2Z31B 5DUPL 3K2MC 4M6OH 3B2UC 1DL7H 1T80A 4BH7B 3BPOB 5C2BL 2VLKD 3GNMH 4GT7A 1NEZG 3TNNB 4RDQF 1ZLSL 5GRUL 3QFJA 4UIKL 3OTTA 4JY5H 1URLA 1FFOA 2ZSWB 5IHUH 4PRDA 1LO5A 4X8JB 1CLOL 5IR1B 1AO7A 4WW2B 4NQCB 1BZ7B 3EW3B 1OF2B 1NC4A 3SDDB 3T4AB 3CXHJ 1JCKA 3E8UL 1ND0B 1OGTB 1IT9H 3STZB 2HFEA 2W92A 1N0XL 4MQSB 4LSTL 1A7OH 4YGVA 3RPIA 4G5ZL 3BUTA 3ROOA 1F4AA 5DSCA 3QG6A 2OI9C 4JRXB 5ADOH 2YD6A 4LIQE 3WBDA 3BKCH 3I6KB 2HG5A 4UQ3A 1IL1B 3PL6C 2A38A 1Q9LA 1S9XB 4PGEA 3T0WA 1BD2B 4M6NH 4JDTL 3OG6B 1OTTC 3K4DA 3MV9D 5EZIH 3DXAB 43CAA 3KPQA 3SY0A 5FO7B 3MRJA 5JTWA 2X4UB 5C6TH 1JTOA 5D2LB 3C60B 2NXYB 1WCQA 2ZCHL 4RGNC 3DVNA 4F80A 4Z7WE 5KVGH 1KGCE 4S1DC 4PG2C 4ODHL 1SY6H 2OL3L 2O61B 4WUUD 4U1LA 1QP1A 1DQMH 4I3GA 4F9LA 5IUSA 4LARH 2IANE 5DD1L 4Y8AA 3QUYA 3GMPB 5TE4H 3X14A 1XGYH 4QY8B 1E6JL 4M1GH 4OFYA 4I18C 3Q0HA 4JAMA 2FLRT 3TZVC 5IIEA 5I1GL 4EDWH 4HWEL 3VD3A 2VH5L 3UZQA 1H3GA 5FOBA 3O6ML 4LMQI 1VERA 4Y5VB 5D96C 4ZS7L 1NPUA 2YSSB 3I6LD 3O6FC 2EEBA 2IBGA 5C0JA 4BKLA 4DOHE 1E4WL 1UWEH 3PWVA 4F58H 4FOMA 4RGMB 3BE1L 3HMXH 2BHZA 3ULUC 3CAFA 1B6UA 5HDBF 3FN0L 3GIZL 4WHDA 3C2AH 2VXVL 3QNXA 2GK2A 4YHNA 3MNZB 1EAPA 1U3ZA 4NWUH 5C09D 5IM7B 5CWSA 2GITA 3MLXH 3NZHL 2ESVA 4WNQB 3ALPA 1CF8L 4LIQH 4BSVB 5ALCL 1ZHLB 3KPMB 3VRIB 1UB5B 4L8BB 5ERWB 3DXAD 2YKLL 1XH3B 4Y16C 4XZUB 1A6VH 3SO3C 2VE6A 2QTEA 3O41B 4ELMF 4P2OB 5FO7A 2MHAB 5KSUB 3O11A 3D18A 8FABA 1Y6NR 4IRZH 1AGBA 1XF2A 4NQSA 5DEZA 4JHAL 3ILPA 2X70A 3TCLB 3VW3L 2C9AA 3TT3H 3ZE1F 1A64A 3AB0C 3W11C 4U6YB 1IAOA 2FCBA 1A9BB 1UXWA 5L9DL 5J12C 1ZA6B 1YQVH 4HQQL 2BOBA 3QO0A 5GRZA 3LKQA 5JDJA 2Z93A 3WUWB 3FT3A 2EDLA 4IOIA 3TV3H 2YA0A 3LQMA 3EUUA 3PQYA 4BFIB 1TNNA 4M93C 3WIIL 3I75A 4NHUA 4PD4K 3PDOB 1INDL 4OCSH 1A7RH 3QDHA 2VABB 4Y4KD 2IPUG 1D5XB 1JNHB 3UYRH 4D0DB 1R6VA 2XICA 3QDMB 3GBNL 3U0TB 4ZFOA 5DC4B 5DHYA 3SDYH 5CBEB 1CQKA 3MLPA 2ZUQB 5I1HL 3B83A 5EIVA 4IJ3C 4XP4L 3NACL 1S7UB 3V2AR 4K2UL 3VJ6A 4RMRA 1MRDH 4XNQB 1WFTA 1SJHB 4MA1C 4L4TD 3RZCA 1H3PL 3D69B 3TO4C 3BRGC 2ZUYA 1Q0YL 3RJQB 5FECB 4A6YB 4FQLH 4Q74A 4LAQL 3SGKC 4IMKA 3AC0A 5C0CD 4H8WL 5C0AE 4Y1AA 5BV7H 4G9FB 4HGMA 5F71A 4Q9CA 1LK3H 4OM0H 1HEZA 2M26A 4UOW0 1E6OL 1GGTA 5JW4M 4P46B 1MFEL 1WC7B 4KHXH 5EU5A 4CN4A 1WLHA 2HFEB 4MSWA 3VXRE 4DN4L 2DI9A 5GS1C 3K3QA 5KVDL 3WKMH 1L9NA 5HHVL 1VEPA 2E5EA 3VI4F 3SE8L 1ADQA 3AREA 2HYMA 1NC4B 1OF2A 3QI9C 4Y19E 5D7JC 5F96L 5L88H 2P42B 5K9JH 3QO0B 4Z7OE 2R1YA 4LQFH 4NBYB 4DZ8A 1D5MB 3UTTB 3NIGF 3DWTA 2X89A 3U4AA 1U95B 4UMGA 5D71L 5DMKA 5BMFH 2X70B 2XYCA 3TCLA 4DFIA 4JRYD 4GQPH 1WQVT 3SGJC 1PW3A 3UTSD 1UACL 4YHKH 2B39A 1NMCC 1JGVH 1NLDL 4J1UA 1G7QA 4F37F 5EU6B 4GFTB 2BXZA 4EN3A 4PJEB 5ADPH 3L3GB 2XTJD 4RGOL 1ZOXA 3BWAA 2WWKO 3QEQD 1M7XA 1WK0A 5HGAA 5KVEH 4ISVB 3D48R 5KN5A 4KRNA 3U36A 5FYJU 2LU3A 5CP3H 3WFDL 4PGCB 3GI8L 4ODSH 4LSVH 3RVVD 5IMMB 2Y07H 1X5AA 2BOCA 2YXFA 4OD3H 3QWRD 4G6JL 3K74B 3JV0A 1BBJB 1MI5A 1CU4H 1W0VA 2ED8A 3DV6A 3IJYA 3HLAA 4ONFH 3LS4L 5KJRL 1JYNA 1JN6A 2W9LA 4PJIF 5D7SL 5FHAH 4OLUL 3RWGB 1RFDH 4XAKE 2ZSVB 5IB4A 2WNGA 3P4MA 3FQWB 2JJTC 2YUXA 4YWGH 2GKIA 3PDDA 3RUGE 4IRSA 4NQDB 3VXQA 1VGKA 4MS8C 5HYQA 3CMOL 4YFDB 2COQA 4OTXH 3GMNB 3CZFA 4NKMB 5DWUL 4RSVA 4FQCL 1S7TB 4QYOB 4EBQH 1N6VA 3E0GA 3WSQL 1A02N 4V2CB 4LHUG 5HHXL 4ZNCD 1A5FL 5LWYH 4WI5A 1BJ1J 2OTPA 3HAEB 4PS4H 2D4DA 2ZUXA 2XPGA 1IC5H 4G6KL 3LB6C 2OXGA 3RY5A 5TE7L 2X4NB 