5ECGA

Crystal structure of the brct domains of 53bp1 in complex with p53 and h2ax-pser139 (gammah2ax)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
198
structure length
192
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATM Localization and Heterochromatin Repair Depend on Direct Interaction of the 53BP1-BRCT2 Domain with gamma H2AX.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Cellular tumor antigen p53
total genus 42
structure length 192
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ecgA00
5AB9A 1H9DA 4QO1B 3TS8A 2RMNA 3WU1A 1GZHC 2P52A 2J21A 4L18A 3WTYA 4AGMA 2IOIA 2YBGA 4AGOA 3VD0A 3Q05A 1EAQA 4G83A 4IJTA 4IBWA 5AOIA 4A63A 4GUOA 3WTXA 4MZRA 4AGQA 4LO9A 4MZIA 2J20A 5ECGA 4IBVA 2ATAA 3ZMEA 4XR8C 2J1ZA 1CO1A 1KZYA 1GZHA 1HU8A 2BIQA 2BINA 4IBUA 3QYNA 3Q06A 2XWCA 5AOLA 5G4MA 4AGPA 1LJMA 1TUPA 1HJCA 4LOFA 3WTSA 4GUQA 3IGKA 2BIPA 4IBTA 2BIMA 4HJEA 2XWRA 3D09A 2GEQA 4L0YA 1EAOA 1UOLA 2BIOA 3VD2A 2X0UA 3WTUA 2J1XA 5LGYA 3WTVA 3KMDA 2J1YA 2ADYA 2J6WA 4LOEA 4IBYA 5BUAA 4IBZA 3US0A 5A7BA 5AOMA 2AC0A 3US1A 4KVPA 2H1LM 4IBQA 4L0ZA 3VD1A 1CMOA 2IOMA 2PCXA 5G4NA 3D07A 3D08A 2IOOA 3D06A 3WTTA 3WTWA 3KZ8A 2X0VA 2AHIA 2J1WA 3IGLA 5AOJA 4G82A 1TSRA 2WGXA 1IO4C 3D05A 3EXJA 1T4WA 5ABAA 3D0AA 2OCJA 3EXLA 2MEJB 2FEJA 4IBSA 3Q01A 1YCSA 2VUKA 1E50A 5G4OA 1HJBC 1EANA 2X0WA 4AGNA 3QYMA 5LAPA 5AOKA 5KBDA 4AGLA
chains in the Genus database with same CATH superfamily
5BVJB 3KBPA 4Z5RA 1RULH 4JK0D 1Q0XL 2EIZA 3WU1A 4BZ1L 4ZOBA 1UYWL 2CKBA 2PKDA 3DUUB 4FTVA 4PJ7B 5B1BB 4CBPA 1AGEB 2V7NA 5EU5A 5AWNL 1M6OA 1QRND 4DFIA 2GJZA 1IAIL 1Q9KA 4J2XA 3P30H 5E2UL 3V7MA 4L4TD 1NBCA 1F45A 4IRJD 2NY2C 4J2QA 3VFSB 3WXWL 1VFMA 1U8MA 3KLQA 1XGRB 4XBEH 5KVEE 4UNIA 1H5BC 5C2UB 1LQBC 4Y19B 1FORL 3BPNC 3OPZH 4X7CC 4Y0GA 3RY6C 1ED3A 4ZS6D 3BFOA 4UZGA 2IPKA 1IAKA 2R15A 3QNYA 3MRKB 4GKZA 4UM8B 4YGVA 2OTUA 3P11L 3RDTD 5I76A 4RAUA 4UBDD 2YOCA 1G1YA 4KNTA 4MQ7A 4Y2DD 1COBA 4AUJA 4JJHA 2DWDB 3UC2A 3D85B 4J3VA 3IBOA 4XC3L 3DSFH 1F1GA 3OB0K 1UGKA 4HWNA 3FNKA 2APFA 1B90A 3W82A 4E9SA 4OTXL 3VWKD 4PJ5D 1NSNL 5ESAB 4RSVA 2Z7ZA 2MRYA 2H26A 3RWIB 1L7IH 5FOBB 3C2AH 1OAUH 3ARFA 1OAQH 5ICXA 1G9ML 4MJID 1M9SA 1Y18A 5I8OH 3BPLB 4KKPA 1AO7D 4EIGB 4N2BA 4HP5A 1BYOA 3DRQA 3LKPA 4NZFA 4UAOC 5E2JA 1NC2B 1VGKA 4FG4A 2DLHA 4N0CD 1I31A 3L5IA 4ZT1A 5C0FB 4X98A 4M1DL 4TNEA 1ROCA 1NMBH 1JNLH 1H8LA 3HRPA 2ED9A 2FQEA 3MMEB 4ZAKC 5I74C 3P73A 3C09C 4KDTC 3BZFA 3STZB 2FR4A 4N86A 4MTMA 4DKDC 1BSIA 2PW2B 5T1KA 1QBMH 3HS8A 3TV3L 4MAUL 1U8OA 1R0AL 3REWA 2R0ZH 1NKRA 2HH0H 2W0PA 5TE6L 3RVXD 2R4SH 5AAWA 2AV7B 2Y7MA 2IAMB 3L2LA 1M7XA 4DCQB 1I3RA 3F7LA 4V11A 3RZCD 5FCSH 1PG7X 3ZHKA 4CBZA 3BX7C 5D9SA 3GRWA 3UAJD 4B9YA 3L1GA 3QISA 4NQUA 3IFNH 4C57C 3Q6GL 4F37K 5JIDA 2FBJL 4B9ZA 4J3UA 1IGYB 4EAEA 2A6KB 2H3KA 3VI3E 1MIMH 5BZWA 3BKYH 4MJ6A 2F5AH 2F15A 3OMZA 1T0NB 5DJ0B 4BK5C 5L8LB 1JVLA 2N7BA 1V05A 5GGSY 1IL1B 1TNNA 4H0LC 4OUUB 3WMSA 5AW7B 3B9AA 2PTTB 1SEBA 3MLTB 5D7LB 1J5HA 5C0JB 3UTZA 1IMHC 3NFNA 5B38B 3VFGH 5F7UA 3O8XC 3D50A 1OPOA 1XF3A 4L3AA 1VFBB 4E5XA 2YQ2A 3G5WA 1EAPA 1BEXA 1RUAL 4HETA 2B0SL 5EOTB 5A2JH 4L8CB 3BQUA 2Y1YA 4IK6A 3QXVA 4IBVA 2ITCB 4HPOL 3GSOB 2JKXA 4M62L 3GINA 3VXSD 4IS6A 3S96B 5F7WC 3H3PH 4UOW0 1INQB 5MENA 3SDYL 4C59B 3VD4A 3KYNA 4EKXA 4AQAA 3FUFA 5IROA 1Q0YL 3FU7A 1BG9A 4MLSA 5MEQB 3GSXB 4XNYH 2ZCHL 3JUZA 4JBSA 3BN9C 2ADFL 2H6PA 1ZDSA 4L9LA 4UNVA 2AV1B 3K1KC 1OP5K 1WC7A 3K2KA 3L5JA 1ID5I 4NQXA 4OV6F 4HKXA 3CDFA 2EVJA 1FFNA 1DBMH 2DQFA 3TEWA 1GJIA 4JG5A 2DKSA 4XZ4A 1CTMA 1ZRUA 4B7IA 2K0RA 1PD0A 3SDAB 5EU4A 3UTTB 4XMPH 3DBXB 2LLNA 2WMPA 4G72B 4F8QA 1FQ9C 5DHDA 3CN0A 4QGYA 5HI5C 1TPXB 2GK2A 2TRYA 4OZFH 1OE1A 4AQOA 4G8GA 3HCVB 4Y4HC 2PW1B 5FKPB 3TA3A 1BQLH 4TNVK 4Z3FA 2Y7QB 3V4VL 3MRQA 4W6WB 3RI5K 3TBYA 4JUTA 4U3SA 2AK4B 2PYEB 3BDBA 1U2YA 2C8NA 3EJSA 3ROOA 1LD9A 3GKWL 1EZSA 1QFWM 1VGEH 1F4AA 5DJ8B 1K3IA 3OAYK 3QJVB 2EAEA 5CR1A 1FHNA 1V5JA 4W9KC 4XPTH 2KH2B 5L2KE 2YJLA 4OJFL 1KTDA 3QULB 4JCLA 5CIPH 4E41E 3NCBB 1MCRA 4LNRB 1WWCA 1GXEA 4IEFA 2Y36H 3BFWA 4R5TA 2JQZA 1CGWA 2F6AA 4WTXA 2XZAH 4ZUSA 2B7DT 4YBQC 1F90L 2P52A 1HXYB 2FWUA 2LV4A 1NCGA 5LN4A 3N42B 5D72L 1O9ZA 1S9YA 1WP6A 2CPCA 1S7TA 4GRWH 4OLZL 2B1HH 4PRPE 3UTTE 4NNPL 5C0AB 4CMHC 4Z3HA 4WLCA 4KKRA 1S7RA 5I6LA 1MUJA 3RB5A 1C5DB 5MEOB 2EH8L 3MA9L 1KULA 1AXIB 1T5XB 2WYIA 3IB4A 2VDOB 1G1KA 1G7QA 2W07B 5TE7H 1KV3A 3UJJH 3C5XA 1KIUA 1VFAB 4M56A 5ISZB 5E5LA 1G4RA 4OLVL 2IQ9L 3HB3B 4TQIA 5IHBA 5L4IA 2BY3A 3ZZLA 2CNYA 4Y5VC 3PPSA 2YSTA 3P77A 2E27H 4P5KA 3EFFA 1GPOL 3FQNA 3LVEA 3V0EA 3FT2B 3F05A 3IDGB 4HK3N 1YPZF 3O8XD 4OR1A 3U1SH 3QZWG 1WISA 4ICWA 1NGYA 3MGOB 5F96H 5BVPH 2BY0A 1J9TA 1VFOA 35C8L 5D7IB 4P3DA 1J0YA 4I7ZC 1S7XA 2BVOB 3T3MB 1SXSA 4AYID 3T6ZA 1N59B 3BDYH 5INDB 3HN3A 5T3XL 1X5FA 3GZKA 3L3HB 1NIBA 5CGYD 2ZCZA 3V5DB 3WFBH 4PIBA 5GRJH 5HBBA 3BUYA 3WIIH 2WLNA 5KZCD 4Z9KB 3MLSH 1HL4A 1MSPA 2RBLA 1H3PH 5HI4D 4APQD 1PX4A 3V4VA 4FN0A 1EMTL 1N6VA 1NC4B 4I18C 4MAUH 3DRTB 3JTSB 3JXAA 2WSDA 3T65B 1X9UA 1G43A 4H1LG 4NENA 1I75A 4WUKH 5AD0A 