5ECHB

Crystal structure of fin219-fip1 complex with ja and atp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 65
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5echB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5echB01
1EV9A 1PKZA 3R2QA 4KF9A 4JE1A 3ME8A 1OKTA 2YJ7A 4ECCA 5D9VA 2OKAA 5L71A 2CVBA 5HR3A 1I9DA 2HRNA 4YH2A 1XXUA 2IPAA 1T7PB 2MBTA 4DVCA 1XW5A 1EV4A 1GTAA 1TDIA 2PPTA 3A5WA 4I2UA 1K0MA 4Q5FA 2OJLA 3I69A 1K3YA 2PWJA 5DAKA 5JWOB 1F3BA 5C04A 2VLTA 1FHEA 2FWHA 2V32A 1HNAA 1OVNA 5HFKA 2MZCA 1MTCA 1R4WA 4XS1A 2EIOA 5IMAA 3IAM2 5ECMB 2DMLA 1BQ7A 1Z3EA 5ENUA 1JZDA 4IJ3A 5IO2A 3K8NA 1GSUA 1VGLA 5AGYA 3TKPA 5CRWA 3RBTA 2K6VA 4NMUA 1PGTA 2VCTA 2R5GA 3M9JA 1MD3A 1VF3A 3S9FA 3VWVA 1WMJA 2VL9A 1SYXA 1ZZYA 3VPQA 4FYUA 2C0GA 4JU5A 4F0CA 1O73A 3L9VA 3HCZA 2AAWA 2B1KA 5ELGA 1OC9B 3KZQA 1O6JA 8GSSA 2LNTA 1BYEA 1DE2A 1USBA 3Q19A 19GSA 1AQXA 4HZ4A 1EP7A 2YWMA 2R4VA 5ECSA 2B6MA 3V1WA 1XPVA 1G7OA 2V1MA 1UA5A 3E3EA 5HR1A 3QDNA 4K7IA 4V1Ap 3GKXA 3ERFA 4F82A 3HVSA 3E9JB 5ECIB 3H93A 2FA8A 2H70A 3ZVJA 4N0ZA 4IN0A 3TKQA 3N9JA 2H6XA 3C7MA 1WOUA 4KCAA 4HEA2 2M72A 2N5BA 1O7UA 5F06A 4KW6A 3F3RA 1M2BA 5IOXA 4GCIA 2HFDA 5FWGA 4CDOA 1SU9A 4AJ7A 4WETA 1X9WB 4FH8A 2VD1A 2IMKA 3HXSA 2V2GA 2H66A 4K7NA 1FOVA 1PQNA 4E8EA 2B7KA 1MD4A 2C0FA 3GUSA 1XWAA 4ZBBA 4JZQA 3Q18A 4K6XA 3ZMKA 4KAEA 2VCZA 1XW9A 2N5AA 2ZUPA 5B8AA 1K3OA 2H1AA 4OFTA 5D9TA 3F4RA 4K8MA 3WT2A 1XVWA 3UJ1A 2ALBA 1ABAA 5H5RA 3ISOA 1EOHA 3L9UA 3ZTLA 2RM6A 1F37A 4WR5A 5ECRB 2B3SA 2HSYA 2XBQA 1PN9A 4HU7A 4RUVA 2HZEA 3UAPA 1BG5A 1YY7A 3GFKA 1WIKA 4G0IA 4K7OA 1O85A 1E6BA 2HT9A 5CAXA 2HSNB 3EINA 3TUEA 2P5RA 3W6GA 3M8NA 1TRSA 1PRXA 1ZYQB 2WB9A 1ZL9A 5ECKB 2YP6A 4K0GA 1PSQA 2AV4A 2BTOT 2F9SA 2LRNA 4BPYA 4PX1A 3GTUA 3FR9A 4EC0A 2DIYA 2C4JA 1K0OA 1SYRA 1K0DA 2DJJA 4DSSA 3GKKA 2P0GA 1EGOA 3C71A 2YNXA 4L5OA 5IMFA 1EWXA 3KIJA 2PBJA 4V1Ag 1XVQA 1EEJA 3VFIA 3SBCA 4MF6A 4KSMA 3F63A 1I5GA 4K1FA 4KDXA 3GN3A 1LU4A 18GSA 4KSOA 2REMA 3CSIA 4ZL8A 2H75A 1TRUA 2I3YA 3Q6OA 2LJRA 2KUCA 4F9ZA 3IPZA 2VM1A 3D6IA 4POLA 6GSVA 1MEKA 5D73A 1GTBA 2VD0A 1AXDA 2IL3A 5D8IA 1GSQA 2IIYA 2YANA 2O87A 3TJGA 5B8BA 3APOA 2OE3A 3PH9A 2RUFA 5H5QA 3GL5A 1T8EB 3C73A 4KDYA 2M46A 5D93A 4NHZA 2VL2C 4XRAA 3EWLA 5AIVA 3DD3A 4EDYA 1OYJA 5CP1A 2DMMA 2GZPA 3ZRDA 4XS4B 1ON4A 2VCXA 1ST9A 1ILOA 4IP1A 3IXRA 2WZ9A 5IMDA 4LMVA 1U87A 4IGJA 4P3YB 4IKHA 4FQUA 2LTKA 1O8WA 2MMOA 1GSFA 1H4OA 5DJLA 3FY7A 4MH3A 1JZOA 1MDKA 2VL2A 1O8XA 4HDEA 1GTUA 4AJ6A 4NAXA 4N10A 2WFCA 3LSZA 2JSZA 3DYRA 4F03A 4YQVA 4BVYA 5IQYA 3FHKA 4I97A 4BWSA 1XFLA 1HD2A 4L0WA 4JRRA 3TKRA 3A2XA 3LGCA 2ES7A 3IK7A 2QGVA 1K0BA 1EEMA 5DBQA 4XS4A 1K0AA 2DJ1A 1AQWA 4F0BA 2KOKA 3ZVJD 3ERGA 5ELAA 1A2MA 3RAZA 1SENA 3GRXA 2K9FA 1M99A 4PNGA 5CRHA 3LXTA 4MABA 2GT5A 3HJMA 2XPEA 3QR6A 1C72A 2J23A 4TR3A 3W8JA 5GAPD 4GSSA 3TRXA 4Z7XA 5F05A 2KHPA 1LJRA 3KP9A 4L5LA 4MH2A 2E0QA 4KCEA 3GH9A 1Z9HA 2NVLA 4EF0A 1XZOA 3U5RE 3H79A 1TK5B 4GQFA 2HRFA 3MAKA 2E7PA 1GL8A 1M9BA 5KN1A 4G2EA 3EU3A 1F9MA 2C80A 3M0FA 1F2EA 4KE3A 2OA7A 2V41A 1X5EA 3R3EA 1Q98A 2JSYA 4I2TA 4MLYA 4JR4A 1BJXA 3US3A 4ZILA 3KJYA 4Q5NA 1GUKA 1YKAA 3IK9A 4GRFA 3UARA 2AUVA 5E59A 3ZZXA 1NHYA 4XRDA 1K3LA 4MF5A 3C1SA 5B7CA 4EVMA 4HQZA 3LYPA 3L9SA 1VRSD 2R2JA 4IJIA 5ECHB 5LCZA 3GSSA 1WPIA 3E0UA 4L0UA 4WEYA 4KNDA 1FW1A 2OADA 5IMCA 1R5AA 4QL7A 4ZB8A 4BWQA 2PN8A 3A2VA 2B7JA 3ZIJA 1FVJA 1V57A 3ZLPA 1GLPA 1HNCA 4WBJA 3HY2A 2WULA 2RM5A 5DVBA 3QPMA 5LD0A 2GGTA 2GS3A 3VWUA 4MDCA 2I1UA 4POMA 2GZYA 3EVIA 2FWGA 1HYUA 2L4QA 3IBHA 4TKYA 2CZ2A 2FCHA 2DLXA 4IQAA 3MWHA 2MMZA 1Q4JA 2H73A 1EGRA 2G2QA 2KP2A 2XBIA 3RHCA 4OWYA 2GQLA 3G9BA 14GSA 4ID0A 1GUHA 3CSJA 6GSXA 3F9UA 1VF1A 2K18A 2X8HA 1F6MC 3NOFA 5AIXA 2PVOC 3KEBA 3O6TA 4KDUA 3GV1A 3BJ5A 1WP0A 3IC8A 1VF2A 2FNOA 4TRXA 1TOFA 1THOA 5B6MA 4RQXA 3HZ4A 1WJKA 3FR3A 3FK8A 2VL3A 1M0UA 4V2MA 2H0GA 1QMVA 4IBPA 4MCUA 4J57E 3F8UA 4MK3A 1OKDA 2GSRA 1GRXA 3LXZA 2FHEA 5A5KA 2H71A 5A4WA 2MYGA 1GWCA 5IIZA 4FIWA 3J7Yb 1XWGA 2L59A 1RK4A 4ACSA 2FY6A 1SL0B 5ECQB 3DIEA 2R37A 3KH9A 2X8GA 3Q74A 1TRWA 1QK8A 1EP8A 4PGTA 4XTSA 3IC4A 3RDWA 2LSTA 3DVXA 2H0HA 2DJ0A 4QL9A 4Q5RA 4FYCA 9GSSA 2DJKA 3G7YA 3FZAA 2OACA 1T4ZA 2C8UA 3GKNA 1BX9A 5EY6A 5A4VA 22GSA 2C3TA 1SL1B 4J56E 2VO4A 4PUAA 3UEMA 1G0TA 1SK0A 1OE7A 2XPDA 3IRAA 1PA3A 1OC9A 2DC5A 1ACVA 2YWNA 6GSYA 2FA4A 4LLRA 1URMA 1YF1A 3GH6A 5ECPB 4G10A 2CV4A 2JU5A 5BMUA 4DSRA 3BCKA 5CREA 2LJKA 1U6TA 1B4QA 1SD9A 4PQ1A 4L8EA 2H8LA 1Z6MA 2K8VA 4YAPA 2LRCA 1Y25A 1XWCA 1AUCA 11GSA 2C3QA 6GSTA 2H1DA 1FAAA 2LV3A 1V58A 1JZRA 3KTBA 5ABRA 3GIXA 2VAFA 5ID2B 4EXJA 1G6WA 3HJOA 2DIZA 3IAS2 4NV5A 2MMNA 3HD5A 5ECNB 4ECIA 2GQMA 3HDCA 2LKUA 1B4PA 1ZCPA 5IPGA 4IS0A 2NDOA 4EKZA 2MMAA 1BAYA 2IN3A 1GP1A 2B5XA 1XIYA 4XCSA 5E4WA 3J7Yk 2C0EA 3FR6A 2P31A 2CAQA 3QMXA 1K0NA 2ON5A 1GUMA 2AYTA 7GSSA 1FG4A 4O7HA 1SJIA 3EMPA 1GULA 5ID2A 4OO5A 4ECJA 4HUAA 3FZ5A 4K9ZA 3U6VA 5DJMA 3LJRA 4E8HA 3I9V2 4DEJA 4X43A 5CRGA 1CQGA 2PGTA 1O81A 2HSMB 2VCWA 4ZXGA 4TN8A 1OC8A 3QFBC 4IVFA 3CMIA 2C0DA 4NWYA 3FYGA 2HI7A 3DMLA 1ERWA 2H19A 3I43A 2GLRA 4ZB9A 2L5LA 4D73B 4OO4A 2MBSA 4MJEA 3NZNA 3LWAA 3HYPA 4HQSA 1Z5YE 5G5EA 3HVVA 3QCPA 4WKWA 3KGKA 3HHVA 2CAIA 4IP6A 1H75A 2DJ3A 5GSSA 1V40A 1FVKA 2H1BA 4I5QA 3JCML 5G30A 2HSMA 13GSA 1FO5A 1A0FA 3D5JA 4GSTA 2ZCTA 5G1KA 4FYBA 4KGIA 5DQSA 3TGZA 2L4CA 3CTGA 2A2RA 3UL3A 3F4SA 2O85A 1QGVA 3TB2A 4D73A 4CHSA 2CA8A 3L4NA 5C00A 1X0RA 2M80A 2XC2A 5KN3A 1A8YA 4GTUA 3VI7A 4BA7A 4ZL9A 1ERVA 5J9CA 4RI7A 4QQ7A 1TRVA 4OFMA 5JCWA 4TR1B 3HJPA 1X9MB 3A3TA 3BD2A 3TKSC 5AN1A 3HA9A 1AW9A 4WR4A 1TTZA 3PGTA 4H86A 3UMAA 3AY8A 5JCUA 3L78A 4TOPA 5KN2A 4IHUA 4NXIA 3TJJA 3KCMA 3TRPA 2CX4A 3VK9A 4LA1A 4IELA 4OFNA 1XOAA 1PL1A 2KP1A 4MZWA 3TDGA 1SK2A 2V6KA 3GKMA 3ZIVA 1S3DA 5IMVA 4NV2A 1A0RP 3TKSA 2JZSA 3QOUA 4MP4A 3MNGA 3DGQA 1KEBA 2I9HA 2B1LA 2GTUA 1X9SB 1BEDA 1FB0A 2PERA 3TOUA 1NM3A 2LNSA 2L5OA 3LEFA 5GAND 4V2NA 3RPPA 3IHQA 3EU4A 3A2WA 1GSEA 2J9HA 4BVXB 1DBYA 1ZGNA 3EMXA 4HZ2A 5H5SA 2VLVA 5KN0A 1GSDA 3EYTA 3ED3A 3F6DA 3D4MA 5IM9A 3DRNA 2OBKA 3CBUA 2L57A 4YQUA 4WF4A 4I8BA 4MF7A 1UC7A 2IFQB 1JLWA 2H01A 2I81A 4N11A 4ILFA 4XIHA 12GSA 20GSA 3MSZA 5IOWA 4XS6A 2FWEA 3C8EA 3LFLA 1PX6A 3FZ4A 3BOAA 4ML1A 1V2AA 2ZNMA 3ZREA 1RW1A 1AQVA 2F51A 3UOMA 3APSA 1YEXA 3RPNA 1SKRB 1M2DA 3D22A 3LYKA 5J3RA 1PD21 3QFAC 5ECLB 3FEUA 5FHIA 3IA1A 1PMTA 3ZITA 1TI1A 2XHFA 3D4TA 2IFQA 2YV7A 2IJYA 4J2FA 2WDUA 5F8BA 3LQ7A 2HRKB 2PVQA 2OE1A 2YWIA 2JL4A 1XWBA 1QUWA 1V98A 1A2JA 4ZL7A 1JFUA 3H1NA 2VCQA 1J08A 2FD3A 1GSYA 2DSAA 4KA0A 1OC3A 2FLSA 1W4VA 3DEXA 4TVEA 1J9BA 2JADA 3KTLA 4I6XA 6GSSA 2C1YA 5G31A 2BMXA 3UBLA 2LUSA 3O3TA 2B5YA 1QFNA 1EOGA 3P2AA 3F6FA 1CQHA 4LL1B 4ULXA 4Q5QA 4HJMA 3H4KA 1YEPA 1A2LA 2VOCA 3WGDA 2EIQA 1Z7RA 5DAKB 2PMTA 1YJ6A 3CSHA 3IOSA 4GQCA 5IPHA 3IR4A 3EC3A 5HQPA 3WGXA 5LNKe 2HE3A 1SKSB 3KD0A 3TCOA 1A24A 5EPFA 4MJBA 4EE0A 1DE1A 3M9KA 1DSBA 1WWJA 1TKDB 1KTEA 2X99A 1S3AA 1G6YA 1Z6NA 4JBBA 2P5QA 1MDIA 3TJKA 1TP9A 2GSQA 1TK0B 1AC1A 3F0IA 3C1RA 2FUG2 1B9YC 3APQA 1MDJA 2TRCP 1LBKA 4PXOA 3FW2A 2GVPA 3KH7A 3L0HA 2G0FA 1WE0A 2JZRA 2LQOA 3UVTA 2NTOA 2VIMA 2JACA 4AJ8A 3CYNA 3D0ZA 1XOBA 1EZKA 1JHBA 2NBSA 2WCIA 3O76A 2I4AA 3M3MA 4JR6A 2H6ZA 1AAZA 1T00A 4K2DA 2GSSA 2AJQB 2L6CA 2IMEA 2YZUA 2LS5A 4TR0A 1IYIA 2E2MA 3ERWA 2WJUA 2F8AA 2H6YA 2IMFA 1XBSA 4MZBA 5DQYA 3ME7A 3KXOA 2EIRA 2CT6A 5IO0A 3I6AA 5J41A 4WXTA 2GQKA 2AB6A 4PQIA 2X64A 3W8SA 5GSTA 1ZMAA 3GHAA 4MMMA 4O32A 4AGSA 3HZ8A 3KMNA 2K8SA 1M2AA 3FZ9A 3GL3A 2YV9A 5CYYA 1A8LA 1YF0A 2DBCA 3VWWA 3P7XA 2YN1A 