3CFKB 2X2YA 5GS0H 3BDBA 1A2YA 2XN9A 2AJVH 2GFBA 4YDVA 3SO5A 2H41A 3LQAC 1CBVH 4X83A 4FABL 1FG9C 3QEQE 4M9PA 4P48A 3STBA 4GBXA 5EU7E 4YHPA 4QRQA 1AP2B 1KJ2B 3S5LG 4AEIH 4ZPTA 3BZ4A 5ESAB 5CFHA 4AZ8A 1MHPL 5BVPL 1P6FA 1VFMA 2R1XA 1CFNB 4N90D 4H25B 1C16B 3TFKD 3QFDA 1LD9A 4LCWB 4UT6L 3WD5L 3MRKA 2X1OA 2VDLL 1IZKA 3I6KA 1IC1A 4P46C 3AS3A 2R9HD 3KXFA 1S9VA 4OM1H 4OI7A 3BKML 5I8EA 4Y4FC 3WO4B 5A2FA 1XF4B 4XNMA 4XAKD 2VLRB 1U8OB 4IBLT 2X09A 5F1IA 3SDXE 1PAMA 4FQQB 3GGWB 4QRRA 1OARL 4YIQA 1OAXH 3HTLX 1MWAH 4FP8L 4NQDE 3X13B 4LPCA 1QSZA 2D9CA 3I02B 5I1DA 1V8HA 2NY4C 3GBML 3K8MA 1YNKH 4QXTB 4XAWL 4NO0A 5SV3A 1YMHB 3UC0L 2R8SL 3H0TB 2AJ3B 5DHVA 1E4XI 2DD8L 1JHKH 5I75C 2J2ZA 4P4RB 4C56B 3ULUE 3DX7B 3UDWC 4U1LB 2F54E 3QQ9C 1EHAA 5DD6B 4CU8A 2VDPH 1HINH 4DUXA 3QUZB 4A2LA 4QHNA 5I1CH 2V5MA 3MRGB 2AJZA 1DUYB 4JO3L 3MRHB 1JP5A 1VGEH 3UTSA 1EEUA 3NABH 2H1PH 1RZFL 2X1XR 2VO5A 4L4TA 3RZCD 3S36H 2VUOA 3MCKA 4G8FA 4JQIH 2FWOB 4LLYA 2R0LH 3S6CA 1DUZB 3G5XA 1DLHB 1RZKL 32C2B 3UBXA 4WCYH 1T1XB 2D2OA 1JPFB 1FORL 1OAQL 4L9LA 1IMHC 4K9EH 1INEL 5JQ6L 2Q86A 2OJEB 4L3CA 5ERWA 1W0YT 1C5BH 3FT3B 4N0CC 1H3UA 3QUMH 1F3DJ 4YZFF 5GRVL 5A2KH 3MRNB 2EYSA 4WENB 5LAXB 5LCVH 4C57C 3FZUD 4DWHA 3PNWA 4TVPD 4HPYH 1KN4H 1D5ZB 1Q38A 4LLUA 4JB9L 5L7XH 4NM8L 1MIEH 4JO4H 2NYYC 1P9MC 2WBKA 2A2QT 5DHVB 1FZJA 2ADIA 4FQJL 4J3XA 5K9QI 3WIFA 4H20H 1XIWA 4E5XA 4JZOA 3UJJL 1F3JB 4FG6D 1J86A 2A6IB 2PO6B 4BK5A 1CDUA 2QL1A 2CXKA 3QH3A 3N85H 3OR7B 1DVFC 4OFKA 1EO8L 5DQJA 4D9LL 3O4LD 4MA8H 3GSXA 3BGAA 1EEZB 3RVXC 3BVNA 3WDHA 4LSSH 5ACLA 1DVFA 3V6OC 4WHYH 2Q20A 1MH5A 4JFEA 1C08A 1BECA 5D8JH 3ROLA 3D87B 2FH6A 1J7VR 5DQJB 1G9MC 3ARGA 2ORBH 4R2GD 3NVQA 3D39B 2DTSA 4YAQB 4HHAB 4OBRA 3X11B 3BN9D 4HEME 4JM2A 2PW1B 3CXDH 4PJBE 4PTTB 3EAKA 5JUEL 4JPIA 1T0MB 4KRLB 3SDAC 4G8IB 4R0LC 1MQKL 1GOFA 3MLSH 4U1GC 5BV7B 3VGFA 3KPNB 4QOKB 4NZTH 3DX6B 4FQHA 3L95B 1F6LL 2AXGB 2F53B 3OKEA 1CR9H 3O6MH 3V0AC 4DTGH 1J8HD 2C3VB 5C3LD 5JA8B 1EAJA 1M7DB 1KCUH 4QTHB 5FYJH 5J13B 2RFXB 3L3OA 2WINB 1VESA 3F12B 4OZHB 4I2XA 3I9GH 5DJZA 4NQCA 5C6PB 4LLDB 1LO4H 2Y23A 4LEOA 1N7ML 1RIUL 2YOCA 3C2AL 3FQTB 4HUUB 2UYLA 1FZOB 3EYQD 1PY4A 1YNTA 4C54A 5JR1H 4NWUL 3RAJH 3WFHA 4P23D 3JTTB 4RAHA 1XFPA 4YHZH 3MV8B 5DS8B 5IOPA 1EX0A 1MHEB 1BFSA 2WLZA 4XCYA 1HHKA 2BRQA 5I19L 4IOSD 3AMLA 2VE6B 5DDHA 4U6XB 3V95A 1HIMH 5IEHB 4ISVA 4MDJA 2VLJB 3MV11 1MRCH 3ARBB 3ZE2F 4D0BA 4I0PC 1WCBA 2HLAA 3CFJB 3QHFH 4OZFB 5IMMA 3LHPL 4MA3B 5GZOD 2ZSWA 4KRPD 4PREB 5H35A 4DEPC 1BQUA 5SWSB 3K1KC 5D4QA 5E24E 4QHMA 1ED3A 4KVCL 3DX7A 4S1QL 1IGMH 2HRPH 3L3KA 4Y1AD 2DQCL 1OAUH 2BSTB 4HXBH 4IRJB 5E8EB 3LN4A 3UJTL 3OWEA 4G42B 4NQTA 1J0YA 3D9AH 4O4YL 3G08A 3C5SA 4PB0L 3RDTA 4IS6A 1BGXL 5JIIA 1V3JA 3BGMB 2JIXB 3TYFA 3O4LE 1M7DA 5T1LB 5EG6C 1GHFL 3L5WB 1DZBA 3TPUA 4PJHB 4N0FB 1QOKA 4P46A 1T21B 3FQRB 3PDGA 1WWAX 1A7QH 4JN2A 3NACH 3OKKB 5HY9A 4Y4HA 2R0KH 4JFHE 3ZDYE 1XIWD 5EB9A 2DQFB 2AV1A 4ZSOA 3DMMD 1LDSA 3TO4B 3BP4B 1NFDA 3JUYA 5J6HA 4YDVB 3DTXA 4CMMB 1P4IH 1OTUC 1I1FB 3QUKA 3BW9A 2V2TA 3PGFH 4UZGA 5F7HA 3DX9A 4KHXL 4MWFA 3P4OA 2ADJA 2XTLA 4G80A 5F6HJ 3KHOA 3QEGH 3O3UN 2Q6WB 1KELL 1UC6A 3T1WA 3TEUA 4XC3L 2FX8H 1FO0H 4QXTA 2I24N 3FOLB 1UQSA 5DK2A 1TNMA 2Y06H 3RVXD 4C58B 4ODWA 5KVFL 2DTML 5GS2D 6CGTA 1Z6JT 3MROB 2NX5B 1G0YR 4NFCA 4P2QA 2A9MH 3BMVA 3NZ8A 2ED9A 5MENA 1UH4A 4DVBA 2F53D 2J8UA 3MRRA 