3H0TB 2X3CA 4UYPA 3RL2B 4XPGL 5D7JB 4DIXA 1EHKB 1NCUA 3LAFA 2Q6WA 3FH5A 3LKNB 4P2AA 5KBKA 1HHJA 5JZ7D 1QRKA 2GTWB 4P59L 4FNQA 3QRFM 3EO9H 2EIKB 4RCAA 5C09E 3ZKNC 1MEXL 3GEFA 4ZRGA 3ARDB 5IB2A 4XN1A 1OTTD 3QCUL 3ZO9A 2QT6A 2BSSB 1ZJBA 2A5UA 1JF6A 2LVEA 5JA8B 2J25A 3I74A 4R0LB 1G9NH 1AYRA 1NANI 2GFBB 4YDZA 5I17A 1ZHBB 4M5YH 1NGWB 4LVHC 5HYJA 3SJVE 3HPLB 3NGBB 3P69A 4TPRH 2L7JA 1M1XB 4PJAB 1I1AC 4OZIB 4XGZA 3FUDA 3II3A 4AE0A 4KTEL 3KPSB 1TQTA 5A6IA 7TAAA 4BGDA 3HE6C 3IDJA 2J44A 2GC4C 4I1RA 3AUVA 4XWOD 3DVIA 1TZHA 5JW4Q 1AACA 3BH9B 4P5TC 2WXQA 4P2QD 1WUNT 1SBBA 2VZTA 4JVPA 5JUEL 1NANH 3LH2L 1FE8L 1A5FL 4WGVB 3UTPD 2WVVA 2VLRD 1DQKA 2EDNA 2HYMA 4IS6B 1JPEA 3EJZD 3RA7L 3VWJD 2BSCA 2I7SA 4DFHA 3MX0A 4P2RB 4JM4L 1WBXA 1GTFA 3DVNB 4LASL 5AYUL 4MXWH 1T1WA 3VG0H 2Z93B 1VF5C 2HVJA 2KMWA 5GGVL 2COQA 2WWMD 4WQOA 2O30A 4QRTA 3KLHD 1DJSA 2VLKE 2AANA 4I77H 1YG9A 4FYSA 1I8UA 4TF4A 2B2XL 3VDCA 4Q9RL 1FNFA 2CDEA 2IPUK 2XQYA 4QRBA 3MO1B 2AQ3A 3AU1B 3SHSA 5F7LB 5EF2A 1XCTB 4MDJA 1R1CA 4YDMA 4AQAB 2OL3A 1QQDB 1A14L 4Z7VF 1DVFC 3GS0A 4Y4FA 4AGPA 1KCKA 4QD2E 1MG3C 2GJ6B 2NZ1A 5IMMA 3QBTB 3G6JA 2OZ4A 4QT5A 2ZKYA 4HIEA 4W70A 5E2WH 4N0FA 1A9EB 4L1DA 3BESR 4X6DE 4QXVA 5CN1A 5B39B 3D09A 4ALAC 3UJTH 1HS6A 2GCYA 3GJFH 4DT2A 4JJOA 4DPBX 1EJ8A 5TH2B 1OIOA 4HU8A 3PWLA 4X6CB 3ASWA 3TOPA 1HEZB 5B4MC 1OAZH 5F0PB 3E6HA 3SDYH 3QQ3B 3US1A 2FJGA 5J13C 3N41F 4NN5B 2NY0D 3SDCD 2E8YA 4PJGE 1J1PH 2ADGB 5F1KC 5T1MB 4OZHE 4G11A 3T08A 4JRFA 2V6HA 3POCA 2P5WD 4XCEB 1DLHB 2JB6A 3EDKA 4OFIA 4CMHB 1NDTA 2ARWA 2Q1EA 4FQLH 3BZDA 3FHAA 1DBML 3TTSA 2WGXA 4HA1A 1BYPA 4G9FA 2F5BL 4YDLC 3FQ2A 3TT1L 3X3GL 1IC7H 1NCIA 4GSDL 2CLRA 2Q2EB 1BEYH 4KKAD 1SJEA 1F8TH 3DRQB 3ESUF 4FDWA 1GJUA 1PNDA 2PP9A 2H7WA 5E4EB 2Y23A 4MVBC 1RIVH 2WTOA 3U36B 1VLXA 1GKOA 3GQFA 4E9WA 3ISYA 4UT9L 3N43F 2XFGB 5T1KB 4HPOH 4HJGB 2WLMA 3MRLA 2YK1H 4BQ8A 4JPQA 5AVQB 3ZGIA 3EHBB 2EABA 5I0VA 5H37G 4NNXB 4NQTA 4XP1L 3DJRA 2IIJA 1OM9A 43C9A 3L5XH 5EUOF 1I7RA 4JM0A 3SDDA 1HVXA 3L13A 4HIJA 3U2JA 2P24A 3O9WC 3GUFA 4M8QA 3VJ6A 1MVFA 2F54B 5IJCC 3IDXL 4IOSA 5DUJA 3R7QA 4L5FL 3GMLA 3CCHA 3F7VA 2NDGA 3S34L 4NQDB 3UZVA 2E46A 1BOGB 5DA0B 5DR5H 2JJSC 4R4BA 2W59A 3DJ9A 1OOWA 4W9HC 2ZUWA 4OD2B 5CS7A 4HUXA 4LSTL 5H4ZA 4ERSH 3VMPA 1TVHA 1Z2KA 3LRMA 4WK0B 32C2A 3QI9B 4JHAH 4ZI8A 2WKOF 1QWNA 4BSVA 4MCMA 2X4PA 5MHSD 2DQIL 3RWJA 3MNVA 5ITFA 2VQUA 3RE0A 3T3MF 4MX7B 7FABH 3QNYB 4YHML 1BIIB 3ZN6A 3Q8AA 5CBAB 1WEJL 1DUZA 3F64A 3VVWA 1HHKB 1HYRC 4HOXA 2OMZB 1ZLSH 3VXOA 1D7BA 2YPLE 3LXAA 3WTVA 4FQCL 4PTTB 3DOHA 2AS5M 3MV8A 3GK8L 4CMMB 4HF5L 1TZIB 2EIDA 4PRAB 2OR7A 1D5XA 2W0FB 1INDH 2IFFL 2FJHA 2NW3B 3IXAB 5CU5A 5FHBH 8PAZA 1EK3A 1ET7A 1NICA 1U8KB 3T0EC 5CINH 3LNIA 1VEPA 2XRAH 3MJGX 2E7MA 4FQXA 4FG6C 1B6DA 4RMWA 1JHKH 4TUOB 4NKMB 4P4KA 3RUGA 1E27A 2HMIC 4B53A 4OKVB 1URZA 3AC0A 1RPQA 1WA0X 4I89A 4RMVA 4LT7A 4XX1G 4BZ2H 4AW4A 2F0CA 1BP3B 2EDRA 3LS4L 1Q72H 2VDKB 4I13B 2FK9A 2FD6L 2OMZA 1G1CA 1NINA 4FQ1H 1IFHL 1DVTA 3NIGE 3ML8A 4PJ8B 4QOKE 2H8PA 2X4UA 5LHDA 3L3KA 3W2DL 3RZCA 5HGBB 4WK2B 1G6RH 4PM1A 4FMVA 4NQCA 3KLDA 3X2QB 2MJWA 3BPCB 3RWEA 1D9KD 3IWUA 4WVRA 3AJ7A 2TSBA 3UMTA 4KUZL 3QPXH 3WN6A 3IBEA 3OTTA 1P5VA 3CHOA 4OKVA 1BFSA 2WLLB 4O9HL 4PTTA 1RK1B 2NXZD 4GEIA 4ZAKB 2WVSA 3K6DA 2OL3B 2CK0H 4K2UL 1DFBH 4ZMYA 3ZYJA 1NTDA 3BZEB 2XJKA 1JPGB 4NN6B 4L4JA 4XHQA 1E40A 4PFEA 3MNVB 5DRXA 4LASH 4RGMB 5AYUH 3LKRB 4HVBA 2A0LC 4D8PA 3K6OA 1D5IH 4JY4A 3WUWA 3EO0B 2Z9TA 3MDJA 3NEXA 3MCKB 2QR0A 3E3QC 5E1AB 5CBAA 4WNJA 1LK2A 5I8EB 4G43B 1XT5A 1CO1A 3ULVC 4QDGA 1DLFL 3MROB 1W15A 3D4CA 3RX9A 3IWVA 2XFXB 1RJYA 3QUXD 4FZEL 4K3GA 4EDWL 3TEUA 4F20A 2GQHA 4PB9H 3L1OH 1LJMA 3D18A 4WRLA 2LU3A 3CXDL 1BZ7B 3H9YA 2NY6D 3ZMRA 2DIEA 3U25A 2QMJA 2V2XA 4M93C 1KV7A 4B9JA 3FT4B 4OM1H 3DXAD 5DJDB 4Z7NF 1EEZB 3PABB 1HXMB 2GY7B 1PZDA 2QFPA 2OXHA 1R5IA 2W60A 2UZPA 2AXFA 4W9LC 2X4NB 4G8GD 3FSVA 43CAA 4F3FB 2HFGL 2YPVH 4IBQA 3MBWA 3ZUCA 2IALA 3IFOB 3KW8A 5T5NG 3RVTD 5M94B 1FV1B 3BGMA 5I2IB 5C6TL 1KLGA 2VDPB 5IQMA 2WNWA 2N0KA 4X99B 5ISZE 4OVUA 3HBGA 1KJ2L 1YNKL 5KVMC 1MJ7L 1OP4A 4KKBD 4NKIL 5DQ9B 5I16B 1EHLH 4MMXC 5AW0B 3F7YB 1MI5B 4YL4A 4DOHB 3HTLX 4GRLC 1ADWA 1P84J 4ODBD 1FO0B 4KROB 4JFFA 3L6FA 3RURA 3QJSB 4DKFH 2ITFA 3N43B 2K6YA 2RAMA 5GGRA 3TIEA 2RQEA 2NY4B 5T33L 1F58L 4ABQA 2VR8A 5B7FA 4ZO8A 3ILPA 1F97A 3GIVB 2Z3FA 2H0EA 1H9DA 2XICA 3QUXB 4XVSH 5I1KL 3W38A 2IJ0C 3MFGB 1G9MC 4OI9A 5DSCB 4ZW5A 3VM5A 1JZ7A 4G8AC 4XMVA 2I9LA 2ZX6A 5KYYB 3S37L 4WDIB 5HDBE 2C7UB 4NLHA 3RY6A 4FJZA 4O02B 5E00A 5ESVA 3K6SA 2GUOA 2SEBA 4PJHA 4Q6KA 1Y6KR 2QQLL 4FNRA 1I7RB 4ABUA 4XXCC 4U0QB 3GRWH 1CU4L 1J1OL 1E7VA 4XXCA 3N55A 1WA1X 1MFVA 3KS0J 4APXA 2F9BT 2OTWA 3INUL 1IT9H 5D70H 4WV1C 1U4FA 3MRGA 4XN2A 2VKWA 3FFCD 1MREL 3H56A 3BVXA 3IETB 2QSCH 3Q5TA 3LD8B 5IMOA 4BFKA 1KZYA 2KT6A 1NCDH 1BLIA 1QQDA 4L4VA 2ZAIA 3KPQA 2AFNA 3MX0B 2EH7L 3DPDA 4LLDB 5DQDL 4DP4X 1C8QA 2G3XA 1YAIA 5KVFE 5I28A 1U3NA 3ORJA 2DQEL 3Q6FA 4JGJA 5T5FH 5KWYC 3GMRA 2H41A 4MD0A 1XGYL 3CZGA 1OP3K 4FQLL 1ZLSL 3L3OC 2GJPA 2CRYA 4HGWB 3NZHH 5HHOA 