3CRTA 2H72A 4IW9A 3LG6A 1TU7A 2H76A 4LL4B 3QD9A 3MDKA 2E2GA 16GSA 5FT3A 2HYXA 1GLQA 3GURA 1B9XC 1ERTA 2IWTA 4MJAA 4G9HA 3VLNA 1XW6A 4USSA 1UN2A 4DSQA 5COHA 2O8VB 2N5FA 2QKEA 4KUNA 3ZFLA 4EL1A 1QXHA 4KB3A 5IMZA 1RQMA 4PQHA 2DJ2A 2PUKC 1SL2B 3PPUA 1X5DA 2QSIA 3TKSE 4TR4A 2GSTA 2OBIA 1GNEA 5HFGA 1SD8A 4G0KA 1B48A 2WGRA 2WRTA 5D9WA 2F3MA 3KM6A 3KP8A 4PNFA 5CO3A 2HZFA 1M9AA 4KH7A 2HZEB 3VI5A 3DKSA 3IV4A 5JCGA 3F4TA 4WBRD 4EO3A 2L6DA 2RLIA 4N0VA 2TRXA 1JLVA 4TXVA 2JZTA 4POKA 3VURA 3BCIA 2UZ8A 3ZYWA 2BJXA 4HU9A 1U3AA 1FB6A 4CW9A 3FKFA 2PU9C 5F07A 3FRCA 1GTIA 4HJ2A 5G5FA 3GTUB 2X8CA 3UBKA 4JEDA 2H74A 5JWQB 1TJDA 2FGXA 4DSSB 5J4UA 1F3AA 4HI7A 1SJ6A 3IDVA 1N2AA 5DALB 4YAVA 1ZYEA 4N30A 4POBA 2HLSA 2R6KA 1T3BA 1IYHA 5J5NA 3CXGA 4ZB6A 1UVZA 1YZXA 4G0LA 4WF5A 1R5PA 2HQTA 5HR2A 2QC7A 3WT1A 1V9WA 4ZBDA 5HFIA 4EUYA 3GNJA 4O5RA 2O7KA 1T4YA 3DWVA 2C3NA 5G1LA 1PL2A 2Z9SA 4EDZA 3IE3A 4OCEA 3G7IA 3HVXA 4HS1A 3M1GA 6GSUA 1SKWB 1M7TA 4OCFA 1OE8A 2NPBA 1YQ1A 4NHWA 1XCCA 4FO5A 5DALA 2VLUA 4ZIJA 1VF4A 1ZOFA 4MPFA 5DCGA 3UVHA 2H30A 3WGEA 2WS2A 1XWKA 4OD7A 3SWLA 3RHBA 2B5EA 3PR8A 3NIVA 2RIIA 3BBYA 3TOTA 5KEJA 4GLTA 2A4VA 1TU8A 1DUGA 4MPGA 1WRYA 3DXBA 3VWXA 4X0XA 2H1GA 1YDKA 4RQRA 1Y6EA 1HNBA 3QAWA 2IMIA 4XHMA 1JZWA 2CQ9A 3LORA 4AF2A 4BVYB 1X5CA 2CZ3A 3GA4A 2H0IA 4LMWA 2YWOA 4ECBA 1GH2A 2GDRA 4OMVA 2HXKA 1KNGA 2O89A 4ZBAA 4TXOB 3QAVA 2KLXA 17GSA 3HKRA 1N8JA 3GX8A 2GT6A 1Z7PA 4TR1A 1A23A 5J9BA 5D9XA 2GZZA 4MJCA 2LEGA 4O92A 3CRUA 4BL7B 2VM2A 4ML6A 5EVOA 1R7HA 1PX7A 1G7EA 1T1VA 4ISDA 1KBNA 4YQMA 3KMOA 1OAZA 4PTSA 10GSA 1K0CA 1NSWA 3TRQA 4TXOA 4GWRA 4PUFC 2YZHA 3ZMLA 3GMFA 4MA9A 2VUPA 2HNLA 4K0NA 1TW9A 2A2SA 1GSSA 6GSWA 5INYA 2YPMA 5HR0A 4NPBA 3CTFA 3DVWA 4GXZA 2LRTA 5G2ZA 4BL7A 1W89A 1B8XA 1SJZA 2HRAA 2AHEA 2LJAA 3GYKA 5AISA 3WD6A 2LQQA 3D21A 4TW5A 2CVDA 5ECOB 4RI6A 4KX4A 1YKCA 5DDLA 3VPTA 1ERUA 1HQOA 2IMDA 5D96A 5JWRB 2R3XA 3EE2A 1U3IA 2EC4A 3P8WA 4BVXA 5DCHA 3TJBA 3P90A 1J0FA 2VCVA 4MZCA 3TJFA 3GSTA 2V6OA 5CNWA 2RUEA 3UIWA 1AIUA 4F2IA 1GNWA 1U88A 5B6NA 5F0GA 4IQ1A 4PURA 2YJHA 3F3QA 2YCDA 1TI3A 5A4UA 3H8QA 3EURA 5GZZB 1SK1A 2OE0A 1TXXA 2CVKA 1THXA 1PKWA 1E2YA 3ZFBA 2HSHA 4X1UA 2ON7A 3N5OA 3OR5A 4GF0A 1R26A 3GX0A 2D2ZA 2YOIA 5CRDA 4V2LA 3PINA 2TIRA 1NW2A 2FWFA 1ML6A 3WYWA 3G7JA 2HRKA 1S3CA 4GSNA 1QQ2A 1NHOA 2F8FA 5EL8A 3ZL5A 3QAGA 1TK8B 4G19A 4HOJA 2CX3A
chains in the Genus database with same CATH superfamily
1EV9A 1PKZA 3R2QA 4KF9A 4JE1A 3ME8A 1OKTA 2YJ7A 4ECCA 4K5RA 5D9VA 2OKAA 5L71A 2CVBA 5HR3A 1I9DA 2HRNA 4YH2A 1XXUA 2IPAA 1T7PB 2MBTA 4DVCA 1XW5A 1EV4A 1GTAA 1TDIA 2PPTA 3A5WA 4GDFA 4I2UA 1K0MA 4Q5FA 2OJLA 3I69A 1K3YA 2PWJA 5DAKA 5JWOB 1F3BA 4PI2C 4K2XA 5C04A 2VLTA 1FHEA 2FWHA 2V32A 1HNAA 1OVNA 5HFKA 2MZCA 1MTCA 1R4WA 4XS1A 2EIOA 5IMAA 3IAM2 5ECMB 2DMLA 1BQ7A 2R0CA 1Z3EA 5ENUA 1JZDA 4IJ3A 2A2PA 4Z2UA 5IO2A 3K8NA 1GSUA 1VGLA 5AGYA 3TKPA 5CRWA 3RBTA 1N25A 2K6VA 4NMUA 1PGTA 2VCTA 2R5GA 3M9JA 1MD3A 1VF3A 3S9FA 3MYDA 3VWVA 1WMJA 2VL9A 1SYXA 1ZZYA 3VPQA 4FYUA 2C0GA 4JU5A 4F0CA 1O73A 3L9VA 3HCZA 2AAWA 2B1KA 5ELGA 1OC9B 3KZQA 1O6JA 2EFEA 8GSSA 2LNTA 1BYEA 1DE2A 1USBA 3Q19A 19GSA 1AQXA 4HZ4A 1EP7A 2YWMA 2R4VA 5ECSA 2B6MA 3V1WA 1XPVA 1G7OA 2V1MA 1UA5A 3E3EA 5HR1A 3QDNA 4K7IA 4V1Ap 3GKXA 3ERFA 4F82A 3HVSA 5KOXA 3E9JB 5ECIB 3H93A 2FA8A 2H70A 3ZVJA 4N0ZA 4AKXB 4IN0A 3TKQA 3N9JA 2H6XA 3C7MA 1WOUA 4KCAA 4AKGA 4HEA2 2M72A 2N5BA 1O7UA 5F06A 4KW6A 3F3RA 1M2BA 5IOXA 4GCIA 2HFDA 5FWGA 4CDOA 1SU9A 4AJ7A 4WETA 1X9WB 4FH8A 2VD1A 2IMKA 3HXSA 2V2GA 2H66A 4K7NA 1FOVA 1PQNA 4E8EA 2B7KA 1MD4A 2C0FA 3GUSA 1XWAA 4ZBBA 4JZQA 3Q18A 4K6XA 3ZMKA 4KAEA 2VCZA 1TXUA 1XW9A 2N5AA 2ZUPA 5B8AA 1K3OA 2H1AA 4OFTA 5D9TA 3F4RA 4K8MA 3WT2A 1XVWA 3UJ1A 2ALBA 1ABAA 5H5RA 3ISOA 1EOHA 3L9UA 3ZTLA 2RM6A 1F37A 4WR5A 5ECRB 2B3SA 4MNNA 5J47A 2XBQA 2HSYA 1PN9A 4HU7A 4RUVA 2HZEA 3UAPA 1BG5A 1YY7A 3GFKA 1WIKA 4G0IA 4K7OA 1O85A 1E6BA 2HT9A 5CAXA 2HSNB 3EINA 3TUEA 2P5RA 3W6GA 3M8NA 1TRSA 4AKHA 1PRXA 1ZYQB 1Y1UA 2WB9A 1ZL9A 5ECKB 2YP6A 4K0GA 1PSQA 2AV4A 2BTOT 2F9SA 2LRNA 4BPYA 1SVLA 4PX1A 3GTUA 3FR9A 4EC0A 2DIYA 4EIQA 2C4JA 1K0OA 1SYRA 1K0DA 2DJJA 4DSSA 4O5QA 4Z2RA 3GKKA 2P0GA 1EGOA 3C71A 2YNXA 4L5OA 5IMFA 2HSNA 1EWXA 3KIJA 2PBJA 4V1Ag 1XVQA 1EEJA 3VFIA 3SBCA 4MF6A 4KSMA 3F63A 1I5GA 4K1FA 4KDXA 3GN3A 1LU4A 18GSA 4KSOA 2REMA 3CSIA 4ZL8A 2H75A 1TRUA 2I3YA 3Q6OA 2LJRA 2KUCA 4F9ZA 3IPZA 2VM1A 2WW3A 3D6IA 4POLA 6GSVA 1MEKA 5D73A 1GTBA 2VD0A 1AXDA 2IL3A 5D8IA 1GSQA 2IIYA 2YANA 2O87A 3TJGA 3HMJG 5B8BA 3APOA 2OE3A 3PH9A 2RUFA 5H5QA 3GL5A 1T8EB 3C73A 4KDYA 2M46A 5D93A 4NHZA 2VL2C 4XRAA 3EWLA 5AIVA 3DD3A 4EDYA 1OYJA 5CP1A 2DMMA 2GZPA 3ZRDA 4XS4B 1ON4A 2VCXA 1ST9A 1ILOA 4IP1A 3IXRA 2WZ9A 5IMDA 4LMVA 1U87A 4IGJA 4P3YB 4IKHA 3A5IA 4FQUA 2LTKA 1O8WA 2MMOA 2OT3A 1GSFA 1H4OA 3CQFA 5DJLA 5A5HB 3FY7A 4MH3A 1JZOA 1MDKA 2VL2A 1O8XA 4HDEA 1GTUA 4AJ6A 4NAXA 4N10A 2WFCA 3LSZA 2JSZA 3DYRA 4F03A 4YQVA 4BVYA 5IQYA 3FHKA 4I97A 4BWSA 1XFLA 1HD2A 4L0WA 2R0PA 4JRRA 3TKRA 3A2XA 3LGCA 2ES7A 3IK7A 2QGVA 1K0BA 1EEMA 5DBQA 4XS4A 1K0AA 2DJ1A 1AQWA 4F0BA 2KOKA 3ZVJD 3ERGA 5ELAA 2QA2A 3RFRC 1A2MA 1ZYNA 5A5HA 3RAZA 1SENA 3GRXA 2K9FA 1M99A 2EFDA 4PNGA 5CRHA 3LXTA 4MABA 2GT5A 3HJMA 2XPEA 3QR6A 1C72A 2J23A 4TR3A 3W8JA 5GAPD 4GSSA 3TRXA 4Z7XA 5F05A 2KHPA 1LJRA 3KP9A 4L5LA 4MH2A 2E0QA 4KCEA 3GH9A 1Z9HA 2NVLA 4EF0A 1XZOA 3U5RE 3H79A 1TK5B 4GQFA 2WVXB 2HRFA 3MAKA 2E7PA 1GL8A 1M9BA 5KN1A 4G2EA 3EU3A 2QA1A 1F9MA 2C80A 3M0FA 1F2EA 4KE3A 2OA7A 2V41A 1X5EA 3R3EA 1Q98A 2JSYA 4I2TA 4MLYA 4JR4A 1BJXA 3US3A 4ZILA 3KJYA 4Q5NA 1GUKA 1YKAA 3IK9A 4GRFA 3UARA 2AUVA 5E59A 3ZZXA 1NHYA 4XRDA 2WVXA 1K3LA 4MF5A 3C1SA 5B7CA 4EVMA 4HQZA 3LYPA 3L9SA 1VRSD 2R2JA 4IJIA 5ECHB 5LCZA 3GSSA 1WPIA 3E0UA 4L0UA 4WEYA 4KNDA 1FW1A 2OADA 5IMCA 1R5AA 4QL7A 4ZB8A 4A5PA 4BWQA 2PN8A 3A2VA 2B7JA 3ZIJA 1FVJA 1V57A 3ZLPA 1GLPA 1HNCA 4WBJA 1BG1A 3HY2A 2WULA 2RM5A 5DVBA 3QPMA 5LD0A 2GGTA 2GS3A 3VWUA 4MDCA 2I1UA 4POMA 2GZYA 3EVIA 2FWGA 1HYUA 2L4QA 3IBHA 4TKYA 2CZ2A 2FCHA 2DLXA 4IQAA 3MWHA 2MMZA 1Q4JA 2H73A 1EGRA 2G2QA 3CHXC 2KP2A 2XBIA 4Z2TA 3RHCA 4OWYA 2GQLA 1PN0A 3G9BA 14GSA 4ID0A 1GUHA 3CSJA 6GSXA 3F9UA 1VF1A 2K18A 4O5UA 2X8HA 1F6MC 3NOFA 5AIXA 2PVOC 4X4JA 3KEBA 3O6TA 1BF5A 4KDUA 3GV1A 3BJ5A 1WP0A 3IC8A 1VF2A 2FNOA 4TRXA 1TOFA 1THOA 5B6MA 4RQXA 3HZ4A 1WJKA 3FR3A 3FK8A 4G01A 2VL3A 2WVYA 1M0UA 4V2MA 2H0GA 1QMVA 4IBPA 4PHZC 4MCUA 4J57E 3F8UA 4MK3A 1OKDA 2GSRA 1GRXA 3LXZA 2FHEA 5A5KA 1ZYPA 2H71A 5A4WA 2MYGA 1GWCA 5IIZA 1M3IA 4FIWA 3J7Yb 1XWGA 2L59A 1RK4A 4ACSA 2FY6A 1SL0B 5ECQB 3DIEA 2R37A 3KH9A 2X8GA 3Q74A 1TRWA 5BMUB 1QK8A 1EP8A 4PGTA 4XTSA 3IC4A 3RDWA 2LSTA 3DVXA 2H0HA 2DJ0A 4QL9A 4Q5RA 4FYCA 9GSSA 2DJKA 3G7YA 3FZAA 2OACA 1T4ZA 3LW9A 2C8UA 3GKNA 1BX9A 5EY6A 5A4VA 22GSA 2C3TA 1SL1B 4J56E 2VO4A 4PUAA 3UEMA 1G0TA 3RGBC 5KOWA 1SK0A 1OE7A 2XPDA 3IRAA 1PA3A 1OC9A 2DC5A 1ACVA 2YWNA 6GSYA 2FA4A 4LLRA 1URMA 1YF1A 3GH6A 5ECPB 4G10A 2CV4A 2JU5A 5BMUA 4DSRA 3BCKA 5CREA 2LJKA 1U6TA 1B4QA 1SD9A 4PQ1A 4L8EA 2H8LA 1Z6MA 4FXYP 2K8VA 4YAPA 2LRCA 1Y25A 1XWCA 1AUCA 11GSA 2C3QA 6GSTA 2H1DA 1FAAA 2LV3A 1V58A 1JZRA 3KTBA 5ABRA 3GIXA 2VAFA 5ID2B 4EXJA 1G6WA 3HJOA 2DIZA 3IAS2 4NV5A 2MMNA 3HD5A 5ECNB 4ECIA 2GQMA 3HDCA 2LKUA 1B4PA 1ZCPA 5IPGA 4IS0A 2NDOA 4EKZA 2MMAA 1BAYA 2IN3A 2O36A 1GP1A 2B5XA 1XIYA 4XCSA 5E4WA 3J7Yk 2C0EA 3FR6A 2P31A 2CAQA 3QMXA 1K0NA 2ON5A 1GUMA 2AYTA 7GSSA 1FG4A 4O7HA 1SJIA 3EMPA 1GULA 5ID2A 4OO5A 4ECJA 4HUAA 3FZ5A 4K9ZA 3U6VA 5DJMA 3MIXA 3LJRA 4E8HA 3I9V2 4DEJA 4X43A 5CRGA 1CQGA 3IHGA 2PGTA 1O81A 