4UQ2A 4O02H 4JHWH 3LMJL 4QOKD 4R4BA 1G7HA 3ULSB 1IFHH 4M8VA 4KQ3H 1T4KB 4ORZC 4WUUB 3HRZB 1QFWH 4QRPD 1LE5A 1IQWL 1NANI 4RRPG 5TQ2H 3IDJB 5HGDA 3LKRA 1TMCB 4LSVL 5ID0B 3L6FB 3K2UL 4Z7UF 3FT2A 4HXAH 5EH1A 4KVNL 4K9EC 3VI4E 3DTXB 1B9ZA 1PBYA 4OLVL 1PKQB 2L7JA 4JM2D 4OIBA 1RUKL 2XPGB 3O3DB 2DBLL 4OFPA 2FYYA 4GJTB 4KMLB 3ARPA 1FDLH 1NDMA 3LPWA 2IH3B 2X4TB 5BZWA 2BK8A 4JY5L 1HHGA 4F7CA 5CJ5A 1FQ9C 2EDYA 3VFUB 3QCUH 4MAYB 4EQ3A 5HI5C 1NBYB 5DJXB 3TIEB 1QSEE 15C8L 1TZGH 2YC1A 3VRLE 3SDCC 5IIEB 1NMBL 4OKVB 5CBAA 2A77H 2BNQD 1Q9OB 1IT9L 3HS0A 4PS4L 5HGHB 4ONGL 3RVVC 2OI9B 2JJUA 5K9KA 4P2QE 5FV2A 4JZNB 1KTLB 2Z92B 5SWQB 1LK2B 4LLQB 1BBJA 4Z0XB 4P0DA 5F9DC 4TVSa 1GGCL 3GGWA 4QRRB 5CAYB 5BO1H 1UADC 5KSAB 2FBOJ 4XNQA 1F4YL 1I3GH 1S9XA 1MRFH 3GEWB 5I76B 3DUUB 5HGAB 1KTLA 2Z92A 5SWQA 3BPCB 1N6QL 4JG0L 1D6EB 1GGBL 1MCOL 5D2LE 1G7JA 3FO1B 5DHYB 5IROC 4XPFH 1MHEA 4BA8A 1IGFH 1H3TA 1G6RB 2P24B 3MLWH 4KJQC 2OQJB 3FJTA 3CU1A 4WU7B 4MNQB 3MBXL 4E42B 1WIPA 1NCWH 3JSSA 3MGTA 3MRMB 1QFUL 3LEXB 1W2KT 4P5KA 5C92A 1P53A 3MLVL 1KJ3L 3TYGH 1W72B 1EBAA 1TETH 3OKKA 4JFPB 3GO1L 4Y5XC 4AT6A 1RSFA 4AIOA 4F7CB 2GYSA 5CHNB 4DGYL 1ZTXH 1IGTB 5E8EA 1WAAA 1X3DA 2Z0BA 3I2CH 5M94B 3RNQA 5B38G 1OGTA 1OOAA 2EXWD 3ILPB 3KLHD 3MV7A 1MHCA 1MLBB 3ZTNL 4XBPB 1J9CT 3CFEB 1CK0H 1WJ3A 4AL8H 1GGIH 2PR4H 1KPUA 2H8PA 2XQBL 3DX6A 4JHZA 1GCFA 4KFZC 4NZUH 1XH3A 4EJ1C 2EC9T 2YRPA 1JVKA 1DQQA 1A0QL 3FCTB 3G5YA 1ODAA 4X6EA 1HHHB 4OV5A 1IAIM 1BZ9B 2UZIH 1OM3H 1XF1A 5CILL 3SKOB 1DBBH 3VH8A 1JRHI 4FZEL 2VQ1A 1KBGL 4YHOL 2H45A 1KIRA 3QIBC 4TSAL 3LKSB 1IGIL 1IILE 1JI1A 4U1IB 3KS0J 1W8OA 2BCKB 5GS3A 3SKJH 5DZLA 4K9EL 1T4KA 4XTRC 4DKDC 3HC4L 3QDGD 1UM5H 2BVOA 1I8IA 2FRGP 2Z35A 5EDXA 3W9DA 2P8MA 3LY6A 2OZ4L 5GRXG 3QUML 4PJ7B 2P47B 4NO3A 1Q1JL 3FQXB 4PGCA 1M7IA 4FMKA 2EH7H 4P49A 2B2XH 1G7LB 4TPRL 4BM7A 1T2QH 3SKNB 1JV5A 1N26A 4HUMB 4ZPVB 1UXWB 1INDH 4OCSL 4TYUA 4YR6A 3EJZD 1S9WA 4PRAA 43C9A 1MIEL 4CUCA 2HKHH 3OKMA 5I66B 3UYRL 3G6DH 1NCBL 2VAJA 5D1QD 4EDXB 4N0UE 1NGYB 1BPVA 3QB7C 2R0ZH 1YEDA 3KDMA 4HIIA 3X11A 5B38B 4X5LA 3OKLA 4HW6A 4LCCA 1B3JA 2Q3AA 1D5MA 3H6JA 3D25A 2IGFH 4QXGL 5F9OL 1T0MA 1UENA 2BVQB 3BPNB 1YN7A 2SEBB 2O93L 3VXPB 3S96B 5C08B 3QUXB 4GAYB 1EEZA 3X12B 3CDGB 1DBKL 4WUUE 4P3DA 5K9OA 4PJBA 3UPCA 2EEDA 3DARA 4LAQH 2GK0A 1L0XA 1U3YA 3U46A 3ARTA 2I9LB 1PSKH 5EIIB 4LMQE 2FWOA 2VL5A 4LLYB 4HFUH 5I2IB 1ND0A 2HJFA 3ZL4H 3AU1B 2EECA 1MFEH 1I9IH 2VXTH 5BVJA 2OL3B 4PTUB 4WO4D 4XVSL 4F3FB 5I0ZA 3MUHL 3IDMA 1JFQH 4TOYL 4FHBD 4X4ZA 1YECH 2R15A 4KKCD 2VSCA 3P0VH 3MZGB 3MJ8B 1E0OB 1NGQL 5HVGB 1HKLH 1NAMH 4U0RB 5C9KA 1AGCA 1JNLH 2XTJB 4L4TE 3LD8C 1TJHH 4X6BB 4M61B 2EYSB 3LAFA 2Z31A 5ILTL 4B0MM 1EFXA 1MLCA 5CJBA 5DMIH 3SQBA 2NY2D 3BGFB 3OJVC 4U2ZA 2BVPB 5M7QA 1AGCB 3VXOB 3QFJB 3GB7A 2A6KA 4WTZG 3PABB 5TH2A 2LTQC 4NGHH 5JXEA 3GDBA 3GMOB 1QSVA 2DLTA 4XI5C 4FQQA 5ADPL 2VDRL 1JE6A 4Z77A 1U91A 4PRPD 5KVEL 2EDQA 4HDIB 1NGZA 2V7NA 1I9RL 3KPSA 1KFAL 2DDQH 32C2A 4N8VG 3UBXB 5JMRA 3LEXA 5HI3D 3SOBH 1S7WB 1UWXH 4U6HB 4L9LB 3MRBB 1CU4L 4U1SB 5KOVC 5C0EA 3PL6D 3PWPA 3HE6B 2QHLA 2D7PA 5LJYH 4OLWL 5AD0A 3BZ4B 3CFBA 5ESAA 1K4CA 1MRCL 3U7WH 1I7ZA 1IM9D 1RFDL 3W81A 5EC2A 5EO0B 2CQVA 1D6EA 4KAQL 3KG5A 3DSFH 1RZGB 2I60L 1MCWM 3VXUA 5I1KL 3P4NB 4QRUB 3HNVL 3MODH 2GY7B 4HC1H 5E4IA 3QDMD 1RJYA 3H9HB 3LRHA 2BSSA 3WXWL 2P5WB 4KKAC 5DJ0B 5D9SA 4KKCC 5GRJH 