5ECGA

Crystal structure of the brct domains of 53bp1 in complex with p53 and h2ax-pser139 (gammah2ax)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
198
structure length
192
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title ATM Localization and Heterochromatin Repair Depend on Direct Interaction of the 53BP1-BRCT2 Domain with gamma H2AX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 42
structure length 192
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ecgA00
4AGOA 3WTWA 4MZRA 4IBTA 4LOFA 4AGNA 1EAQA 2P52A 4LOEA 1E50A 2FEJA 3IGLA 1TSRA 2WGXA 4GUQA 2ATAA 2BIMA 1EANA 2BIOA 5AOIA 4IBQA 1HJBC 5G4NA 2PCXA 1H9DA 3QYNA 5ABAA 2IOIA 2X0UA 5A7BA 3Q06A 2X0WA 4AGPA 2GEQA 2RMNA 3WTXA 2XWCA 4AGQA 3VD1A 3WTUA 1EAOA 3D08A 4AGMA 2IOOA 4GUOA 4IBUA 4A63A 3D0AA 4AGLA 5AB9A 2YBGA 1T4WA 5LAPA 1GZHC 4IBSA 2IOMA 2OCJA 4G82A 3WTTA 5AOLA 4IBYA 4L0ZA 3EXLA 4L18A 3VD0A 3KMDA 2MEJB 1LJMA 4IBZA 3D05A 4IBVA 3ZMEA 3Q05A 3WTYA 5AOMA 5BUAA 5ECGA 2J1WA 2XWRA 1CMOA 1HU8A 4G83A 5G4OA 4XR8C 2BIQA 4QO1B 5KBDA 4LO9A 2J1XA 3WU1A 2AHIA 3D07A 2BIPA 3Q01A 1IO4C 3QYMA 2H1LM 1TUPA 3D06A 3VD2A 2VUKA 2X0VA 2J1YA 5G4MA 3TS8A 4HJEA 1KZYA 1HJCA 2AC0A 2ADYA 2J20A 3US0A 3IGKA 3D09A 4KVPA 5LGYA 1UOLA 1CO1A 5AOKA 3EXJA 3US1A 4IJTA 4MZIA 2J21A 2J6WA 1YCSA 4IBWA 2J1ZA 3WTVA 5AOJA 3WTSA 1GZHA 3KZ8A 4L0YA 2BINA
chains in the Genus database with same CATH superfamily
2Y1AA 5JTWA 2VXQH 4GG6B 5CP3H 4NN7C 1QLFB 4HUCA 2EH8L 3AREC 1PIFA 3VA2C 3VUAA 1RQ5A 3N04A 2VT0A 2WWMC 2AEOA 3BHBB 4NI3A 4NM8L 5EUOF 1SQMA 2WLZA 1FZJA 1ACCA 3G6AA 5JPNB 4HOZA 1F3JB 4PWJA 2YD5A 1NQBA 1FG9C 2WBJA 2WLLB 1HH6A 2QHRH 4UZGA 5IBUB 3VXQA 1JE6A 1MWAB 3DOHA 3QEQD 1P5UC 4E68A 2Y7QA 1AGEA 2P7TB 3D1MC 3OX8A 3K0WA 3MRJB 4L4VB 5DS8B 3VXSD 5FEBA 5HHXH 5D1XB 2H1PH 4K2UL 1LO3H 2EDRA 1BCIA 5DJDA 3WIAA 4A7GF 4TM9A 3QFJA 3DJ9A 5IGXL 1ZTXH 4W9EC 2ZKMX 1FCGA 4MJ5B 5FO7B 5KYYB 2IXQB 4POYA 1MVYA 2ED8A 2EH8H 2NUTB 2X4OA 4U1IB 2BRQA 3AG3B 2ZOUA 4OGQC 4HIQA 1ZCRA 2BOCB 2XWTB 4HWBH 4KNUA 4Z7WA 3KYMB 4TNVF 1CWVA 1IIIA 1NCNA 4OJAA 4UTBH 4Z7OB 1A6VL 3VFMA 1RULL 4P46D 4PV8A 4E0RB 4JX0A 4IOSA 1L9SA 4XN2A 3RUGB 4RX4D 3ZMEA 2IANA 2DWDB 3W0WD 5ABDE 4JY5L 1ILSA 4OAWA 1I7UB 4Y1AE 4RA3A 1A6ZB 5IBTH 1IAMA 2K0RA 3TEXA 1P7KA 1U8KB 1JYWA 3MLTB 5L4MA 4ELME 4LDOB 5TTRA 3UG5A 5EU6D 4N2FA 1A8JH 5JHMA 3AB0C 3X12A 2D7QA 2ZG2A 5IGXH 2VISA 1MCSA 4PRNA 2F7QA 4RQQA 1GJUA 3W82A 1H3XA 3UJIL 3QDGD 5LAXA 3VXNA 4F1SA 3VQ1C 2RFXA 4Y16C 1D5XA 3N43B 4OCSL 4JVWA 1BOGA 1MWAL 3GIVB 1O6TA 2I7SA 3TN0D 5ITFA 2Z7UA 4DH2A 1A6VH 3BWUC 5AW2B 5JPMB 2EYRB 3QEGL 3BP4B 4RA0C 4KXDA 1R3JA 1SOQA 1RHFA 2ZJSH 4ZK8A 3VXSA 4QCIA 1T3FA 2AEPH 1PD0A 1GJWA 1UENA 4JY5H 2DQ6A 4G3YL 3CBRA 5KS9E 1FVCB 2WIIB 3PWUA 4L37A 3OD3A 4HJ0D 1DR9A 4WU5A 4WENB 2NLJB 4IEFA 4LHUG 4NC1E 2H5UA 3NZ8A 5CNHA 1TEGA 3CQFA 4WUUB 2CRYA 3SKMA 5J5EA 5D1XC 3MUGA 1OW0C 4ZW7A 3D4YA 4OFPA 2QPUA 4N0UB 4DK6A 4WI3A 3P0YL 5SWSE 5C9JB 2BOBB 3E3QE 3UJIH 4FA8A 4FLOA 5F7MC 5I0YA 2XKNB 3S5LB 1HESA 2C9XA 2PXYD 1UA3A 1MCJA 4MS6A 3OKMA 4OCSH 1U91A 1MWAH 2A83A 1FGVH 2ZXQA 4RX4A 4TULL 5EPMA 4Y0GA 2GUOA 3W0WA 1U36A 2MTAA 2WZ5A 3OR6B 4JCMA 3ARWA 2ZQKA 3IETB 4HOMA 5KUKA 3QEGH 5DA4A 4UINL 2XTJB 3DV4A 5I74C 2OMWA 1JK9A 4W70A 1PPIA 1R75A 3O3BB 4NZFA 5EU6A 1TMQA 1P7BA 1XGPB 3VWJD 2BSSA 4IYKA 1QI5A 5HHQB 2LTQB 4JDZA 1LHZA 3EBAA 4GLRH 3KG5A 5CEZL 4JRFA 3FW6A 3HNTL 5D1QD 1FN4A 2XU9A 4APQD 3QDGA 1KBKA 2MKWA 1P0SE 3LEYL 3FQ4A 2CNZA 3BJLA 3DRQB 4S0HA 5F0MB 2PKDA 3P0YH 4E9VA 1X7QA 3TN0A 3MAWA 2PPEA 4QHKJ 4MXWL 3C09B 5AOLA 3HAEG 4ZTEA 3UO1L 3V4VB 4TULH 3M7OA 3OKLA 3UG4A 3M46A 4QYOB 3LH9A 5BZDB 3BT2L 4J4PD 4EUPB 3TNNB 1B0WA 4NRYB 1Z3GL 3D85D 4F7PB 1SDDB 4YNYA 4ZMWA 3EOTL 5EOTB 5L88L 5T3ZE 1FZOB 1SXCA 4IMLB 1NCJA 3TIDA 2VW4A 1UQSB 5A2CA 2GK0A 5DVLA 1DVZA 1BVOA 1HXYB 3HNTH 1I9JH 3EGSA 5KYXB 4HIEA 3VFWB 1A14H 1BQSA 2D2CC 1Z5LB 1ZA6B 4M6ML 4PP1D 3LIUA 5D1ZI 2G9HA 1R3HA 1XGRB 4PLKC 1QNIA 3SQBB 1A9EA 1RZGA 4KRMB 4GUPB 3RY6A 5K9OA 4Y1AA 2BVTA 3QUML 3QQ3B 2X70B 4CVXA 4FE9A 4J3XA 4HZAA 4V2CB 3BT2H 3VWJA 3NCWA 4KOCA 1Z3GH 4NOFA 4UV7H 5D1QA 1R5VA 4YSPA 2OZ4H 5L88H 1J05B 2V7NA 3EOTH 2XTJC 4APQA 1A7RL 4AYSA 4TNWK 4Z6AT 4LKXB 4N2MA 4X8JB 3UACA 3RFZA 2Z91A 1WUNT 1TCRB 4LLDB 5D4IA 3ZZLA 4QWWD 2ICEB 4E9SA 3HB3D 3DX4A 3V4VL 1FVDA 2UZXB 4PWGA 3NH7L 2X1QA 1BVLA 4C47A 4PJ7B 1YEGH 2W80C 4N9OB 5DJ0B 5IR1B 4LP4A 1XZ0B 4XPTL 1UM4L 2FX7L 1DEEA 3BH9B 4KV5E 5C6WH 4H8HA 4J4PA 3ARGD 3F3HA 3FF8A 3NJLA 4B97A 1INDH 3QUMH 5KS9A 3UTPD 1D5BB 2V4LA 5D4HA 1I9IH 5B38A 3PIQB 2BSTB 2NXZB 5C08B 2EACA 3VI4F 5I1IL 2O6CA 5E1AA 1HT6A 1A7RH 2MNWA 4OJDH 5I1CL 1BA9A 1URIA 1A6TB 4ZFQA 4FF9A 3FT9A 5LVEA 2QQLH 5ESVB 4JFHE 1UZGA 5DRNB 5I15H 4J2QA 4DFIA 1A4JB 1P1ZB 3VGAC 2NYZA 1T21A 2WXQA 3VXRB 4GKZB 3NH7H 4YSCA 1TVBB 3ZTDC 2HFGL 4O2EB 4XPTH 1UM4H 2FX7H 2G5BB 4RWHA 2CIIB 1U8LB 3BPCA 3MRCA 3M6DA 3P11L 1X4YA 1QSEB 1DBKL 2DMBA 2XVGA 3FHEA 5T8IA 4H0HB 5JMRA 1YMHA 1FPTL 5MEQB 4NHCL 2ZOKB 5I1IH 4OY9A 2YA1A 4QOKD 3DC0A 5I1CH 2DIEA 4G80B 3KW7A 4LO9A 5DS2A 5E7FA 2HRPL 3GD1C 3X11A 3GTNA 