1ETA1 4JFUA 3CMOL 1INDL 2IFFH 4ES9A 5KUMA 2CO7A 1J0JA 2XWTB 1L0QA 3LNFA 4JEGB 5DZOA 4G5ZH 1LYQA 1PX3A 4Z7OE 4NBXB 1CE1L 2HJKB 3VXRB 5IB5B 4A7GA 4GKOA 4APQA 2AI0H 4TNWK 3UO8B 2GC7C 3Q8CA 3GNML 4P46B 2X3AA 1LO3L 5CM1A 1ZEAL 2K7QA 3SGEI 2EYSB 1V55B 1HKFA 2XZCL 4HH9A 2J8UF 4YHMH 1CQKA 1UCBH 2GCYB 3ZDYF 4AZ8A 5EEXA 4YO0B 2VDKH 1IEAB 5C9JA 5IB1A 4UILL 3BD4A 1CE6A 1IFHH 4P8QA 3ZKMD 3K8MA 2QHRH 4I3SL 3VGFA 4CVUA 5E4IA 4J8QA 1OAKH 3JZYA 2XTSA 2C3VB 4HF5H 5A43C 4XPAL 1OL0A 1M56B 1X5AA 1NAKH 3C8KA 3M88A 3CVHA 1XXDC 2UYLB 3JTTB 4EQ2A 2YWZA 1SQ2N 4YX2H 5L9DH 1FYTE 3ESNA 2ZG3A 4OF7A 4S1QH 4GRLD 1OGTA 3IDNB 1R3KA 4QAWA 4P2OD 1NC4A 4XI5D 1LEIA 5DDHA 2JJTA 1Q1PA 4P2QE 2GITB 4OFVA 1U2HA 3P2DA 1AZCA 4PR5A 5J3HC 5CZKA 2YC1B 2KYIA 2HRPL 3KPSE 3NSXA 1RKRA 2VLRA 4YDNA 2ITDA 3VRLE 5KBNC 1N3NA 2VSMB 1DYZA 12E8L 1B0IA 1S5IH 1JV2A 4JFFE 3ZKQD 3O6FD 5D1ZA 3F2LA 3N1GC 1M7IB 3TIDA 2Y4SA 3OR7B 1HFUA 2EICA 3KPNB 4E36A 3AS1A 5L8JB 2J4WH 1FA4A 5F8QC 2OSXA 2XQ0A 2JTDA 3HC2A 4BWTA 4RRPA 4O9HH 5D2LB 4MD5B 2MSPA 1KELH 1QD0A 5IV2B 1UWEH 3KPLB 3BXNB 3V55A 1BAWA 5CJQL 4PRID 4QLRA 3RWHB 2AERT 1T5XA 3GGWA 1OEZW 3LKQA 3PWVA 1ACZA 4L9LC 4WJ5B 5IF0A 3O2DH 5E8EB 1V7MH 4LKCB 3O6MH 1W72B 3GMNA 2FGWL 2AXFB 1WTGT 2WCSA 1EIBA 4GG6E 3L08A 4YLBA 4OM1L 3S3CB 4F7TA 3CFCL 1WQVT 2E7DA 5CLZA 3ZLQC 4FQIH 1D3CA 1DJYA 4LOEA 5DCCA 5C9JB 3N1PC 3LNGA 3QEQE 2H32H 4ZX5A 3MXWL 1RLWA 1QSEE 1BQRA 1FN4B 2DQHH 2R0WH 3CSBA 3F6IA 4DCQA 1TCRB 5AWNH 1JL8A 4R7NB 1UT2A 1D9KB 1IAIH 2Z8WC 4FAAB 1JV2B 4LSPH 3KPPB 5C6TH 5AAMC 2BFVL 1H19A 2OULB 4DW2L 4A7TA 2ITEA 4ZUWA 4KX7A 4AQ1C 5ABZA 3T0VA 3P3TA 3WTTA 3IFPA 4NN6C 1NOFA 2J73A 3SBWA 4P3CH 5EN2B 2VSKB 5C0IB 4HJSA 2XLLA 4KHXH 4OF3A 3EYOB 1ZK5A 1AMYA 3AWGA 1LEIB 1LDSA 4XHJC 1T4WA 2V5YA 3EXLA 4Z7VA 1MJJB 1NIEA 3EFFB 4EO5A 2Y9RT 4FABL 2D7TH 3BEVA 5I1JH 5I6XB 3IGUA 1D9KC 1JZIA 3L4TA 1D5ZB 1G0YR 1M42A 4M4PA 4NZ8A 4CU6A 4LLUB 2NYYD 1KY6A 3JVFC 4RRPG 2JCCF 3U1QA 3VXMB 1GSMA 4EI6A 4OTXH 4OBRA 2HX9A 1NSNH 3PGCA 4MZ3A 5MEQA 1AE6L 2DQ6A 3ZT7A 3ILPB 4ZMPA 4GT0A 1LM8V 2EDHA 1MWAA 1T2QL 1KXQE 4H8HA 3MJ9A 4O4YL 2E7CA 4M6NH 5J9PA 5L4JA 5KYNA 2F7PA 3GSOA 5EZLA 1E30A 1KTRL 3LD8C 3C5ZC 3OAZK 1FYTB 2O5NA 5I30L 1MFMA 2XNAA 3DVGB 4PB9L 1FNSH 1YN6A 4HLJA 1SZNA 4GUPA 4NZRL 3W5NA 1QLRB 3OXRB 3ILQC 2QEJA 1EVTC 5F89A 5BPPA 3NIDE 5D6CB 3RWEB 5I19H 1KPRA 3DBXA 4NP9A 2PTTA 3MLTA 4XMXA 4I0PD 4J1UB 3IU4L 3K72A 2KLTA 4PJFB 4JMNA 5E00B 4XWGH 2K9UA 4FFTA 3SQOL 3DDFA 4H8WH 1YY9D 2VDQL 1JPST 3JVGA 1IE4A 5E5MB 4Z7UB 4ZNEE 4K5MA 1ZV5A 1MFAL 3NIGB 4QOKB 1FL3A 3ZY7A 1WHOA 1GS7A 4U1KB 4A38A 4BSWA 3A67L 4P2RE 1MFBL 2VM9A 4P2QA 4PCYA 4Y8AA 2OSLB 5BZXA 4ODWA 1FFTB 2X42A 5KSAD 5TQ2L 2YPVA 3OMAB 5CP3A 2GIMA 4NJAH 4ZSOE 1M2VB 1N2RB 5T5FL 1YO4A 2EADA 1SF5A 4JM2B 4RZCB 5DZVA 3HPJB 3P3SA 1JGVL 3KEDA 2NSXA 2CBTA 3QDHA 4NEHB 4UDUB 3VQLA 5JPMB 4IBTA 3LXBA 4N28A 4KWUA 3QZLA 1E8YA 3O3EB 4D94A 4OD3H 5J1AA 4KMTL 1AOZA 2AJZB 2KUTA 1ZXKA 3L3DB 4GEJA 3QUMB 4OFKA 2R69H 4KKLC 2VJ8A 4WCYL 2PW1A 4PRIB 4FXKC 2AVGA 1JZ3A 4DKFL 4BCZA 4O58L 4MASA 3FO2B 2CGZA 3CLFL 3PJNA 4ISVB 4YHKH 1DBKL 4A37A 5MENE 5E24E 1PIGA 3LZOA 3B2DC 2QPSA 1E7UA 5D7SH 1X5HA 2O72A 2XVGA 3QGVA 2NNCA 4DN3H 4ZW7A 4YBHA 2L4OA 3UTSB 3KLAB 3BISA 3MLVL 1R9FA 4ZNCD 3C6SA 2V5SA 1EEZA 3PL6A 3MLRH 2F54D 1XSIA 2R9HC 4KVCL 3REWB 5E1QA 3AXLB 3FRUA 4P2OB 1F18A 2DQUL 3DGGA 4GAFB 4HLZG 1GKEA 5A16A 3V6ZB 2P80D 3BZFB 2FR4B 2HLFD 4PI2A 4EI5D 3IPBA 1AAJA 2WWKT 5LDUA 5F44A 1JHLL 1O6TA 5DD3H 5DJAB 5EZJA 3T3PE 3BFQG 1FV1A 5FHAH 3BAJA 5HDLA 3MRFA 1B3JA 4IJ3B 4S1QL 3ZDZF 2CBQA 4MZ2A 1OM3L 4OF0A 4PWJA 3CDCA 1IKOP 1MFEL 1P5UC 2XN9E 4PG2C 3BAYA 3LS5H 4J4PA 5L4MA 5IIEA 1I1AB 1E4KC 2BP5M 1BXXA 2R4RL 3G08B 3A22A 3K46A 5EZIH 3Q2NA 4WWOA 4E2OA 4Y2NA 4YSEA 4XMPL 4PCKA 3D5OF 4YAQA 2R83A 4O02H 5FOJA 2EINB 5FW8A 4C54A 1ULVA 4U1IA 4DZ8B 1RIUH 5GJTL 2NY0C 1BQLL 2MKLC 2VM4A 4MAYB 2KI6A 1H15B 2G9HA 2GT9A 5I1IH 2ISDA 1XGTA 3MLUH 2FWLB 5I76B 3PDGA 1AGEA 1J9SA 5ID1B 3CHXA 3OJDA 3BAIA 3DUUA 1WFNA 3RBSA 4HXAH 3MV7A 3S48A 5GS0C 2FO1A 1NL0L 5F88A 1SJVA 3HUJF 3AZUA 5IVZB 4BWWA 4XP6H 2CXGA 1U30A 2EE9A 4LDOB 1EDYA 5FM8A 4I4WA 4FFZH 4C56A 3KPOB 5K39B 3IJ8A 4L4TB 1ADQA 1BCIA 3D18B 4N2IA 1AR1D 2AAAA 1QBAA 3BWZA 1M53A 3RZCB 1AZNA 4AV5A 1KJMB 3RGVC 4RBPH 3X12B 1KDIA 2Y5TB 3BPOC 2X4SA 4JB9H 3KXFB 3KCPA 5HVGB 3RFRA 3FFCA 2QDVA 2UZXA 5LNEA 4CC4A 3LRSA 1E6JL 4LIQL 1QR1A 3DIFA 3D3VE 5I8KL 3EH2A 3NYKA 1KEMH 4FHKA 1UA6H 2UWEB 5KSAB 3KHQA 1J0IA 2IDCA 5DK0A 1M6OB 5CJ8A 4XB3A 2VW4A 4PJCF 1RAMA 1H0DB 2NW2B 2DYPB 3ATAA 4NDMA 3DMMA 2WINA 1SVZA 2AQSA 2NLJA 3FQUB 2N01B 2QPFA 3UZVB 4XNXH 5CNHA 3WIHA 4XWOC 4X7TB 4QAMB 4N90D 3IN2A 3QS2A 3WIHH 2DWYA 1V3JA 4HXBL 3GXMA 4NAMA 2PYEE 4EN3A 3GJEB 4DPAX 1BFOA 2HVJB 4FABH 5I1JL 4AKPA 1KYFA 2K70A 12E8H 4Y1AD 3U4EB 1X44A 4UINH 1OAYH 1UD3A 3FMGL 4UTBL 2VXSL 4OCWH 2V0AA 2VB5A 5J57B 1ZTXL 4V2CB 3H4HA 2VDNB 3LRLA 2X1XR 1BMGA 5D1QE 2BWDA 4PJ9D 2EE2A 5L2KA 1D7DA 1UT9A 1N5YL 4TOYL 5DTFA 4IIZA 3TO4C 1KGCE 1OPGL 5K39A 4G7SB 1LO5B 4LSUL 5MP6H 1M1XA 1P6AB 5CJ5A 4U1NA 3U0WH 2ODIA 3ECVA 1P53A 1U3HA 2Y5TA 