1YEWC 2HSMB 2VCWA 2WW0A 4ZXGA 4TN8A 1OC8A 3QFBC 4IVFA 3CMIA 2C0DA 4NWYA 3FYGA 2HI7A 3DMLA 1ERWA 2H19A 3I43A 2GLRA 4ZB9A 2L5LA 4D73B 4OO4A 2MBSA 4MJEA 3NZNA 3LWAA 3HYPA 4HQSA 1Z5YE 5G5EA 3HVVA 3QCPA 4WKWA 3KGKA 3HHVA 2CAIA 4IP6A 1H75A 2DJ3A 5GSSA 1V40A 1FVKA 2H1BA 4I5QA 3JCML 5G30A 2HSMA 13GSA 1FO5A 1A0FA 3D5JA 4GSTA 2ZCTA 5G1KA 2O3EA 4FYBA 4KGIA 5DQSA 3TGZA 4E68A 2X4AA 2L4CA 3CTGA 4CY8A 2A2RA 3UL3A 3F4SA 2O85A 1QGVA 3TB2A 4D73A 4CHSA 2CA8A 3L4NA 5C00A 1X0RA 2M80A 2XC2A 5KN3A 1A8YA 4GTUA 3VI7A 4BA7A 4ZL9A 1ERVA 5J9CA 4RI7A 4QQ7A 1TRVA 4OFMA 5JCWA 2DKIA 4TR1B 3HJPA 1X9MB 3A3TA 3BD2A 3TKSC 5AN1A 3HA9A 1AW9A 4WR4A 1TTZA 3PGTA 4H86A 3UMAA 3AY8A 5JCUA 3L78A 4TOPA 5KN2A 4IHUA 4NXIA 3TJJA 3KCMA 3TRPA 2CX4A 3VK9A 4LA1A 4IELA 4OFNA 1XOAA 1PL1A 2KP1A 4MZWA 3TDGA 1SK2A 2V6KA 3GKMA 3ZIVA 1S3DA 5IMVA 4NV2A 1A0RP 3TKSA 5J4YA 3FMWA 2JZSA 3QOUA 4MP4A 3MNGA 3DGQA 1KEBA 2I9HA 2B1LA 2GTUA 1X9SB 1BEDA 1FB0A 2PERA 3TOUA 1NM3A 2LNSA 2L5OA 3LEFA 4PI0C 2EFCA 5GAND 4V2NA 4YKGA 3RPPA 3IHQA 3EU4A 3A2WA 1GSEA 2J9HA 4BVXB 1DBYA 1ZGNA 3EMXA 4HZ2A 5H5SA 2VLVA 5KN0A 1GSDA 3EYTA 3ED3A 3F6DA 3D4MA 5IM9A 3DRNA 2OBKA 3CBUA 2L57A 4YQUA 4WF4A 4I8BA 4MF7A 1UC7A 2IFQB 1JLWA 2H01A 2I81A 4N11A 4ILFA 4XIHA 12GSA 20GSA 3MSZA 5IOWA 4XS6A 2FWEA 3C8EA 3LFLA 1PX6A 3FZ4A 3BOAA 4ML1A 1V2AA 2ZNMA 3ZREA 1RW1A 1AQVA 2F51A 4N3ZA 3UOMA 3APSA 1YEXA 3RPNA 1SKRB 1M2DA 3D22A 3LYKA 5J3RA 1YVLA 2UV8G 1PD21 3QFAC 5ECLB 3FEUA 5FHIA 3IA1A 1PMTA 3ZITA 1TI1A 2XHFA 3D4TA 2IFQA 2YV7A 2IJYA 4J2FA 2WDUA 5F8BA 3LQ7A 2HRKB 1S4BP 2PVQA 2OE1A 2YWIA 2JL4A 1XWBA 4AKIA 1QUWA 1V98A 1A2JA 4ZL7A 1JFUA 3H1NA 2VCQA 1J08A 1PFOA 2FD3A 1GSYA 2DSAA 1FOHA 4KA0A 1OC3A 2FLSA 1W4VA 3DEXA 4TVEA 1J9BA 2JADA 3KTLA 4I6XA 6GSSA 2C1YA 5G31A 2BMXA 2H1LA 3UBLA 2LUSA 3O3TA 2B5YA 1QFNA 1EOGA 3P2AA 3F6FA 1S3RA 1CQHA 4LL1B 4ULXA 4Q5QA 4HJMA 3H4KA 1YEPA 1A2LA 2VOCA 3WGDA 2EIQA 1Z7RA 5DAKB 2PMTA 1YJ6A 5A34B 3CSHA 3IOSA 4GQCA 5IPHA 3IR4A 3EC3A 5HQPA 3WGXA 5LNKe 2HE3A 1SKSB 3KD0A 3TCOA 1A24A 5EPFA 4MJBA 4EE0A 1DE1A 3M9KA 1DSBA 1WWJA 1TKDB 1KTEA 2X99A 1S3AA 1G6YA 1Z6NA 4JBBA 2P5QA 1MDIA 3TJKA 1TP9A 2GSQA 1TK0B 1AC1A 3F0IA 5A34A 3C1RA 2FUG2 1B9YC 3APQA 1MDJA 2TRCP 1LBKA 4PXOA 3FW2A 2GVPA 3KH7A 3L0HA 2G0FA 1WE0A 2JZRA 2LQOA 4EIPA 3UVTA 2NTOA 2VIMA 2JACA 4AJ8A 3CYNA 3D0ZA 1XOBA 1EZKA 1JHBA 2NBSA 2WCIA 3O76A 2I4AA 3M3MA 4JR6A 2H6ZA 1AAZA 1T00A 4K2DA 2GSSA 2AJQB 2L6CA 2IMEA 2YZUA 2LS5A 4TR0A 1IYIA 2E2MA 3ERWA 2WJUA 2F8AA 2H6YA 2IMFA 1XBSA 4MZBA 5DQYA 3ME7A 3KXOA 2EIRA 2CT6A 5IO0A 3I6AA 5J41A 4WXTA 2GQKA 2AB6A 4PQIA 2X64A 3W8SA 4QMKA 5GSTA 1ZMAA 3GHAA 4MMMA 4O32A 4AGSA 3HZ8A 3KMNA 2K8SA 1M2AA 3FZ9A 3GL3A 2YV9A 5CYYA 1A8LA 1YF0A 2DBCA 3VWWA 3P7XA 2YN1A 3CRTA 2H72A 4IW9A 3LG6A 1TU7A 2H76A 4LL4B 3QD9A 3MDKA 2E2GA 16GSA 5FT3A 2HYXA 1GLQA 3GURA 1B9XC 1ERTA 2IWTA 4MJAA 4G9HA 3VLNA 1XW6A 4USSA 1UN2A 4DSQA 5COHA 2O8VB 2N5FA 2QKEA 4KUNA 3ZFLA 4EL1A 1QXHA 4KB3A 5IMZA 1RQMA 4PQHA 2DJ2A 2PUKC 1SL2B 3PPUA 1X5DA 2QSIA 3TKSE 4TR4A 4CY6A 2GSTA 2OBIA 1GNEA 5HFGA 1SD8A 2WVZA 4G0KA 1B48A 2WGRA 2WRTA 5D9WA 2F3MA 3KM6A 3KP8A 4PNFA 5CO3A 2HZFA 1M9AA 4KH7A 2HZEB 3VI5A 3DKSA 3IV4A 5JCGA 3F4TA 4WBRD 4EO3A 2L6DA 4ICYA 2RLIA 4N0VA 2TRXA 1JLVA 4TXVA 2JZTA 4POKA 3VURA 3HVNA 3BCIA 2UZ8A 3ZYWA 2BJXA 4HU9A 1U3AA 1FB6A 4CW9A 3FKFA 1I1IP 2PU9C 5A1NB 5F07A 3FRCA 1GTIA 4HJ2A 5G5FA 3GTUB 2X8CA 3UBKA 4JEDA 2H74A 5JWQB 1TJDA 2FGXA 4DSSB 5J4UA 1F3AA 4HI7A 1SJ6A 3IDVA 1N2AA 5DALB 4YAVA 1ZYEA 4N30A 4POBA 2HLSA 2R6KA 1T3BA 1IYHA 5J5NA 3CXGA 4ZB6A 1UVZA 1YZXA 2VKZG 4G0LA 4WF5A 1R5PA 2HQTA 5HR2A 2QC7A 3WT1A 4AI6A 1V9WA 4ZBDA 5A1NA 2O5VA 5HFIA 4EUYA 3GNJA 4O5RA 2O7KA 1T4YA 3DWVA 2C3NA 5G1LA 1PL2A 2Z9SA 4EDZA 3IE3A 4OCEA 3G7IA 3HVXA 4HS1A 3M1GA 6GSUA 1SKWB 1M7TA 4OCFA 1OE8A 2NPBA 1YQ1A 4NHWA 1XCCA 4FO5A 5DALA 2VLUA 3TU3B 4ZIJA 1VF4A 1ZOFA 4MPFA 5DCGA 3UVHA 2H30A 3WGEA 2WS2A 1XWKA 4OD7A 3SWLA 3RHBA 2B5EA 1SVMA 3PR8A 3NIVA 2RIIA 3BBYA 3TOTA 5KEJA 4GLTA 2A4VA 1TU8A 1DUGA 4MPGA 1WRYA 3DXBA 3VWXA 4X0XA 2H1GA 1YDKA 4RQRA 1Y6EA 1HNBA 3QAWA 2IMIA 4XHMA 3CWGA 1JZWA 2CQ9A 3LORA 4AF2A 2R0GA 4BVYB 1X5CA 2CZ3A 3GA4A 2H0IA 4LMWA 2WW2A 2YWOA 4ECBA 1GH2A 2EFHA 2GDRA 4OMVA 2HXKA 1KNGA 2O89A 4ZBAA 4TXOB 3QAVA 2KLXA 17GSA 3HKRA 1N8JA 3GX8A 2GT6A 1Z7PA 4TR1A 1A23A 5J9BA 5D9XA 4W66A 2GZZA 4MJCA 2LEGA 4O92A 3CRUA 4BL7B 2VM2A 4HSCX 4ML6A 5EVOA 1XG8A 1R7HA 1PX7A 2WW1A 1G7EA 1T1VA 4ISDA 1KBNA 4YQMA 3KMOA 5J40A 1OAZA 4PTSA 10GSA 1K0CA 1NSWA 3TRQA 2A4HA 4TXOA 4GWRA 4PUFC 2YZHA 3ZMLA 3GMFA 4MA9A 1SVOA 2VUPA 2HNLA 4K0NA 1TW9A 2A2SA 1GSSA 6GSWA 5INYA 4ZB7A 2YPMA 5HR0A 4NPBA 3EPTA 3CTFA 3DVWA 4GXZA 2LRTA 5G2ZA 4BL7A 1W89A 1B8XA 1SJZA 2HRAA 2AHEA 2LJAA 3GYKA 5AISA 3WD6A 2LQQA 3D21A 4TW5A 2CVDA 5ECOB 4RI6A 4KX4A 1YKCA 5DDLA 3VPTA 1ERUA 1HQOA 2IMDA 5D96A 5JWRB 2R3XA 3EE2A 1U3IA 2EC4A 2X49A 3P8WA 4BVXA 5DCHA 3TJBA 4BIKA 3P90A 4K5SA 1J0FA 2VCVA 4MZCA 3TJFA 3GSTA 2V6OA 5CNWA 2RUEA 3UIWA 1AIUA 4F2IA 5J4VA 1GNWA 1U88A 5B6NA 5F0GA 2WZSA 4IQ1A 4PURA 2DKHA 2YJHA 3F3QA 2YCDA 1TI3A 5A4UA 3H8QA 3EURA 5GZZB 1M3JA 1SK1A 2OE0A 1TXXA 2CVKA 1THXA 1PKWA 1E2YA 3ZFBA 2HSHA 4X1UA 2ON7A 3N5OA 3OR5A 4GF0A 1R26A 3GX0A 2D2ZA 2YOIA 5CRDA 4V2LA 3PINA 2TIRA 1NW2A 2FWFA 1ML6A 3WYWA 3G7JA 2HRKA 5BRTA 4YKFA 1S3CA 4GSNA 1QQ2A 1NHOA 2F8FA 5EL8A 3ZL5A 3QAGA 1TK8B 4G19A 4HOJA 2CX3A
chains in the Genus database with same CATH topology
1EV9A 1PKZA 3R2QA 4KF9A 4JE1A 3ME8A 1OKTA 2YJ7A 4ECCA 4K5RA 5D9VA 2OKAA 5L71A 2CVBA 5HR3A 1I9DA 2HRNA 4YH2A 1XXUA 2IPAA 1T7PB 2MBTA 4DVCA 1XW5A 1EV4A 1GTAA 1TDIA 2PPTA 3A5WA 4GDFA 4I2UA 1K0MA 4Q5FA 2OJLA 3I69A 1K3YA 2PWJA 5DAKA 5JWOB 1F3BA 4K2XA 5C04A 2VLTA 1FHEA 2FWHA 2V32A 1HNAA 1OVNA 5HFKA 2MZCA 1MTCA 1R4WA 4XS1A 2EIOA 5IMAA 3IAM2 5ECMB 2DMLA 1BQ7A 2R0CA 1Z3EA 5ENUA 1JZDA 4IJ3A 2A2PA 4Z2UA 5IO2A 3K8NA 1GSUA 1VGLA 5AGYA 3TKPA 5CRWA 3RBTA 1N25A 2K6VA 4NMUA 1PGTA 2VCTA 2R5GA 3M9JA 1MD3A 1VF3A 3S9FA 3MYDA 3VWVA 1WMJA 2VL9A 1SYXA 1ZZYA 3VPQA 4FYUA 2C0GA 4JU5A 4F0CA 1O73A 3L9VA 3HCZA 2AAWA 2B1KA 5ELGA 1OC9B 3KZQA 1O6JA 2EFEA 8GSSA 2LNTA 1BYEA 1DE2A 1USBA 3Q19A 19GSA 1AQXA 4HZ4A 1EP7A 2YWMA 2R4VA 5ECSA 2B6MA 3V1WA 1XPVA 1G7OA 2V1MA 1UA5A 3E3EA 5HR1A 3QDNA 4K7IA 4V1Ap 3GKXA 3ERFA 4F82A 3HVSA 5KOXA 3E9JB 5ECIB 3H93A 2FA8A 2H70A 3ZVJA 4N0ZA 4AKXB 4IN0A 3TKQA 3N9JA 2H6XA 3C7MA 1WOUA 4KCAA 4AKGA 4HEA2 2M72A 2N5BA 1O7UA 5F06A 4KW6A 3F3RA 1M2BA 5IOXA 4GCIA 2HFDA 5FWGA 4CDOA 1SU9A 4AJ7A 4WETA 1X9WB 4FH8A 2VD1A 2IMKA 3HXSA 2V2GA 2H66A 4K7NA 1FOVA 1PQNA 4E8EA 2B7KA 1MD4A 2C0FA 3GUSA 1XWAA 4ZBBA 4JZQA 3Q18A 4K6XA 3ZMKA 4KAEA 2VCZA 1TXUA 1XW9A 2N5AA 2ZUPA 5B8AA 1K3OA 2H1AA 4OFTA 5D9TA 3F4RA 4K8MA 3WT2A 1XVWA 3UJ1A 2ALBA 1ABAA 5H5RA 3ISOA 1EOHA 3L9UA 3ZTLA 2RM6A 1F37A 4WR5A 5ECRB 2B3SA 4MNNA 5J47A 2XBQA 2HSYA 1PN9A 4HU7A 4RUVA 2HZEA 3UAPA 1BG5A 1YY7A 3GFKA 1WIKA 4G0IA 4K7OA 1O85A 1E6BA 2HT9A 5CAXA 2HSNB 3EINA 3TUEA 2P5RA 3W6GA 3M8NA 1TRSA 4AKHA 1PRXA 1ZYQB 1Y1UA 2WB9A 1ZL9A 5ECKB 2YP6A 4K0GA 1PSQA 2AV4A 2BTOT 2F9SA 2LRNA 4BPYA 1SVLA 4PX1A 3GTUA 3FR9A 4EC0A 2DIYA 4EIQA 2C4JA 1K0OA 1SYRA 1K0DA 2DJJA 4DSSA 4O5QA 4Z2RA 3GKKA 2P0GA 1EGOA 3C71A 2YNXA 4L5OA 5IMFA 2HSNA 1EWXA 3KIJA 2PBJA 4V1Ag 1XVQA 1EEJA 3VFIA 3SBCA 4MF6A 4KSMA 3F63A 1I5GA 4K1FA 4KDXA 3GN3A 1LU4A 18GSA 4KSOA 2REMA 3CSIA 4ZL8A 2H75A 1TRUA 2I3YA 3Q6OA 2LJRA 2KUCA 4F9ZA 3IPZA 2VM1A 3D6IA 4POLA 6GSVA 1MEKA 5D73A 1GTBA 2VD0A 1AXDA 2IL3A 5D8IA 1GSQA 2IIYA 2YANA 2O87A 3TJGA 3HMJG 5B8BA 3APOA 2OE3A 3PH9A 2RUFA 5H5QA 3GL5A 1T8EB 3C73A 4KDYA 2M46A 5D93A 4NHZA 2VL2C 4XRAA 3EWLA 