5A6MA 4MGXA 1BQHG 3EH5B 4JGNA 1CLCA 3OZKA 3S3DB 4TLTA 3TCLA 1N68A 4NCDA 1UACL 3LKNA 5KVDL 5C3LD 2QQQA 4PJIE 4FKKA 3ARGA 1RHHA 4NLHA 3DYPA 2EXYD 4UOQA 4JFVA 1IQWL 2H3XC 1L4IA 2HFGH 4GRLB 4KMTL 3F83A 4YSRA 2LW3A 4N9GB 2F58L 1LWRA 1ZLEA 3CZFA 3NFNA 3RDTD 2ZUQB 2YGOA 1F4XH 2A6KB 5D9SA 1TJGL 1E9PB 1JRHL 2VXQA 4X5LA 2D0GA 6CGTA 5D7JD 3RA7L 2A0LD 3K4ZA 1XH3B 2AXFA 3RILA 3SIKA 2XVKA 5F9OL 3SDXF 1Q0YL 1FPTH 4WWKB 2I9TA 3LXUX 3VA6A 3O3AB 5H35B 2CR6A 1EAQA 2XWDA 3RVVC 1CFNB 4K8RH 1HSAA 2HRPH 1NLDL 5L0QC 2UY7B 3UZQB 2E27L 3S3PA 4LXFA 4Q9BA 3DX8A 3CVIL 5KVDH 1KBBA 1S78C 2XUWA 3L16A 3UH8A 1IQWH 4I0CC 2YUWA 3IN0A 1KGYE 3BEVA 1U8OB 2FAUA 1W9XA 1N0LA 1TJGH 2GEQA 1JRHH 3CFNA 4F3FA 4QOKA 2AJYL 2VLME 4Q89A 4YUEL 2WQWA 1QATA 1INQA 3TO4D 4HWBA 1BAFH 2FWOA 4CW1B 4UTBA 1BVNT 1DBBL 3IXTB 5HHOB 3VXUE 1CXLA 4Y9GA 1UT1A 2QPFA 2FLRT 4HHWA 4LPCA 4X6FB 2HT2C 1NLDH 1LWJA 1I1FB 1SJMA 3QRBA 2VGLM 2E27H 1CYWA 3U9UB 3HS0A 4F20A 1JPTL 4P5KA 1KCVL 3CVIH 4LCUA 3ZZSA 4D0BB 4M7JH 3QXDA 4IIQB 3DETC 3FN3A 3RDTA 2MCPL 3PL6B 1XO8A 3HZ3A 3RVWC 2ATPA 1S5IL 1F8TL 5D7JA 4U49A 3IDGA 5FA3B 4AMWA 3MUZ1 3F65A 4XP5H 4KXCA 4MQ7A 1HEZA 5J9PA 3F7RA 4GRLC 1Z5HA 4JHUA 4MS8C 4YSTA 4PW4A 2BP3A 2E9IA 3ZE2F 2ZUQC 3GGWA 4I18B 2AJYH 2V2XB 4F9PA 4AOFA 4Y5YA 2H2PD 4YUEH 4XXDA 2W0FB 2FEEL 1OZTG 4Y5VB 1N67A 5L8KB 3D4GA 3VH8G 1T6BX 3SDYL 3ZL4L 4R90H 1KMGA 4WWKC 5IB3A 5IV2B 5JHDB 3PHOA 3KVDD 3FQXA 2OAAA 3PJSB 1RUAH 1JJUA 1XXDC 3QWRD 1TF4A 2FVNA 5L9DH 4JLRA 4CN1A 3RKDD 3L4WA 2DBLL 5EIIB 3MDJA 1JPTH 1KCVH 2OJ1A 5EU7C 3KEDA 4HHAB 2MCPH 4GBXB 5IJKC 5CFHA 3L5WB 5EN3A 1F8TH 4HCIA 1PW3A 1R3LA 3AS1A 2WQXA 2GBTA 4JZNB 3VMNA 1DQVA 1RLWA 4PVLA 2J55A 1BVKB 5IHWA 2VLMD 3TO4A 3P4MA 1F1GA 3CSFA 5AZ2H 1IMHC 1RZ7L 3NG5A 1FRGL 3JTTB 4AM0B 3OWEA 4WY7L 5CR8A 3VXUD 1U92A 2H26B 3BAKA 1DQDL 4PJIA 1AVAA 2A4CA 1WCQA 5J6HA 2ZCZA 3VI3B 1ES0B 2FUQA 3FT0A 3LRLA 4ZX4A 4RCAA 2NR6D 3QDME 3REWB 4MSWA 3UPRB 4GKSB 4K15A 1XR9B 3CFMA 3UIYA 4CGTA 4B3EA 2DBLH 2XT1B 1KTKE 4G8FA 2C34A 2YD9A 3HPLB 4XZUB 4NIYE 1KCKA 4GRMA 4KPHH 5I0VA 4TV3A 5DJAA 3WSQL 2CLZA 4CSTA 2YAHA 3WXVH 1QEWA 5F7FA 4PR5A 5AKRA 3IT8D 1DBML 4ZQKB 4IIQC 2HFFA 3RGHA 3PL6C 1BG9A 3IFOB 1QAWA 3AU1B 4PVNA 4W9JC 2F1EA 3IDIA 5B3SB 3EYQC 1U8IA 3SGJC 2W9EH 4W9IC 2Z4QA 3MLWH 5DURD 3SY6A 4ERSL 2CDEA 4DOHB 1RZ7H 3QH3A 3FOMB 4I9WD 1W0VB 4OLVL 5DQ9A 3MNWB 3NIDE 1B4TA 4WY7H 3T71A 1F90L 1HX0A 4BE6A 4XOAA 1V05A 3QWRA 4P0DA 3TV3H 1DQDH 3MLTA 4A2HA 1E8WA 1IC5L 2IC2A 4R7NA 5DK0B 4B95C 2AKRB 2KBGA 3ZO9A 5JQ6L 2GIYA 5FW8A 4EBQH 5AVWB 4GG6F 4S1SL 4KGLA 2AMGA 2Q0ZX 4WDIA 1EO7A 1MHEA 1JFQL 2BVEA 2XXMB 3SY0A 1QFWL 2WKLA 4PJBE 2A6JA 4POUB 4ZS7L 3L3JB 4A38A 3BFOA 1CZ8H 4K3HA 5AVYB 3RZCA 1NCWL 2X6BA 1U95B 4LCWD 4L9LA 3WNLA 4AIZA 1XMEB 4LPYA 1CICB 1EEZA 1NC2B 3VXUA 2HXAA 2YOAA 2EYRA 1X5LA 4WI7A 4ERSH 4XCYB 1RZIA 2DQHL 4ALAL 1S7UB 3CZLA 4QDGA 5JORA 3D2TA 4OLVH 5BXFB 2NYYD 3C2SA 3CSYA 2NR6A 5DVMA 1MLCA 1F90H 2DKMA 3BEWB 3V6OC 3VXMB 4PJFB 1NKRA 3W39A 3H9YA 1M6OA 2WOBA 1YQ2A 3MLUL 5DHVB 4KXZH 3JBG7 5TQ2H 2OZ4A 2J2ZA 4W81A 3EDFA 5DEJA 4S1SH 1O5PA 3P4OB 3TYFB 5GGVY 5J56B 4TSAL 5HHME 4W9CC 5I17A 4W4OA 2EDDA 1QFWH 4ZS7H 1UOLA 4Y19B 2QEJA 1WFJA 3C75A 3NSJA 5H2BB 4Z7OF 1S8DB 2WWKO 4QHLB 4JVUA 2QLVB 3PP4H 1QLRB 2QGEA 3ZMRA 4P57B 1OLLA 3RUGF 3GJEA 1CE6B 2GJPA 4BFEA 3MRIB 2L8AA 2FRGP 1PIGA 5DJYB 1K8IA 4FX5A 2DQHH 3EZJB 1GOGA 5E8DL 4NZUL 4MZRA 3STZA 3BT0A 5F89A 3HR5A 3QUMA 4OLUH 4X8XA 3OJDB 5GRYA 5E08L 1OGTB 5CU5A 4JJHA 3NJKA 5FOJA 2WLJA 3QXWA 3MLUH 1D6EA 2LAAA 1BEYL 1AQMA 1F42A 3GO1L 4ORGB 3MJ9H 5MP6H 2B1AL 3T2QA 5FHBL 4HOXA 1D5MB 1BBJA 4LCWA 1GY1A 2JB6B 3IFPB 4MDJA 3PE9A 1U93B 2HJLA 2I5YL 3C8HA 1M1XB 1R5WB 1CURA 2MQGA 3WNMA 4Q8BA 2XWJA 4XC3L 4K8RD 2B9BA 3VD1A 4NN5B 1IC7L 1SNRA 3FK3A 2OR7A 3N42B 2XQYK 1JYNA 3QULA 5DHEA 2WYZA 1QBBA 3QDMA 4W1TA 1W72A 1CICC 4HV8A 4A63A 4HKXB 3WE6B 1JGEA 4NZUH 3JQOB 5FB8B 1QOKA 3OKKB 3RVXC 5E08H 2D4DA 1T83A 3MU3A 1I31A 4PV9A 5I26A 1WFOA 1F11B 2NXZD 4JKKA 1MAMH 5D2LF 4J3TA 4L4TD 5E5MA 5HHMD 4D2NA 1BEYH 3BUIA 4MJHA 4C58B 1A65A 1X4ZA 4ZO8A 4R5XA 2B1AH 2HLFD 5FHBH 1XGUA 4NZRL 3JSSA 1B9ZA 1FNAA 3UL4A 3MYJA 1SJHB 3O4LD 2JH2A 3PQYE 2I5YH 3QUZD 1GVIA 1N0XL 1O6SB 2JCCE 2N0KA 3DURB 2NTSP 4HS6B 4K7FA 2R1WA 1EZSA 3EYFB 2DQTL 1VSCA 1D9KB 2VAJA 2A9AA 4RMVA 5TH2B 2XNAA 3X17A 1IC7H 1XF2B 2Y1VA 3MRQB 5DD5H 1HAUA 4FNSA 1BQHB 1IFRA 3GSNH 4U1MB 5CLTA 5C8JB 2RIKA 2BVQB 1QSED 5BUPA 3ATBA 5DJZB 4XVJL 1HKLH 3IJ7A 4PJBA 3Q5YA 3BAJA 2ITCA 2BY2A 3RWJA 3HA0A 2BWQA 5MERA 3KLKA 3TASA 3NJJA 4R96B 3ROOA 3STBA 2X0VA 2HSIA 5K9JL 2W5PA 4JFFB 3ARBA 3AITA 4Q6KA 2FIKA 2WXPA 4MVBC 4NDMA 5C0CB 1UWXK 1MCOL 4FQHB 3UROR 1A4CA 5TPWL 5DC0A 4AC2A 5I2IB 5DMIL 4RWYL 4YC2C 4CC0A 1M7IB 1Z32X 2EYSB 1DVXA 2VIRB 3O45A 3VXTB 3HRZB 4HK3J 3SKJL 2W91A 3T77A 4H1LG 3IF1B 3MR9B 5LDUA 5D1ZB 3P2TA 4JGUA 4WEBL 3ZR6A 4F2ME 1SBSL 4OVUA 2XPGB 4M3JA 1HL4A 1U4EA 5FYLH 4GQ9L 3T8XB 1PZ5B 4GXFA 4ZXBB 5EEUA 1IAII 4FMFA 4LCIH 1Z2KA 2BXZA 3FH5A 4L4TA 1CDCA 3T4YB 4EIUA 5KJRH 3TBWB 4XVJH 4MLIA 1OHQA 5FCUH 1FQ9C 4NKMB 3ZQXA 2OK0L 4PJGE 4I3GA 3GLDA 