2R69L 4OTXL 5DWUH 3LS5H 1C12A 2GT9A 4PJHF 4XB7A 5GS1A 5J7CC 2W9DL 4ZG1A 3O9WC 4OQTA 3G6JF 4W6XB 4FFWC 4RZCA 1CZ8L 1VADB 2RCSH 2OM5A 3IDMB 1U8OA 4DN3H 3DROA 4J8RB 5DVKA 5C0BE 3CLEH 5FM4A 3UJIH 1HN1A 3K8LA 2R0WL 4HFWB 5FM8A 4AYFA 1PGRB 3RX5A 2AJVL 5I1AB 4LCIL 2RGSA 1XIWC 4NJAL 1I75A 1J1OH 1EVUA 3VGDA 2AS5M 2N4IA 4Q7DA 3QZWG 3ZE1E 2AJUH 3I3DA 1RVFL 4HBCL 2BVOB 4ZDHB 1DP0A 1MY5A 1NKOA 2PCPA 3OR7A 4LGSB 4X6DF 4XVTH 5T3XH 4AEIL 2IF7A 3SJVD 2P5ED 3FO9A 2A6DB 1JN6B 5E8OA 1RAMA 3MRKB 2Q8AL 1YNLL 1C7TA 2V9RA 5I15L 4ZDHA 3UMTA 3HPJA 5GS2H 3GFUA 4NKDA 1T1WB 2X05A 2WQ8A 1SBSL 4PY7A 2VIRA 4ZUWB 3RRQA 3G5ZB 2BY1A 3OGOE 5C08A 1KCSL 1PEWA 1TVDA 3ZO0A 3OB0K 2HTLC 4MQTB 3OJDA 1J8HA 3DURB 5EU6D 4CRPA 1FL6A 2QV2A 4LRIA 4IDJH 3GSWB 1TIUA 4PJGE 2H9GB 3ZKMC 1Y0LB 4HAGA 3UROR 2XRAL 5IBTL 5IBUG 5F3BA 3HI6L 5I1JH 4XAWH 4LSRL 4JZJA 3U0WH 3SDDC 5D7IB 3QDJA 2XKUA 5ITFA 3VDAA 4Z78B 5TDNB 1F4XH 5F9JB 4C4KT 3V4UL 4WJ5B 1RJYB 1F4WH 4NDMB 1R5WB 2B4CC 2NX5D 1LO5B 3HI1B 2E27H 2FJFA 4U1NA 3NFNA 1YN6A 1PG7L 3VFGH 2NTFA 4JPKL 5SX5H 3X17A 4XMPL 2IH1B 12E8H 2DMBA 5D72L 1KNOB 3H9SB 1QFWL 5A3ID 4H1LG 1KPVB 4KKNA 3EO9L 4NP4L 4HV8A 5B21A 3I6GB 4CDGC 4NZRL 5JZ7C 3B6SB 5JPMA 1WZLA 1WF5A 3WHE1 2F5BH 1ZMYA 1P7HL 4NRZB 3MXVH 4QLRA 2YEZA 2H32A 1RZKC 3OKOB 4OZIE 1CGUA 4GW1A 4KI5F 5KS9B 2BFVL 4AEFA 4Y1AE 1WEJH 1C5BL 4XRCA 1CDIA 5EUOF 3CFCH 1YEJH 3VXOA 3V4PL 1DQDL 5AG9A 2HRLA 4P5MB 1M6OA 1SYVA 4TSCL 4JDZB 3TZVB 3IB4A 1JF6A 5LCVL 5I71C 3S35L 4HPYL 5EU7C 4JM2F 1TZGL 3GMLB 3PHQA 1YMHA 1N59A 4YC2B 4N0FA 3WXVL 1EPFA 4XXDA 5ISZD 2R2EB 3Q5YA 3AAZB 3QIUC 4YIQB 5IVOA 3SDDD 2GW5A 3FB6A 2NY6B 4YGAB 2MQ3A 4OI9A 4P3CL 3FKUS 1ZGLA 2UY7A 3Q6FB 2BSTA 4Y1AB 1F5WA 1I3RA 4MD5A 3FL7A 35C8H 2W0FB 5H37H 3UAJC 4ZO7A 2WSKA 3TBWA 3FRUA 1ZLUH 4FQXC 1MCKA 1T5XA 1XZ0B 5ACMA 4EUPH 3V6OE 2R1WB 4GXUN 3M17A 1Q0XL 3PL6B 4M5YL 4ZPTB 1NC2D 5D8JL 1GGBH 1MCOH 3B8SA 4M4PA 1KB5B 4ZO8A 5D5ME 1F45A 2HJLA 2JJVA 3NIFF 1CLOH 5K33A 3GHEL 3CXDL 3O2DH 3UPRA 3MBXH 3EOAA 1QFUH 2CK2A 4WGWB 2WM0A 1MELA 3VFVA 2NY2C 4K3JH 4MXQD 1L7IL 1UG9A 3KR3L 4BH8A 3GO1H 1I4FA 5T1KA 1FZOA 5H37G 5D1ZA 1L4IA 2Y7QA 1HZHH 1OSZB 2EC8A 4X5WB 5TPWL 2BRRL 2HWZL 4GXVH 3MLUL 2J88L 3VFUA 1KLUA 3P4MB 2CLVA 1RZIA 2NNAA 1LE9B 5IQ9B 3QUMA 3DHMA 4LBEA 4E0RB 2PR4L 1R3KB 5D1XC 4RFEB 5EZOL 5BS0B 3ULVE 4PGDA 5CZKA 4K71B 4ZQKB 2P8MB 5EA0H 4NN7B 4OCYL 4RNRA 3SBWA 4PJFB 3SGJA 5INCB 1K5NB 2VITB 1FV1B 1Q94B 3REWB 4D9RE 2H32H 1BQLH 3OJDB 3ARWA 4ETQA 3V6ZB 4Q2ZB 4LAJH 3MV9E 3MYJB 3FQUB 4YHOH 3BOVA 4GMTH 3UTQB 3DXAA 2HT4C 4HGKC 4PJ9C 4HHAA 3WL9A 1R24A 4HGWB 5GGSY 3BD4A 3FO2A 4N9OB 1R3IH 3L3IB 4I18A 4XWOD 4Y4KC 4ZUUA 5LQBH 1FNSH 2VDML 4TVPE 4ZS7H 1A4KB 4JDVB 1DVFB 4NNPL 5EBLA 3F7VA 3ARDC 5C2UB 5HY9B 3EO0A 1TZHB 1NBZB 1Q1JH 3NCYS 3Q5TA 2ZZUT 1QRNE 5I71B 3FN3A 5CEZH 3GSNA 3OAYK 1MVFA 4IMKC 4M8QB 3EYOB 4KVCH 4XNXL 1KG0B 4TPRH 1C5DB 3STZA 4FG6C 2WWMD 1TVBB 3EJZC 2DYPA 4C83B 2GTZB 1ULVA 4PP2A 4AM0B 3D9AL 5IKCB 1OT2A 3DYOA 2YSSA 1RZIB 3VWKA 4DW2H 3CFDA 2CMRH 1HSBB 1DBJH 4GH7B 4JDZA 1J18A 5GJTL 4MWFB 3TZVA 4WUKH 1J1PL 5LXGH 1U2CA 3B9KC 3ETBF 4B5EA 5A2IH 1OHQA 3WNKA 3D1MC 1C12B 2GT9B 1I1FA 3GJFK 3QUKB 3SDAA 4N5EC 3WLWC 4L4VE 2WUBH 1MUJA 2IMNA 3KPQB 3SY0B 3QDGB 1XR8A 3WCYA 4PG2A 3D85B 4G6AD 1CVRA 1DBKH 3STLA 1H5BA 1BFVH 3A67H 4UOJA 3IU3B 4JY4B 4M5ZH 5IEHA 4LCCC 2J1KA 1SM3L 5GRVK 5HHOB 3EYQC 1ORSA 1QLFB 2HT3D 