1KCVH 1BVKA 2JJWA 4Y19D 2BP0B 3FO1B 4AH2A 3H2QA 3HN8A 5AAPA 3PWPA 2AEOA 3U9UB 3QIBA 4H25B 3DIFB 4IK7A 5C09A 4WJG3 2CHZA 3KPOA 4OGYH 3RIFK 4TVPH 3SE4A 4FQXC 4OB5L 1Q38A 1A66A 4JHVA 1QABA 3X13A 4S1DD 3X1EA 3X12A 2JK5B 3L5WB 4XODA 4DERA 1QI4A 2V3DA 2YFNA 5BVJA 3MFFA 4JFDB 4NLAA 2XBZA 4ZOAA 3HZKB 4LLQB 4ISVA 4M7JL 1XO8A 2COVD 5AKRA 4AMWA 3EO9L 1VPOL 4OCSL 3QYNA 5IFAL 1FNSL 3E6FA 3B9KB 2QPDB 2H47C 3MU3A 4A6YA 2D8KA 4YHNB 5JYLA 1F42A 1FH2A 2WZ5A 5ID0B 3ZDXF 1XZ0A 4DK5A 2GJRA 4HIHB 5D1ZD 5JW3L 1P1VA 3KCWA 4DETA 1HESA 4WFFE 1T7WA 3DVFA 4EI0A 2Q76A 2FJSA 1SEQL 5IJDC 3ARZA 4GMSH 1B4JH 1RZKL 3IN0A 3QZMA 1QX1A 3GTNA 3SKNA 4XWGL 1V10A 3HZVA 3TA4D 1ZANH 3B2MA 3LN9A 3Q1SL 3RAJH 1N18A 2RCSH 2IFGA 2QVMA 5IGXL 1MNNA 2OM5A 2ZWZA 2BLFA 3MRLB 2QVTA 1XEDA 3UYPB 4PRIA 3QO0B 1HILA 1YUKB 4ODXB 1A5FH 4E9QA 2KLRA 4HWBA 1A3ZA 5EU6E 3ARGD 1WAAE 1QRNE 4ZUVA 4G8EA 3JYBA 2FHBA 3AS3A 4GXVL 1A0QL 2EXYD 5E8DH 2OI9C 3QJFA 3BIKB 3QUML 1VA9A 4RNRA 1E5YA 2NNAA 3V0VA 5K59F 5MERA 4FNTA 3SD2A 1H3UA 2X12A 1U36A 1OWRM 3V7AE 2XNAB 4G6AD 1BVNP 1U8QB 4Z7QB 1RXLA 3W9EB 5MEPB 4AIZA 2C9RA 1QFOA 4U49A 1QACA 1E4JA 1C1EL 5CHNA 2VDLL 2DJMA 1QPXA 4AK2A 3HPLA 3ABMB 2H3XC 3TL5A 1DJXA 4NGHL 3SQOH 4YNYB 1UACH 3PHSA 5DQJA 4CSSA 1H3VA 2QQNH 3GSNA 1DBBL 3VFOA 3CFKA 2L7UA 1QSEB 2EDWA 4A55A 1QHQA 1OALA 2BSTB 3SO5A 4L9DA 4Y1AB 1RUQH 2KC0A 3B7TA 4P2QB 2AGJH 4JFFD 4K0OA 3CDYA 5A2FA 2BVQB 4ADGA 5I15L 1U8NA 4JFSA 5CP3H 1CGVA 5C0BB 2AXGA 1TEFA 3QNZA 2BNQB 5MI0B 3ESOA 2Y1AA 4Y4HD 1BIHA 2Y06H 1KJVA 2UZYA 4Y9BA 2CRMA 2IAMC 1BMWA 1LK3H 5BUPA 3HZYA 3UJIH 4JG1H 5TDPA 4Y5YB 1O7DC 3FT1A 3PAZA 4P46D 3TH3T 3U7YL 1NDMA 4BDVB 4AQ8A 1MY5A 4L05A 4TUKL 3U82B 3UC0H 2VAJA 5LGHL 4QIRA 2H6OA 5F89B 1NKGA 4LP8A 4LLAA 4MA3B 2FCBA 4GUPB 4GSDH 4OZHF 2ZONA 3RYMA 3SY0B 1A9VA 3WNJA 2VLKB 1ZT7A 3A4DA 3Q9QA 3ZK0A 2CLVB 3BN3B 3IJEA 4V1DB 5LBSA 3K81A 4HOMA 3KGTA 1A9BB 3OC5A 2D7QA 5IJVB 5JIPA 4I5BB 4Z1PA 3MCLL 3NJLA 4PUBH 3HHMA 3JWNC 1V27A 4HKZA 4YZFF 1QA9A 2VXQA 5SWZA 3TJPA 4F1ZA 2VNCA 3KWUA 1C5CL 1MWAH 3QEQD 3E3QE 3FF7A 1M7DA 4FP8L 3D39D 4OZ4A 3QZOA 3BWSA 3GI9H 3KJ6L 4TVPE 1PTZA 1NCWL 5I1EH 3DETC 1UA6L 1JFQH 4PJDA 3ZBMA 3T4AB 3LHPL 1IC1A 4GBXB 5DK3A 3GMOA 4ZYKB 2P8LA 1CYWA 2WTRB 5IV2A 5FHAL 1DQDH 1XCXA 5LXVA 2ESVA 2H1LM 3FB5A 4M5ZL 4S1SH 3CZKA 2WUCH 5ISZA 4D2NA 4A6YH 2VE6A 1WGOA 3D06A 4LQ1A 3TJEH 1UT1A 2E0PA 1ZIBA 4LB8A 4HJJL 4XTRD 2Q86B 1KGWA 1VHPA 2D3VA 1P4IL 4NKDB 5D7JA 1CFQA 4IU3B 3BQUB 4NQQA 1J48A 3IJ9A 1UQSA 2NY3D 3B6SA 5EUKB 3VU2A 5I8KH 2G5BB 1P5UA 2OTPA 2BVTA 5JYMA 1KIPA 4Y8DC 2X7LA 3FOLA 3IDIB 1A7NH 5ACMA 3WGUB 1SFHA 4R0LA 4R8WH 4WW2C 5EO1A 1A1NA 3F7QA 4PVLA 5F1OB 2XC8A 3V4VB 2X41A 1SEBB 2QQKL 3LKSA 1MG2C 1I8IA 2AF2A 2XX0A 4R7NA 1R17A 4EZMA 1JZFA 1OP5H 5T1KD 1MLCA 3ZR5A 3ZDZE 4DVBA 1OPGH 2N56A 2PN5A 4ZUWB 3ISWA 5BO1H 2DD8L 2JKSA 4L18A 5DO2C 3CX5J 3KYOA 4NRZA 3I02B 1H5BA 2QTEA 3JTSA 3K91A 4PJIB 5CIPA 2NX5A 4ZAKD 3I2CL 3ZTJH 1RERA 3WELA 5IB1B 4KDVA 4ODTH 4GW1A 3L7FB 4NKQB 4AK1A 4PMEA 3QCTL 4HQQH 4U6HA 4N0CC 4DSYA 3TBCA 3FAXA 4FI7A 4QHUB 2HA1A 4JZNB 5E2TL 3MRNA 1K8DA 1KEGL 3WLBB 1EFQA 1U3JA 3C2AL 1DQML 5FGSA 2YEVB 4QTHA 2HRGA 1NEUA 1TJHL 5ACLA 4M8VA 2O61B 1UURA 2RJMA 4BKLB 3EO1B 5IEHB 5CLXA 4AJVA 3MLZL 2XWCA 3BHBB 2ZXEB 3GUTB 3CFEB 3VWKC 2QHLA 4LNRA 2W38A 5GRUL 2ESVB 2JWYA 2Q8AL 3IMBA 5LXGH 2YPLA 1INEL 4YO0A 3F04A 3QJUB 1KIPB 4KH2A 3VH8G 2XWRA 4Y2DC 3EBHA 2AK4D 1RULL 1BVLB 1BBDH 3GPEA 4WWPA 3PWJA 2VN4A 3NQKA 1CXFA 5MEND 1OF2A 2Y7OA 5DVKA 2VIRB 2DRUA 4WUUB 1NLDL 1QRNA 4RFNB 4H7VA 5I82A 2IMNA 2NNRA 2HKAA 3SYOA 4DKEH 4FXGB 4WHTA 3DV4B 2FX7H 4K71C 2KDYA 4O2CB 2VRKA 1A64A 3VRJA 4XBPA 4C56E 3LCYA 5E5UB 3VI4B 4EBQL 3SEPA 3IFLH 1B2WL 4X4ME 4W9DC 1T66C 1E2WA 3A24A 4XXDB 1G9MH 2E7LC 1AKJA 1FORH 1ZLVH 3FOMB 4OCYL 2RQ8A 3QXWA 2LVCA 2FLMA 4DKAA 3G7TA 4NC1C 2H1PL 2JXMB 4HFWB 1UTDA 1N7ML 1XF2A 2EIEA 3OZKA 5LUMA 1A2YA 4HKXB 5FA3A 4H8PA 5EA0L 1C5BH 4OGYL 1I82A 1ITCA 4UANA 3VFSA 1XH0A 1CLVA 2HVKA 4TLTA 2PWDA 2RGSA 2YRLA 1JZ6A 3O2DA 2ZOWA 2UXFA 3OQ3B 3GFUA 2P43B 3OB0H 1INQA 2VQ1B 2A73A 3CAFA 5I1AA 3TURA 4HPHA 2XN9B 2B9BA 4XTRC 3FQTA 4YHPB 4K3JH 4LDLB 5SX5H 3VXME 4YHLL 4MJJA 2H32A 3VD9A 4Y1AA 3T0BA 3T8VA 4POYA 3VFNB 5F7HA 2X53A 1OQOA 1NCJA 2FRGP 2P5EE 3CZFB 3DECA 3NK3A 3O8XB 3TA3C 3BEWA 2IBGA 4DUXA 4LFHD 4HLEA 1JGEB 1N67A 1UD8A 2AW2A 3BP4B 1P7QB 3MLWL 4PJ9A 3TLRA 4NM8L 3WFZA 4N2AA 5HDRA 5IW3A 4NQEB 3VXNA 4X4YA 5DFAA 4L4VB 1CICA 5GRVL 3OKDA 1ORSA 1SLWA 1DTUA 1T1YB 5D5ME 3ZHFA 2VXUL 2DQGL 3G5VB 3QIUA 2ENPA 3L1FA 3PV6A 1QLFB 2F2HA 2BCKA 2YIHA 3GMPB 3MA7A 3OJVC 4JRLA 4MA3A 3FB8A 1XZ0B 3R18A 3SY0A 4C56D 3PABA 1Z3GL 4D0CB 2CHXA 3BD3A 4FYTA 4WWKA 4BUQA 3S6CA 2WXPA 1E65A 1N12A 3PWPE 4PRHB 3VMOA 3ZXAC 4X5RA 3RNKA 1THCA 2R1WB 2Y1ZA 3VFUA 3LIZA 3GB7A 4XP9H 2XWJB 3ZDYE 4TXVB 2W1NA 2VDMH 3WGVB 4N2KA 2XG4B 2VO8A 4JG1L 1KN4H 1J12A 3FTGA 5MERB 2R2HB 4K55A 1K6QH 2YPKB 3QO0A 4UB0H 2F5AL 2DWDA 3IMWA 5AOMA 2Z8RA 5FYKL 3CSYA 1UCTA 3AY4A 5CN2A 4YHNA 1UZ6E 2QQLH 4GQPH 4XPTL 1CI5A 4UMSA 1A47A 5IEKA 3QE5A 4YSDA 3S97C 5IREA 1DVZA 2XBDA 1WS8A 4E0RB 4TNGA 3MCLH 