3FONA 3O4LA 3R0MA 1HHKA 3QUZA 1RPUA 5K9JH 1ZT4A 3FRPB 1N5AA 5FGSA 2ITDA 3EFFB 2Y7OA 3MBWB 3GNML 1MCOH 5TPWH 3EHBB 5DMIH 4X4XA 4RWYH 4XN8A 4DKDC 4GAFB 1XF4B 4GAGL 3SKJH 4WGWB 3SBQA 3LNDA 3WMQA 1S7VA 3RVTC 3UIZA 3V5KB 4FXGC 2A6IA 5ADPL 3W5MA 1QSEA 4P2RB 3F7VA 4HXBH 5FM5M 4NHUB 4EZLA 1D9KC 4M56A 1OPGL 3PHAA 4GQ9H 4ZTOL 5F3BB 1M1SA 4MNQD 4ZSOE 4Y1TA 1XH0A 2IDFA 5TD4A 2JJSC 4PRAB 4NKOA 2BNQE 1OLZA 3FRUB 1X6NA 3CUPB 5KWYC 2APFA 3BYTA 1F2XK 2QKIC 3IMTA 2H32B 3P40A 1S9VA 1PZ2A 1WWBX 5LNGA 4LASL 2GPZA 3LV3B 4D9LL 4PJ7F 5C0IA 1UB6A 2CE6A 2O5NA 2EYTB 3UTSD 4K94L 2I25N 5JZ7C 1LQSR 5BJTB 2F8XC 4OIIL 5F0JB 4FHJA 3HC0B 2KLRA 4GAGH 1B0RA 2J6EL 4KROD 2OXHB 3ZJAA 2KHAA 4PQXA 3HRZC 5ADPH 2Y4SA 3A3YB 4IS6A 4PCYA 5D1ZC 3SDCD 2RGSA 3FB5B 2DQGL 1OPGH 2N01B 1LP9B 2BW4A 2BIPA 3BUYB 3BVNB 5C6TL 5L2JB 3GEWB 1TSHA 2WXGA 4HG4J 5C0BB 3HG5A 2X10A 1KJMA 5KG9B 3AG4B 4XCEA 2VM3A 2NY6B 3A4FA 3PQYA 4HF5L 4L8CA 4QLWA 4CBPA 4QRTA 5EU5B 5F9WC 4C4UA 4FQQA 3UABA 1OF2A 1F97A 5HJBA 4LASH 5FGCB 4DNLA 5LGKA 4D9LH 5FO8A 4Q6IB 2UYLB 4DVBA 4K94H 4JPIB 1YCSA 3J8F7 4LEEA 3WS3A 4R7DA 1M3JA 3WTVA 3RU8L 1G6VK 4PLJC 2J6EH 1F3DJ 2OMZB 4LRIA 5FKPB 2COQA 3V7AG 1CG9A 3S7GA 3VTTA 4L3EE 4MNQA 4GBXD 4U0QB 3I6GA 3W11D 4Q4IA 2YD1A 4TL5A 5EBWB 1K3IA 2DQGH 2JV6A 4N1CA 3W9EB 3HC3L 5C6TH 1J0IA 2PETA 4UAOB 2RALA 4QTIL 1BZEA 2XY2A 1U2CA 1C08B 1HNYA 2NY0B 4AXWB 3K8MA 3O2WL 3UTSA 3SKNB 3S0PA 2WO2B 4D0DB 5IF0B 4AQEB 2FECL 1FDLL 1ZOXA 2HH0H 1DDHB 1ZDQA 5J3HD 5CEYA 5C7XL 3LVTA 1ZGLA 3GMPA 2Q6WA 1OCWL 4LIQL 1AHWA 4P2QB 3SDCA 2GITB 3RU8H 5FR3A 1KB9J 5GGRA 1KWGA 4WJ5B 4N90E 3VFRB 4JFWA 1VADB 4C83A 3RTQA 5TE7L 4AGLA 3D69B 2ZUTA 1IJ9A 4PJGA 3O11A 4WO0A 4OVVA 5IOPB 4PJ9C 3EDEA 2H32H 3GUFA 2PP7A 1I75A 5IESL 1RZFL 5DYFA 1HWWA 3CBKB 3HC3H 1KPVA 1J12A 5I75B 5HPOA 4QTIH 1NL0L 5HI4D 1T5KA 2VDNH 4LEOB 5T3XE 2VR3A 3O2WH 5LGHL 1V7NL 1OE1A 2NY6C 4LNRB 4ZUSB 3IDMB 3IJ9A 3FTGA 4HIIB 4MJ6B 4Q97A 5AG8A 2DN7A 1ACXA 1FDLH 1GAFL 5KYUA 2E9BA 3ZVVA 5C7XH 4IDJL 1ZHBA 5FYLE 2VZTA 3MRDB 1MDTA 2JQAA 4LIQH 4Q6IC 4L3ED 2JELL 4ZSOA 2YD6A 3DROA 5TE7H 4FNTA 2BZDA 1NUGA 3JVFC 3TA3D 3LN4B 1A7BA 1S7RB 1MF2L 1Q0EA 2K4AA 5T5FL 4AM0A 3LIZA 5GHWL 1RZFH 4N85A 5FYJL 2IWFA 3BH8A 5JIHA 5T33L 3E8UL 2MOVA 5MHSE 2P5WE 1WD9A 5DHYB 1UXWA 5G4MA 4CSSA 1FG2A 3UTZA 1THCA 4JKPL 4M8RA 3UG3A 4WTQA 3QCUH 3MI6A 5LGHH 1V7NH 1G7PA 4G6JH 3O4OC 3VXMD 4RGNE 2NY0C 4FI8A 4DPCX 1QEXA 3HKFA 2RTTA 4WW1B 1GAFH 4ZMAT 5ICYB 2IBZY 4DP6X 4FG4A 4WLCA 3Q6GL 3FO2A 2Y7NA 1YN7A 4N90D 3LVEA 4MASA 3MJ9A 3BCFA 5CJQH 2YMOA 4X80L 5IJVB 3PGDA 4LOFA 1KDIA 4KI5E 5IQMA 5E2WL 5AVUB 3IEAA 1MNNA 4JO4L 4UQ2B 5IG7B 4ZG1A 3N1FC 1E4XL 1E28A 3TCXA 4XMPH 5EF2A 4A67A 1XAUA 3RKPA 1KTBA 1MF2H 1AD9B 3D9AH 2Q8AL 5I8CA 2ZCLL 3KPSE 4XO8A 3B9VA 4H4NA 5FYJH 4YBQC 3QUYB 5T33H 3B7UX 3E8UH 1XTMA 3JUYA 5F9JB 2VMJA 3FS9A 4O9HH 5I6MA 1ET5A 1PX8A 1IEAA 1WF5A 3LDBB 5AAPA 3ZQ9A 2HLEB 2UV3A 4XNDA 4Z7UB 4JY4B 2X4PA 3H3BC 5FYLD 2G3NA 4L3EA 5ISZB 3GI8L 3B7SA 1UA6L 4D9QD 5I76B 3B3IB 1AXIB 4DGVL 4BXVA 1U3JA 3NFPA 5IB5B 1E4JA 3LN9A 5K9QI 4WU7B 1P4LB 1T5WB 3TA3A 4MD5B 3IGAB 3CPLA 4OF6A 1F6AB 2V9UA 4XE0A 1TEYA 4HJTA 2Z8RA 3QG7H 2YGVA 4XPBH 5E2WH 1YUHA 3LXAA 1E4XH 1BIIB 4AQAB 2ZCLH 4HIHA 4H25B 3VI3F 4KBPA 4M7KL 2X4NA 2YQGA 4KY1H 3TL5A 1JPGB 3ZDZB 5IREA 2K8QA 4JN1L 3VXMA 2CO6B 3LOWA 3GSNA 3HI1B 2CSPA 4WWNA 1ID5I 1S7WA 3GBML 4J39A 3II2A 4OLEA 4KKLD 2APSA 3T0XA 4BWWA 4P23B 1A25A 2DLTA 5IQ7L 3NJXA 3KGSA 4JFQA 1TJHH 3OMAB 4Y2OA 4F37K 4CRPA 4DGVH 2AI0L 3NCJL 2VDPB 4I1NB 4PWEA 3RIKA 2JLPA 4TVPH 3B9KB 4AL8C 2XWBA 4KI5D 5MEPB 3FCGA 4ANUA 4RAUA 5FO9B 4DKAA 3HG2A 4KKCD 4F7EB 5GISL 2H9GB 3CDGA 3WDIA 2WUCH 4MWFB 1R34A 3WKML 4FOMA 4KRLB 3OKOB 2J44A 4LQ1A 3GZKA 2AZAA 1MKFA 1UVQA 3HG1B 4JS7A 2NY2D 3U2JA 2BVOA 2CPUA 3HMWL 4JN1H 2FLMA 3QUYC 2QSQA 4YFDB 4CN4A 3BAIA 2PTTB 3APCA 5AAWC 1BX2B 1NA8A 4F7MB 2HMID 2EUWA 3FBQA 2IH8A 1HSBA 3HE7B 3LDBC 4L2YA 2JB6A 2DRUA 1OTSC 1M9SA 1TNMA 3W2DL 1R4XA 3NCJH 2HX8A 2X4UA 1DJZA 1MW3A 1QI3A 4WI0A 4PGEA 1ZVNA 2GAZB 5HI5D 1UOWA 4ZAKB 5KSAC 1J88A 4AJVA 1IL1A 5GISH 3IJEA 5JOFA 3HTLX 2GIMA 3JYBA 1MLBA 3NDZE 3WKMH 3HI5L 1OTTD 3W9DA 2DYSB 5F1IA 4U2ZA 3WE6A 2FBRA 3U25A 2ATKB 3DJZA 4PJFF 3WNPA 4BK8A 4YJZL 4LMQE 5EZOL 3BVVA 3RI5F 2W60A 5EHFA 3V9FA 3UBFA 3AY2A 3HMWH 3WDHA 1IGYB 4CC1A 5AWNL 2VDPL 3QEHB 5IROC 4PYGA 1RK1B 1NIEA 3WS6C 3WTUA 2Q9OA 3AXIA 1WIUA 4IBLT 25C8H 3DTDA 3KW8A 5DEZA 3W2DH 5EBMA 3S35X 2K6ZA 1W8NA 4ONHA 3WLBA 3QEUA 3WN5B 3CPUA 4Y9EA 3DTXA 5CBAA 4B0MB 1NCAH 1Y0LA 1LO2L 1RFDH 3FJTA 2Y3AA 4JR9L 1MQKL 5E6YA 3DDGA 1I7ZA 2OCJA 4OZHA 4E41E 1LE9A 2GABA 3HI5H 3DMMC 1AGFB 1EV2E 5E4EB 1U33A 4P2RD 1IAOB 5KVGE 5EZOH 5BW7C 1GA2A 1ZSDA 3U4AA 1QVOB 1SEBB 4H26B 1NPJA 1ZPLA 1AMYA 2QQNH 4I0PC 2BCKA 2G5UA 2VDPH 4R96A 5AWNH 5C0JB 2ZICA 1P69B 3V0VA 5JMOC 1HXMB 3C87A 4WKZA 3RJQB 5LNEA 3ECQA 1MRDL 3QORB 3HHRB 4FMVA 2Y5TB 3P0VL 3S6CA 3T4AB 5L2KB 3MV01 4J3OH 4TUKL 4XVSL 3N42F 4QXWA 1QACA 1LO2H 3CXHJ 4JR9H 3D48R 2BCMA 2OMYA 2J5WA 4WTWA 4EPSA 1QW9A 2CLVB 4ZAKC 5AUMB 1L5GA 3T8XA 4M48H 2E47A 4MXQC 4Z7VB 4I1RA 2HX7A 2J6EA 3GLEA 