5AIVA 3DD3A 4EDYA 1OYJA 5CP1A 2DMMA 2GZPA 3ZRDA 4XS4B 1ON4A 2VCXA 1ST9A 1ILOA 4IP1A 3IXRA 2WZ9A 5IMDA 4LMVA 1U87A 4IGJA 4P3YB 4IKHA 3A5IA 4FQUA 2LTKA 1O8WA 2MMOA 2OT3A 1GSFA 1H4OA 5DJLA 5A5HB 3FY7A 4MH3A 1JZOA 1MDKA 2VL2A 1O8XA 4HDEA 1GTUA 4AJ6A 4NAXA 4N10A 2WFCA 3LSZA 2JSZA 3DYRA 4F03A 4YQVA 4BVYA 5IQYA 3FHKA 4I97A 4BWSA 1XFLA 1HD2A 4L0WA 2R0PA 4JRRA 3TKRA 3A2XA 3LGCA 2ES7A 3IK7A 2QGVA 1K0BA 1EEMA 5DBQA 4XS4A 1K0AA 2DJ1A 1AQWA 4F0BA 2KOKA 3ZVJD 3ERGA 5ELAA 2QA2A 1A2MA 1ZYNA 5A5HA 3RAZA 1SENA 3GRXA 2K9FA 1M99A 2EFDA 4PNGA 5CRHA 3LXTA 4MABA 2GT5A 3HJMA 2XPEA 3QR6A 1C72A 2J23A 4TR3A 3W8JA 5GAPD 4GSSA 3TRXA 4Z7XA 5F05A 2KHPA 1LJRA 3KP9A 4L5LA 4MH2A 2E0QA 4KCEA 3GH9A 1Z9HA 2NVLA 4EF0A 1XZOA 3U5RE 3H79A 1TK5B 4GQFA 2HRFA 3MAKA 2E7PA 1GL8A 1M9BA 5KN1A 4G2EA 3EU3A 2QA1A 1F9MA 2C80A 3M0FA 1F2EA 4KE3A 2OA7A 2V41A 1X5EA 3R3EA 1Q98A 2JSYA 4I2TA 4MLYA 4JR4A 1BJXA 3US3A 4ZILA 3KJYA 4Q5NA 1GUKA 1YKAA 3IK9A 4GRFA 3UARA 2AUVA 5E59A 3ZZXA 1NHYA 4XRDA 1K3LA 4MF5A 3C1SA 5B7CA 4EVMA 4HQZA 3LYPA 3L9SA 1VRSD 2R2JA 4IJIA 5ECHB 5LCZA 3GSSA 1WPIA 3E0UA 4L0UA 4WEYA 4KNDA 1FW1A 2OADA 5IMCA 1R5AA 4QL7A 4ZB8A 4A5PA 4BWQA 2PN8A 3A2VA 2B7JA 3ZIJA 1FVJA 1V57A 3ZLPA 1GLPA 1HNCA 4WBJA 1BG1A 3HY2A 2WULA 2RM5A 5DVBA 3QPMA 5LD0A 2GGTA 2GS3A 3VWUA 4MDCA 2I1UA 4POMA 2GZYA 3EVIA 2FWGA 1HYUA 2L4QA 3IBHA 4TKYA 2CZ2A 2FCHA 2DLXA 4IQAA 3MWHA 2MMZA 1Q4JA 2H73A 1EGRA 2G2QA 2KP2A 2XBIA 4Z2TA 3RHCA 4OWYA 2GQLA 1PN0A 3G9BA 14GSA 4ID0A 1GUHA 3CSJA 6GSXA 3F9UA 1VF1A 2K18A 4O5UA 2X8HA 1F6MC 3NOFA 5AIXA 2PVOC 4X4JA 3KEBA 3O6TA 1BF5A 4KDUA 3GV1A 3BJ5A 1WP0A 3IC8A 1VF2A 2FNOA 4TRXA 1TOFA 1THOA 5B6MA 4RQXA 3HZ4A 1WJKA 3FR3A 3FK8A 4G01A 2VL3A 1M0UA 4V2MA 2H0GA 1QMVA 4IBPA 4MCUA 4J57E 3F8UA 4MK3A 1OKDA 2GSRA 1GRXA 3LXZA 2FHEA 5A5KA 1ZYPA 2H71A 5A4WA 2MYGA 1GWCA 5IIZA 4FIWA 3J7Yb 1XWGA 2L59A 1RK4A 4ACSA 2FY6A 1SL0B 5ECQB 3DIEA 2R37A 3KH9A 2X8GA 3Q74A 1TRWA 5BMUB 1QK8A 1EP8A 4PGTA 4XTSA 3IC4A 3RDWA 2LSTA 3DVXA 2H0HA 2DJ0A 4QL9A 4Q5RA 4FYCA 9GSSA 2DJKA 3G7YA 3FZAA 2OACA 1T4ZA 3LW9A 2C8UA 3GKNA 1BX9A 5EY6A 5A4VA 22GSA 2C3TA 1SL1B 4J56E 2VO4A 4PUAA 3UEMA 1G0TA 5KOWA 1SK0A 1OE7A 2XPDA 3IRAA 1PA3A 1OC9A 2DC5A 1ACVA 2YWNA 6GSYA 2FA4A 4LLRA 1URMA 1YF1A 3GH6A 5ECPB 4G10A 2CV4A 2JU5A 5BMUA 4DSRA 3BCKA 5CREA 2LJKA 1U6TA 1B4QA 1SD9A 4PQ1A 4L8EA 2H8LA 1Z6MA 2K8VA 4YAPA 2LRCA 1Y25A 1XWCA 1AUCA 11GSA 2C3QA 6GSTA 2H1DA 1FAAA 2LV3A 1V58A 1JZRA 3KTBA 5ABRA 3GIXA 2VAFA 5ID2B 4EXJA 1G6WA 3HJOA 2DIZA 3IAS2 4NV5A 2MMNA 3HD5A 5ECNB 4ECIA 2GQMA 3HDCA 2LKUA 1B4PA 1ZCPA 5IPGA 4IS0A 2NDOA 4EKZA 2MMAA 1BAYA 2IN3A 1GP1A 2B5XA 1XIYA 4XCSA 5E4WA 3J7Yk 2C0EA 3FR6A 2P31A 2CAQA 3QMXA 1K0NA 2ON5A 1GUMA 2AYTA 7GSSA 1FG4A 4O7HA 1SJIA 3EMPA 1GULA 5ID2A 4OO5A 4ECJA 4HUAA 3FZ5A 4K9ZA 3U6VA 5DJMA 3MIXA 3LJRA 4E8HA 3I9V2 4DEJA 4X43A 5CRGA 1CQGA 3IHGA 2PGTA 1O81A 2HSMB 2VCWA 4ZXGA 4TN8A 1OC8A 3QFBC 4IVFA 3CMIA 2C0DA 4NWYA 3FYGA 2HI7A 3DMLA 1ERWA 2H19A 3I43A 2GLRA 4ZB9A 2L5LA 4D73B 4OO4A 2MBSA 4MJEA 3NZNA 3LWAA 3HYPA 4HQSA 1Z5YE 5G5EA 3HVVA 3QCPA 4WKWA 3KGKA 3HHVA 2CAIA 4IP6A 1H75A 2DJ3A 5GSSA 1V40A 1FVKA 2H1BA 4I5QA 3JCML 5G30A 2HSMA 13GSA 1FO5A 1A0FA 3D5JA 4GSTA 2ZCTA 5G1KA 4FYBA 4KGIA 5DQSA 3TGZA 4E68A 2X4AA 2L4CA 3CTGA 4CY8A 2A2RA 3UL3A 3F4SA 2O85A 1QGVA 3TB2A 4D73A 4CHSA 2CA8A 3L4NA 5C00A 1X0RA 2M80A 2XC2A 5KN3A 1A8YA 4GTUA 3VI7A 4BA7A 4ZL9A 1ERVA 5J9CA 4RI7A 4QQ7A 1TRVA 4OFMA 5JCWA 2DKIA 4TR1B 3HJPA 1X9MB 3A3TA 3BD2A 3TKSC 5AN1A 3HA9A 1AW9A 4WR4A 1TTZA 3PGTA 4H86A 3UMAA 3AY8A 5JCUA 3L78A 4TOPA 5KN2A 4IHUA 4NXIA 3TJJA 3KCMA 3TRPA 2CX4A 3VK9A 4LA1A 4IELA 4OFNA 1XOAA 1PL1A 2KP1A 4MZWA 3TDGA 1SK2A 2V6KA 3GKMA 3ZIVA 1S3DA 5IMVA 4NV2A 1A0RP 3TKSA 5J4YA 3FMWA 2JZSA 3QOUA 4MP4A 3MNGA 3DGQA 1KEBA 2I9HA 2B1LA 2GTUA 1X9SB 1BEDA 1FB0A 2PERA 3TOUA 1NM3A 2LNSA 2L5OA 3LEFA 2EFCA 5GAND 4V2NA 4YKGA 3RPPA 3IHQA 3EU4A 3A2WA 1GSEA 2J9HA 4BVXB 1DBYA 1ZGNA 3EMXA 4HZ2A 5H5SA 2VLVA 5KN0A 1GSDA 3EYTA 3ED3A 3F6DA 3D4MA 5IM9A 3DRNA 2OBKA 3CBUA 2L57A 4YQUA 4WF4A 4I8BA 4MF7A 1UC7A 2IFQB 1JLWA 2H01A 2I81A 4N11A 4ILFA 4XIHA 12GSA 20GSA 3MSZA 5IOWA 4XS6A 2FWEA 3C8EA 3LFLA 1PX6A 3FZ4A 3BOAA 4ML1A 1V2AA 2ZNMA 3ZREA 1RW1A 1AQVA 2F51A 4N3ZA 3UOMA 3APSA 1YEXA 3RPNA 1SKRB 1M2DA 3D22A 3LYKA 5J3RA 1YVLA 2UV8G 1PD21 3QFAC 5ECLB 3FEUA 5FHIA 3IA1A 1PMTA 3ZITA 1TI1A 2XHFA 3D4TA 2IFQA 2YV7A 2IJYA 4J2FA 2WDUA 5F8BA 3LQ7A 2HRKB 2PVQA 2OE1A 2YWIA 2JL4A 1XWBA 4AKIA 1QUWA 1V98A 1A2JA 4ZL7A 1JFUA 3H1NA 2VCQA 1J08A 2FD3A 1GSYA 2DSAA 1FOHA 4KA0A 1OC3A 2FLSA 1W4VA 3DEXA 4TVEA 1J9BA 2JADA 3KTLA 4I6XA 6GSSA 2C1YA 5G31A 2BMXA 2H1LA 3UBLA 2LUSA 3O3TA 2B5YA 1QFNA 1EOGA 3P2AA 3F6FA 1CQHA 4LL1B 4ULXA 4Q5QA 4HJMA 3H4KA 1YEPA 1A2LA 2VOCA 3WGDA 2EIQA 1Z7RA 5DAKB 2PMTA 1YJ6A 5A34B 3CSHA 3IOSA 4GQCA 5IPHA 3IR4A 3EC3A 5HQPA 3WGXA 5LNKe 2HE3A 1SKSB 3KD0A 3TCOA 1A24A 5EPFA 4MJBA 4EE0A 1DE1A 3M9KA 1DSBA 1WWJA 1TKDB 1KTEA 2X99A 1S3AA 1G6YA 1Z6NA 4JBBA 2P5QA 1MDIA 3TJKA 1TP9A 2GSQA 1TK0B 1AC1A 3F0IA 5A34A 3C1RA 2FUG2 1B9YC 3APQA 1MDJA 2TRCP 1LBKA 4PXOA 3FW2A 2GVPA 3KH7A 3L0HA 2G0FA 1WE0A 2JZRA 2LQOA 4EIPA 3UVTA 2NTOA 2VIMA 2JACA 4AJ8A 3CYNA 3D0ZA 1XOBA 1EZKA 1JHBA 2NBSA 2WCIA 3O76A 2I4AA 3M3MA 4JR6A 2H6ZA 1AAZA 1T00A 4K2DA 2GSSA 2AJQB 2L6CA 2IMEA 2YZUA 2LS5A 4TR0A 1IYIA 2E2MA 3ERWA 2WJUA 2F8AA 2H6YA 2IMFA 1XBSA 4MZBA 5DQYA 3ME7A 3KXOA 2EIRA 2CT6A 5IO0A 3I6AA 5J41A 4WXTA 2GQKA 2AB6A 4PQIA 2X64A 3W8SA 4QMKA 5GSTA 1ZMAA 3GHAA 4MMMA 4O32A 4AGSA 3HZ8A 3KMNA 2K8SA 1M2AA 3FZ9A 3GL3A 2YV9A 5CYYA 1A8LA 1YF0A 2DBCA 3VWWA 3P7XA 2YN1A 3CRTA 2H72A 4IW9A 3LG6A 1TU7A 2H76A 4LL4B 3QD9A 3MDKA 2E2GA 16GSA 5FT3A 2HYXA 1GLQA 3GURA 1B9XC 1ERTA 2IWTA 4MJAA 4G9HA 3VLNA 1XW6A 4USSA 1UN2A 4DSQA 5COHA 2O8VB 2N5FA 2QKEA 4KUNA 3ZFLA 4EL1A 1QXHA 4KB3A 5IMZA 1RQMA 4PQHA 2DJ2A 2PUKC 1SL2B 3PPUA 1X5DA 2QSIA 3TKSE 4TR4A 4CY6A 2GSTA 2OBIA 1GNEA 5HFGA 1SD8A 4G0KA 1B48A 2WGRA 2WRTA 5D9WA 2F3MA 3KM6A 3KP8A 4PNFA 5CO3A 2HZFA 1M9AA 4KH7A 2HZEB 3VI5A 3DKSA 3IV4A 5JCGA 3F4TA 4WBRD 4EO3A 2L6DA 4ICYA 2RLIA 4N0VA 2TRXA 1JLVA 4TXVA 2JZTA 4POKA 3VURA 3BCIA 2UZ8A 3ZYWA 2BJXA 4HU9A 1U3AA 1FB6A 4CW9A 3FKFA 2PU9C 5A1NB 5F07A 3FRCA 1GTIA 4HJ2A 5G5FA 3GTUB 2X8CA 3UBKA 4JEDA 2H74A 5JWQB 1TJDA 2FGXA 4DSSB 5J4UA 1F3AA 4HI7A 1SJ6A 3IDVA 1N2AA 5DALB 4YAVA 1ZYEA 4N30A 4POBA 2HLSA 2R6KA 1T3BA 1IYHA 5J5NA 3CXGA 4ZB6A 1UVZA 1YZXA 2VKZG 4G0LA 4WF5A 1R5PA 2HQTA 5HR2A 2QC7A 3WT1A 4AI6A 1V9WA 4ZBDA 5A1NA 2O5VA 5HFIA 4EUYA 3GNJA 4O5RA 2O7KA 1T4YA 3DWVA 2C3NA 5G1LA 1PL2A 2Z9SA 4EDZA 3IE3A 4OCEA 3G7IA 3HVXA 4HS1A 3M1GA 6GSUA 1SKWB 1M7TA 4OCFA 1OE8A 2NPBA 1YQ1A 4NHWA 1XCCA 4FO5A 5DALA 2VLUA 3TU3B 4ZIJA 1VF4A 1ZOFA 4MPFA 5DCGA 3UVHA 2H30A 3WGEA 2WS2A 1XWKA 4OD7A 3SWLA 3RHBA 2B5EA 1SVMA 3PR8A 3NIVA 2RIIA 3BBYA 3TOTA 5KEJA 4GLTA 2A4VA 1TU8A 1DUGA 4MPGA 1WRYA 3DXBA 3VWXA 4X0XA 2H1GA 1YDKA 4RQRA 1Y6EA 1HNBA 3QAWA 2IMIA 4XHMA 3CWGA 1JZWA 2CQ9A 3LORA 4AF2A 2R0GA 4BVYB 1X5CA 2CZ3A 3GA4A 2H0IA 4LMWA 2YWOA 4ECBA 1GH2A 2EFHA 2GDRA 4OMVA 2HXKA 1KNGA 2O89A 4ZBAA 4TXOB 3QAVA 2KLXA 17GSA 3HKRA 1N8JA 3GX8A 2GT6A 1Z7PA 4TR1A 1A23A 5J9BA 5D9XA 4W66A 2GZZA 4MJCA 2LEGA 4O92A 3CRUA 4BL7B 2VM2A 4ML6A 5EVOA 1R7HA 1PX7A 1G7EA 1T1VA 4ISDA 1KBNA 4YQMA 3KMOA 5J40A 1OAZA 4PTSA 10GSA 1K0CA 1NSWA 3TRQA 2A4HA 4TXOA 4GWRA 4PUFC 2YZHA 3ZMLA 3GMFA 4MA9A 1SVOA 2VUPA 2HNLA 4K0NA 1TW9A 2A2SA 1GSSA 6GSWA 5INYA 4ZB7A 2YPMA 5HR0A 4NPBA 3EPTA 3CTFA 3DVWA 4GXZA 2LRTA 5G2ZA 4BL7A 1W89A 1B8XA 1SJZA 2HRAA 2AHEA 2LJAA 3GYKA 5AISA 3WD6A 2LQQA 3D21A 4TW5A 2CVDA 5ECOB 4RI6A 4KX4A 1YKCA 5DDLA 3VPTA 1ERUA 