3AUVA 2D03H 3MV8A 4Z0XA 1PYWB 2OTUA 2I9TA 4UQ3B 4PV9A 1KENH 1CLCA 3REVB 4XC3H 5LGJB 5DMGD 1S7QB 4HIJA 2ZG3A 4O5LH 4X0KB 5EOCH 2DQJH 3KPSB 2K9UA 3IKKA 4PJXF 5E2UL 4IHOA 5SWZE 3RNKB 2NZ9C 2YPLB 4I3RH 5D7IA 4HWUA 4NUGH 4HLJA 4Q97A 1P7QD 4QHNB 2QQKL 2J8HA 3BGMA 3KPOA 3ECBA 1FL5B 1DCLA 2FECL 3L7EA 5DMIL 2WBJC 4DEPB 1SEQL 4HH9B 3MQIA 3VFVB 2H9GA 4TUJA 4LQ1A 5CUSL 1UYWL 2FSEA 1ZE3C 1EEQA 4NWTH 2I5YH 3QXAB 1IKFL 3MJ9H 3A6OA 3MOQA 1CICA 2P7TA 3SJVE 4S1RH 3VRJB 4HX1B 2DS4A 4ZS6C 3WFCH 4JO2L 5SX4I 3SEPA 2XWTA 2ZG1A 1C7SA 2DDQL 3VH8G 2G9HB 2MHAA 2PYEE 1AGEA 1QQDA 4XPBH 4NT6A 4WO4B 4MA7L 5IB5B 4FTVE 1UJ3A 3O4LB 3ESVF 4P23C 5DS8A 1INQA 3SE8H 5MI0B 2XFXB 2YPVH 3EIFA 4NNXA 5K9JL 4OLYL 4Y88A 5DO2D 4D9QD 1FNGA 1S9VB 3CPLB 4WW1A 3WHXA 2EICA 5DDHB 5C0CE 3G9AB 4WV1A 1U8KB 3TBSA 3I6GA 2OR9L 3H7BB 4G8GE 4I2XB 2ILLA 1UZ8A 4WFFD 4JKPL 1UACH 2BC4A 1T04B 4AENA 4L8SC 2VDNL 1G6VK 4HC1L 4YDIH 4Y4KA 2IH1A 5C0GA 2NYYD 2QQLL 4APQB 4X4XB 4K7PL 1OTUD 5A40E 3IU4H 4YHPB 5DFTA 2NXYC 1UH3A 4XGZB 1MJ7H 2K7QA 5JIHA 3X14B 1XR9A 3DO3A 3C5ZA 1A6AA 3INUH 4APQC 2EXYC 5IB2B 4N9GA 3VGHA 3L7FA 4LKCA 4NPYB 5EORH 2RBLA 3WLBA 4UU9A 2BMKB 2GSGB 1YEEL 1KTKE 2VXUL 3ZDZF 3QI9D 4K3DH 5D7JD 2IAMC 3MMEA 4IOFC 4KV5E 4N8PA 3S37H 5I66A 4TULL 1EO5A 2R0WH 4JREC 1UM4H 5IVXE 1E4XL 4FQXD 4XRCB 3LH2H 3IFLL 1EHLH 5KJRH 8CGTA 1I7UA 5DUML 4WY7H 3OX8A 3GZKA 3MCG1 3C08L 4OT1L 5C0BB 1JNNH 4YWGL 3A6CL 1CTOA 1P4BL 4QCIB 1EVTC 2H3NA 3DHJA 5FIEA 1E4KA 3BDYL 1PG7X 2PXYC 1NGXA 3BP4A 4MLIA 2P5EA 4FS0A 5JW4Q 1ZHKA 4XPFL 3HG1D 4PRNB 4NKOA 3WIHL 3WHXB 5E99H 5CJQH 1D5BA 3TM6A 1I85C 2IEPA 3RP1A 5T1DL 5C09B 1RI8A 3K46A 3OQ3B 3QQ9D 3FQRA 1KB5H 4G6KH 1KUMA 3QUZD 1YUHA 5EU3A 1L6ZA 1N64H 3ZDYF 5DQ9B 2HMID 1HKFA 5IBTH 2APXA 2HTKC 3I2CL 3PP3K 1P1ZB 2F15A 3I50L 5C6WH 1DEDA 2DMKA 5HDQL 4OQTH 1CK0L 2KZWA 4JRYB 3KPSD 1EJOH 2F19L 3DURA 4YE4H 1JWSB 4PRPE 5EOQH 1JGEB 4GLRH 3QHZH 4XPTH 2FX7L 3UTZA 1NC2A 1PD6A 4UT6H 3RIAK 4HKZA 2V2XA 1T7XA 4LF3A 1B2WH 3ARFA 4AIZA 3MLZH 5CP7B 1K6QH 2VLRA 2HLAB 3CFJA 1DLFL 4OZFA 2HP4A 4PJ8B 4LCWE 3PGCB 5FF6B 4L8CB 5KVMC 4DCQA 4WO4C 1XGQA 3MV9A 1OAYL 2MKWA 1FLRL 3BSZL 4RMTA 2BXYA 4PGJA 3L3HB 4UV7L 2NMSA 3FB8A 3BUYB 4PP1D 4LCWD 3PWNB 4S10A 3MLTB 1I7ZB 2OTWA 3OKNB 2I9TB 2F5BL 5IQ7H 4MQ7B 3TGXA 4S1DD 3IJSB 2IQAB 2ZOKB 4P3DB 1EZVY 3RUGA 3HG1E 5F7EH 1N5AB 3OGCB 3GBMH 1J0HA 4U1MB 4PGZA 4HJGA 4H26A 3RL2B 3FB5A 2QSCL 2SEBA 3QAZC 3EFDH 4KUCD 4XXCA 5L0QC 3VCLB 2KDGA 1IC4L 5FO9B 1FNHA 4NC1E 1RK1A 1QA9A 4Y5XA 3U30B 2FIKA 1JZ8A 4JFFD 5DRNA 2YRLA 1EK3A 3VG0H 4FTVA 2BNRE 3CX5K 3X13A 4N0YL 2J12B 3HZVB 2P43B 5GS1B 3TVMD 1K2DB 3L95A 1OL0A 3WXVH 2C4FT 2FB4H 3S36L 1NCBH 2LQRA 4NSKB 5EUOB 5DRNB 3MBEA 4Y4FD 4HH8A 4WI2A 4JGUA 2ERJB 4NN6C 1XGRA 1ZAGA 4JVWA 5F7DB 1KLFA 3G04B 4NRYA 3KYMA 3QI9A 5D7JA 1C5DA 1U2HA 5CD3B 1BREA 2OL3A 4PTUA 3SKMB 3VXMA 4PGBB 3U6RB 4MX7A 3MNWA 2ATKA 3KXFB 2YD4A 4NC1C 4M5YH 1U42A 2IALA 3HZMB 4FRWA 5JNYB 5C71A 1U8PA 4H8WC 2VZTA 2ZUQC 1U3HC 2GIYA 1FH5H 4X6CA 3VXRA 1UJ3B 2HH0H 3BD3A 5KSUA 5H94B 2M2DA 5IVXA 1M1SA 3MRIA 1T0NB 3UTQA 1KJ2A 3ALWA 5CSGA 2VXTL 4XCNA 3LIZH 3ZKQD 4F33B 1OB1B 5ID0A 3WEXB 5TE4L 1XAUA 1YECL 2FH8A 3QIWA 3QEHB 3QIUD 1B90A 1HKLL 1OP3H 2KZ1B 2X7LB 1UEYA 3H9ZA 4KROC 4GAJL 3T4YA 4R4BB 4XP4H 1MQ8A 5IBLD 4NKQB 3MGOB 3TBVA 1P7KA 2BRRH 5HI5D 4EDXA 2Q7NA 1B4RA 1CGVA 1EEYA 4OGXH 1SQ2N 3RNQB 5ELIA 4MAYC 3BQUD 3BISA 