2B14A 4AQ1A 3PG2A 1DJSA 3TBWA 5HP5A 2A99A 1ILUA 1CGYA 2P8MB 3GB7B 4ODTL 8CGTA 5D7IB 1KBWA 4NFDA 5H37G 5C0BD 3SGEH 3BIKB 1YEEL 3QUKA 3ZBMA 3RPIB 2IFGA 4G2AA 4R0LA 5DZJA 3O9WB 1Y18A 3AT9A 1ZVYA 2G75A 5AAMA 3U36A 1MRDH 3P0VH 3S3BB 1EMTL 1JWUB 4Z5RA 2ADJA 3TBSA 2ODHA 3G5WA 4L29A 4TUKH 2XV2A 1U8HB 4PS3A 4XVSH 2L0DA 1R5IA 1T5XA 4E41D 3WN5C 1IGIL 3SJVB 1AQDB 1NGYA 2XV0A 3WFEL 1UH2A 2JI2A 2ALAA 4D3CL 3MV7B 3WMPA 4JM2B 4KKBC 1RJYB 3APMA 4A7GA 1LEGA 1U8PB 5EA0H 2JXMA 5C0EA 4PH8A 3A21A 1ZHKB 2A7BA 4H13C 4PRPD 2C4XA 1ZANH 1KXQA 4YDNA 2QHLA 1E2WA 1R3KB 4TVPE 1T20A 3PFQA 4QJ3B 1PU0A 5CO1A 5D7SH 5KJ7E 4PTTA 2FEDD 3PWLA 5J11C 1OTUD 3SCMA 4BA8A 1B2YA 4YHPA 4TOYL 1XB8A 4OZFH 2FSEA 2X7LA 1H5BA 1LEKA 2MHAB 2CJTA 2DWTA 3BN9D 1GGUA 1EMTH 4LFHD 5BS0B 2O6FA 3CVDA 3DVGB 1OF0A 4J8RB 5B3JF 4KNTA 5A6LA 3T4AC 4ZMVA 4YHKL 2WLKA 5IJDC 4AMXA 1NOFA 3OKEB 1NDGA 1IGIH 2HA1A 5CJOL 5C2UB 3VACA 1Z9SA 2G60L 4UQAA 3WFEH 5KTEL 1IVLA 4JRYB 4D3CH 3FB7B 4P5MB 4OLXL 2W1NA 4JO5A 4NO0D 1FNHA 3GMQA 1RPKA 3QZMA 5L7XH 3UPAA 4WHTB 3SKOA 4LLMA 1BJ8A 1M6UA 5I6KA 2IPKA 5EBLB 4OZ4B 4TOYH 2OR8A 1RUKL 3QIUD 4KJPD 5K33A 4PWFA 4E41A 1T2XA 5HVHB 2F08A 2XXGA 1FH2A 1OCCB 2A6DB 4UU9A 2PTVA 5T1JA 2D7MA 1LNUA 4HT1H 4EQ3A 4KTYA 5CEXA 3ARTA 4LF3B 4P8QA 4X7EC 2V3DA 4GSDL 3OR7A 3O6KL 3ESVF 3FO9B 3PCYA 1MNUL 1KNOA 1CFVH 4D8OA 1QR1A 2OTWA 3NZSA 4PRPA 1PBYA 2ZUXA 4KK5D 5F6HJ 4JNXA 1O7DE 2FIRT 3LN5A 2XG4A 3US1A 2ZSVA 1M05A 4TVPD 3N1GC 2XWEA 1R19A 4MD4A 3RBGA 3VI4E 4JUSA 3B9DA 2J1ZA 3KJ4B 5LBGA 4AXWA 2BXYA 4NO5A 4BDVB 1EWHA 2EEFA 2YEVB 2FSDA 3S9DB 3T1WA 5HHPB 4GKLA 1MCQA 2EVIA 4KKNA 4UT9L 4QJ5B 5IQLA 3SO3C 4XP4L 1RUKH 1HEJC 1GR7A 3QO1A 3ZK0A 4QY8A 3KLHD 4PGJA 2C3VB 4JDVA 3NEXA 4GP8B 1HE8A 4NQCE 5HPMB 2WTPA 4IGBD 1OB1B 1T04B 4G1MA 3C2AL 1LP9F 1F0LA 3O6KH 2OTUA 3LYRA 1UZ6F 1GC1L 3EYUL 1TQBC 4NO0A 3VMOA 1HDMA 3DIFA 4NQEB 3X13B 5IB1A 4KX8A 5JXED 1I8IB 5DUJA 5IB4B 1KIUA 2C3HA 3QIUA 1AG6A 1KLUB 2NUPB 1A4KA 2OJEA 4WK4B 4XP4H 5AB9A 3PREA 4XMKL 1A7QL 1ZY9A 1HHIB 2FJGA 3A6BH 4QHMA 5FKAA 1HTYA 3FQUA 4CNIA 2CXKA 4JDEB 2AXWA 2BNUB 4IU2B 1NCTA 2UVFA 3V4PL 2DTML 1AGCB 1WV7T 3MLVL 1UXSB 2F53B 3C2AH 3IRCA 3EBHA 3OM3B 1Q9WA 3POHA 2LR4A 3EYUH 1GC1H 1L9OA 2R2BA 3QIWA 1CXKA 2ICWJ 1HHGA 4K7PX 3SDXE 3W38A 3CMOL 4GO6B 4WI9A 2O61A 4WJKB 5KSUB 3FUIA 1JYXA 5SX5H 1DQTA 4D0CA 1ZLUK 4G43A 2FYYB 1XSIA 2AV1B 5DUBA 1JNJA 1DL7H 2VL5A 3JVGC 1FGNL 3TO2B 1XV8A 2X42A 1IRAY 1SXBA 3L9YA 4I2XE 4IGBA 4X9FA 3Q2CA 4LHJB 3UCQA 1YY8A 5IQ9A 1LVEA 1A7QH 2IH1A 3DBXB 1N59A 4FFYL 3D0LB 3V4PH 2DTMH 4RVBA 1C5BH 3MLVH 5ID1A 1CD9B 1FLRL 2K8MA 3B9KD 1GY2A 3L6FB 1E27B 5AW7B 3T0EE 3US0A 4UT7L 4PV1C 1HNFA 1ZA3B 3ZDXB 2EECA 2DQJH 2AEQL 5CN3A 4OCXL 4BFIA 5JIKA 5JXEA 5AOZA 1K4CA 1RZJL 2Y2WA 2GEEA 4J3OD 1JZ5A 3E80A 4LRNL 3GM0A 3OB0H 3TNMA 4WGKA 5FDWA 2NW3B 3E9TA 1Q0XL 4HW6A 5DMKB 3RB7A 4NM4H 3DX9A 4RSYA 3GS7A 1GZPA 4PI2A 1G7IA 1GGIH 4R84A 4LOEA 4G9FB 3FUHA 5BRQA 4QKXB 1FGNH 4WHCA 3S4SG 4OKDA 4ODHL 2VOTA 2H1XA 2OX5B 3H2QA 4QLRA 3UZEC 4Z3FA 4DO6A 5TDPB 5ABAA 5E2JA 3VI4A 2HVBA 3CX5J 3MMEA 1NC4B 1XX9C 1UD5A 4FI7A 2OMXB 3BKCH 4UT7H 1BPLB 5F7UA 3EO1B 2WKOA 3ZE2E 1NGWA 2AEQH 2DQEL 3G04A 2HVKB 4M1CC 4HAKA 4OCXH 1U8CB 3C5JB 3WN6A 5IHUH 5I6OA 4HKJA 1RZJH 2V2WB 2DKUA 3BKYL 4N5ED 5E23A 4LRNH 4NC0B 3L7FB 1MCBA 1D2PA 1Q0XH 3D08A 4JHWL 1UB5A 1WJ3A 4KUCF 1AO7E 3EFOB 3DSNB 4M5ZH 4B9GA 4JFDB 4NQCA 4MCYB 4YIQB 4A04A 3K80A 1KUMA 2RACA 1NJ9A 5CWSA 1KIPB 3Q2WA 1W8EA 4ZUVA 1LO5B 2ZOLB 4ZUTA 1I8LC 1H0DB 2O26U 4ZUUA 1BBDL 2VXTL 5T1MB 1N9PA 3LY6A 5CP7B 4ODHH 4AVJA 4HETA 2CRIA 1KYFA 1NANI 4L18A 2ZG1A 2MPAL 4FFVC 1VENA 1N12A 4K71C 4CMMA 3ME0A 5CJ8A 3WIFB 5EULV 2YRZA 5D7LB 1JWMA 2V7HB 2IIJA 4LKCA 4FQ2H 5JW4Q 4U7KA 1EUUA 4XHJD 2W94A 1NM9A 4FG0A 5AVRB 2FO4B 2VJXA 4UILL 1RP8A 4GMSH 1ZS8A 2OFQA 1GGBL 2R4SH 1KTCA 3AUVA 4N8CH 3WENA 4KJYA 4U6YB 2BH0A 4JHWH 1N2RA 2NX5E 3R1GH 5DYOA 1IGCL 2BOLA 3O3EA 1E9OB 4Z95H 1YDPB 3T0BA 5HGHB 2V3EA 4P99A 4G8EB 1WQVT 5I8OL 3KWUA 1BBDH 1OP3K 3SQRA 3U4KA 2VUKA 4PGBB 2H2SC 4YSOA 3OSKA 3WDJA 1B4RA 1BF8A 5GGVH 1FV1A 3PNWB 1NCGA 3SDXA 4X4ME 3ML9A 1N8ZB 1YN6B 2GYSA 1CBVL 1EFXD 2F7PA 2YD3A 4HUWB 1TTCA 2XIBA 4EZMA 4AKOA 3ULUC 3H8NA 3R19A 1MAKA 1NEZG 2OR9H 1KEGH 4B7IA 1OSPH 5D72L 3U6RA 4YLQT 2XG5B 2CUAA 2WWMD 2B77A 4CVUA 2GY7B 3GINA 2VZ1A 3O6LL 2VN4A 1OSEA 2ICWB 4TQIA 2C9SA 2E9GA 3I02B 4KRNA 3U0TB 4NKDB 3T0EA 1U21A 3EKCA 2X4TA 1YMME 3KPRE 2J56A 4JFOA 6FABH 4AIEA 2F15A 4JPWH 3VM5A 4OZFA 4O5LH 4JMNA 4YHIB 1QZ1A 3ULVC 2B1HL 3TC9A 1ORSA 5HGAB 4UDTA 1A47A 1CYGA 1NGXB 4DT2A 1CBVH 3B3BA 3P3RA 3TWYA 3QQ9C 2NNAB 3EIFA 3GJFK 5F7EL 3SYOA 2DLIA 5IBLD 1BJMA 2W0LA 3IJ8A 1QR4A 4NQXB 4B9KC 1JK8B 2NX5D 3MVSA 4A2LA 2X4QA 5D1XE 5D72H 1CR9H 3CQQA 4JM2D 5KSBB 1OB0A 4R97C 2VMCA 3MV8D 3P9MB 3TH3T 4UF7C 1KC5L 4P9HL 2PCFA 3CXFA 4UYPA 5KYWA 3O6LH 4FXKB 2YK1L 3DVNB 3PUCA 3TT1L 4ELKA 5HJ3A 1JHTA 3BZ4B 1DLHB 1EFXA 1VPOL 5BS0D 3GMLB 1M3IA 2AJZA 2B1HH 5F3HA 2MKLC 4MRCA 2GFBA 1PD1A 3RUGE 3T6WA 5AD0B 3KPQA 3U0WL 5F7EH 3M07A 5C07B 4F7CA 2CZNA 3TBCA 2R2EB 5A1AA 1RXLA 3AREA 3HOGA 3QJFA 5ENWA 2YRLA 3RYMA 