1HQOA 2IMDA 5D96A 5JWRB 2R3XA 3EE2A 1U3IA 2EC4A 2X49A 3P8WA 4BVXA 5DCHA 3TJBA 3P90A 4K5SA 1J0FA 2VCVA 4MZCA 3TJFA 3GSTA 2V6OA 5CNWA 2RUEA 3UIWA 1AIUA 4F2IA 5J4VA 1GNWA 1U88A 5B6NA 5F0GA 4IQ1A 4PURA 2DKHA 2YJHA 3F3QA 2YCDA 1TI3A 5A4UA 3H8QA 3EURA 5GZZB 1SK1A 2OE0A 1TXXA 2CVKA 1THXA 1PKWA 1E2YA 3ZFBA 2HSHA 4X1UA 2ON7A 3N5OA 3OR5A 4GF0A 1R26A 3GX0A 2D2ZA 2YOIA 5CRDA 4V2LA 3PINA 2TIRA 1NW2A 2FWFA 1ML6A 3WYWA 3G7JA 2HRKA 5BRTA 4YKFA 1S3CA 4GSNA 1QQ2A 1NHOA 2F8FA 5EL8A 3ZL5A 3QAGA 1TK8B 4G19A 4HOJA 2CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV9 A;  1PKZ A;  3R2Q A;  4KF9 A;  4JE1 A;  3ME8 A;  1OKT A;  2YJ7 A;  4ECC A;  5D9V A;  2OKA A;  5L71 A;  2CVB A;  5HR3 A;  1I9D A;  2HRN A;  4YH2 A;  1XXU A;  2IPA A;  1T7P B;  2MBT A;  4DVC A;  1XW5 A;  1EV4 A;  1GTA A;  1TDI A;  2PPT A;  3A5W A;  4I2U A;  1K0M A;  4Q5F A;  2OJL A;  3I69 A;  1K3Y A;  2PWJ A;  5DAK A;  5JWO B;  1F3B A;  5C04 A;  2VLT A;  1FHE A;  2FWH A;  2V32 A;  1HNA A;  1OVN A;  5HFK A;  2MZC A;  1MTC A;  1R4W A;  4XS1 A;  2EIO A;  5IMA A;  3IAM 2;  5ECM B;  2DML A;  1BQ7 A;  1Z3E A;  5ENU A;  1JZD A;  4IJ3 A;  5IO2 A;  3K8N A;  1GSU A;  1VGL A;  5AGY A;  3TKP A;  5CRW A;  3RBT A;  2K6V A;  4NMU A;  1PGT A;  2VCT A;  2R5G A;  3M9J A;  1MD3 A;  1VF3 A;  3S9F A;  3VWV A;  1WMJ A;  2VL9 A;  1SYX A;  1ZZY A;  3VPQ A;  4FYU A;  2C0G A;  4JU5 A;  4F0C A;  1O73 A;  3L9V A;  3HCZ A;  2AAW A;  2B1K A;  5ELG A;  1OC9 B;  3KZQ A;  1O6J A;  8GSS A;  2LNT A;  1BYE A;  1DE2 A;  1USB A;  3Q19 A;  19GS A;  1AQX A;  4HZ4 A;  1EP7 A;  2YWM A;  2R4V A;  5ECS A;  2B6M A;  3V1W A;  1XPV A;  1G7O A;  2V1M A;  1UA5 A;  3E3E A;  5HR1 A;  3QDN A;  4K7I A;  4V1A p;  3GKX A;  3ERF A;  4F82 A;  3HVS A;  3E9J B;  5ECI B;  3H93 A;  2FA8 A;  2H70 A;  3ZVJ A;  4N0Z A;  4IN0 A;  3TKQ A;  3N9J A;  2H6X A;  3C7M A;  1WOU A;  4KCA A;  4HEA 2;  2M72 A;  2N5B A;  1O7U A;  5F06 A;  4KW6 A;  3F3R A;  1M2B A;  5IOX A;  4GCI A;  2HFD A;  5FWG A;  4CDO A;  1SU9 A;  4AJ7 A;  4WET A;  1X9W B;  4FH8 A;  2VD1 A;  2IMK A;  3HXS A;  2V2G A;  2H66 A;  4K7N A;  1FOV A;  1PQN A;  4E8E A;  2B7K A;  1MD4 A;  2C0F A;  3GUS A;  1XWA A;  4ZBB A;  4JZQ A;  3Q18 A;  4K6X A;  3ZMK A;  4KAE A;  2VCZ A;  1XW9 A;  2N5A A;  2ZUP A;  5B8A A;  1K3O A;  2H1A A;  4OFT A;  5D9T A;  3F4R A;  4K8M A;  3WT2 A;  1XVW A;  3UJ1 A;  2ALB A;  1ABA A;  5H5R A;  3ISO A;  1EOH A;  3L9U A;  3ZTL A;  2RM6 A;  1F37 A;  4WR5 A;  5ECR B;  2B3S A;  2HSY A;  2XBQ A;  1PN9 A;  4HU7 A;  4RUV A;  2HZE A;  3UAP A;  1BG5 A;  1YY7 A;  3GFK A;  1WIK A;  4G0I A;  4K7O A;  1O85 A;  1E6B A;  2HT9 A;  5CAX A;  2HSN B;  3EIN A;  3TUE A;  2P5R A;  3W6G A;  3M8N A;  1TRS A;  1PRX A;  1ZYQ B;  2WB9 A;  1ZL9 A;  5ECK B;  2YP6 A;  4K0G A;  1PSQ A;  2AV4 A;  2BTO T;  2F9S A;  2LRN A;  4BPY A;  4PX1 A;  3GTU A;  3FR9 A;  4EC0 A;  2DIY A;  2C4J A;  1K0O A;  1SYR A;  1K0D A;  2DJJ A;  4DSS A;  3GKK A;  2P0G A;  1EGO A;  3C71 A;  2YNX A;  4L5O A;  5IMF A;  1EWX A;  3KIJ A;  2PBJ A;  4V1A g;  1XVQ A;  1EEJ A;  3VFI A;  3SBC A;  4MF6 A;  4KSM A;  3F63 A;  1I5G A;  4K1F A;  4KDX A;  3GN3 A;  1LU4 A;  18GS A;  4KSO A;  2REM A;  3CSI A;  4ZL8 A;  2H75 A;  1TRU A;  2I3Y A;  3Q6O A;  2LJR A;  2KUC A;  4F9Z A;  3IPZ A;  2VM1 A;  3D6I A;  4POL A;  6GSV A;  1MEK A;  5D73 A;  1GTB A;  2VD0 A;  1AXD A;  2IL3 A;  5D8I A;  1GSQ A;  2IIY A;  2YAN A;  2O87 A;  3TJG A;  5B8B A;  3APO A;  2OE3 A;  3PH9 A;  2RUF A;  5H5Q A;  3GL5 A;  1T8E B;  3C73 A;  4KDY A;  2M46 A;  5D93 A;  4NHZ A;  2VL2 C;  4XRA A;  3EWL A;  5AIV A;  3DD3 A;  4EDY A;  1OYJ A;  5CP1 A;  2DMM A;  2GZP A;  3ZRD A;  4XS4 B;  1ON4 A;  2VCX A;  1ST9 A;  1ILO A;  4IP1 A;  3IXR A;  2WZ9 A;  5IMD A;  4LMV A;  1U87 A;  4IGJ A;  4P3Y B;  4IKH A;  4FQU A;  2LTK A;  1O8W A;  2MMO A;  1GSF A;  1H4O A;  5DJL A;  3FY7 A;  4MH3 A;  1JZO A;  1MDK A;  2VL2 A;  1O8X A;  4HDE A;  1GTU A;  4AJ6 A;  4NAX A;  4N10 A;  2WFC A;  3LSZ A;  2JSZ A;  3DYR A;  4F03 A;  4YQV A;  4BVY A;  5IQY A;  3FHK A;  4I97 A;  4BWS A;  1XFL A;  1HD2 A;  4L0W A;  4JRR A;  3TKR A;  3A2X A;  3LGC A;  2ES7 A;  3IK7 A;  2QGV A;  1K0B A;  1EEM A;  5DBQ A;  4XS4 A;  1K0A A;  2DJ1 A;  1AQW A;  4F0B A;  2KOK A;  3ZVJ D;  3ERG A;  5ELA A;  1A2M A;  3RAZ A;  1SEN A;  3GRX A;  2K9F A;  1M99 A;  4PNG A;  5CRH A;  3LXT A;  4MAB A;  2GT5 A;  3HJM A;  2XPE A;  3QR6 A;  1C72 A;  2J23 A;  4TR3 A;  3W8J A;  5GAP D;  4GSS A;  3TRX A;  4Z7X A;  5F05 A;  2KHP A;  1LJR A;  3KP9 A;  4L5L A;  4MH2 A;  2E0Q A;  4KCE A;  3GH9 A;  1Z9H A;  2NVL A;  4EF0 A;  1XZO A;  3U5R E;  3H79 A;  1TK5 B;  4GQF A;  2HRF A;  3MAK A;  2E7P A;  1GL8 A;  1M9B A;  5KN1 A;  4G2E A;  3EU3 A;  1F9M A;  2C80 A;  3M0F A;  1F2E A;  4KE3 A;  2OA7 A;  2V41 A;  1X5E A;  3R3E A;  1Q98 A;  2JSY A;  4I2T A;  4MLY A;  4JR4 A;  1BJX A;  3US3 A;  4ZIL A;  3KJY A;  4Q5N A;  1GUK A;  1YKA A;  3IK9 A;  4GRF A;  3UAR A;  2AUV A;  5E59 A;  3ZZX A;  1NHY A;  4XRD A;  1K3L A;  4MF5 A;  3C1S A;  5B7C A;  4EVM A;  4HQZ A;  3LYP A;  3L9S A;  1VRS D;  2R2J A;  4IJI A;  5ECH B;  5LCZ A;  3GSS A;  1WPI A;  3E0U A;  4L0U A;  4WEY A;  4KND A;  1FW1 A;  2OAD A;  5IMC A;  1R5A A;  4QL7 A;  4ZB8 A;  4BWQ A;  2PN8 A;  3A2V A;  2B7J A;  3ZIJ A;  1FVJ A;  1V57 A;  3ZLP A;  1GLP A;  1HNC A;  4WBJ A;  3HY2 A;  2WUL A;  2RM5 A;  5DVB A;  3QPM A;  5LD0 A;  2GGT A;  2GS3 A;  3VWU A;  4MDC A;  2I1U A;  4POM A;  2GZY A;  3EVI A;  2FWG A;  1HYU A;  2L4Q A;  3IBH A;  4TKY A;  2CZ2 A;  2FCH A;  2DLX A;  4IQA A;  3MWH A;  2MMZ A;  1Q4J A;  2H73 A;  1EGR A;  2G2Q A;  2KP2 A;  2XBI A;  3RHC A;  4OWY A;  2GQL A;  3G9B A;  14GS A;  4ID0 A;  1GUH A;  3CSJ A;  6GSX A;  3F9U A;  1VF1 A;  2K18 A;  2X8H A;  1F6M C;  3NOF A;  5AIX A;  2PVO C;  3KEB A;  3O6T A;  4KDU A;  3GV1 A;  3BJ5 A;  1WP0 A;  3IC8 A;  1VF2 A;  2FNO A;  4TRX A;  1TOF A;  1THO A;  5B6M A;  4RQX A;  3HZ4 A;  1WJK A;  3FR3 A;  3FK8 A;  2VL3 A;  1M0U A;  4V2M A;  2H0G A;  1QMV A;  4IBP A;  4MCU A;  4J57 E;  3F8U A;  4MK3 A;  1OKD A;  2GSR A;  1GRX A;  3LXZ A;  2FHE A;  5A5K A;  2H71 A;  5A4W A;  2MYG A;  1GWC A;  5IIZ A;  4FIW A;  3J7Y b;  1XWG A;  2L59 A;  1RK4 A;  4ACS A;  2FY6 A;  1SL0 B;  5ECQ B;  3DIE A;  2R37 A;  3KH9 A;  2X8G A;  3Q74 A;  1TRW A;  1QK8 A;  1EP8 A;  4PGT A;  4XTS A;  3IC4 A;  3RDW A;  2LST A;  3DVX A;  2H0H A;  2DJ0 A;  4QL9 A;  4Q5R A;  4FYC A;  9GSS A;  2DJK A;  3G7Y A;  3FZA A;  2OAC A;  1T4Z A;  2C8U A;  3GKN A;  1BX9 A;  5EY6 A;  5A4V A;  22GS A;  2C3T A;  1SL1 B;  4J56 E;  2VO4 A;  4PUA A;  3UEM A;  1G0T A;  1SK0 A;  1OE7 A;  2XPD A;  3IRA A;  1PA3 A;  1OC9 A;  2DC5 A;  1ACV A;  2YWN A;  6GSY A;  2FA4 A;  4LLR A;  1URM A;  1YF1 A;  3GH6 A;  5ECP B;  4G10 A;  2CV4 A;  2JU5 A;  5BMU A;  4DSR A;  3BCK A;  5CRE A;  2LJK A;  1U6T A;  1B4Q A;  1SD9 A;  4PQ1 A;  4L8E A;  2H8L A;  1Z6M A;  2K8V A;  4YAP A;  2LRC A;  1Y25 A;  1XWC A;  1AUC A;  11GS A;  2C3Q A;  6GST A;  2H1D A;  1FAA A;  2LV3 A;  1V58 A;  1JZR A;  3KTB A;  5ABR A;  3GIX A;  2VAF A;  5ID2 B;  4EXJ A;  1G6W A;  3HJO A;  2DIZ A;  3IAS 2;  4NV5 A;  2MMN A;  3HD5 A;  5ECN B;  4ECI A;  2GQM A;  3HDC A;  2LKU A;  1B4P A;  1ZCP A;  5IPG A;  4IS0 A;  2NDO A;  4EKZ A;  2MMA A;  1BAY A;  2IN3 A;  1GP1 A;  2B5X A;  1XIY A;  4XCS A;  5E4W A;  3J7Y k;  2C0E A;  3FR6 A;  2P31 A;  2CAQ A;  3QMX A;  1K0N A;  2ON5 A;  1GUM A;  2AYT A;  7GSS A;  1FG4 A;  4O7H A;  1SJI A;  3EMP A;  1GUL A;  5ID2 A;  4OO5 A;  4ECJ A;  4HUA