1CXKA 2J71A 1R0AH 2EDOA 4N0UA 2NMSA 1GA2A 1IGIH 4NZDA 1HH6B 4AEHL 2QQNL 4EIBA 3O9WB 4LSRL 4M43L 2CA3A 4OI8A 1C5CH 4BK5A 3QDMA 4FA6A 4X80H 3SBQA 3O6LH 1OP9A 4GPVA 4E9YA 1KCBA 2A6KA 1ET5A 1F3DH 5DQ9A 2H1XA 2BJML 4AIZB 3ZT6A 2ZOOA 3FUHA 1MW1A 1RK7A 2Q8BH 4IBSA 1YECH 1MLBA 5SWSD 4F5CE 5K9QI 2XKUA 1O9WA 2DW5A 4LCWB 1U8IA 3KBFA 2LW3A 3P73B 3G5XA 4LSQL 2A3TA 4LVNC 1QMUA 3VWKA 5E6RB 4JANB 3ALXA 5D2NE 3PRZA 4KDWA 3DO7A 4G6AC 9CGTA 2WKGA 3QJFB 2DIJA 4JRYE 3U7YH 4CNIA 1XGPA 4JL2A 1RZIA 4HCRH 4JFXB 3SE8L 3NPSB 4XPHH 4YHIB 4KX8A 5EEUA 3GBLA 4HC1A 2JI3A 3HMXL 5DTFB 4AM0B 1U6AL 1YEGH 3K80A 3QG6A 3EIFA 3ZL2A 3UGEA 3CMOH 4Y19A 2X4UB 4R2GB 4PGCA 2FEEI 3B9VA 4LAJH 4YUEL 1HINH 1M1SA 3D34A 4ODTL 3BVUA 2FO4A 3P4NB 4ZFGL 3GBNH 1Q9KB 2DJ4A 2GJ6D 3QIBB 1HCZA 4L1BA 4B9KC 2NZIA 2WQXA 1CFBA 4NXSA 1W91A 1NBQA 4QRPB 3BPNB 4IRZA 1BFVL 2VDRB 4CDGC 3DURA 5B7MA 5J13B 4D8PB 3QIWA 1UD4A 4HZLA 5HHXL 5J1SC 1UH3A 3DX6A 2YMXL 2DI8A 4GLRH 1IAKB 1XDTT 2PPFA 1A7RH 4JFYB 3DO3A 3L3OA 4DQAA 4UTAL 2CJ3A 2D4FA 5HPOA 5KBPA 3TZVD 5B22A 1SYVB 3T4YA 5J56B 3HI6L 3DTDA 2G4GA 4P3WA 3TASA 1DSFL 4XCCH 1WWWX 4POZD 3D6GA 2XQYK 4H20L 4B41A 1Q1JL 4RGOH 4DNLA 2J43A 3ZTDC 1UZGA 4JRYB 4MMZB 2AQNA 5AW3B 3FSAA 4HZLB 5D7IE 5B3SB 4UQIM 4A67A 4U7KA 5DZJA 3VG9C 3RHWF 2BP0A 2K7PA 1X9RA 3JV4A 4D3CL 1IQWH 4HUVA 4YWGL 1QZNA 4U1SB 3NCCB 2R0KH 4XZUB 5DHYA 1E3ZA 2VERN 3BC9A 1CMOA 2UWEF 1ZT4B 5ICYA 2A6DB 4DPCX 1DQVA 3IF1B 4YN3A 5D7HA 4R7XA 2ZOUA 1E6OL 2JCCE 2YSSA 4PRPD 4LCYB 1AKJD 4QRPE 3MOBH 3OJDB 1BBDL 2QV4A 4MS8C 3RVXC 5T3XD 5CEXB 5AKSA 5DMYA 1Q9LB 1S7WB 3FFOA 3WNMA 2HKFH 4P9ML 4FZ8H 5DJYB 3ZYOA 5EEWA 2VUKA 4IMKC 4Y5XB 1EWHA 4HUXB 1DQLH 1QSFD 4FQJL 4JFDD 4YE0A 1PY9A 3P4NA 4N1HB 4R0LC 3T4AC 3THML 3RGBA 1QW8A 2NTSP 4MNQE 2AJSL 2R1YA 2APBA 4HUUB 1H8SA 1OD9A 4WFEE 5IVXF 1IM9A 4CDHA 1CFTA 4IKJA 3DJTA 5DYOB 1NFDA 1AZZC 5EULV 1ECYA 1MVYA 3R06A 5DUBA 5DK0B 2HFEB 2R1XA 3K8LA 1KTKE 5EPMA 1T1YA 3TA3D 1INEH 1K72A 3L1EA 1SDAB 2AKRA 2HTLC 3MRPA 1ADQL 2WBJD 3MRRB 1BZQK 1TPXC 2GK0A 2WNKA 5LQBL 3UTSD 3P2TA 4QTIL 3D2UB 1FZJA 3U48A 3ZSTA 2CO2A 2FT8A 1ZGLA 5I6XC 1VZGA 2R2HA 2CCVA 2R56L 3APDA 4UBDC 1BWMA 3OKLB 3RDTC 2GW5A 4XPGH 1TJGH 3AMKA 4YSRA 1E5UI 3I6LD 3P02A 4MA1B 2BIQA 3GB7B 4K7PH 4U1HB 5HHMD 5CD3A 3FYIB 2DL9A 1R3JB 3FU9A 3NDYE 1P4BH 5IG7A 1JZJA 5IOPA 1WTLA 1SXZA 1BG1A 4XNMB 2E8ZA 1HIML 3KL5A 5D7KD 5GGVH 2XWJA 1G6VK 2C3WA 2VERA 5IMLA 3KLAA 2A74B 3NESA 2PP8A 1PU0A 2VLMD 2JKNA 4JPIA 4X6FB 5D93B 3UEZA 3VYNA 5L0QB 1R5VA 1EZUA 3PL6B 3TBSB 2EEFA 2B1OA 4N24A 1DO5A 5I0ZA 3TT1H 1R3HB 1NGXB 3K5RA 3F84A 5DO8A 1RCYA 5A3IC 3B43A 4MNQD 4OV5B 1EMTH 5DZLA 4AYMC 2YR3A 2XKNB 4G7YL 4MJIE 3KVDD 1ECZA 5FYJE 4JCMA 4LSVL 3V6OC 2YK1L 2Z1KA 3MV8D 4U6YA 2X70B 2VDML 5H37A 3NEEA 4FA8A 2YAFA 5F93C 2VDQH 3HC4H 4BBWA 3LQAL 3MRIA 2CKNA 5E6SB 5EDSA 5HP5A 2CMRH 5EZJB 1M6UA 1MFAH 1QRNB 3QWNA 1TZHB 2WXMA 1CFVL 3HEIB 4G42A 4WWID 3D33A 3KGRA 4IKKA 1CLCA 3PFUA 4JM2F 5HHNB 4PW9A 3ARGB 1O5DT 2HFFA 1YEFL 5AVVB 3ASOB 4XH2A 2WZ0A 5JR1L 2Y2TA 5CEYA 5JHDD 2YQ3A 4NX0A 4BFIA 2V9UA 3LB6D 3IRCA 3KGUA 5CUSL 2WXIA 1IKNA 1AOHA 3U30C 4UCFA 5DR5L 2V2TB 1A6WL 4LSRH 4M43H 2NY1B 4C83A 4OW6A 1Y0LB 1KG0A 1URLA 1KTBA 4ONFL 4ZPTA 5JOFB 5KSBB 2VQ1A 2WVVB 3CFMA 1OKEA 1C7TA 3RVWC 4WCYH 1CG9A 4ZMZA 4FFZA 3FYEB 4AYGA 3BEWB 1YEDB 3TBTA 4H1LH 1JPFA 2HVKB 1PEWA 4MXWL 1N64L 3G6JB 4UT9H 2GJ6A 5GZND 5LGKA 2WOYA 1HX0A 3SDXB 3N41B 5HYJB 4FJYA 1QBLH 2WLYA 2WXFA 1SBSL 2DBJA 3SKMB 1A3QA 4JO3H 3BKJL 1YNTA 2X87A 1VERA 3GSVB 5EO9A 3T9WA 4DO5A 5DD1H 5C0CB 1R5WB 1LE5B 1K6QL 2D03L 4HGMA 3GJFB 1SUJA 3QZWB 4CW1B 1JYNA 4X0KB 4A04A 1PKQA 3DWTA 1MJ8L 1T22B 3DX0A 3OG6B 1F4WL 2P5WE 2VMCA 3MO1A 5INDA 5C0NC 1NFDE 5HGHA 4JKLA 1DSFH 4PLKD 4CILA 5E2WL 1KJ3L 4P2RA 4WTZG 1HZKA 4Y16B 5DFVC 5IQLA 2WC7A 3T2OA 4ZFGH 1ORQA 5GS1B 1YDPB 2C5DC 3FQYA 5E4EC 1J9RA 3BE1L 2OK0H 3EYUL 4GO9A 3O2WL 5D7IA 3Q7JA 3MV9E 3SE3A 4JFEB 4Z7NB 2F58L 2PUQT 1S9VA 3SOBL 4LVNB 1XB8A 5A6LA 1NAML 3VYPA 1M57B 1RZ7H 4NJ9H 2NT1A 2W9EH 3QIUD 5D55A 3QA3A 2BS9A 4YWGH 5AZUA 3WFEH 2Z64C 1HHIB 1HHJB 4J6RL 2BNRD 4KJWC 3SOTA 3NRPA 4M6OL 4QRSB 5DMIH 4DGVL 5GJTH 1RPUA 3X3FH 2G60L 2OQJA 5B1CA 1KFAL 2A99A 1KXQA 4KUZH 1HH9B 1LO0L 3MOBL 3TFBA 4ZUUA 3LV3B 2Q87A 3MLUL 4GW1B 4F91B 4K7PX 5H94B 5DMKB 4N2HA 5FHBL 5IBTL 2P8LB 1J8KA 3FFCE 4NNYB 2F54E 1F41A 2BWIA 4JS7A 4HJ0D 2ZPKH 3S2AA 1WFJA 3D9AH 1CXEA 2K6ZA 2PPDA 3HNSH 4FJ6A 5FO9A 2Z7UA 5H4YA 2OZ4H 3WN5A 3FO0L 5AB2A 3RX8A 1N70A 2X6BA 1NUFA 1TEYA 2M2DA 3LQMA 2Z91A 4J3OF 4OCMC 1I1FA 4KXCA 4G1MB 1NPUA 1XIWD 4LCUB 4HSAC 1E4WH 1IGCL 1BDYA 2BNUB 3ROLA 4ADIA 5HYQB 1QSVA 4XE0A 3RNQB 5CP7B 3V0GA 4ELME 3U0PB 1NMBL 4F2EA 4PI0A 3NFSL 2ZXAA 5DHVB 2WJ7A 3UROR 5DJZB 1I8IB 3M7FB 3ZDZB 5HGHB 2VZ1A 4XCCL 3DMMC 3RX5A 5DEZA 2P7TA 2VQ4A 1FDLL 4QY8B 3MRBB 1GOFA 3DGDA 2QZ5A 1AH1A 5ECGA 4GG8A 3IJHA 4ZDHB 1RD6A 3LDBC 3UCQA 1KZQA 2R4SL 2EZ0C 3UTTD 3W0WD 2NY4D 2M26A 3RIKA 1O75A 1ZT1B 2X44D 1ZDQA 2LU4A 1IUZA 4TQ8A 1U95A 4B27A 5KG9B 1LO2H 3PUUA 1ES0A 1P2CA 3HE7B 3MN8A 5FWQA 3GLAA 3S5ZA 1BVOA 4NQCD 4PGBB 4YHOH 3RRQA 2VE6B 1ZLEA 1G7QB 1RI8A 5DMKA 