2VQ1A 2RHEA 4A7VA 1AI1L 4ZZKA 2X4SA 2DQIL 1DCEA 4JY6B 3U30B 3IKCA 3WFZA 2ZONA 3MRMB 3ZTNH 1KC5H 4P9HH 5CEZE 3G3LA 1CTMA 4N8VA 1YMMD 4NJAH 2ISDA 2R1YB 2YK1H 2EAEA 1D5RA 2YOCA 4QRPD 5JNYA 3PJNA 1AQKH 2AERT 4OBSA 4R3SB 1VPOH 4WW2B 4PJHB 3EGXA 3HC4L 4NSKB 3GLAA 3AS2A 4CDGC 2HFEA 4I87A 2VDKB 4ODSL 1SYVB 4YSAA 5CGTA 2NX5A 3IRPX 4O2CB 3CBJB 3V7MA 4NX0A 3MRLA 4M1DL 1FJ1A 5AOJA 2A4ZA 2ED7A 1JZIA 3JTSA 3Q6FB 2YQBA 4BFRA 5HYJB 4MAYB 3DX3A 4BK5C 2DI9A 3MV8A 5LCVL 4KJWC 3SHSA 3LSOB 4ZMTA 5KN5A 1WBZB 3QCVL 3H0TB 4ZQTA 5D5MB 1NDMA 2HX9A 1DVUA 1AI1H 3EOYG 3QXAA 4HWZA 2V8LA 2DM7A 2DQIH 4ILDA 4P49A 1OM3L 2AXGB 1YAIA 4X5RA 5D2LE 4ZMZA 3E8VA 4CC4C 5EO9A 5EU3B 4N0UE 1EPFA 3N91A 4J12A 2IQAB 2OMUB 4X4MA 1NTDA 2X2YA 1O7VA 1RI8A 1EEYB 3VAEA 4BSWA 2H7WA 4LCYA 2PYED 5GSVB 1U8JB 4MZ2A 3FTYA 2G30A 1OAUH 3IMUA 1MHCB 4WSGA 4YHNA 3UAEA 1ND0A 1QTPA 4P2OB 5AB2A 4K9EL 4DN3L 4YWGL 1PS3A 2XTJE 4ODSH 1GSKA 3VD7A 2NNRA 1CPUA 3T3MB 1AYOA 4K5MA 4M1DH 1WHOA 5D7IF 4OD3L 1J9CT 3OGCA 5F0LB 4HC1L 1IAKB 4Y9FA 1MJUL 4O51B 1CFTB 2WMPB 2Q5BA 3QCVH 1K6QL 3BKJH 2O5XL 4K9EC 4LARL 1YMMA 3Q1SL 4E5XA 3KPRA 2R0LL 4AKPA 4IOFC 3ARVA 3FTUA 5AKTA 3IFNL 4YQXL 4QRPA 4BHUI 4BGDA 4MCNA 3UBXB 5DK2A 2ENSA 3C60C 4NUGH 3N6YA 4KMQA 2LU7A 4JFSA 4R4ND 2VDKL 1YEFH 2N3JA 3PDOB 4QRUA 4OF5A 3RIAK 3EG9B 4HCGA 3L13A 4IBVA 2UZPA 3Q48A 3F2LA 4G9DB 4DN3H 1W2KT 4YWGH 4MXVF 1OT4A 1OW0A 1UCBH 4WW2C 1JN6B 3BWSA 3R8QA 3QG6B 4DERA 2VM9A 5KZCD 5INCA 4JO1L 2X6MA 2O93L 1WT5A 3V4PA 4YFLI 1KJ3L 1Q1PA 2P3YA 4OD3H 3JV6A 1ORQA 4UBDC 4HC1H 2YR3A 5CILL 4EN3C 1MJUH 2H0EA 1NWPA 1K6QH 1SHSA 5F1OB 1XF5B 1C9SA 2GK2A 3P4NA 4MAYC 4OM1L 3U2IA 4LARH 3Q1SH 1NCUA 2APTA 3U9WA 3ESPA 2PYEA 4FXTA 3IFNH 1PJWA 4YQXH 1DQKA 1UD4A 3POCA 4FNLL 5C0RH 1TUPA 1WD8A 3BD5A 3KDMA 1FVEA 3QXTA 3A4EA 3QCTL 4XBPA 3N1QC 1UFUA 2X6AA 4HJUA 1B0GA 4GXVL 5HPMA 1ZLVK 1AKJB 3TCTA 3K6OA 1Q38A 3LEVL 4EJ1C 3IVKA 4NZ8A 1OARL 5CU9A 1IBBA 1AKPA 4LVNB 3KCWA 4HH8A 3HZVB 1KJ3H 3WTWA 1E5UI 2ADIB 2UWEB 4IRJB 4YK4C 4QTHB 5DC4B 3FU9A 2VSMB 4OM1H 4GUQA 2VXSL 4FEIA 4PB9L 4FNLH 2ICES 3MO1B 4TVSa 4M3KB 1JWSB 1UWEL 1KPRB 4MMYA 5CGYC 4CKQA 4PJ7E 3TBYB 4RNRB 4BKLB 1HHIA 4HK0B 4G9FD 4URKA 4GXVH 4PGCA 3I50L 2L7UA 1K2DA 3QWOB 1IT9L 1U8MA 3G5ZA 4F58L 2WM0A 1IB5A 1ZHNA 4BBWA 1TPXB 1WUZA 2NZIA 1YY9D 5C08E 2NQCA 5I1JL 3UBGA 1MHHB 5D2LA 4IBUA 1RZ8A 3M17A 1QHQA 5K39A 3ZRSA 5BQ7A 5IMLB 4HGWA 4S1DD 3SE9L 1AXTL 1WG3A 1HOCB 1R24A 3L54A 4ACTA 1VA9A 4X6DB 4YS4A 2VXSH 2Y7MA 2Q86B 1ZEAL 3HUJA 5DC9B 3A22A 3IMBA 2WBKA 2EIDA 5IQOA 3JWOC 5KVFL 4MCZB 3OWRA 4XNUL 1KJ2H 5F71A 1UWEH 2DWSA 3BAEL 2ZWNA 1JP5A 4HIPA 1MVUA 4UZUA 2FO8A 2GC7C 1DVFB 4PCTA 4U1JB 1PZBA 3VG9C 3N06B 4QRQA 3QJHB 2RB8A 2DMCA 4ZMLA 3I50H 1IT9H 4BZ1L 2I27N 2EO9A 3ILDA 5DRXA 2DM2A 5GGUB 4E9XA 1JNLL 5IEKA 3X3GH 5I1JH 1VDGA 1CUOA 3DPBA 3UDWA 1L0PA 4F91B 5D93B 3G6JB 4LSTL 3TFKC 2DDQL 3NESA 3SDDC 1INEL 4PRIB 5DO2C 4PGDB 3FO1A 3G6DL 4IRJC 4CILA 1FIGH 1NAMB 1ZEAH 4X8GA 5H4ZA 5KBLA 5L4FA 2D31A 2DI8A 3MA9H 3MGAA 5E9NA 2F54B 1RUPL 5BV7B 4GP5B 3BAEH 1BECA 3SDAC 3MRPB 3MXVH 3HAEH 1DLFL 1OKEA 2GJJA 4L3FA 1FSKB 1BM7A 4MZIA 4S1RL 1NEZB 2C1OB 2J6WA 3TFBA 1NZRA 3LEXA 4BZ1H 1WE5A 4W93A 4AG4L 3KJ6H 1S5HB 5FYJU 1NGZA 1JNLH 5D71L 5K9KA 3MACL 5E6IB 1UYWL 2V2WA 3R4RA 4GQPH 1V7ML 2B1OA 5DZLA 5AVZB 1PG7L 3ARDB 3NCCB 3R18A 4JM4L 4LSTH 4DCQA 4G1EA 1DP0A 1S78D 1DDTA 4L8DB 4M61B 3BD4A 1A3RL 1KTDA 1HHHB 4XRCA 1QO3B 5EU7E 3L17A 3G6DH 5C3TA 3KR3H 2DWEA 1USQA 3RWGA 4O58L 4AE1A 1D5ZB 1KCBA 1NMAL 2R2CA 3FDWA 1S2EA 2C9VA 1RUPH 4IMKC 5BRZD 1H0DA 3RWFB 2DWYA 4U6HB 1EK3A 4JKMA 3PS6A 1HC1A 1DLFH 4TN9A 4JZOB 1JGUL 5E4IA 5I1LB 5ITBH 1VACA 2UZIL 4S1RH 1I3RB 5IQNA 3QZPA 4UTCA 4POZC 1CE1L 1DUZA 3ZDXF 6PAZA 2FT7A 3PWNA 1A6AB 4AG4H 3DJTA 2JKJA 1HQRB 2HT2D 4RAVB 2P9RA 2B5IB 1NAML 3B9EA 3BVTA 1SJEB 1UYWH 1EJFA 1V7MH 5HHOE 5J6GA 1PG7H 2PNDA 4JM4H 1ZS2A 5HDBB 5I71B 2EXWC 1UJ3B 3NACL 1A3RH 5AW5B 5GGTL 4EOWL 2OMVA 5DWUH 1BZ7A 3JZ7A 4FNQA 4Z7QF 2WV3A 2Z6FA 3BP5A 4RMWA 4BFJA 2M2DA 2GJ6D 2NY3C 3C6SB 3K81A 3G08A 4O58H 4ZOAA 1NMAH 2JJUA 3GHBH 1XF3B 4MS8D 2R0KL 4N0CC 3ZKMC 5JLZB 3AS0A 3CFEA 5F70A 1YNLL 4UNUA 4KU1A 3RB5A 5BV7C 4DSYA 1JGUH 4UQCA 5BZXA 1LL1A 2UZIH 2XN1A 4CN6A 2H6UA 3ULUF 3MJGX 5ECGA 1HCVA 3O3DB 1QTSA 4DO5A 1FSKC 4G7VL 3G5XB 1DVYA 3SPVA 1T7WA 1QKZL 4MBRA 4OKVB 4RGMC 2BC4B 3A6CL 4M93B 3BESR 4X5XA 3B8YA 4OV5A 2EIEA 1NAMH 1OVZA 2W95A 1FFPB 4GAYB 4HOWA 2XFXA 3LPFA 1X5HA 4L9DA 3FHQA 4JE4B 1KYAA 5JHDE 1DQJB 1BEXA 4Z3EA 3ARDC 2APXA 1ZJBA 5BRZA 4EOWH 3QXUA 1HJCA 5F1NA 4K7PY 1KZQA 4XVTL 5BQDA 4UB0L 1RSFA 2Q3XA 1E9QB 2R0KH 3ULVF 2BS8A 1Z0NA 2JIXB 4LL1A 1YNLH 4NPYA 1KB5B 4IK6A 1L9NA 4Y9BA 4HJGB 4Z3IA 4ZFFA 4IU3B 2EO1A 1HILA 2X2HA 3K1DA 4Y5XB 4GRWB 4DP5X 2HUEA 1S6NA 3GRGA 3WJMB 1CDHA 3GSXA 4G7VH 4AGOA 1J10A 4WNSA 4AJWA 5BMFL 1QKZH 2PWEA 1S7SA 4MJIE 3U82B 2XN2A 2VMFA 3V6OE 3JV4B 3A6CH 4KJQC 4N2BA 4RLDA 2GTZB 4NUMA 5TFSL 1ZLSL 3BOVA 4X7DC 2IQ9H 4AWJC 4FI6A 1IM9A 3CVHB 2AAVA 4Z0XA 1X4XA 5GGSA 3MX0A 2GJ6A 5M94B 4RISL 1DQIA 2BIOA 2DQFB 3QRGL 2V6HA 1IVTA 1PKOA 4WAFA 4MMZC 1UJ3C 4OD2A 3M45A 3EYQD 