3MFFB 2XA8L 5F8QC 3L3DA 3R8QA 2OLDA 4D0CB 2A73B 4ZO6A 4ESKA 2EYTA 4KK6C 2VDRH 1YJDH 2A9NH 5JW4R 1I1RA 2V9TA 1G9NL 4HLZH 4W6YB 5DJAB 5ETUB 4LHJB 4OCYH 1IAIH 4Z7QF 4Y2DB 5HBBA 4KQ4H 4JAMB 1T7WA 5CZXC 4H1LA 2YA2A 3GBLA 4RGMC 1T5WB 4RIRB 3WKML 3NIDF 1NAKH 1MJUL 2MSPA 4M48H 4MJIE 1NGXB 1BVLA 3DMMB 3UPAA 4K7FB 1YMMB 2EDKA 1BBDL 4K71C 2CO6B 5KSAC 3HG1B 4ODUB 1AHWB 3LKSA 3HUJB 5C9JA 1YN7B 3EHBD 4DGIH 2XQYK 1A1MA 2OP4H 5EWIH 3Q1SH 5IHBA 2UWEE 3WE6A 4AQOA 2I60H 1GIGH 4WI7A 1MHHA 3CVHH 4HQQH 2P49B 3TH3T 4KK9D 2H2PC 5DMKB 4M1DL 2BERA 2GSGA 4P4KA 3U0TA 4XBEH 1FE8L 1Q9OA 5DK0A 4LLAA 4XCFL 1J8HE 5DEGA 2J6EA 4WTXA 2QKIB 3NN8A 1U8LA 4YHZL 2BY3A 2J6EL 2ICES 4GG6E 5AAWA 2EYRA 5JIPA 4MVBC 4XGZA 5IGXH 3KLAA 3CLEL 4ELKA 4PJIB 2QBWA 5TFSL 2CRIA 1KXQE 3ET9F 4LCIH 1JK8A 5DLML 1JPGA 1KCKA 3ARBD 1GC1C 4OLUH 2V5YA 3TJHD 4OF0A 1KC5L 1UA6L 1F8TL 3LKPA 1BF2A 1T7VA 3GMMA 3OB0H 4RCAA 3UBXI 2B20A 3WN5C 4G6FB 2ARJQ 2A1WL 1CDHA 2VTFA 3ULUF 2FJGB 1X5ZA 3HCVB 5KS9E 2AERT 5EPMB 3QDAA 1IGML 3VXMD 3IJHB 1OAUL 4UBDC 3U83A 1UB6A 3MR9A 5F72S 4YX2H 1U36A 5A2LH 5E00A 3WSQH 1T6WA 4JR9L 1RZ7H 3T08A 5E8DL 5KVDH 4OQ1A 2CDFB 3ULSA 4HV8B 2W38A 3F7PC 1YEIH 4PJEF 4LLVA 4WI6A 1HXMA 2FLBT 1ETZA 4ZAKB 4O5LL 5EOCL 4WEMB 3VDCA 3ZKSD 4HCRA 3RA7L 5KW9L 1TFHA 4O2CA 4LSUH 4GG6A 3BH9B 3HI1A 4MGXA 3EOBA 1WFUA 4XB8A 5IQ9A 4DAGH 3T3MF 2VQUA 4LLDA 3GSUA 2BZDA 2DQIL 2IQ9L 5ITFB 4J3TA 5D7LA 4Z7VF 3C6SB 5D2NA 5GRYA 3CVIL 3VXSB 1JGVL 2BDNL 4PJ9D 2Q8BL 3NOIA 1HSAA 1S3KL 2CR6A 2HKFH 4GRLB 1NKRA 4Z7VE 1I9JL 4JZJB 5FGCB 3JWDH 3WD5H 4ODVL 1XF2B 4U3CA 3GRWA 2F53A 3TBVB 1AD9B 4M1CD 1N3NB 2Y25A 2ZNWA 1HHGB 1OD7A 5E0QA 5IVZA 3IF1A 2APBA 4U6YA 1E28A 4P2RD 4M7KL 5FYKD 1BQHB 3ZKND 1DQLH 3ARUA 4OD3L 1KPRB 1BZQK 3ARFC 4PJ5D 5KSBF 3K7UA 4LVHC 4QHLA 1RIVH 4YEEA 1WBYA 1H15B 1IAMA 4KTEL 1GGUA 1MPAH 3UYOD 4U1JA 1OAKL 4MXWH 2A6DA 5BW7C 2Y5TA 4L3EE 2W59A 4YDIL 5C0CA 5ICXB 5ISZB 1TENA 4MNQE 2BSRB 4RAVA 2HVKB 4PBWD 1GH7A 2A73A 1G7HB 2C5DC 4A2MA 4GRWB 1ZGLB 4IEFB 1JHLH 1RV6X 3F62A 3EGSB 5F6IB 5HYSB 2OCFD 5MEPB 2J8UB 4UQ2B 1WTGT 5DVMA 3WO4C 1DQTA 1A9EB 3IXAA 5C0IB 2RIKA 3T2NL 1VFAA 2PYEA 3INUL 2PNDA 2VDKH 1D3CA 4XCEB 3ZKNC 4Y19A 4JM2C 1BZ7A 4RMSA 1LDPH 1ZS8B 3FAXA 1AJ7H 3RKDC 3ARGC 3WUWG 4K3DL 5IBUB 1I7RB 3LQZB 1N0XH 3T0VA 2N7AA 3PHQB 1EIBA 5JA9A 4CADA 4YBHA 2MPAL 3EDEA 5A43C 3LSOB 1JZ7A 4HS3A 3L5XL 1RJZB 5EZJA 1QR1B 2DM7A 5J1SC 2YWYA 5F7LB 3BKCL 1X5FA 1AR1D 2Y6SD 3C6LC 4NCC1 4KI1A 1Q9LB 3SGEH 1JMXA 3DX9B 1RUAL 4NRZA 4UUJB 3RGVA 2VUYA 5F9WC 2R4RL 5E1HB 4ZYKB 4PJGB 1L0YA 1FN4A 2NR6D 3X3GH 1HDMA 5ESVA 5C08E 1SY6L 2OL3H 2FX9H 3CXHK 1N3NA 5MEOA 1QKZH 1BOGB 2WW8A 4GQ9L 2D7TH 1CE6B 2UY6A 4POYA 4G8EB 2NY2B 2YPKB 3PHOB 4JANA 4RFEA 5FO8A 2GEEA 4F57H 5DR5L 1E6JH 4K3JL 5D1QC 1L7IH 3KR3H 4JM4L 2EE2A 1X5IA 2AJSH 1U8MB 4L4VB 5I1GH 3S3SA 1DFBH 2CRZA 4AG4L 5DF0A 5ICYA 4U6VH 5C09E 5HPMA 1GGCH 3MRGA 1FFRA 1CGSL 1T66C 2BNRA 3FRPA 4PG9B 4X9HA 3QP3A 4R4NC 2A0LD 3FOLA 1FFNA 3HI5H 4OZIA 1HINL 5GXBB 1CCZA 3CH1B 2ZOLA 4GW4B 4PJFF 4ZUSA 3EOYG 3VE0B 4FQ1L 1JHTB 4KDTA 5FYJE 3RY4A 1KT2B 1QLRA 3AM8C 2EDXA 2OSLA 4R26L 3DO7A 4YC2C 1U8QB 3QJHA 1EUUA 3UTSE 1VSCA 2DM4A 3MFGB 5JOPE 3RTQA 1EXUB 1PX3A 3BH8A 3QIUB 5F9WB 4WCYL 4AY0A 1GZPB 3H2WA 1RULL 1G7MA 5I2IA 1JGDB 2VC2L 1I1AB 5ACZB 2WBJA 3U46B 1T22B 5LQBL 4KRPC 3SGEI 5EBWA 3QPQD 5JXAH 4QRTB 2PCPB 5K9OB 3JTTA 3BWUC 1XGTB 4WWKA 5I6XC 