2XYBA 2GBVA 4DO4A 4FXLA 1RHFA 2PABA 2FUTA 2FBJH 3STBA 2B9AA 3SSGA 2LFEA 2GPZA 3F12A 4X8XA 3X14A 5ALBL 4NKDA 3QDGE 3K6FA 3SCMC 4PP2A 2GSMB 2ADYA 1FNEA 1KYAA 2VDRH 3QC5X 1J0KA 1OB0A 1HEHC 2VSCA 3OAYH 3F5WB 1YRKA 4M9PA 1ROWA 3T09A 2EXYC 4NT6A 5C0AA 2XCMC 4XC1L 3QXTA 3VFRB 2W5PA 4M5SA 4D0DA 1YMHB 2FSEA 2BNQA 3DX8A 2E6PA 4MNQA 3DX2A 3THMH 3LMJL 5BJTA 2FEDD 1Z5LB 1DN2A 3HZYB 5DZ9A 5EFIB 3HFFA 3HRZA 2R0LL 1LMIA 4GYBA 1T1ZB 2WQAA 3HE6A 1YEWA 3T8XA 3GSNB 5D96B 4P2OC 3UOAB 3W2DH 5HHNA 3QUXA 1DZ0A 3WKMH 1W80A 2FEJA 3KPQB 1JNNL 4LHUA 1OTUC 1PZCA 2TSAA 2E9BA 4G8FA 3HI5L 3GRWL 1T0OA 3C60B 3ARBC 3PDDA 1IIKA 2SEBB 1YNTB 3CXDH 4GW4B 4PJHB 1ZJAA 2VLKA 2OMYB 4R97B 2EDQA 4ADJA 2X6AA 3LZQA 2XHNA 2D0GA 4UM9D 4NKIH 1L6PA 1HEJC 4UMGA 2XWXA 1AANA 3ZE1B 4IOFD 2BSTA 2BCMA 4C4KO 3P9MA 3VFPA 3QRGL 2BIIA 3JVGC 2YEZA 4JFED 1QFWL 1E28A 5JPMC 4PV9A 2QSCL 5JPNC 3BQVA 3NJJA 2V4LA 2PWGA 2ETWA 4F2ME 3Q1SH 1QFUH 1TQCB 1CB4A 3AM8A 2UZYB 5KJRH 4FQXD 1G6RA 1QSED 2G5RA 4LPUA 4XRCA 5DEFB 2DM3A 1TG8A 2H6PB 5J11C 3W39A 2OXGA 1I4FB 3PP3H 1HDMA 1T7VA 4JO3L 2VDNH 5LJYH 4N5EC 3MRPB 1ZS8A 4UU9B 3LZPA 4PQXA 3ZMEA 5C97A 1A3LL 4OQTA 3MJ7B 4YLQT 4DAGL 4U33A 1YNKH 1EHLL 5I8CA 1MJ8H 1FGVL 1RL1A 3LEYL 5E8NA 4C55A 4JG0H 2XN0A 2YUXA 4KO9A 3ILDA 2RH0A 5ID0A 3ZZSA 3MBWB 1F11B 4HWEH 4MKTA 2A83A 4F3FA 3MNDA 4QJ3B 3QFDA 4RESB 4WI4A 1IT9L 1C1EH 5D70L 5T33H 1ZGLB 4PJCA 4JGNA 4LPVA 1AG6A 1FZJB 2AABL 3DX7A 3UYPA 4JFTA 1CTNA 1F90H 1KLGB 4P4RA 3UYRL 2BZDA 3RIFF 3A3YB 3VW3H 1G7JB 4XMLH 5D8JL 1NAMH 2DJSA 3BKJH 1BXVA 1EHXA 1ASPA 1UB5A 5DEGB 3ULVF 3BZ5A 4J3BA 5BW7A 43CAB 3VFVA 2E86A 3ATEA 3S88H 3A6BH 1SDDA 4OF8A 2V33A 2JELH 3QEHA 4UQCA 3HMWL 1NFDF 5AVYB 2GTZB 5TFSH 1R5IB 1KCRL 1R3HA 3BGMB 2WZAA 3QJXA 3VD1A 4HDIB 3X3FL 4Y2OB 3QW9A 5TE7L 4UDTB 4KQ4L 5CCKH 1EQWA 4X6FA 1N5AB 2A74A 1X5GA 4KXAA 2JVUA 3CC1A 3CPUA 1AIFB 2J1WA 3FN3A 3OZLA 5HJ3A 2OK0L 2B3RA 4PS8A 3D25A 4R7LA 3ECBB 3S3PA 2DQDH 3HR6A 4MA8H 2KHAA 1IC0A 3G5YB 5C07D 5LAXA 1OARH 3MACL 3CSTA 2FJUB 2X89D 3POHA 4K15A 2OCFD 2CD0A 2A77L 2X6VA 1K5WA 3PAVA 3L3GB 4PG9B 4MXVF 4PJ8A 3D87B 3RPKA 2WWNA 2B1AL 2WCPA 2ZQKA 4G7RB 4U1NB 4IIQA 2QHRL 4KKBC 3BMVA 2J6EL 4LDEB 2EDTA 3U4EA 3RHWK 4KROD 3NFSH 1FC1A 4KVNL 5L2JB 2VUYA 1DJIA 1RZ8A 1HN1A 5DYOA 1WGVA 1T80A 3IGFA 4IJTA 3RWFB 3BGAA 3DMMB 3L2MA 3V79C 1EGJH 4PPTA 4ACPA 3PWPB 2OMVB 3DIVA 2D7NA 5BQ7B 4U4BA 5IFHL 3HNSL 5IBLD 5A6MA 3RGHA 4NQSB 2JSFA 5HVHB 2WXRA 1OCWH 3STLA 1WA2X 1RZ7L 1SJHB 5JQ6H 2NUTB 2WLLA 3DSNA 1FP5A 5DUPH 1ZVSA 1IEBA 3BMWA 4FNSA 2WLKA 1WVZA 4XPAH 4MQ7B 1NCAL 1HK6A 1XMWA 2A6JB 2G9KA 3B7SA 1NAKL 5J11B 1ANUA 1RZ8B 2IWKA 5K93A 1PQZB 3FSOA 3DK0A 5TK2A 1CK0H 3TNMB 1PZUB 3UJJL 2BFVH 1GC1C 4KFZC 1T5WB 5CJXA 4YSUA 2C9UA 2BVEA 4RMRA 3WUWB 1MFCL 5EOQL 3G3LA 3LSOA 4NFDA 4NQVA 4F33B 2R9HD 4XO8A 4IOFC 2FO4B 2E27L 3D39E 3ESMA 3O11B 4A7QA 1LO2L 1ZLWK 4JR9L 1OVZA 3ARBD 1MHHB 3TVMA 1CGUA 1JPSH 3BO8A 4YVUA 1S46A 4NOBA 4B3EA 3UBXG 3FJTA 2VAAB 3S98A 3U4BH 5A40E 1DL7L 3SJVD 1OGAB 4IRJA 3H54A 2W0KA 4U1LB 5EBMB 2WKOA 5G4NA 4JFXA 3UO1H 4XXWA 5KSUB 1HHKA 2YMTA 3TESA 4N68A 1DUZB 1TVHB 5JHLA 4KKNA 1YPZA 1WIPA 3D0VB 1JK8B 5L0QC 1A4KB 4DK6A 1KWGA 4KK6C 3HI1A 3AGVA 3MV8B 4PREB 2VC2L 5ITFB 3OLEA 1CVRA 2DQHL 4NO0D 4JO1H 4R6UA 3KXFA 1FRGL 1KELL 4OGXL 4JKNA 4M03A 5HHOE 4YR6A 3ULUE 1GR7A 1IEBB 3MRMA 4GXFA 3FQ1A 2FZ3B 2ZX7A 2BHYA 1KB9J 3B7UX 2Z31A 2XXGA 3CQQA 4XC1H 5CEZE 1XB6A 1KCSH 3I6GA 3O3EA 4MX7A 4FNLL 1MRDL 4ABWA 4IJ3C 1BQHA 1OK8A 4MJ2A 4MA1C 3U6XS 3CSPA 1V7ML 3L4YA 1G9EA 3QS3A 4ZQTA 1KSRA 1S5HB 1UM5L 4PRPA 5B8CA 1MHEA 4X6DF 3MGTB 4WIQA 2CWRA 4G1EA 1U8HB 3SCMD 3IDMB 3OWRA 4LAQH 4FQIL 5J8OA 1ACYL 4HJUA 3C12A 1QFUL 4LESA 4NN7C 4EI5A 4UTAA 3U7WL 4UOZA 2VKXA 5E5MA 2C4XA 3GXIA 5C3IA 3NTCH 1JF1B 1MI5E 4HZAA 4F7MA 4N0UB 2Y7SA 3EG9B 3EOBA 3ILQD 3WS6C 4KQ3H 3US9A 4YH6A 1IILE 4HC1L 2WVUA 3Q13A 5HYJE 3QHFL 3M46A 2PCFB 1MCKA 4ZSOA 1XIWA 3FB8B 4F80A 4IDLA 5ESQA 1DVUA 3D0VA 4W6XB 1XR9B 1HSBB 4HU2A 4YOKA 2AJZA 2ICWJ 2QV2A 1FWXA 4P2RD 4L23A 3CFDA 3DX3A 2FJGB 1OGAA 4IRJB 2KBGA 2VAAA 3LKOB 1TLKA 3OXSB 1GYCA 2MNJB 5K33A 4GKSB 3F8UB 2JF1A 1EHNA 1YN7B 2UXVA 1AE6H 4I77L 4XCEA 2PTVA 1QHOA 1XIWC 3AXLA 4NQDA 4P2OA 1HCFX 2RB8A 4XPBL 5A16B 5J06A 4Y2OA 3T8XB 5ITBH 4G9FB 4JDZA 4Z7VE 5BOJA 4IU2A 4KK6D 5EORH 5IM7B 5AB1A 3CSYB 2BNRE 4KO6A 3V0AC 3WS6A 1L9TA 3QJRB 4NJAL 1X5JA 2H3NA 3GHEL 5AW6B 4NN5C 3QRBA 1XGZA 2J5WA 4BGLA 4HX1A 3IEAA 5IK3B 4KGJA 3PQYB 2CNZA 3B5GA 5CD5D 2Q2LA 3EW3B 3GSUA 5D5MF 2BHFA 1HSAB 2FJFB 4J3XA 4TKWA 4ZMXA 1NDGB 4YXLL 1CZ8L 4M02A 4XVJH 5TE4L 5B38G 3VW3L 3G6DH 3QXDA 1FNLA 3AREA 5B8CC 3D05A 4PJGF 3TPUB 4JKWA 3CLFH 4KO7A 2Q7YB 1YN6B 1LILA 2F68X 3D7PA 3FF8A 5KJRL 1P7BA 2BP3A 3M7OA 1WBXB 4W9ZA 3IRZA 4I8DA 3QWOA 5C0BE 5F3BB 4DUVA 4OLUL 3CUPB 3W11D 2ATPA 1AXSB 4MVBD 5AOKA 1KPRB 4K3EL 5E03A 4XP4L 2CCWA 4YSCA 1LNUB 4DP0X 1T89C 5C2BL 3K0YA 4Z77B 2YD2A 3MJ9H 4FQCH 1A3LH 5FK9B 1FYTA 2P3YA 2V3EA 4JPKL 3E1F1 2BY2A 1T21B 2ZXBA 3L17A 3S3JA 1NEZA 2WB7A 3NJXA 1X5KA 4G9FE 4Z7VB 2GFBA 5K5YA 1T6BX 3O4OC 3P1VA 2DB8A 3L3GA 4XP6L 4J1UA 4O58H 4NWTL 1U8LB 1FVEA 4IBLT 