3KD4A 2WZ6A 4UB0H 2X0WA 4HH9B 4XVTH 5AEAA 3IMRA 3TJHC 2W38A 2SEBA 5DJ2A 1AMXA 4W9GC 4GW5B 2EDWA 2FWUA 1EXHA 3OXSB 4UI2A 3TBVB 2CGRL 3OAWA 1LD9A 3WGVB 1IARB 2NDGA 3ILEA 3MRNA 3X1FA 1JCVA 4U1LB 3SE3C 1CFQA 4P2OD 5BMFH 2YQ3A 2I60L 3QVAA 3CFDA 4Q7DA 5IJKA 2BP0A 3ECBA 2J71A 2Y2YA 1GXEA 4M93C 4MLSA 3KS0H 4R4BB 2Z1KA 5J1SC 1NGQL 4KHXL 2ZXCA 1N3NA 1KB5L 1IBHA 1MCWM 2QR0B 5DJ8A 1MCPL 4HC1A 3RWHB 1ADQL 1JBJA 1BXAA 2BMKB 5AG9A 4TXVB 3WFBH 2DBJA 1OPOA 4XNYL 3MA7A 3I84A 2Q76B 3C6LB 2LOEA 1GS6X 2NCMA 4LHUD 4EI6A 1MI5D 2BY0A 1BGXL 1XR8A 5TJWK 2CGRH 3BE1L 3CVHL 4MJID 5C0DB 5EO0A 4KKPA 1GMIA 3WIIL 1C5DB 3PPEA 4NYLB 4ZFZB 3FFCD 3H7BA 5KSBF 5EZLB 3GQFA 3RGBA 2PMZA 1BD2B 1XDTT 3I9AA 4PJFE 5EOCH 4N2HA 1B6UA 1EJOL 5TE4L 5I30L 4WO4C 1PY0A 1NGQH 2XA8L 1I1YA 4MDIB 3IDXH 1RJCA 4F8PA 4ABVA 3RVUC 3DX6A 3NCXA 4Q2ZB 1ADQH 2C1PB 1EGJH 2L7EA 4GRWH 3K8KA 4Y19E 1NUFA 1IE5A 1C7TA 2CGZA 2IPUG 2D7OA 1FL3A 3UBHA 3VCLB 3KBFA 5JYLA 2FX8L 2ITEA 2Q20A 3DYMA 1L0XA 1NEUA 2CIKB 2LLLA 2K9FB 2R27A 1E8ZA 2O5ZL 3BE1H 1TQVA 1QLEB 1V3MA 3CVHH 3QS3A 4DEPB 2I7OA 5LXGL 5AW3B 1WLHA 4OGYL 1NBZB 1FO0B 4DPRA 1D7DA 3WIIH 2NY5L 5DZNA 3O0LA 1CFTA 4MA3A 1MCHA 5TE4H 1EJOH 2VZOA 5I30H 1OGAB 3HBPA 1CGWA 1J8SA 2XA8H 2W59A 3KM2A 3IE4A 4HD5A 5F96L 3REVA 1KT2B 2NTFB 2TSAA 1AOZA 3MGTA 4LHUA 2BWIA 1MI5A 2WZ0A 3FAXA 1QRKA 2V9TA 3AZUA 5CCHE 3CCHA 3E1ZA 1RJZB 4AVKA 2EDNA 3VRLF 4WW2F 3DI2B 4PJHF 3UTQB 4MJIA 3VFTA 3BUTA 3V6OA 5FM4A 2IAMB 3VFPB 3KWWA 2FX8H 5J7CC 3WHE0 5DQDL 1KJ2A 3C6LC 2O5ZH 3FFCA 4PRHB 5E56A 5B7FA 4OGYH 3MGOB 4BK4A 1TFHA 2OJZH 5GXBB 5SWZB 3MCKA 2NY5H 1TMCB 4G11A 4FHBD 2BFVL 4UQDA 2J8UF 4YZWA 1RZKL 5D5MF 4NP9A 2K7QA 3BX7C 3JWNC 1BVZA 4NQDB 2BNRB 4X7TA 2ICCA 3GSQA 2JB5L 2PW1A 5BVJA 4P05A 2CCVA 5ICUA 1UH3A 1U3HB 4HUMB 4GINA 1UJTA 3RFRA 4WK0B 2VKXA 2OMTA 3FSAA 4P4KB 4FTDA 5EC1B 3NYKA 1E2VA 2XX1A 1QLEL 2JTDA 2VABA 4S10A 3L9RB 1FO0L 3RWIB 1WC7B 2NY4D 1MFCL 4XVUC 3AXLA 4KRPB 4MB5A 4C56E 4AYID 5DMGD 2YA2A 5CZKA 2DYRB 5GRUL 1Y6KR 1PDKA 2C9RA 5DQDH 3BWAA 3WU1A 4AENA 1AHKA 1HNGA 3T3MF 2AHIA 1K3ZA 3GM8A 3HAEA 4XAKD 2CDFB 1PYWA 4QEGA 1PGRB 2BFVH 4QIRA 2WNWA 2ZX7A 1RZKH 2I9LB 2D3JA 3DSFL 4J3UA 1PVHA 3WYRA 2G0KA 1KIQA 4LGPB 1LTXA 2F19H 2JB5H 4RGOH 4WGVB 3VFUB 2AC0A 5JIPA 3T1FA 4IM8A 1KEML 3VQ2C 4N2LA 1UUNA 2K6WA 1A1NB 2FT6A 4JFFE 4WEMB 5BZWA 4YDLB 1COBA 1CVRA 3HZMB 4MA8L 1JWSA 1B90A 3MRRA 1QLEH 4N86A 15C8H 2FATL 3KPOA 3QJOA 1FO0H 1QFWM 5T1KB 3CDZB 1D7BA 3I9GL 4MNGE 3U9PL 4F5CE 4JANA 3WUWB 5GRUH 1RV6X 4QRFA 1YECL 5B3JE 3UC0L 1IIKA 5FAAA 5D2NB 3WELA 1G9ML 4LAQL 1M71B 5G55A 2DV6A 1BQUA 2F61A 3Q8FA 3GSOB 2NRDA 1EO5A 1IJNA 4KUZH 4ODUA 1NM4A 1Q9LB 4LLYB 3T09A 3B8SA 2C3WA 2AQ2A 1QWHA 3CE1A 2OI9B 1KEMH 5EOQL 4QRBA 5IHZA 3MOQA 3APDA 5SV4A 1UEMA 4W9FC 2ZUYA 1H6FA 1A2YB 3FUDA 4Y2DC 3VD3A 3OKDB 1U3HC 2IPUK 1CLZL 3QR2A 1BFOB 3OC8A 4JFTA 4MA8H 4TUUA 2EDQA 2A9NL 5CCKH 2BP8A 3B2UD 1AGBB 4EIGB 4P4KC 1K8DA 3BGFB 2OSXA 4ZODA 3DOSB 1T2QH 1VGKB 1VEPA 3C5SB 3I9GH 5FFLA 2D4FA 2GJZA 4U1KA 4AYFA 2WO3B 2CO3A 1M53A 3UC0H 1FZKB 2IDTA 4AL8H 1MXGA 4R4FL 3O6FC 4LAQH 3DOIA 1FNLA 4U3SA 3EDJA 2CU9A 2DJMA 2UWEF 2ZKXA 2JQZA 2MOGA 2Z8VC 3FTSA 2Y07L 2P8PB 3DO7B 3ZL1A 3GMMA 3L5IA 2AJVL 2FTAA 2CM6A 4MD0B 4CA4A 2X2JA 3DTUB 4J1UB 3N44B 3QZNA 1ZE3C 2V3FA 4MMXB 1I85C 2YJLA 2KZWA 3NSCA 4WFED 2A9NH 4CMHC 3T04D 1XWVA 4ZRGA 4I8DA 3TVMC 1CMOA 4HSCX 1MW0A 4KZEH 1HI6A 5E94B 1M2VA 2YAEA 3EH3B 3LB6C 4NRZA 5IK3B 5GS1B 3NBNA 2E6QA 1F4WH 5L4IA 1J0ZA 1IKNC 5I19H 1QFHA 2WBXA 4DN4L 3MRBA 4NRXB 3D3VB 1LP9E 4R4FH 1FL5A 3MJ8A 1EUTA 4U1GB 1UZ6E 1FFOA 3IU3B 1T0MA 5KOVC 1PY9A 4JQXC 2WZPA 1IM3B 1SJXA 4NFBA 4GAJL 4X6DF 1DFBL 3L5XL 1KYOJ 2ED9A 2EJ1A 3ATEA 1KBPA 2XYBA 5AW8B 1LEIB 3ES6A 4FXGA 5DRZA 2B9AA 5CM1A 3MBEC 4GW1B 3C12A 2YGPA 4WI4A 4C56A 4L3CB 3ESUF 2OI9C 3F5WA 4LSVL 1V55B 4LL4A 4ORZC 2JJSA 1F2QA 4DQOL 5MEOB 4K5OA 1ZT7A 3EBGA 4BH7B 2ZPKL 1ULVA 3LXCA 4N0YL 2QKIA 5ESAB 2FK9A 3F7QA 4F1ZA 3T0WA 2A1WL 2K1MA 4JQIH 2KQNA 3B83A 2C9QA 2JCWA 3OKNB 4DN4H 5AB1A 5E0FA 3VFNB 1H15B 4LBEB 4FCAA 3ZMNA 1UD8A 4QHUB 1G1YA 5TF1L 3MPCA 3WBDA 2Y69B 3QYNA 3KPTA 3NSFA 3QA3B 1J11A 4GAJH 2PYFA 1CDYA 3L5XH 4FG6C 4FEMA 2NCEA 3ZIYA 1KGCD 2D7NA 3GMNA 4MNGA 3S96B 4F5CA 1QZNA 2VDRB 5CIPH 1AH1A 2BK8A 3TPUB 4LSVH 4OJCA 4NNYA 4PJ5E 4X99A 1X5FA 1PKQB 2R9HD 4P4RB 2CJSA 5K1NA 4MMXC 4JAMB 5FK9A 4QRRB 3CZKA 4H8WL 4Y4FB 4P2QE 1AC0A 5T1LA 4DQOH 4PJ9D 3FFOA 4H1LH 4D7PA 2ZPKH 4CADA 2N1TE 3BPLC 1HQ4B 4N0YH 3WAJA 1CFBA 3GSVA 1J1XH 4WFFE 2A4EA 3LNFA 5GS1C 2A1WH 2EE2A 4DETA 1N19A 2KMWA 5I1KL 3Q43A 3GKWH 2WTOA 5AENA 5E2TH 1MCRA 1LE5A 2ENYA 1MEXL 4HKZA 3IM1A 5DJ6A 4NCC1 3VFOB 5TF1H 4KI1A 4PREA 2D3VA 1Q94B 4JHAL 5C71A 4WWPA 3C9NA 3MNVA 3UC2A 1O9VA 1XGTA 2O6PA 4HP5A 4NQTA 3D2UD 3Q05A 2XZQL 3ELAT 2GHZA 3AWFA 1K4DB 1PL3A 4XCCH 2OV0A 1RK0B 3EOBA 3RNKA 4AZUA 2VRQA 1KIRB 4XP1L 1BJ1H 2CO4A 3PP3K 3MBXH 3HS8A 4H8WH 1UEYA 4KH9A 4KXBA 4HLJA 5HYQB 5DEGB 4FYSA 1SOKA 5FYKL 1D7FA 1ADQA 2L7QA 4WI5A 1EGJA 1DQQA 4DKEL 5GZND 4EQ2A 2HTLC 2EIMB 5I1KH 3DWTA 2H8PA 2CBPA 1H3UA 2FDBP 2O4EA 2OW7A 1XGQA 1MG3C 1T7YA 4BWTA 2J1YA 1ZJAA 