A;  3FZ5 A;  4K9Z A;  3U6V A;  5DJM A;  3LJR A;  4E8H A;  3I9V 2;  4DEJ A;  4X43 A;  5CRG A;  1CQG A;  2PGT A;  1O81 A;  2HSM B;  2VCW A;  4ZXG A;  4TN8 A;  1OC8 A;  3QFB C;  4IVF A;  3CMI A;  2C0D A;  4NWY A;  3FYG A;  2HI7 A;  3DML A;  1ERW A;  2H19 A;  3I43 A;  2GLR A;  4ZB9 A;  2L5L A;  4D73 B;  4OO4 A;  2MBS A;  4MJE A;  3NZN A;  3LWA A;  3HYP A;  4HQS A;  1Z5Y E;  5G5E A;  3HVV A;  3QCP A;  4WKW A;  3KGK A;  3HHV A;  2CAI A;  4IP6 A;  1H75 A;  2DJ3 A;  5GSS A;  1V40 A;  1FVK A;  2H1B A;  4I5Q A;  3JCM L;  5G30 A;  2HSM A;  13GS A;  1FO5 A;  1A0F A;  3D5J A;  4GST A;  2ZCT A;  5G1K A;  4FYB A;  4KGI A;  5DQS A;  3TGZ A;  2L4C A;  3CTG A;  2A2R A;  3UL3 A;  3F4S A;  2O85 A;  1QGV A;  3TB2 A;  4D73 A;  4CHS A;  2CA8 A;  3L4N A;  5C00 A;  1X0R A;  2M80 A;  2XC2 A;  5KN3 A;  1A8Y A;  4GTU A;  3VI7 A;  4BA7 A;  4ZL9 A;  1ERV A;  5J9C A;  4RI7 A;  4QQ7 A;  1TRV A;  4OFM A;  5JCW A;  4TR1 B;  3HJP A;  1X9M B;  3A3T A;  3BD2 A;  3TKS C;  5AN1 A;  3HA9 A;  1AW9 A;  4WR4 A;  1TTZ A;  3PGT A;  4H86 A;  3UMA A;  3AY8 A;  5JCU A;  3L78 A;  4TOP A;  5KN2 A;  4IHU A;  4NXI A;  3TJJ A;  3KCM A;  3TRP A;  2CX4 A;  3VK9 A;  4LA1 A;  4IEL A;  4OFN A;  1XOA A;  1PL1 A;  2KP1 A;  4MZW A;  3TDG A;  1SK2 A;  2V6K A;  3GKM A;  3ZIV A;  1S3D A;  5IMV A;  4NV2 A;  1A0R P;  3TKS A;  2JZS A;  3QOU A;  4MP4 A;  3MNG A;  3DGQ A;  1KEB A;  2I9H A;  2B1L A;  2GTU A;  1X9S B;  1BED A;  1FB0 A;  2PER A;  3TOU A;  1NM3 A;  2LNS A;  2L5O A;  3LEF A;  5GAN D;  4V2N A;  3RPP A;  3IHQ A;  3EU4 A;  3A2W A;  1GSE A;  2J9H A;  4BVX B;  1DBY A;  1ZGN A;  3EMX A;  4HZ2 A;  5H5S A;  2VLV A;  5KN0 A;  1GSD A;  3EYT A;  3ED3 A;  3F6D A;  3D4M A;  5IM9 A;  3DRN A;  2OBK A;  3CBU A;  2L57 A;  4YQU A;  4WF4 A;  4I8B A;  4MF7 A;  1UC7 A;  2IFQ B;  1JLW A;  2H01 A;  2I81 A;  4N11 A;  4ILF A;  4XIH A;  12GS A;  20GS A;  3MSZ A;  5IOW A;  4XS6 A;  2FWE A;  3C8E A;  3LFL A;  1PX6 A;  3FZ4 A;  3BOA A;  4ML1 A;  1V2A A;  2ZNM A;  3ZRE A;  1RW1 A;  1AQV A;  2F51 A;  3UOM A;  3APS A;  1YEX A;  3RPN A;  1SKR B;  1M2D A;  3D22 A;  3LYK A;  5J3R A;  1PD2 1;  3QFA C;  5ECL B;  3FEU A;  5FHI A;  3IA1 A;  1PMT A;  3ZIT A;  1TI1 A;  2XHF A;  3D4T A;  2IFQ A;  2YV7 A;  2IJY A;  4J2F A;  2WDU A;  5F8B A;  3LQ7 A;  2HRK B;  2PVQ A;  2OE1 A;  2YWI A;  2JL4 A;  1XWB A;  1QUW A;  1V98 A;  1A2J A;  4ZL7 A;  1JFU A;  3H1N A;  2VCQ A;  1J08 A;  2FD3 A;  1GSY A;  2DSA A;  4KA0 A;  1OC3 A;  2FLS A;  1W4V A;  3DEX A;  4TVE A;  1J9B A;  2JAD A;  3KTL A;  4I6X A;  6GSS A;  2C1Y A;  5G31 A;  2BMX A;  3UBL A;  2LUS A;  3O3T A;  2B5Y A;  1QFN A;  1EOG A;  3P2A A;  3F6F A;  1CQH A;  4LL1 B;  4ULX A;  4Q5Q A;  4HJM A;  3H4K A;  1YEP A;  1A2L A;  2VOC A;  3WGD A;  2EIQ A;  1Z7R A;  5DAK B;  2PMT A;  1YJ6 A;  3CSH A;  3IOS A;  4GQC A;  5IPH A;  3IR4 A;  3EC3 A;  5HQP A;  3WGX A;  5LNK e;  2HE3 A;  1SKS B;  3KD0 A;  3TCO A;  1A24 A;  5EPF A;  4MJB A;  4EE0 A;  1DE1 A;  3M9K A;  1DSB A;  1WWJ A;  1TKD B;  1KTE A;  2X99 A;  1S3A A;  1G6Y A;  1Z6N A;  4JBB A;  2P5Q A;  1MDI A;  3TJK A;  1TP9 A;  2GSQ A;  1TK0 B;  1AC1 A;  3F0I A;  3C1R A;  2FUG 2;  1B9Y C;  3APQ A;  1MDJ A;  2TRC P;  1LBK A;  4PXO A;  3FW2 A;  2GVP A;  3KH7 A;  3L0H A;  2G0F A;  1WE0 A;  2JZR A;  2LQO A;  3UVT A;  2NTO A;  2VIM A;  2JAC A;  4AJ8 A;  3CYN A;  3D0Z A;  1XOB A;  1EZK A;  1JHB A;  2NBS A;  2WCI A;  3O76 A;  2I4A A;  3M3M A;  4JR6 A;  2H6Z A;  1AAZ A;  1T00 A;  4K2D A;  2GSS A;  2AJQ B;  2L6C A;  2IME A;  2YZU A;  2LS5 A;  4TR0 A;  1IYI A;  2E2M A;  3ERW A;  2WJU A;  2F8A A;  2H6Y A;  2IMF A;  1XBS A;  4MZB A;  5DQY A;  3ME7 A;  3KXO A;  2EIR A;  2CT6 A;  5IO0 A;  3I6A A;  5J41 A;  4WXT A;  2GQK A;  2AB6 A;  4PQI A;  2X64 A;  3W8S A;  5GST A;  1ZMA A;  3GHA A;  4MMM A;  4O32 A;  4AGS A;  3HZ8 A;  3KMN A;  2K8S A;  1M2A A;  3FZ9 A;  3GL3 A;  2YV9 A;  5CYY A;  1A8L A;  1YF0 A;  2DBC A;  3VWW A;  3P7X A;  2YN1 A;  3CRT A;  2H72 A;  4IW9 A;  3LG6 A;  1TU7 A;  2H76 A;  4LL4 B;  3QD9 A;  3MDK A;  2E2G A;  16GS A;  5FT3 A;  2HYX A;  1GLQ A;  3GUR A;  1B9X C;  1ERT A;  2IWT A;  4MJA A;  4G9H A;  3VLN A;  1XW6 A;  4USS A;  1UN2 A;  4DSQ A;  5COH A;  2O8V B;  2N5F A;  2QKE A;  4KUN A;  3ZFL A;  4EL1 A;  1QXH A;  4KB3 A;  5IMZ A;  1RQM A;  4PQH A;  2DJ2 A;  2PUK C;  1SL2 B;  3PPU A;  1X5D A;  2QSI A;  3TKS E;  4TR4 A;  2GST A;  2OBI A;  1GNE A;  5HFG A;  1SD8 A;  4G0K A;  1B48 A;  2WGR A;  2WRT A;  5D9W A;  2F3M A;  3KM6 A;  3KP8 A;  4PNF A;  5CO3 A;  2HZF A;  1M9A A;  4KH7 A;  2HZE B;  3VI5 A;  3DKS A;  3IV4 A;  5JCG A;  3F4T A;  4WBR D;  4EO3 A;  2L6D A;  2RLI A;  4N0V A;  2TRX A;  1JLV A;  4TXV A;  2JZT A;  4POK A;  3VUR A;  3BCI A;  2UZ8 A;  3ZYW A;  2BJX A;  4HU9 A;  1U3A A;  1FB6 A;  4CW9 A;  3FKF A;  2PU9 C;  5F07 A;  3FRC A;  1GTI A;  4HJ2 A;  5G5F A;  3GTU B;  2X8C A;  3UBK A;  4JED A;  2H74 A;  5JWQ B;  1TJD A;  2FGX A;  4DSS B;  5J4U A;  1F3A A;  4HI7 A;  1SJ6 A;  3IDV A;  1N2A A;  5DAL B;  4YAV A;  1ZYE A;  4N30 A;  4POB A;  2HLS A;  2R6K A;  1T3B A;  1IYH A;  5J5N A;  3CXG A;  4ZB6 A;  1UVZ A;  1YZX A;  4G0L A;  4WF5 A;  1R5P A;  2HQT A;  5HR2 A;  2QC7 A;  3WT1 A;  1V9W A;  4ZBD A;  5HFI A;  4EUY A;  3GNJ A;  4O5R A;  2O7K A;  1T4Y A;  3DWV A;  2C3N A;  5G1L A;  1PL2 A;  2Z9S A;  4EDZ A;  3IE3 A;  4OCE A;  3G7I A;  3HVX A;  4HS1 A;  3M1G A;  6GSU A;  1SKW B;  1M7T A;  4OCF A;  1OE8 A;  2NPB A;  1YQ1 A;  4NHW A;  1XCC A;  4FO5 A;  5DAL A;  2VLU A;  4ZIJ A;  1VF4 A;  1ZOF A;  4MPF A;  5DCG A;  3UVH A;  2H30 A;  3WGE A;  2WS2 A;  1XWK A;  4OD7 A;  3SWL A;  3RHB A;  2B5E A;  3PR8 A;  3NIV A;  2RII A;  3BBY A;  3TOT A;  5KEJ A;  4GLT A;  2A4V A;  1TU8 A;  1DUG A;  4MPG A;  1WRY A;  3DXB A;  3VWX A;  4X0X A;  2H1G A;  1YDK A;  4RQR A;  1Y6E A;  1HNB A;  3QAW A;  2IMI A;  4XHM A;  1JZW A;  2CQ9 A;  3LOR A;  4AF2 A;  4BVY B;  1X5C A;  2CZ3 A;  3GA4 A;  2H0I A;  4LMW A;  2YWO A;  4ECB A;  1GH2 A;  2GDR A;  4OMV A;  2HXK A;  1KNG A;  2O89 A;  4ZBA A;  4TXO B;  3QAV A;  2KLX A;  17GS A;  3HKR A;  1N8J A;  3GX8 A;  2GT6 A;  1Z7P A;  4TR1 A;  1A23 A;  5J9B A;  5D9X A;  2GZZ A;  4MJC A;  2LEG A;  4O92 A;  3CRU A;  4BL7 B;  2VM2 A;  4ML6 A;  5EVO A;  1R7H A;  1PX7 A;  1G7E A;  1T1V A;  4ISD A;  1KBN A;  4YQM A;  3KMO A;  1OAZ A;  4PTS A;  10GS A;  1K0C A;  1NSW A;  3TRQ A;  4TXO A;  4GWR A;  4PUF C;  2YZH A;  3ZML A;  3GMF A;  4MA9 A;  2VUP A;  2HNL A;  4K0N A;  1TW9 A;  2A2S A;  1GSS A;  6GSW A;  5INY A;  2YPM A;  5HR0 A;  4NPB A;  3CTF A;  3DVW A;  4GXZ A;  2LRT A;  5G2Z A;  4BL7 A;  1W89 A;  1B8X A;  1SJZ A;  2HRA A;  2AHE A;  2LJA A;  3GYK A;  5AIS A;  3WD6 A;  2LQQ A;  3D21 A;  4TW5 A;  2CVD A;  5ECO B;  4RI6 A;  4KX4 A;  1YKC A;  5DDL A;  3VPT A;  1ERU A;  1HQO A;  2IMD A;  5D96 A;  5JWR B;  2R3X A;  3EE2 A;  1U3I A;  2EC4 A;  3P8W A;  4BVX A;  5DCH A;  3TJB A;  3P90 A;  1J0F A;  2VCV A;  4MZC A;  3TJF A;  3GST A;  2V6O A;  5CNW A;  2RUE A;  3UIW A;  1AIU A;  4F2I A;  1GNW A;  1U88 A;  5B6N A;  5F0G A;  4IQ1 A;  4PUR A;  2YJH A;  3F3Q A;  2YCD A;  1TI3 A;  5A4U A;  3H8Q A;  3EUR A;  5GZZ B;  1SK1 A;  2OE0 A;  1TXX A;  2CVK A;  1THX A;  1PKW A;  1E2Y A;  3ZFB A;  2HSH A;  4X1U A;  2ON7 A;  3N5O A;  3OR5 A;  4GF0 A;  1R26 A;  3GX0 A;  2D2Z A;  2YOI A;  5CRD A;  4V2L A;  3PIN A;  2TIR A;  1NW2 A;  2FWF A;  1ML6 A;  3WYW A;  3G7J A;  2HRK A;  1S3C A;  4GSN A;  1QQ2 A;  1NHO A;  2F8F A;  5EL8 A;  3ZL5 A;  3QAG A;  1TK8 B;  4G19 A;  4HOJ A;  2CX3 A; 