4WFGE 4PMFA 3VXMA 4AKQA 3FULA 3NJIA 3ULUC 3MRNB 3TVMC 1MJUL 5GIRA 3B8YA 3V7AG 4H1LB 3SGDH 4AMKL 4L29B 3C5SB 3W0WA 3DI2B 5HHPA 3FQRB 1N59A 1JXGA 5IW6A 3NMEA 2YZ1A 1MF2L 4OZGE 4XI5C 3IMSA 1F4YH 4PCSA 3G6JE 4RA3A 2ENSA 3MRBA 3WN5C 3VTTA 3AU1A 5JOPE 3L7FA 2Q8BL 5AOLA 5G4MA 1G7HA 1GYVA 2HT3C 2IH9A 2GBAA 4LOFA 4M7KH 2BDNH 4HDIA 4TM9A 3ZDXB 2I26N 3FT2A 4KZCA 2M8XA 4U7SA 3FT3B 4YXKL 1LO4H 1PLGL 2YRZA 4NRZB 3BXNA 3C6LA 3NABH 1FYHB 1MFEH 4Q89A 3S5LG 1YEEH 1JWSA 4XNXL 2FNWA 2J1XA 4HCRL 3SE8H 3LKQB 1VKXA 4L2YA 3WFHB 4FF9A 2FSDA 3EJJX 5L88H 4MXQD 2R39A 4U2ZA 4K5OA 3EO1A 5IEHA 2YS4A 3VGBA 4MDIB 4QHNA 3ZQ9A 3TXAA 1I7TB 1JZGA 2BK8A 4WUUA 3QFDB 1OAYL 3FMGH 1V7NH 4LP5A 3EJZC 2A83B 4UTBH 1K8DB 4DN3L 2DM2A 4ODUB 1S7SA 2MNUA 4P5TD 3DC0A 4Q0XL 4R5XA 2AJUL 1EEQA 3HE6D 3WJLC 3V6BR 5MI0C 1N5YH 4WW2F 2J6EH 2A6IA 2HKHH 3NEOA 1CDUA 1EJFA 3AUWB 3D4GA 1KTLB 3K0WA 1UWGH 5IB2B 4X7SL 1OW0C 5IBUB 2UXGA 3LDBB 1T03L 4PJDB 3TWCL 2BNRA 4AJWA 3M07A 4XCFH 3RTQA 1NZRA 2IH1A 2DICA 4IRSC 4PJXA 4B5EA 1WITA 5IFHH 1OT2A 5J12C 2WTPA 4WSKA 4Y5VB 1FH5H 2W95A 3HG4A 5FDYA 3VD5A 3H0TA 2VDPL 3BSZA 4LEXL 4PBVC 1NJ9B 3L4CA 2HT4D 4PJAE 4OZIE 5IJVA 4OQTH 3MTXA 1A6UH 1Q1JH 5FM5M 2FD6H 3BP6B 3KJ4C 4XNUH 2E74C 5I5JA 5D2NB 3OKMB 3G6AA 3P9MB 4N2GA 1S7VA 4AQEA 5ETUA 3FB6A 4ZYKA 1CPUA 4G6KH 4XAKE 1DJZA 4J3OG 3BP7B 4OD1H 1SOKA 2Y7QA 2DLEA 2FX9L 4RGNC 3VXRA 4V1DA 5GSRB 1C5DA 5MEOA 4BE6A 4UV4L 1GIGH 2YA2A 1XF4B 3KD4A 2OMNA 2P8PB 3LOWA 5IP4A 1WAEA 1UH2A 3TO2B 5BUGA 2P47B 5C0RL 1MJ7H 4GO8A 5CGYC 1TR7A 3QZBA 3ZTCC 1JF5A 1T6WA 3VCLB 1IJNA 2Z34A 5CCJA 4GMSL 4BIKA 1CE6B 4JREC 5E6IC 1DFBL 1U33A 4R4NC 3AXIA 4DP7X 4KHTL 3ZTJG 4AYBA 1ZANL 4FFZL 4NNYA 1VFUA 3BWUF 4OZHA 4FYRA 4ZW6A 2HJLB 1F58H 3FAWA 2V8MA 1BVZA 5I1CL 1X4ZA 4DVRH 1D5IL 3JTTA 5F0JB 3V6FB 2YXMA 2D2OA 5T3ZD 1AFVH 1OTUD 1UB6A 2EJ1A 2CUAA 2VR3A 4GJTB 3QNXA 3CXHJ 4Y89A 2Q5BA 1OF0A 4RLDA 1GW0A 1XTLA 3BZ4A 3EH4B 2Y7NA 3WO4B 2VC2H 4EN3C 3BP5B 4TOYH 1K5NB 4DGIH 4LHQB 4JY6B 5CKAA 4PSPA 1XCWA 4L3ED 4PJEA 3WKNA 1J9QA 1SFDA 4LBAA 1EAPB 4ANVA 3QORA 1XSOA 4WV1B 4BFOA 1GYUA 5AENA 5KW9L 5D2NA 3NDZE 3RVTC 4BKTC 3Q5OA 4GSQA 1MNUL 4K23L 2ZKHL 2J5LC 1OK0A 1CG9B 4GS7C 4OB5H 1QTSA 3KYNB 2PPCA 1A1MB 4UIKL 1RP9A 3I9AA 3WIHL 2VW7A 2WMPB 1Q8MA 1QNZH 5IMOB 4NZJA 3MV7D 5CLWA 4JQVC 4P23B 3Q48A 4QKXB 2QVKA 3V4PH 4WO4C 2N1TE 2YA1A 3CBKB 3EDDA 1T22A 5GXBB 2AGJL 2NTFA 1SXAA 1QZ1A 3CFKB 4QY8A 2BMKB 2HJFB 2X5PA 1U58A 1KMGA 3J8F7 1G94A 3WXWH 5F3BA 1KYOJ 4TUUA 1E4HA 4UT9A 1YEKL 4I1NB 5IR1B 2KKQA 1QUNB 2Q7YA 3QUXC 5AVZB 4U1MA 2HLAA 5MENB 5LCVL 4ETQA 1E9PB 1PFOA 2DH3A 3MYJA 2B15A 2CRIA 2E9JA 2EEDA 4ANUA 4NO0A 1T0MA 1E8WA 1CE1H 2RCSL 5F9OL 3AY2A 1S8DB 3IAQA 2WXHA 5HHQB 2C9PA 1DANU 2VDLH 2WNGA 6PAZA 3DMMD 5IQOA 3GO1H 2WXKA 4PLJD 1JRHL 3VFGL 4PH8A 2A9CA 1OCZB 2B0SH 2DTMH 4O2FB 5D1XC 4QHKJ 1I1RA 3PF2A 1RZGB 3QUKB 4ZJ9A 3AABA 1J10A 1RUQL 5E95B 5CJOH 3B9KA 1HU8A 1VPOH 3ETTA 4OCSH 1U3HB 2FGZA 3FN0L 3MRRA 4P99A 2YRBA 1QR4A 5KVFH 1TENA 2VLLB 2Y22A 4OY9A 4B9GA 1B9KA 4BFEA 5I2IA 3MODH 2MOQA 4XCNB 3VWJB 1TTCA 3FQRA 2C1PB 4NP4H 5IG7B 4OM0L 1I7UB 1YLBB 2JCCA 3ARSA 5C07B 2E47A 3X13B 1B4JL 1MREH 3WIAA 2DM4A 5TQ0L 3CK0L 2DY2A 4HIHA 4W4NA 1YYCA 3G6DL 4PJ5B 2ID5A 2ZT9C 5HPMA 4M6MH 3HVDA 4KBPA 2MTPA 4PS7A 2OX5A 4XNZC 1IARB 2EDMA 4UAOB 5F9JB 1AZRA 3L4WA 5KEZA 4OSUH 1BBJB 2Y2YA 1KB5A 2V2XB 4QF1A 2XETA 2ZX9A 5AQ0A 4IDJL 3WHE1 5EU7C 2HMID 3WG7B 1XR8B 1USQA 1T7ZA 2LQRA 2ZP0T 4GXVH 1CL7I 1R5VB 2EEAA 2FVNA 5C0FA 4FG6D 4NHCH 1GOHA 4NWUL 1MCNA 5KSUA 3BUBA 4FFYL 3EBAA 1CXIA 2XTJD 4KI5D 1YEEL 3K74B 4BFJA 1IO4C 3MLYL 3N44F 1IBYA 3EBGA 3Q8BA 2IH3B 2FX8L 3MV8E 4Y2LA 4M3KB 4QRRA 4XZUA 4H88H 4PRHD 4N1EA 1P4LB 4Y5XC 1IEHA 3RPIA 1D7CA 2G2RA 1GMEA 2J1KA 1J8HA 1E2ZA 3CDZB 3MUZ1 3QJHB 3I2CH 3ZIYA 3QYMA 1H0DA 3UTPE 1KJ3H 1IQDB 4EE2A 1UWXK 4JE4B 1WUZA 2XV6B 4I9WD 2H2PC 1HSAA 2FJFA 1ZPUA 3N0PB 4Q2ZB 2X6UA 1KYOK 4ANXA 2NLJB 3FQUA 1NMCC 3S4SB 4TSBH 4ZPTB 1JCKA 3MXWH 4G43A 1F4YL 2F53A 3EAKA 4OZGF 1T83A 3GXUB 5C6PB 2HKHL 5HGBA 3CXHK 3L3KB 3UACA 2HT2C 2FLRT 3OKEB 1PW3A 1TXKA 1ZT4A 3DPBB 4K9JA 4OFYD 4QRUA 3E8UL 1XGQB 5BOZG 5G5DA 1U8MB 1S3KL 3CV5A 4Y4FD 3RY5A 1KB5H 3C8HA 2AAVA 4UV4H 4WNSA 4J5VA 4WI3A 1PLAA 4F7EB 2FT6A 4GRLB 4LO9A 4MZIA 4UT7H 3JWDL 1SHMA 1NEZG 4JKKA 2QTVA 5E08H 3CU1A 1SN0A 3VJ6B 1GGTA 1N0LA 3JYCA 2K8MA 2C34A 4XNUL 3ZTNL 4OLVH 5BO0D 2X2IA 3MV11 3WENA 4LLMB 5I1CH 43C9B 3OLGA 2Z65C 5ESQB 3BH8B 1RUPH 3T0EB 1EXGA 1I9RH 3MRHA 5FUCC 4QHKI 1W8EA 1XR8A 1XL4A 4IIQB 1OY3B 2ZWNA 3MRKA 4J3WA 4UM8A 5CWSA 1PG7L 3BW9A 3QYCA 5I1GH 1MXGA 3ZHLA 3RL1B 2P28B 1KN2H 1T2QH 4O4YH 2VLJB 1JF1A 3QJHA 4TVUA 1Y6NR 2IMMA 3RWJB 4HLZH 2X6MA 3QDMB 3SBRA 1E42A 4AX3A 4DZ8A 1B4RA 3TFKC 1LWJA 3P4MB 1EFXA 1RUML 5E8PA 5CSZB 1B4TA 3EF4A 4XXWC 4ZTPL 5F7KC 5EO0B 5AAMA 4IRJC 4G7QB 3HJ0A 4XNMA 1FH5L 4N2EA 2A2QT 3UX9B 3SDCC 4AOFA 1HHHB 5T3ZL 2VOTA 4QYOB 4JKPL 1FL6B 3HA0A 4MDRA 1Z9MA 1JFHA 5CD3B 2DI9A 1SMAA 2IADA 1WAAA 2NZ9D 3L2NA 4JFHD 3A6CL 4P05A 5DS8A 2WNXA 5BOPA 4EPSA 1EBAA 4FLOA 5KBMA 2NZ9C 2J6EA 4MA7H 4OCXL 3NP4A 1IBBA 1IKNC 3OHXB 4FA7B 2R1WA 2F19L 