2VE6A 2VDRL 1BXXA 3HCVA 3TEYA 4DAGL 4NPKA 5DUPH 1I8MA 5F7WC 4B9YA 5MENB 3VRIA 3WL9B 1FZMB 5K5YA 1NFDB 5DD3L 2XZQH 4B9FA 3C8DA 1MN4A 5BVPL 3VH8A 4LDLB 4PJ9A 4HEMA 4DZBB 3U2SA 3L2MA 2WP3T 4TPRL 1AR1D 2YS4A 3TURA 2B2XL 3KPMA 3DIVA 1S9KC 4YXLL 1CU4L 1IILE 3FUJA 4Y4KC 1A9VA 4AGNA 4PJ8D 4WFFD 4OGAD 4XCNA 5D55A 4C4KT 2ZXEB 4NBZB 3CSTA 4Y4FC 3VGFA 1V10A 4PSPA 1I3GL 1VHPA 5J13B 5JOEA 4BFBD 1AE6L 3RL2B 4TTDD 2VXVL 4WV1B 1U2YA 2HG5B 3D2UA 2X3CA 4EVNA 3DGGA 3LRHA 4OZIB 3WNIA 1I1AC 4DAGH 3CZSA 2FZ3B 1QA9B 1FYTD 1NOAA 3QNXB 1GIGL 1C7SA 2CBTA 1N64L 3H42L 2AK4D 5DD3H 5FO2A 1I82A 4X42A 5BVPH 2WGNB 2ZAIA 3B56A 1OGAD 5ISZE 4PPTA 1IEBA 4MKTA 4W9KC 2VB5A 1RUML 3PDGA 4GXUN 1DN0A 4YDIH 5IIEA 5G2NA 1M7DB 2B2XH 4FFWD 2WXHA 4Z78A 4JPVL 5GZNA 1CU4H 3AWEA 4ZOEA 3ZT5A 1QBAA 2GCYA 2JKRM 3CH1B 2F6AA 3IMVA 3L95B 3BJ91 1WFNA 4NQSA 5IEHA 4AV4A 1T1XB 4N2KA 2XOTA 1K5NB 1I3GH 3L9EA 4NI6A 4UOW1 5EFIB 4NZTL 4PVBA 1WFMA 1AE6H 3M86A 4X0KB 5D96B 4Z8FL 3KMDA 2VXVH 2GY5A 1BSIA 1I53A 3FCSB 4G8GB 1YA5A 4KVCL 1BFVH 4RRPM 1IX2A 4S2SA 2JK5A 4Z7NF 1ZGLP 1FE8L 4JL2A 2I07B 3FT4B 4F93B 4PJ5A 3QHZH 1F3RB 3U0PA 1HCFX 4PG9B 4NNXB 4QI3A 5B39B 4JZJB 1N64H 3H42H 3EOAA 1B9KA 4A2GA 4A7TA 2D8KA 4PJ8A 2GSGA 1YZZA 3PGFL 4ODWA 4XMUA 4A37A 1RUMH 5F7NC 4L8BA 2Q7YB 1XTLA 4N2NA 3VCLA 1CXIA 2JKTM 3UEQA 2KZKA 3GDCA 3S34H 2NQDA 3HVDA 2RH0A 4LLVB 4X6EB 4QD2E 4L5FL 4P5TD 1ZT1A 4U1SB 1XB6A 3U6XS 4KRPD 4NZTH 4ZJ9A 8FABA 1AZZC 4Z8FH 3SPCA 4DZ8B 4KVCH 2MTPA 2A9DA 4YDVB 1C12A 1FYTA 3LKSB 2EQDA 4ANVA 1HS6A 1G7QB 1FE8H 4WV1C 1B4LA 2AK4A 4XN1A 1MAJA 2ZOTA 1OTSD 2IDQA 2HB0A 4JJ5A 2WQAA 3L1OH 3FQRB 2PWHA 4FQ1L 3ZT6A 2BLFA 2AJSH 3BP6B 5L8JB 2WCGA 2XACC 1ESOA 5B3NA 4BE5A 3U48A 5TK4A 2FEJA 1Y6MR 3FTWA 1ZV2A 2VMEA 4FTVD 3WI9A 5J8OA 1SQ2N 3C5ZB 4UZSA 3EH1A 5JXAL 4OUOA 3V8CA 4YHLL 4E9QA 1S9YA 4ISVA 2Z31C 3DUHA 1XHHA 2Q7NA 2ZF9A 1FNGA 1E6JL 4QHNB 2OKMA 2AQNA 2R0WH 1Q90A 1GZQA 1XQ4A 1KXTB 1H19A 3IJSA 2R1XB 4G8IB 5B38G 4UNVA 4MA1B 3OG4B 5D70L 5T5NG 1MREL 4RESB 5PAZA 2AV7A 1VAHA 5HGGS 2PO6C 3GRWH 1P7QB 1IQDB 3L3KB 1U42A 3EYSL 1Y6NR 2HPTA 4RMQA 3SODB 4XWOC 4HUVB 1JV2B 3ALWA 5KYNA 4ZPVB 3C6EA 5FHAL 3HRPA 4R2GB 3QZWA 4PS4L 3N40P 4P5TA 3CGTA 4XGZA 5ICXA 2R39A 3T2PA 1MCLA 2FT8A 3ZDYB 5EEWA 1G7MA 4YDZA 5JXAH 5E8OA 5AAWA 4GG8B 1IBFA 4JFEB 4B5ZA 5A2AA 2I32A 1XCQB 3AQZA 2NSQA 4MQXD 4I0PD 3U4EB 3KWTA 4LLWA 1RUQL 2ERJB 3VVVA 3SGKC 4BFKA 1X9QA 3LX9A 4PJXB 1YJDC 3P9LB 3OG6B 2KKQA 1CLYL 4TTGA 2CO7A 3MFFB 4BSVB 4LAJH 5KSAA 1BW8A 3NUKA 1S9XA 1FH5L 2V9RA 3A0OA 4NO3B 3EYSH 3MNZA 4XPHL 4FTVA 3C8KB 2P5EB 3GSUA 2Q10A 3GC3A 2FH8A 5L2KE 2FQFA 1LILA 1ZXQA 4MXQD 2NXYB 3B2DC 4PJDB 1DQMH 1SN5A 5IVXB 5J06A 3VD2A 1TEFA 1KFGA 3NFSL 5DHMC 3C5ZC 4FFZL 3WS6A 5ICZB 2BHFA 4UM8B 5JDSB 3VFSB 4TLUA 3QZBA 4AEIL 2KLSA 3CV5A 1RUQH 1AGDB 4FABH 5FOBA 1AD0B 1KLGB 3IMSA 4GLRI 1RERA 1SY6L 1FBIH 4JQIA 4GUCA 2EIZB 3K2UL 5TE6L 3RWDA 6TAAA 5D7IE 1HYSD 1CLYH 4L1DA 1DSFH 1KN4L 4EEEA 1IM3D 1R33A 3V7AE 1FH5H 4YHOL 3WY2A 4MA1C 3OMZA 3DMMA 2A74C 3JZYA 3KLDA 4XPHH 3VG0L 5HGBB 4GSUA 3VGHA 4UIKH 5BW7A 4LCCC 1FZJB 5CIPA 2UUDK 3G6AB 4R2GC 4I0PA 4OU3A 3IJHA 1MHPL 2WBJB 3NFSH 3SJVE 1HH6B 3VXQB 4NCC2 4FFZH 4LESA 3LH2H 3OAUH 4H1LA 4MXVE 2P45B 3MV7E 2Y7QB 4X6BA 1AGEB 3OX8B 3T6ZA 4B5EA 4AEIH 2OXGA 4ZMYA 3F84A 5BO0D 4YFLF 3ET9F 1K5WA 5DJDB 4YHYB 2D0HA 3QFJB 5TE6H 5DXWA 5HDQH 1KN4H 2AK1H 2KERA 4ZYKA 2ZWKA 3HBGA 3EYOA 4PJAE 4NWTH 1AS8A 2HKAA 1YEDA 4YHOH 2HKHL 2CHXA 2X4OB 4ICWA 4IRZL 4BCZA 3FQWA 4BZ2H 4Z7WB 4V11A 1TJIL 1SMOA 5B1KA 1C5CL 1W0WA 1P4IL 3VFMB 4G82A 5FA4A 3TF7C 4PV8B 1F5WA 2VERA 3AQDA 3WG7B 1KLFA 2Z7WA 1YPZF 2UXTA 3ILPA 5HGDA 1IBGL 2IANB 1BQRA 1QUPA 4OAWB 4OT1L 3P2BA 1P7KB 3F7KA 4JRYE 4QXUL 3R4DA 3Q44A 2BVPA 4GIAA 4Q9RL 1WISA 1FC2D 2YKKA 1IFGA 3Q2LA 2PPFA 3KXFE 4EZKA 4JK0D 2EE6A 3X12B 3OAZK 2VISB 5IMMA 4PRNB 1H8LA 1A1MB 1WPCA 3HG0A 4RQQB 5LAXB 3VXNB 5KEZA 2RFXB 1KBVA 2HKHH 3NCBB 4QO1A 5GRWA 3GIZH 1J0JA 1D5XB 3CZEA 4IRZH 3Q7JA 4NXSA 4LHQB 4H8UA 5E24E 4KKAC 1BOGB 3CNKA 1GW0A 3ARFC 3DPDA 1TJIH 5ITFB 1AZNA 3VFVA 2FUTA 1JMZA 2XIIA 4H88L 4IKJA 4BQ8A 2BHYA 1R3JB 3S5YA 3WNNA 3VXSB 4QCIB 1T3FB 3WOVA 4OT1H 3W37A 3L5HA 2PCYA 2WBJC 3PWUB 2B7DT 4L37B 4QXUH 4IJTA 3DK0A 4WU5B 2DEWX 3ESNA 4IEFB 1ZLDA 4Q9RH 1NSNL 3NZ8B 3GHEL 3SKMB 5IBUG 3K74B 3MUGB 2ENQA 2Y7SA 5EU6E 4UOJA 3KPLA 4OIAA 4YHYC 4O00A 2D7TH 4PG2C 2AJUL 3PRZA 3WMSA 3HKZA 2ZYIA 3OKMB 4WSJA 1U91B 2A83B 1WZMA 4V2BA 4HMCA 5EPMB 5K93A 3WFDH 3QQDA 2GUOB 2EKJA 3K91A 3W0WB 4CVZB 4M6AA 1T0NA 5KZCB 1VFUA 1F1DA 3DV4B 3FKUS 2VNCA 3QFDA 2OMWB 1X9LA 1VZIA 1URZA 1JK9B 5E1IA 1H3PL 1G7JA 3FH7A 5E6RB 5EU6B 5C9KA 1S7TA 4JDZB 3TOPA 2QBWA 3THML 1JXJA 1ZD6A 2OTPA 1FN4B 2UY6A 1A3ZA 4NQEE 3QDGB 1IBZA 2EUZA 4LSDA 5AYTA 3OB8A 5H37H 3EAKA 4QRAA 2OYKA 2J7LA 2YGNA 5J6SA 3G7TA 4FADA 3LAFA 5JA9A 2I26N 1X7QB 3TN0B 3JWDC 4I77L 3OGOE 2P46B 4AH2A 3T0VA 2AJUH 2J73A 4FJ6A 2VLJE 1TJMA 1YVLA 4B0MM 4FLQA 3SKUD 2EKSA 2Y24A 2BS9A 3OKLB 1MJ8L 3B2VL 2PUQT 4HJ1A 4X50A 1T1WA 2YO3A 3ZR5A 2DF3A 2F53E 3BAXA 4EI5D 4WJG3 3H9SD 1KV7A 2BIIA 2G2RA 3ABGA 4YNYB 1JF1A 1WCBA 5AOMA 3V5HA 