4OSUL 1F3JA 2EIDA 4K23L 3SE4A 1N7MH 2MCG1 1CDYA 4I4WA 3PQYD 4JFFA 3DROB 4YPGB 4JFOB 4Z5RB 5DJCB 4PLJD 2C1OB 1A7RL 1AD0B 3TWCH 4XMLL 1JF1B 1JRHL 1KULA 3BP6A 2H2SD 5DRWA 3ALXA 5JMOC 3FN9A 4H20L 2H26B 1MWAA 3QUYB 1VDGA 4LCUB 3DGCR 5IK3A 3RWHA 4ELMB 4QGTA 2ICWB 3IKCA 2WUBL 4POZD 4XP1L 2X9WA 4FFYH 1IZJA 1Q72L 5EUOE 1M7IB 3ZLQC 1X7QA 2EDEA 4CMHB 5BQ7B 1NCDH 3V5KB 1LO0L 2QQQA 1EH9A 4FQIL 5BRZB 4XCYB 1K4CB 2R2CA 1JPTH 5E7FA 5HHNB 4U6HA 1QBMH 5AUMA 1UFUA 4G8GD 2NY0C 2F8OA 2E9WA 4ONHA 1X4XA 5F1NA 2Z91A 1IM9B 3F7YB 5C0BA 3DI3B 2NW3A 7FABL 2FBJH 5B3JE 2MMXA 5T5FL 1OW0C 1AQKH 3MV7D 4ELME 3UTSB 3ARED 2JCCF 5F96H 5BS0D 4OD1L 5IFJA 3JWOL 4H5SA 1AGFB 5EZJB 4Z7UE 2CUMA 2JCCE 3F5WA 4LQFL 1QRKA 3BWAB 3LSOA 4Z6AT 3OJMB 1WBZA 2LU7A 4RFNB 4ORGA 1U0QA 4LGPB 1DN2A 1NGWA 3L5IA 4PRDB 4CADB 4HMCA 1QTYT 4HS6A 4OGXL 4FXGB 4ZTOH 2PW2A 5FK9A 2VLRD 5I18H 3V6BR 4HK3J 5B39A 4MLSA 3HHRB 4O51A 1NUGA 1NC4D 1D5ZA 2LU4A 4HKXB 5D5MF 4JRWA 1TZIB 5JHDD 3QCTL 4NWTL 4N0UA 2I5YL 4GUPB 1HILA 1NLBH 2A9NL 1JTPA 4OZGA 3CSYA 3OHXB 1PKOA 1A7NL 2ZUUA 3PWPE 1FBIL 1EO7A 3T0AA 4YEFA 4JPWH 5CD5C 5E1AA 3RAJL 2C4XA 3OG4B 3RWFA 3HPLB 4ZUTA 1MFAL 1RUQH 5MHSD 1KELH 1J0ZA 1MJUH 2F74B 3NFPB 4DJMA 2JLLA 4WFEE 2YPVL 2EIZB 3KJ4B 1N5YH 1X5XA 5CEYB 1A6PA 3VXMB 3FQNA 5DT1L 3H42L 2IAMA 2GQHA 5JORA 1MJJB 5FHAL 5IB5A 2HT4D 2Q7YB 3MNVB 3DO7B 3BZFA 1QG3A 4L8SB 1JPSL 1H8NA 4GS7C 1ZLUK 4L4TB 1TQBC 2B8OT 1ZT4B 3QEUB 4LLMB 1YJDC 4MJ4A 3QIBB 5CEZE 3ULVF 3BH8B 5KSAA 5BOPA 4NOFA 5E4EB 3CFKA 1NDGB 1P2CA 2AXJA 3AREC 4L9DA 1FJ1A 4Y8DC 1JWUA 3RWDB 5IHZA 3HC0B 1ACYH 1K8IA 3B9KD 5ESQB 3WHE0 1AXSB 4J3VA 3PE9A 4I3SL 1UGNA 3T77B 2CH8A 1KACB 4G7YH 4Z7QE 5C0AA 5HGGS 4QYOA 1AI1H 1NL0H 2MNUA 3GSRB 3A0OA 4TTDC 3S37L 4JRXE 4Z7OF 2AV7A 4PRIB 9CGTA 4WFHE 4LGRB 3RL1A 3AS0A 5D7LE 1P84J 1OWWA 2AK1H 4LKXB 4OLVH 2BY0A 2ZUSA 4P59H 3V52H 2ID5A 1QZ1A 3WFZA 1OT1A 4WY7L 3GMQB 3TIEA 3VXNB 2GJZA 1RUKH 5C8JB 3U0PB 1WT5A 1KC5H 1UA6H 4EUPB 4XVUD 1JPFA 5GGQL 5EU4A 5IEKB 3KYOB 3GM8A 4PJGA 5I8CB 3NBNA 3IFOA 4OLEA 3P4LA 2NTSP 3QCUL 3CPLA 3FB7A 2W60A 2Y5EA 2H6PB 3MA7B 3O3BB 5CIPH 1UB6B 3MR9B 4O9HL 4CDHA 5IJVA 4RFNC 5DJDA 1OWRM 5H2BB 3CSYB 3GI9H 3TBYA 4HUVA 4OLXH 4P9MH 1QR1A 1PVHA 3JZ7A 3TN0A 1Z3GH 1VEOA 2ZUVA 5TJWK 4RWYL 2GTWA 4U05A 4YFLF 5EU6A 1FNEA 4X5XB 3S3PA 2R56L 2HN7A 5DMGC 1T7ZA 5B8CC 3RVWD 4F15B 1U8JB 4NO0B 4PJ8D 3V0VB 2Y36H 1E4KC 4S0TD 5BS0A 3I50H 3QEQB 5F93C 4MD0B 4MZ2A 4XVTL 4PLNC 2AJYH 1ORQB 2IG2H 1S7TA 4RISH 3NN8B 2XTJC 4Y16A 3JWDL 1XF4A 1S7SA 2V5TA 3T2QA 2NX5A 3MGAA 5EZLA 4OCMC 4EI5B 4ONHB 5C0CB 3D3VB 1IFHL 1DLFH 1VACA 4KZEH 1G1CA 2X4SA 5MEQB 1OAYH 2XKNB 4XP9H 4Z7VB 2VZVA 1T1ZB 2LE9A 1F11B 3VXUD 3L9RB 4X9FA 1KJ3H 3C5JA 2L4OA 1YYLL 5KG9B 1X5LA 3X12A 5KTEL 2HFFB 3I3BA 4DKFH 2NXYD 2QR0A 2PKDA 1D6VH 5F1OB 2Q1EA 3PF2A 4NQCE 5I1JL 5C0ND 1INEH 4G8GB 4I2XE 4DK3A 4XH2B 4KXZI 1UH2A 4LCCB 3C5JB 3D85A 3ZTNH 1XZ0A 1CD1A 5I1EH 3M1BB 1FDLL 2RQ8A 1IC4H 4LPWA 4GKZA 3WDJA 4U6TA 4H1LB 3V4UH 1NBVH 4WV1C 1LEIB 2HLFD 3E1F1 3EDFA 2ENSA 4BSJA 2IANA 2WZPD 2CR3A 4JPVH 1KYOJ 4QRSA 3SGKA 4N0YH 1FZKB 5L7XL 5ANMA 2EDTA 2UZIL 4EXPX 1NMBH 1S7VA 4EZMA 5SWSE 2VYRE 4OKVA 5CBAB 2HTLD 2X40A 5TDOB 1RMFH 3I75B 3FMGH 1E4JA 2JB6B 4XPHL 5GISH 4NO3B 2H2SC 4DGVL 1N59B 3WS3A 2J8UF 1T89C 5L2KE 1ONQA 3EFFA 3IDNA 5MP6L 3KLSA 2IH3A 4AMKL 1CFQB 1OCWL 3Q5OA 3V0WL 1AR1C 2Y6SC 1KJ2L 4L8DB 1FFOB 5DUPH 2FD6L 5D5MA 