3M17B 4LLYB 3IPEA 3ARVA 2G0KA 5DRWB 4L8SA 3HHSB 4IRSA 3GZPA 1UUNA 1R6VA 4RISH 2X88A 5SWZD 3DX7B 4BSVB 2O6EA 4HIXL 4K94C 4LF3A 1I85C 4KY1H 3QJQB 3G5VA 2O5XL 2WZPA 4RZCA 4OFDA 2JB5L 1CICC 2O6CA 3ZE1F 4LBEA 4RWHA 3BJ91 1TFPA 1DR9A 4OCRL 2VDRL 1XCQA 2VXUH 3IJSA 2DKUA 3QT2A 4M4RB 5EBGA 3FRUB 4WWKB 2Z7WA 3PWUB 2OL3L 4HJTA 3CZFA 3O8XA 5KVEL 2BFGA 1G0XA 2HTLD 4RGNB 2PO6D 3IKKA 4X8JB 1IE5A 4YDLB 4XB8A 4WFHD 4UU9A 4R3SA 2WQSA 4JM4H 4F8NA 4ZFOA 5J7CC 2QKSA 1PCXA 2JB6B 1HI6A 3G9AB 5HHVL 3NQIA 4M6NL 1MAML 4KVCH 3IFLL 3TNNA 2JJTC 2EE3A 3HR5B 4CVZB 2QBWA 3OKNB 3PPEA 2VLLA 2EDJA 4XMZA 4PV1C 3HG0A 1I3UA 5KW9H 1GRWA 4OZGA 3TEZA 2WLHA 1AHKA 1C5BL 3IU4H 3U36A 5IQ9B 3R19A 1RZGA 1OTTC 4U1SA 4NM8H 4AJYV 1E9OB 4OLEA 1FFOB 2WY3B 2XVKA 2PTUA 4L0YA 4X5LA 2IPTL 2XACC 1Z5HA 2CLRB 2E6JA 4TLKA 2EUZA 2BP8A 4U3HA 3N85H 4XMTA 1GY2A 1AKJB 3BZ4B 5F7MC 4NO2B 3DLQR 3EDJA 1DQTA 5CSGA 2C1OB 1AGDA 1Y1UA 4Q74A 3QDGB 1NGZA 5DHEA 4EI6B 4WSJA 2DS4A 2VLJE 2FX7L 4PRBB 4GP5B 5HI4C 4APQC 2LTQC 4HWZB 3MODL 4NWUH 3LEVH 3IFPB 3QFGA 1MJJA 2ESVE 3QPKA 5D71H 3EZ8A 1EJOL 1UKSA 2D3NA 2EC9T 2C7FA 3V8CA 4NUGL 3FH8A 4TPRL 1NL0H 1TVBA 1I7ZA 4KI5C 3T3PF 2R69L 1YMHA 4UB0L 1HE8A 2A73B 2VR7A 4NPJA 1T1ZA 2OS7A 3HE6B 1U8PB 1UXWB 4Z6AT 5I1AB 2NTFB 3BEVB 1MCJA 3PQYE 1M71A 4OGAC 5HYSB 5I1HL 1AIZA 4WFHE 4N85A 3ECBA 1WE5A 3HZMA 4JRXD 4K3DH 3C60A 5EIIG 4RA0C 3UG3A 3P3UA 4KPHL 3MBXL 3NUKA 2ZKWA 4RAVB 5IHLB 1B9ZA 4W9IC 1W6LA 4AEHH 1CVSC 1BXAA 4P5RA 4MDJB 4IKIA 3R8QA 3VE0A 3ZJAA 7CGTA 1NFKA 2EDEA 5TD4A 4M7LL 5I17B 3BP4A 3CXFA 4PJ9B 3I84A 5KANG 3WFCL 2YBRB 5DD6A 4K73A 2VDMB 3F62A 4N8VA 1JIBA 5J6HA 5DWUH 2JKJA 1T3FB 5J0BA 4X6CE 5HI3D 4HAKA 4WHDA 2WXGA 3OR6B 4HKJB 1X5ZA 4ODSH 3DVGA 3HG5A 5L7XL 2JELL 4M1CD 2J56A 3PWVB 4U6XB 2EO1A 5D2LF 3MLWH 4YBLB 5DHMC 3IDXH 1EAJA 1UM4L 1ZA6B 3VRIB 3KNBB 1Q9OA 3UABA 1ZE3C 5JNYB 5IW1B 3RQ3A 3I02A 3W9DB 3UJTL 1P1ZB 1YMME 2A6IB 2A9BA 3MZTA 1JZHA 3DXAA 3SO3C 1J5OL 3HUJA 2XPGA 1FO0H 3ETBJ 4X80L 2VLJD 1UH4A 3L54A 2B14A 4NIYE 1HINL 4TTGA 4PLJC 1I9RL 1X6NA 3CHSA 1RIUL 5AOZA 3KPLA 1HZHH 4PGZA 1NGYB 3MGOA 4HV8B 4RMBA 4DP6X 4ZMAT 2P7TB 2WK2A 4MXVE 3TF7C 4BV1A 1EUUA 4X8GA 2AJYL 3AS0A 3CFEA 3DROB 3AGWA 4PY7A 1E0OB 1A6VH 3GXPA 3BUYB 2YD3A 4BKLA 1W72A 3GMNB 3II1A 3FTWA 2MCPH 2DPKA 1XF4A 5FGRA 4F1SA 3OSKA 3VD2A 2GVYA 5AL8A 4MMXA 3LJ3A 1RZKC 1I1FB 4N6RB 2MNWA 4DGUA 3PHAA 3RWHA 3NACH 3GK8H 4UM9B 3HRZC 5C3LD 4PJ7E 4PJBB 3QZWA 1AJ7H 1CGSH 1FL5B 4W4OC 3EDFA 4M5TA 2Z92B 4PP1C 4XC3H 2IGFH 5I6MA 1JNHB 1VZIA 3G6AB 1R4XA 5BXFA 4HEME 2MOVA 1JD7A 1RURL 1E8XA 3CFBA 3GSRA 1KGCD 4KXBA 4HKJA 3SDXA 3VXSE 1PG7H 5I1GL 3OX8B 4WO4D 1TT6A 3UMNA 5AZ2L 3WTWA 4TSBL 1O6SA 3V5DA 4AL8C 1H3WM 3NA9H 1RZQA 5HGDA 1J87A 1JPFB 2NQCA 5CZXD 1C9SA 4Y19E 1OZTG 1BD2B 4DP5X 2HJKA 5I18L 4KZEL 4QHNB 4CVWA 3DHJA 4YGAB 3EUDA 2C9XA 2QMKA 1LLAA 1QNIA 3IJ7A 2XY1A 4JHZA 2XA8L 5JXEA 3HBZA 4ZTPH 2XIBA 3BN9D 1MCPL 1T04B 4ZUSB 3VTMA 3T1FA 3WL9A 4I1PA 4BUGA 4GBXA 4PJ5E 1ZLVK 4IEFB 1BQ5A 5C3TA 1Q0XH 2JB5H 3CQPA 1OOAA 4FLRA 4RGOL 4WI0B 1KB9K 3RAJL 2XU9A 3AG4B 4X6DB 4KY2A 4YQXH 2VUOA 4ZUUB 1PS3A 4NQED 4QR7A 3UDWA 2O6DA 1TLMA 1JGLL 2PYEA 3S36X 2FDBP 4KTGA 4EUPA 4AV4A 1FZOB 1A0QH 3JV6A 1Z9PA 1JWSB 1UWYA 2WGNB 2XKNA 1T4KB 2OPCA 3QUMH 3CE1A 4DVBB 2OAAA 2BOBA 4BSJA 4HIXH 5E6ID 5EU7E 3OKMA 4S1RH 4W9CC 3AB0B 4H8VA 2WWKO 5JMRA 2X1PA 1ZHLB 4Z0XA 3DUHA 4FHJA 4HPYL 1G7LB 1PEZA 3FUIA 1ZLUH 2CJSA 1P5UB 4NAQA 4M1DH 5JA9A 1SYSB 2J7LA 4X5QA 1IX2A 1ZS2A 1HWGB 2XRAL 2XV3A 4FRWA 3QXDB 4JHBA 1CDYA 3L1OL 2IH1B 4PJXB 5DGQA 3TGXA 3RKDD 4KTDL 3MRDB 4JKPH 2AK1L 4N0RA 3D12B 1KENH 1AGDB 4PWFA 1HNGA 1F86A 1FVDA 5T3XE 1JN6A 4LCCB 4FCHA 2YUVA 1AS6A 3WNNA 4GRWB 1W72L 2ZNWA 2X0UA 4E5XG 3CUPA 1MY7A 2B4CH 3HAEG 1UM5H 5DSCA 2NXZB 1OT4A 4GW5B 3V0VB 2BSBA 3TO4D 4WUUE 4U3CA 4IHBA 2K1MA 3LYRA 4DN4H 4TQPA 1KPVB 4P57B 5CP7A 2LABA 1E9OA 3K6SB 2QGEA 4PJ9C 3MCG1 5DRNA 4KJPD 3P0YL 2R0KL 2LE9A 5DLMH 1JPTH 5CILH 3UTZB 4HG4K 1NFAA 1LGVA 2PCXA 1WJ3A 5J6SA 1B88A 2XA3A 2NXYB 3OGCB 4Z77A 1Z9NA 1MIML 5DJ6B 5JOFA 1QO3A 5KSBA 3NFNB 1JJUA 3A4FA 3G5ZA 4CAGA 1A6PA 1PZ5B 4XNZB 3WEAA 3GT6A 1TYJA 3CNKA 2X28A 2E75C 5DMJB 2OP4H 4LPCA 4PJGB 2JKLA 3T6VA 2K9FB 2WAHA 4K9EH 4NZUH 5DVLA 3TPUA 3ZPDA 2D31A 2PYFA 4PU2A 3PHOA 1F5WA 3WS3B 3OSVA 1IBZA 1UXLA 3QUZD 4EI5B 4WGKA 4FMKA 2PETA 4E41A 1KXTB 1HQ4A 2ZG2A 5LBGA 2OJEB 4QHLA 4AVIA 4HCGA 3LY6A 4LLQA 5D1XB 4D9QE 3ZE2B 1HL8A 5DJDA 5HHME 4N0YL 1QWHA 3GSNL 4PRPB 5KTEL 3W0WB 3AS2A 1O6VA 3HFML 5CZRA 2OYLA 1I8KB 3U9WA 2XQBL 2XFXA 4U1HA 3ZQWA 2YAHA 4LVOC 4S1SL 1JNLL 1DQQA 1ETZA 2X9YA 1MXDA 3HHSA 4IQHA 3GHEH 2HT3D 3PNWB 5AW2B 2NY2D 1E5BA 4K5NA 4WTWA 5D6DC 3U9UA 2QR0B 5E1AA 3WCYA 2ZP9A 4DQOL 5IOPB 2E9WA 1ODUA 2R0ZL 4L4VE 3INUH 1DVYA 5FPIA 3HZKA 4G7YH 3MNZA 1P4IH 3O2WH 5L4FA 4OJAA 3WIFA 5DO2D 1KLUA 4X6CF 4YXLH 2W0LA 4IM8A 1ND0B 5T1LB 3AG3B 4M3HA 2J3SA 3UZQB 1HSBA 1OGAE 3S35X 4F9PA 4N2NA 2KERA 4WU5A 3SGDI 3KWWA 1UENA 4Y16D 4XAWH 2E59A 1BZEA 3HAEB 3VACA 1QHPA 3G04A 4RMTA 4J6RH 4N25A 7PCYA 1QBLL 1UWFA 3CZEA 3FQWB 3NJGA 5E8OA 4DGVH 4RWYL 1CD1A 2AJ3B 1UM4H 4LIQE 3PJSA 1X7QA 4V33A