4AI7A 3AM8C 3J27A 3ZKXB 4HQQL 4IK7A 2VZVA 4PJAA 3TIDB 1ONQA 2HJFA 2GK0B 3CSBA 1H6TA 3THMH 1S7XA 2YSSA 1CS6A 3EGSB 1NUDA 3GMRA 3LZQA 4HIEB 5GZOD 4HJJH 4JO3H 1PZUB 3RX9A 2ROXA 4HBQA 5I6PA 4UUJA 2XI9A 4HDIA 3D07A 3MRHA 1XL6A 2G9HB 1R3HB 4F8TA 4HXAL 5JUEL 2LQRA 1TCMA 1A9EB 1RZGB 3PWPE 4I77H 4U6XA 4JBSA 1ZLUH 2YPLE 4LVHC 3SPGA 1XSJA 2H1LM 4LP8A 4Y1AB 4JDTL 2ZP8A 5K9OB 3ATDA 1SDYA 4P46C 1MJ8H 3B2VH 4CVXB 3H4HA 2PCPA 3QAZB 3PV7A 1BAWA 1BF2A 1CQKA 3EO0A 1JRHI 4K7PH 3VWJB 1G9NL 1R1CA 4Z3GA 2CRZA 2YN3A 3KXFA 4G7YL 3S5LG 5D1QB 4PRBA 1R5VB 1PZ3A 1A7OH 2V7NB 4I7ZC 2CKBH 3FOLA 3ZDXE 4APQB 4XB7A 4HQQH 5ANHA 4GI6A 3RFZB 2Z91B 1AHMA 1FF5A 4K5LA 1KGIA 1PLBA 1BREA 1QPXA 2OZNA 3VWKC 1QRNE 4BKSC 3ATFA 1YG9A 2E56A 1AZCA 1WEJL 1BVLB 4XBGA 4HXAH 2J12B 3UYOD 4P48A 3Q5OA 4MBOA 2Z65C 4XNZC 4Z7QE 5GJTH 5D6CA 2FR4A 1DEEB 4JDTH 4EI5A 5C0FA 5KS9B 2Q3ZA 1JGLH 5DEFA 2K78A 3D5OF 3H9SA 1OD7A 5KW9L 4M4PA 1WK0A 3GRWA 4M1CD 1BZ9A 4RSVA 5B38B 1G9NH 4K3JH 4EXKA 4G7YH 4DP8X 3IDNA 3JUZA 4G6KL 3ULUE 2Y3NA 4B9JA 1H3GA 3JVGA 4HCRH 2Y36L 5E1AB 4HJ0C 1AP2A 1IAIM 3S37X 3OHXC 4JFZH 1IFHL 4FLRA 2IOOA 4AUJA 4EUPG 1D5IL 1U30A 3UJJH 2JJVA 1A02N 5C0GA 4HKBA 3B6SA 5BOZG 3OMIB 3ZQWA 3PWPD 3O6ML 1T21B 3RBSA 1SLXA 5EBGA 1THAA 1WEJH 4HLEA 3S2AA 1CGXA 4OI9A 5F93C 2MMXA 2PXYC 1PF3A 4IJ3C 2Q7YA 5D7KD 4I88A 3BPCB 3MRCB 1KBGL 4IBZA 3RTLA 3ZIMA 3ULVE 3DKHA 1OEZW 3NN8A 5F7LB 1XF1A 4RFNB 1JL8A 5D7LE 3QAZC 1WHPA 1YMHB 4G6KH 3OB0K 1KB3A 4DZ8A 4HWEL 2FEEI 4DUWA 4JFED 5D1QC 2GC4C 4UYQA 3WIHA 4KQ0A 4FXLA 3OJVC 1TQUA 2P49B 1BZDA 3X11B 5KBDA 4FP8L 1WA1X 3UZEA 4MAUL 3RFZC 4WCYL 3TCLB 1QSFD 2FH6A 2BSDA 3N85L 5KBPA 3HHSA 4N22A 1WAEA 3LKNB 3UFIA 1DJWA 4F92B 5DFTA 3O6MH 2QSTA 3DJRA 3ARGB 4A6YL 1RHHB 5GS0H 1D6VL 2J4WL 2JTYA 2WTRA 2EXSA 1TQTA 2R51A 5EZPA 5CLXA 2FLBT 2VR7A 2E4TA 2AQQA 3EO9L 5IT2L 1EBAA 4RMUA 3CZFB 3NFNB 2DQDL 3OJ2C 4FD0A 4IQHA 3SE8L 5D9SB 4YVNA 3AY4C 1KBGH 1KENH 4YVUA 5C2BH 2ZKYA 1OP3H 1IU1A 4W9DC 3D50A 1KJVA 2AXFB 3G9AB 3IS0X 4KO6A 3V6ZA 1CXEA 2I9TB 1SVBA 3QQNA 4L1SA 4HWEH 1OK8A 1EVUA 4N5UA 1I8LA 4N2CA 4KDTC 1FCCA 1AY1L 2P47B 3PWPA 4I3RL 3WHXA 1LYQA 1HSAB 2YPLA 4AIOA 2AJXL 4FP8H 1SBBA 2P52A 4MAUH 1XBDA 4WCYH 3V0IA 3DX8B 3BP7A 1H8SA 3N85H 4G7RB 4PP1C 5L6YL 3FN0L 4KOBA 4PYHA 2E7MA 4A6YH 1PEWA 4HUNB 1D6VH 2J4WH 2Y23A 3A67L 3M1BA 5F6IC 3PAZA 2FJFA 3Q2NA 4NQUA 4QXGL 2JKNA 4XPAL 1NPNA 3BEVB 3EO9H 5KANI 1LDPL 3P73A 1FAKT 3SE8H 2HWZL 1N0LB 4XPGL 4F3FB 5JIDA 1JPSL 1ITCA 4QOKB 5DQJA 4BZ2A 4JFEA 3Q2VA 4MKMA 1KOAA 1INQB 3US9A 3LKQA 2FWOB 1VCBC 5I16A 1QSFA 3NEOA 1ZAGA 3GJFH 3IDYC 5A16A 3H9ZA 5ALBL 4DIXA 2AJXH 2B3IA 3HB3C 5KSBE 5E00A 5E1GA 3HS0B 5T3ZL 1OSZA 2ALWA 2ZKWA 4P5KB 4XTRC 5LBSL 3FN0H 2VXQL 4LCUB 1RZPA 3RDTB 2X89D 3CFTA 3V0WL 3A67H 4R26L 1CGSH 1QFWI 2ATPB 1G6RA 4QXGH 5D7JB 5J12B 4YHML 4XPAH 4MQ7B 1LDPH 1HEZB 4M9OA 5J9PB 4XMLH 4JEGB 4ACPA 3WJJA 1TO5A 4P3WA 1JPSH 3GGWB 1N5YL 4IRZA 1ZV9A 2VDOL 3H9HA 5LQBL 4Y5YB 4XXDB 4ZPTA 4HPHA 4PM1A 4ZO7A 5IHBA 4YLCA 5CZXD 5GQBA 1EEUA 4F7KA 1G7LA 5IB3B 2HVJA 3PHOB 2J1XA 3ERXA 3FQXB 1MY7A 4AITA 2BRRL 3Q13A 3LTVA 2YQ2A 3QS2A 4JLRB 3EJUA 5T3ZH 3GDBA 3S36X 5LBSH 2AAAA 2KYIA 4GKOA 4P3DA 3V0WH 3CFIC 4I5BA 4R26H 3VE0A 4M62L 1KCLA 3ZDYF 2ESVE 4Z76A 5HGBA 4YHMH 1R3LB 4GB9A 4HWBL 4TSCL 4F9LA 2BSCA 2VZUA 1A21A 3AAZA 4HFWA 4UTBL 3TO4B 3E38A 3P4MB 1MCDA 4J3WA 2J1KA 1IEHA 3VRLE 1UWFA 1WS7A 4PJHE 1RIVL 3VRJA 1N5YH 1H8OA 5LQBH 2VDOH 4RETB 1JD7A 5IBTL 1U92B 1G1KA 4YDMA 1HXKA 1X7SA 2F1BA 5GRJH 4X6CA 1TVHA 4PJIB 5TDOA 3WEOA 5J6HB 5CAYB 3EZ8A 4NEHB 4MSWB 1EHKB 1ZVSA 2BRRH 2J8UE 2X89A 3M8OL 2ILLA 5D5ME 2IH9A 5HI3C 1T4KA 3EH4B 4G8FB 5IW1A 1SVCP 2BIMA 1NBYA 4GRMB 4NT6A 2BO0A 2EXYC 3TWCL 1Q9OA 5DJAB 2W9DL 1ZIBA 2CLZB 3HS0C 1QEWB 1OY3B 4JE0A 4GS7B 4M62H 4PR5B 3ILQD 4FFTA 3BUPA 5H37A 1T6VN 5LJYH 2HFFB 3RDTC 4OZGF 3V6BR 4TSCH 3MTXA 5HD8C 1SOSA 4PJDF 1A1OA 3IDIB 2RJMA 1U8IB 3E6FA 4C8XA 5D7EA 2A0LC 3SOTA 2Z4QB 2VLRE 4OSUH 4FAAB 2CDEB 2JKXA 2ZJSL 1RIVH 3QH3B 1VFBA 3LHAA 2RD0A 2AEPL 4AGQA 5DQ9B 1BLNA 1OOWA 3ZE0B 2FQEA 3T3ME 5F88A 2QMKA 3QRFM 4R7NB 1SGKA 3NCFB 5KANG 3ZYOA 1QTYT 5AALA 1T22A 2CHWA 3M8OH 5EC2A 3C60D 1A7NL 4WDIB 1LMKA 1MHEB 1A1MA 3SY0B 4ZW8A 2A6JB 3IU4L 3TWCH 1MWOA 2W9DH 3CIQA 1U41A 3DXAE 3RZCB 5E7BA 3LHPL 3QI9B 5KVMC 1FGVL 3X14A 4BM7A 5EIIG 1T03L 4L9LB 4Y4HD 2B15A 1PQZA 4OD1L 5ETUA 4AIZB 1P2CA 1EEZB 3VXUB 1PZDA 4ZMNA 2CR0A 1RZIB 3CFBA 5A43C 5INDA 3HMXL 4UBDD 3TO4C 4EN3D 2VN3A 3KL3A 4KO7A 3JYCA 5JORB 2PWGA 3CSYB 1W8OA 5JPNC 1MLCB 2ZUSA 1WO2A 1JDCA 1G0YR 3D0VA 1NBQA 3W39B 1N26A 4LBAA 2DEXX 1M6OB 1GOFA 5E2VH 3FT1A 3KLAA 4TNEA 2YZ8A 4LSRH 2J2ZB 2QLYA 4UQIM 2CKBA 3TEWA 3ZZQA 1A7NH 2IH3A 5I17B 2WWNA 5FFGA 3IU4H 4Z7WF 1NFIA 5DURB 3LHPH 1L3WA 3BGMA 1CLVA 2EIBA 4OM0L 3M1CA 1T03H 1ODUA 4GS7C 3RDJA 4CVZA 4OD1H 2CH8A 3GJEB 2CA4A 3AACA 2A73A 3HBZA 2QZ5A 3SZ6A 3DV6A 4Y1AD 5KVFE 5FWQA 4NBYB 4JW3A 1K8IB 3MN8A 3HMXH 1NEPA 1ZLVH 1N7ML 3STZB 4I4WA 4IKLA 4TQPA 5F89B 3HR5B 3QUMB 5GS0D 5A2FA 3NCEB 5A2BA 1KF9B 3PHSA 3C60A 3FFDA 2VSCA 1SUHA 1I9JL 5ABZA 3DRTA 5DJXA 1D6EB 2ESVA 2UWEE 3RKDC 5FF6A 1HVXA