1DL7L 1A7PL 1XGPB 4NYLB 3MA9H 5C0RH 3TFKC 4U1HB 1RUAH 3S97C 1YY8A 4FZ8L 1D5IH 4E41D 5H8DA 4P9HL 4LDOB 5E9DD 4R3SA 4QO1A 5I1IH 3ZKXB 5DFWH 3X3GL 1FH5L 3VXRB 1IGJB 4Q58C 2NY3D 5KN5B 1FGVL 4NO2A 5L2KD 1A8JH 4CL7A 2CXGA 3V6ZA 5KSVA 2HKHL 3MJ7B 4HAFA 5T3ZH 4D94A 4M3JA 3U4BH 3RHWK 1U93A 2NQCA 3E6FB 4LP5A 4LSTH 1V3LA 1NCNA 5DUBB 1NFDE 1UT9A 3KPOB 5LBSH 1DFBL 2ENYA 4HUUA 1LEGB 2VISB 3S3JA 4QRPB 4MXVE 5F9OH 1NFDF 1T66D 3KYOA 3GJEB 4CAGA 4DTGL 1S7VB 2YD7A 4Z0BL 5I6XB 3DUHA 1H3XA 1RJLB 5IWLC 1GGIL 4JY6B 2BVEA 4HIXH 5GGRY 3NAAH 3BPOC 1S78D 1UQSB 5FCSH 5KSBA 2QSQA 2LAGB 2OMBA 2CKBB 2GSIB 3B2VL 3MRQB 5EOTA 4E42A 1JMZA 1FAIH 2FO4A 3OAZH 3S34H 4KQ4L 2J4WH 5J57B 5ALBH 1I9IL 1P5UA 4LARL 4KTYA 4WW2C 2YEZB 3BW9B 2VXQH 3MREB 5HHOD 3IU3A 4JY4A 1ZEAL 2D4FA 1CIUA 3BGFC 4TSAH 4ZAKD 3MRJB 5JW3L 3LDBB 1BBDH 1S7RA 2R9HC 3BEWB 3HE7C 1R3HA 3BJLA 4RIRA 4U7SA 4ACPA 4HKJB 2ESVD 1P5VA 3N9GL 3OF6D 5FV1L 3V6FB 2J88H 3MLUH 5D2NE 1MH5B 2X4QA 1RUMH 2NX5E 3GMMB 3QUXD 4G43A 4NZDA 5B4MD 4S1SL 1SYSB 3PWJB 5K9KB 1E4WH 1X9QA 1KJMA 4Z7NE 4X7CC 4YHIB 2EH7L 5FUZL 1MJJA 2AEQH 1OP5H 4QF1A 1IKNC 3QDMA 1S9KC 4S1QH 4P3WA 1U6AH 4YBLB 2I07A 1FE8H 1OQXA 4QT5B 1UJ3C 4WHCA 3FB6B 2EE6A 3RDTB 5SX5K 5C0IA 5CJXC 5HGBB 4XMLH 1TQCC 5DQDH 4PB0H 1XMWA 4M00A 3JV6A 5HVHC 3FTGA 2AI0L 5IESL 5E5RB 4HS6B 3DPBA 4LVEA 1BHGA 3V9FA 2XKSA 5ICXA 3OSKA 3QT2A 4QWWC 5DJ2B 4NKIH 5BCAA 5FKPA 1C5CH 3RWEA 3O8XA 4MHHG 5I8OL 1ZSDB 1AGBB 1NUNB 3GMPA 3L3IA 3DSFL 1JGUH 3OZ9H 3SPVA 2Z8WC 1WZMA 1BJMA 1Y18B 5F70A 1U9KA 2PYFB 4HT1H 3P4NA 4QRUA 4UTBL 3WXWH 5L2JA 4X4YB 5E2TL 2DQHH 5C09A 1WUNT 4FXLA 5GRJL 4GRMA 2RR3A 4KJWC 3RWIB 4OF6A 3SE9L 5AD0B 3BKJH 2J3SA 5EU4B 3GHBH 4O58L 4N5ED 3TBTA 3JBG7 1YNTB 4U2YA 1XF3B 4OIIL 3QZWB 1MIMH 3I6LE 5HD8C 4PJ5B 5B8CA 5HVFB 2HA1A 3DOSA 4NRYB 2FX8L 4C56D 3UBXG 5D2NB 5HJ3A 5IP4A 4D3CL 3JWOH 4LSUL 1MF2L 2WINA 3DIFB 25C8H 3NCEB 3NZ8B 1OPGH 2C3WA 3PHSA 4HEPG 4O2CB 4TSBL 2DI8A 1OGAA 3P9MB 3N06B 1WIUA 2AEPL 3TA3C 2AJ3A 2HKFL 2GJ6D 2M8XA 4X99A 3X3FL 4GKSA 5J1AA 1FNEB 3GSWA 2KKQA 4I48B 2X4PA 1ZT4A 4ODXA 1MWAB 2YK1L 2D31B 1RZGA 1BQSA 3MUY1 3RL2A 4PJCB 1EGJA 1F2QA 1KCSH 3RWDA 1FJ1B 4R4FL 2FJHA 5HHVH 1I3UA 1I1AC 1A3LH 4HXAL 4JJ5A 3PWPB 1J87A 4PV8A 1KCRH 4Z76A 2YD9A 1YEGL 2NLJB 3OXRB 1HYRC 1CS6A 5ENWB 1MPAL 3MTRA 1U92B 4R4ND 3GSXB 5BOZG 3SKMA 3QG6B 2FECI 4KPHL 1IGYB 4PLKD 3ULUH 3MXWH 1U8QA 3QJHB 3T65A 1UWXK 4M43H 2CDGA 1F4WL 4PY8J 5I1AA 2R69H 1IKFH 5F7DA 5TE6L 4I9WE 4XP6H 3QXAA 4P2CG 3ARBC 1MAML 2A74B 4HWZB 3EYFA 4RA0C 5CS7A 1QSFE 2JCCA 1CI5A 4HJJH 4HZAA 4LLUB 1HOCA 1FL5A 2LABA 3DVIA 1IC7L 1PFCA 5SX4H 5TGBA 3F7QA 5FK9B 2WP3O 3F58H 4NJAH 1D9KD 4L3ED 2OZ4A 5BVJB 3OKOA 3O45A 5BO1L 3NFSL 4R7NB 3ZT5A 2BNRB 2VLJA 4BJLA 3DSNA 4NQDA 1B0RA 3OR6B 4LCYA 4WFED 5EO9A 3CMOH 3NCCB 3O4OC 2EC9U 3T8XA 3LRSB 2IQAA 2ZOKA 5BRZA 1YNLH 5HVWA 3RWGA 3S98A 3S35H 1VB9A 4I5BA 1AQDB 3ES6B 3LV3A 3KPTA 4GG6F 1NCCL 3HLAB 5HHXH 5GSRB 2JK5B 3SDXF 4OLXL 4G8EA 1AC0A 1R0AH 1NCWL 5JW4N 4L1HA 2CO7B 3MLRL 5IB3A 4J6RL 5FGBC 2CGRH 4TULH 1EJ6A 1U3HB 3MLVH 1CL7I 3PIQA 5DR5H 5ESVB 5F89A 4UINH 4MJ6B 1NSNH 3QUZA 2HJKA 1SJEA 5E4EC 5I9QB 3MRHA 1C1EL 5DUMH 3CSPA 3HI6H 3SN6N 5MERA 3OX8B 2ADGA 3EYVB 5JHDE 3A6CH 1MFCH 1P4BH 5HI4C 5B39G 4M62H 4OF8A 1CL7H 4ZODA 3PWUA 2YR3A 5E9DA 1L7TH 2C3HA 1AY1H 4FQ1H 4YBQC 5EBMA 1U8HB 4RAUA 1MNUH 4CBPA 5DJCA 4M8QA 3KPRB 3W9DB 1W72A 4IRSC 1HH6A