#chains in the Genus database with same CATH topology
 1EV9 A;  1PKZ A;  3R2Q A;  4KF9 A;  4JE1 A;  3ME8 A;  1OKT A;  2YJ7 A;  4ECC A;  4K5R A;  5D9V A;  2OKA A;  5L71 A;  2CVB A;  5HR3 A;  1I9D A;  2HRN A;  4YH2 A;  1XXU A;  2IPA A;  1T7P B;  2MBT A;  4DVC A;  1XW5 A;  1EV4 A;  1GTA A;  1TDI A;  2PPT A;  3A5W A;  4GDF A;  4I2U A;  1K0M A;  4Q5F A;  2OJL A;  3I69 A;  1K3Y A;  2PWJ A;  5DAK A;  5JWO B;  1F3B A;  4PI2 C;  4K2X A;  5C04 A;  2VLT A;  1FHE A;  2FWH A;  2V32 A;  1HNA A;  1OVN A;  5HFK A;  2MZC A;  1MTC A;  1R4W A;  4XS1 A;  2EIO A;  5IMA A;  3IAM 2;  5ECM B;  2DML A;  1BQ7 A;  2R0C A;  1Z3E A;  5ENU A;  1JZD A;  4IJ3 A;  2A2P A;  4Z2U A;  5IO2 A;  3K8N A;  1GSU A;  1VGL A;  5AGY A;  3TKP A;  5CRW A;  3RBT A;  1N25 A;  2K6V A;  4NMU A;  1PGT A;  2VCT A;  2R5G A;  3M9J A;  1MD3 A;  1VF3 A;  3S9F A;  3MYD A;  3VWV A;  1WMJ A;  2VL9 A;  1SYX A;  1ZZY A;  3VPQ A;  4FYU A;  2C0G A;  4JU5 A;  4F0C A;  1O73 A;  3L9V A;  3HCZ A;  2AAW A;  2B1K A;  5ELG A;  1OC9 B;  3KZQ A;  1O6J A;  2EFE A;  8GSS A;  2LNT A;  1BYE A;  1DE2 A;  1USB A;  3Q19 A;  19GS A;  1AQX A;  4HZ4 A;  1EP7 A;  2YWM A;  2R4V A;  5ECS A;  2B6M A;  3V1W A;  1XPV A;  1G7O A;  2V1M A;  1UA5 A;  3E3E A;  5HR1 A;  3QDN A;  4K7I A;  4V1A p;  3GKX A;  3ERF A;  4F82 A;  3HVS A;  5KOX A;  3E9J B;  5ECI B;  3H93 A;  2FA8 A;  2H70 A;  3ZVJ A;  4N0Z A;  4AKX B;  4IN0 A;  3TKQ A;  3N9J A;  2H6X A;  3C7M A;  1WOU A;  4KCA A;  4AKG A;  4HEA 2;  2M72 A;  2N5B A;  1O7U A;  5F06 A;  4KW6 A;  3F3R A;  1M2B A;  5IOX A;  4GCI A;  2HFD A;  5FWG A;  4CDO A;  1SU9 A;  4AJ7 A;  4WET A;  1X9W B;  4FH8 A;  2VD1 A;  2IMK A;  3HXS A;  2V2G A;  2H66 A;  4K7N A;  1FOV A;  1PQN A;  4E8E A;  2B7K A;  1MD4 A;  2C0F A;  3GUS A;  1XWA A;  4ZBB A;  4JZQ A;  3Q18 A;  4K6X A;  3ZMK A;  4KAE A;  2VCZ A;  1TXU A;  1XW9 A;  2N5A A;  2ZUP A;  5B8A A;  1K3O A;  2H1A A;  4OFT A;  5D9T A;  3F4R A;  4K8M A;  3WT2 A;  1XVW A;  3UJ1 A;  2ALB A;  1ABA A;  5H5R A;  3ISO A;  1EOH A;  3L9U A;  3ZTL A;  2RM6 A;  1F37 A;  4WR5 A;  5ECR B;  2B3S A;  4MNN A;  5J47 A;  2XBQ A;  2HSY A;  1PN9 A;  4HU7 A;  4RUV A;  2HZE A;  3UAP A;  1BG5 A;  1YY7 A;  3GFK A;  1WIK A;  4G0I A;  4K7O A;  1O85 A;  1E6B A;  2HT9 A;  5CAX A;  2HSN B;  3EIN A;  3TUE A;  2P5R A;  3W6G A;  3M8N A;  1TRS A;  4AKH A;  1PRX A;  1ZYQ B;  1Y1U A;  2WB9 A;  1ZL9 A;  5ECK B;  2YP6 A;  4K0G A;  1PSQ A;  2AV4 A;  2BTO T;  2F9S A;  2LRN A;  4BPY A;  1SVL A;  4PX1 A;  3GTU A;  3FR9 A;  4EC0 A;  2DIY A;  4EIQ A;  2C4J A;  1K0O A;  1SYR A;  1K0D A;  2DJJ A;  4DSS A;  4O5Q A;  4Z2R A;  3GKK A;  2P0G A;  1EGO A;  3C71 A;  2YNX A;  4L5O A;  5IMF A;  2HSN A;  1EWX A;  3KIJ A;  2PBJ A;  4V1A g;  1XVQ A;  1EEJ A;  3VFI A;  3SBC A;  4MF6 A;  4KSM A;  3F63 A;  1I5G A;  4K1F A;  4KDX A;  3GN3 A;  1LU4 A;  18GS A;  4KSO A;  2REM A;  3CSI A;  4ZL8 A;  2H75 A;  1TRU A;  2I3Y A;  3Q6O A;  2LJR A;  2KUC A;  4F9Z A;  3IPZ A;  2VM1 A;  2WW3 A;  3D6I A;  4POL A;  6GSV A;  1MEK A;  5D73 A;  1GTB A;  2VD0 A;  1AXD A;  2IL3 A;  5D8I A;  1GSQ A;  2IIY A;  2YAN A;  2O87 A;  3TJG A;  3HMJ G;  5B8B A;  3APO A;  2OE3 A;  3PH9 A;  2RUF A;  5H5Q A;  3GL5 A;  1T8E B;  3C73 A;  4KDY A;  2M46 A;  5D93 A;  4NHZ A;  2VL2 C;  4XRA A;  3EWL A;  5AIV A;  3DD3 A;  4EDY A;  1OYJ A;  5CP1 A;  2DMM A;  2GZP A;  3ZRD A;  4XS4 B;  1ON4 A;  2VCX A;  1ST9 A;  1ILO A;  4IP1 A;  3IXR A;  2WZ9 A;  5IMD A;  4LMV A;  1U87 A;  4IGJ A;  4P3Y B;  4IKH A;  3A5I A;  4FQU A;  2LTK A;  1O8W A;  2MMO A;  2OT3 A;  1GSF A;  1H4O A;  3CQF A;  5DJL A;  5A5H B;  3FY7 A;  4MH3 A;  1JZO A;  1MDK A;  2VL2 A;  1O8X A;  4HDE A;  1GTU A;  4AJ6 A;  4NAX A;  4N10 A;  2WFC A;  3LSZ A;  2JSZ A;  3DYR A;  4F03 A;  4YQV A;  4BVY A;  5IQY A;  3FHK A;  4I97 A;  4BWS A;  1XFL A;  1HD2 A;  4L0W A;  2R0P A;  4JRR A;  3TKR A;  3A2X A;  3LGC A;  2ES7 A;  3IK7 A;  2QGV A;  1K0B A;  1EEM A;  5DBQ A;  4XS4 A;  1K0A A;  2DJ1 A;  1AQW A;  4F0B A;  2KOK A;  3ZVJ D;  3ERG A;  5ELA A;  2QA2 A;  3RFR C;  1A2M A;  1ZYN A;  5A5H A;  3RAZ A;  1SEN A;  3GRX A;  2K9F A;  1M99 A;  2EFD A;  4PNG A;  5CRH A;  3LXT A;  4MAB A;  2GT5 A;  3HJM A;  2XPE A;  3QR6 A;  1C72 A;  2J23 A;  4TR3 A;  3W8J A;  5GAP D;  4GSS A;  3TRX A;  4Z7X A;  5F05 A;  2KHP A;  1LJR A;  3KP9 A;  4L5L A;  4MH2 A;  2E0Q A;  4KCE A;  3GH9 A;  1Z9H A;  2NVL A;  4EF0 A;  1XZO A;  3U5R E;  3H79 A;  1TK5 B;  4GQF A;  2WVX B;  2HRF A;  3MAK A;  2E7P A;  1GL8 A;  1M9B A;  5KN1 A;  4G2E A;  3EU3 A;  2QA1 A;  1F9M A;  2C80 A;  3M0F A;  1F2E A;  4KE3 A;  2OA7 A;  2V41 A;  1X5E A;  3R3E A;  1Q98 A;  2JSY A;  4I2T A;  4MLY A;  4JR4 A;  1BJX A;  3US3 A;  4ZIL A;  3KJY A;  4Q5N A;  1GUK A;  1YKA A;  3IK9 A;  4GRF A;  3UAR A;  2AUV A;  5E59 A;  3ZZX A;  1NHY A;  4XRD A;  2WVX A;  1K3L A;  4MF5 A;  3C1S A;  5B7C A;  4EVM A;  4HQZ A;  3LYP A;  3L9S A;  1VRS D;  2R2J A;  4IJI A;  5ECH B;  5LCZ A;  3GSS A;  1WPI A;  3E0U A;  4L0U A;  4WEY A;  4KND A;  1FW1 A;  2OAD A;  5IMC A;  1R5A A;  4QL7 A;  4ZB8 A;  4A5P A;  4BWQ A;  2PN8 A;  3A2V A;  2B7J A;  3ZIJ A;  1FVJ A;  1V57 A;  3ZLP A;  1GLP A;  1HNC A;  4WBJ A;  1BG1 A;  3HY2 A;  2WUL A;  2RM5 A;  5DVB A;  3QPM A;  5LD0 A;  2GGT A;  2GS3 A;  3VWU A;  4MDC A;  2I1U A;  4POM A;  2GZY A;  3EVI A;  2FWG A;  1HYU A;  2L4Q A;  3IBH A;  4TKY A;  2CZ2 A;  2FCH A;  2DLX A;  4IQA A;  3MWH A;  2MMZ A;  1Q4J A;  2H73 A;  1EGR A;  2G2Q A;  3CHX C;  2KP2 A;  2XBI A;  4Z2T A;  3RHC A;  4OWY A;  2GQL A;  1PN0 A;  3G9B A;  14GS A;  4ID0 A;  1GUH A;  3CSJ A;  6GSX A;  3F9U A;  1VF1 A;  2K18 A;  4O5U A;  2X8H A;  1F6M C;  3NOF A;  5AIX A;  2PVO C;  4X4J A;  3KEB A;  3O6T A;  1BF5 A;  4KDU A;  3GV1 A;  3BJ5 A;  1WP0 A;  3IC8 A;  1VF2 A;  2FNO A;  4TRX A;  1TOF A;  1THO A;  5B6M A;  4RQX A;  3HZ4 A;  1WJK A;  3FR3 A;  3FK8 A;  4G01 A;  2VL3 A;  2WVY A;  1M0U A;  4V2M A;  2H0G A;  1QMV A;  4IBP A;  4PHZ C;  4MCU A;  4J57 E;  3F8U A;  4MK3 A;  1OKD A;  2GSR A;  1GRX A;  3LXZ A;  2FHE A;  5A5K A;  1ZYP A;  2H71 A;  5A4W A;  2MYG A;  1GWC A;  5IIZ A;  1M3I A;  4FIW A;  3J7Y b;  1XWG A;  2L59 A;  1RK4 A;  4ACS A;  2FY6 A;  1SL0 B;  5ECQ B;  3DIE A;  2R37 A;  3KH9 A;  2X8G A;  3Q74 A;  1TRW A;  5BMU B;  1QK8 A;  1EP8 A;  4PGT A;  4XTS A;  3IC4 A;  3RDW A;  2LST A;  3DVX A;  2H0H A;  2DJ0 A;  4QL9 A;  4Q5R A;  4FYC A;  9GSS A;  2DJK A;  3G7Y A;  3FZA A;  2OAC A;  1T4Z A;  3LW9 A;  2C8U A;  3GKN A;  1BX9 A;  5EY6 A;  5A4V A;  22GS A;  2C3T A;  1SL1 B;  4J56 E;  2VO4 A;  4PUA A;  3UEM A;  1G0T A;  3RGB C;  5KOW A;  1SK0 A;  1OE7 A;  2XPD A;  3IRA A;  1PA3 A;  1OC9 A;  2DC5 A;  1ACV A;  2YWN A;  6GSY A;  2FA4 A;  4LLR A;  1URM A;  1YF1 A;  3GH6 A;  5ECP B;  4G10 A;  2CV4 A;  2JU5 A;  5BMU A;  4DSR A;  3BCK A;  5CRE A;  2LJK A;  1U6T A;  1B4Q A;  1SD9 A;  4PQ1 A;  4L8E A;  2H8L A;  1Z6M A;  4FXY P;  2K8V A;  4YAP A;  2LRC A;  1Y25 A;  1XWC A;  1AUC A;  11GS A;  2C3Q A;  6GST A;  2H1D A;  1FAA A;  2LV3 A;  1V58 A;  1JZR A;  3KTB A;  5ABR A;  3GIX A;  2VAF A;  5ID2 B;  4EXJ A;  1G6W A;  3HJO A;  2DIZ A;  3IAS 2;  4NV5 A;  2MMN A;  3HD5 A;  5ECN B;  4ECI A;  2GQM A;  3HDC A;  2LKU A;  1B4P A;  1ZCP A;  5IPG A;  4IS0 A;  2NDO A;  4EKZ A;  2MMA A;  1BAY A;  2IN3 A;  2O36 A;  1GP1 A;  2B5X A;  1XIY A;  4XCS A;  5E4W A;  3J7Y k;  2C0E A;  3FR6 A;  2P31 A;  2CAQ A;  3QMX A;  1K0N A;  2ON5 A;  1GUM A;  2AYT A;  7GSS A;  1FG4 A;  4O7H A;  1SJI A;  3EMP A;  1GUL A;  5ID2 A;  4OO5 A;  4ECJ A;  4HUA A;  3FZ5 A;  4K9Z A;  3U6V A;  5DJM A;  3MIX A;  3LJR A;  4E8H A;  3I9V 2;  4DEJ A;  4X43 A;  5CRG A;  1CQG A;  3IHG A;  2PGT A;  1O81 A;  1YEW C;  2HSM B;  2VCW A;  2WW0 A;  4ZXG A;  4TN8 A;  1OC8 A;  3QFB C;  4IVF A;  3CMI A;  2C0D A;  4NWY A;  3FYG A;  2HI7 A;  3DML A;  1ERW A;  2H19 A;  3I43 A;  2GLR A;  4ZB9 A;  2L5L A;  4D73 B;  4OO4 A;  2MBS A;  4MJE A;  3NZN A;  3LWA A;  3HYP A;  4HQS A;  1Z5Y E;  5G5E A;  3HVV A;  3QCP A;  4WKW A;  3KGK A;  3HHV A;  2CAI A;  4IP6 A;  1H75 A;  2DJ3 A;  5GSS A;  1V40 A;  1FVK A;  2H1B A;  4I5Q A;  3JCM L;  5G30 A;  2HSM A;  13GS A;  1FO5 A;  1A0F A;  3D5J A;  4GST A;  2ZCT A;  5G1K A;  2O3E A;  4FYB A;  4KGI A;  5DQS A;  3TGZ A;  4E68 A;  2X4A A;  2L4C A;  3CTG A;  4CY8 A;  2A2R A;  3UL3 A;  3F4S A;  2O85 A;  1QGV A;  3TB2 A;  4D73 A;  4CHS A;  2CA8 A;  3L4N A;  5C00 A;  1X0R A;  2M80 A;  2XC2 A;  5KN3 A;  1A8Y A;  4GTU A;  3VI7 A;  4BA7 A;  4ZL9 A;  1ERV A;  5J9C A;  4RI7 A;  4QQ7 A;  1TRV A;  4OFM A;  5JCW A;  2DKI A;  4TR1 B;  3HJP A;  1X9M B;  3A3T A;  3BD2 A;  3TKS C;  5AN1 A;  3HA9 A;  1AW9 A;  4WR4 A;  1TTZ A;  3PGT A;  4H86 A;  3UMA A;  3AY8 A;  5JCU A;  3L78 A;  4TOP A;  5KN2 A;  4IHU A;  4NXI A;  3TJJ A;  3KCM A;  3TRP A;  2CX4 A;  3VK9 A;  4LA1 A;  4IEL A;  4OFN A;  1XOA A;  1PL1 A;  2KP1 A;  4MZW A;  3TDG A;  1SK2 A;  2V6K A;  3GKM A;  3ZIV A;  1S3D A;  5IMV A;  4NV2 A;  1A0R P;  3TKS A;  5J4Y A;  3FMW A;  2JZS A;  3QOU A;  4MP4 A;  3MNG A;  3DGQ A;  1KEB A;  2I9H A;  2B1L A;  2GTU A;  1X9S B;  1BED A;  1FB0 A;  2PER A;  3TOU A;  1NM3 A;  2LNS A;  2L5O A;  3LEF A;  4PI0 C;  2EFC A;  5GAN D;  4V2N A;  4YKG A;  3RPP A;  3IHQ A;  3EU4 A;  3A2W A;  1GSE A;  2J9H A;  4BVX B;  1DBY A;  1ZGN A;  3EMX A;  4HZ2 A;  5H5S A;  2VLV A;  5KN0 A;  1GSD A;  3EYT A;  3ED3 A;  3F6D A;  3D4M A;  5IM9 A;  3DRN A;  2OBK A;  3CBU A;  2L57 A;  4YQU A;  4WF4 A;  4I8B A;  4MF7 A;  1UC7 A;  2IFQ B;  1JLW A;  2H01 A;  2I81 A;  4N11 A;  4ILF A;  4XIH A;  12GS A;  20GS A;  3MSZ A;  5IOW A;  4XS6 A;  2FWE A;  3C8E A;  3LFL A;  1PX6 A;  3FZ4 A;  3BOA A;  4ML1 A;  1V2A A;  2ZNM A;  3ZRE A;  1RW1 A;  1AQV A;  2F51 A;  4N3Z A;  3UOM A;  3APS A;  1YEX A;  3RPN A;  1SKR B;  1M2D A;  3D22 A;  3LYK A;  5J3R A;  1YVL A;  2UV8 G;  1PD2 1;  3QFA C;  5ECL B;  3FEU A;  5FHI A;  3IA1 A;  1PMT A;  3ZIT A;  1TI1 A;  2XHF A;  3D4T A;  2IFQ A;  2YV7 A;  2IJY A;  4J2F A;  2WDU A;  5F8B A;  3LQ7 A;  2HRK B;  1S4B P;  2PVQ A;  2OE1 A;  2YWI A;  2JL4 A;  1XWB A;  4AKI A;  1QUW A;  1V98 A;  1A2J A;  4ZL7 A;  1JFU A;  3H1N A;  2VCQ A;  1J08 A;  1PFO A;  2FD3 A;  1GSY A;  2DSA A;  1FOH A;  4KA0 A;  1OC3 A;  2FLS A;  1W4V A;  3DEX A;  4TVE A;  1J9B A;  2JAD A;  3KTL A;  4I6X A;  6GSS A;  2C1Y A;  5G31 A;  2BMX A;  2H1L A;  3UBL A;  2LUS A;  3O3T A;  2B5Y A;  1QFN A;  1EOG A;  3P2A A;  3F6F A;  1S3R A;  1CQH A;  4LL1 B;  4ULX A;  4Q5Q A;  4HJM A;  3H4K A;  1YEP A;  1A2L A;  2VOC A;  3WGD A;  2EIQ A;  1Z7R A;  5DAK B;  2PMT A;  1YJ6 A;  5A34 B;  3CSH A;  3IOS A;  4GQC A;  5IPH A;  3IR4 A;  3EC3 A;  5HQP A;  3WGX A;  5LNK e;  2HE3 A;  1SKS B;  3KD0 A;  3TCO A;  1A24 A;  5EPF A;  4MJB A;  4EE0 A;  1DE1 A;  3M9K A;  1DSB A;  1WWJ A;  1TKD B;  1KTE A;  2X99 A;  1S3A A;  1G6Y A;  1Z6N A;  4JBB A;  2P5Q A;  1MDI A;  3TJK A;  1TP9 A;  2GSQ A;  1TK0 B;  1AC1 A;  3F0I A;  5A34 A;  3C1R A;  2FUG 2;  1B9Y C;  3APQ A;  1MDJ A;  2TRC P;  1LBK A;  4PXO A;  3FW2 A;  2GVP A;  3KH7 A;  3L0H A;  2G0F A;  1WE0 A;  2JZR A;  2LQO A;  4EIP A;  3UVT A;  2NTO A;  2VIM A;  2JAC A;  4AJ8 A;  3CYN A;  3D0Z A;  1XOB A;  1EZK A;  1JHB A;  2NBS A;  2WCI A;  3O76 A;  2I4A A;  3M3M A;  4JR6 A;  2H6Z A;  1AAZ A;  1T00 A;  4K2D A;  2GSS A;  2AJQ B;  2L6C A;  2IME A;  2YZU A;  2LS5 A;  4TR0 A;  1IYI A;  2E2M A;  3ERW A;  2WJU A;  2F8A A;  2H6Y A;  2IMF A;  1XBS A;  4MZB A;  5DQY A;  3ME7 A;  3KXO A;  2EIR A;  2CT6 A;  5IO0 A;  3I6A A;  5J41 A;  4WXT A;  2GQK A;  2AB6 A;  4PQI A;  2X64 A;  3W8S A;  4QMK A;  5GST A;  1ZMA A;  3GHA A;  4MMM A;  4O32 A;  4AGS A;  3HZ8 A;  3KMN A;  2K8S A;  1M2A A;  3FZ9 A;  3GL3 A;  2YV9 A;  5CYY A;  1A8L A;  1YF0 A;  2DBC A;  3VWW A;  3P7X A;  2YN1 A;  3CRT A;  2H72 A;  4IW9 A;  3LG6 A;  1TU7 A;  2H76 A;  4LL4 B;  3QD9 A;  3MDK A;  2E2G A;  16GS A;  5FT3 A;  2HYX A;  1GLQ A;  3GUR A;  1B9X C;  1ERT A;  2IWT A;  4MJA A;  4G9H A;  3VLN A;  1XW6 A;  4USS A;  1UN2 A;  4DSQ A;  5COH A;  2O8V B;  2N5F A;  2QKE A;  4KUN A;  3ZFL A;  4EL1 A;  1QXH A;  4KB3 A;  5IMZ A;  1RQM A;  4PQH A;  2DJ2 A;  2PUK C;  1SL2 B;  3PPU A;  1X5D A;  2QSI A;  3TKS E;  4TR4 A;  4CY6 A;  2GST A;  2OBI A;  1GNE A;  5HFG A;  1SD8 A;  2WVZ A;  4G0K A;  1B48 A;  2WGR A;  2WRT A;  5D9W A;  2F3M A;  3KM6 A;  3KP8 A;  4PNF A;  5CO3 A;  2HZF A;  1M9A A;  4KH7 A;  2HZE B;  3VI5 A;  3DKS A;  3IV4 A;  5JCG A;  3F4T A;  4WBR D;  4EO3 A;  2L6D A;  4ICY A;  2RLI A;  4N0V A;  2TRX A;  1JLV A;  4TXV A;  2JZT A;  4POK A;  3VUR A;  3HVN A;  3BCI A;  2UZ8 A;  3ZYW A;  2BJX A;  4HU9 A;  1U3A A;  1FB6 A;  4CW9 A;  3FKF A;  1I1I P;  2PU9 C;  5A1N B;  5F07 A;  3FRC A;  1GTI A;  4HJ2 A;  5G5F A;  3GTU B;  2X8C A;  3UBK A;  4JED A;  2H74 A;  5JWQ B;  1TJD A;  2FGX A;  4DSS B;  5J4U A;  1F3A A;  4HI7 A;  1SJ6 A;  3IDV A;  1N2A A;  5DAL B;  4YAV A;  1ZYE A;  4N30 A;  4POB A;  2HLS A;  2R6K A;  1T3B A;  1IYH A;  5J5N A;  3CXG A;  4ZB6 A;  1UVZ A;  1YZX A;  2VKZ G;  4G0L A;  4WF5 A;  1R5P A;  2HQT A;  5HR2 A;  2QC7 A;  3WT1 A;  4AI6 A;  1V9W A;  4ZBD A;  5A1N A;  2O5V A;  5HFI A;  4EUY A;  3GNJ A;  4O5R A;  2O7K A;  1T4Y A;  3DWV A;  2C3N A;  5G1L A;  1PL2 A;  2Z9S A;  4EDZ A;  3IE3 A;  4OCE A;  3G7I A;  3HVX A;  4HS1 A;  3M1G A;  6GSU A;  1SKW B;  1M7T A;  4OCF A;  1OE8 A;  2NPB A;  1YQ1 A;  4NHW A;  1XCC A;  4FO5 A;  5DAL A;  2VLU A;  3TU3 B;  4ZIJ A;  1VF4 A;  1ZOF A;  4MPF A;  5DCG A;  3UVH A;  2H30 A;  3WGE A;  2WS2 A;  1XWK A;  4OD7 A;  3SWL A;  3RHB A;  2B5E A;  1SVM A;  3PR8 A;  3NIV A;  2RII A;  3BBY A;  3TOT A;  5KEJ A;  4GLT A;  2A4V A;  1TU8 A;  1DUG A;  4MPG A;  1WRY A;  3DXB A;  3VWX A;  4X0X A;  2H1G A;  1YDK A;  4RQR A;  1Y6E A;  1HNB A;  3QAW A;  2IMI A;  4XHM A;  3CWG A;  1JZW A;  2CQ9 A;  3LOR A;  4AF2 A;  2R0G A;  4BVY B;  1X5C A;  2CZ3 A;  3GA4 A;  2H0I A;  4LMW A;  2WW2 A;  2YWO A;  4ECB A;  1GH2 A;  2EFH A;  2GDR A;  4OMV A;  2HXK A;  1KNG A;  2O89 A;  4ZBA A;  4TXO B;  3QAV A;  2KLX A;  17GS A;  3HKR A;  1N8J A;  3GX8 A;  2GT6 A;  1Z7P A;  4TR1 A;  1A23 A;  5J9B A;  5D9X A;  4W66 A;  2GZZ A;  4MJC A;  2LEG A;  4O92 A;  3CRU A;  4BL7 B;  2VM2 A;  4HSC X;  4ML6 A;  5EVO A;  1XG8 A;  1R7H A;  1PX7 A;  2WW1 A;  1G7E A;  1T1V A;  4ISD A;  1KBN A;  4YQM A;  3KMO A;  5J40 A;  1OAZ A;  4PTS A;  10GS A;  1K0C A;  1NSW A;  3TRQ A;  2A4H A;  4TXO A;  4GWR A;  4PUF C;  2YZH A;  3ZML A;  3GMF A;  4MA9 A;  1SVO A;  2VUP A;  2HNL A;  4K0N A;  1TW9 A;  2A2S A;  1GSS A;  6GSW A;  5INY A;  4ZB7 A;  2YPM A;  5HR0 A;  4NPB A;  3EPT A;  3CTF A;  3DVW A;  4GXZ A;  2LRT A;  5G2Z A;  4BL7 A;  1W89 A;  1B8X A;  1SJZ A;  2HRA A;  2AHE A;  2LJA A;  3GYK A;  5AIS A;  3WD6 A;  2LQQ A;  3D21 A;  4TW5 A;  2CVD A;  5ECO B;  4RI6 A;  4KX4 A;  1YKC A;  5DDL A;  3VPT A;  1ERU A;  1HQO A;  2IMD A;  5D96 A;  5JWR B;  2R3X A;  3EE2 A;  1U3I A;  2EC4 A;  2X49 A;  3P8W A;  4BVX A;  5DCH A;  3TJB A;  4BIK A;  3P90 A;  4K5S A;  1J0F A;  2VCV A;  4MZC A;  3TJF A;  3GST A;  2V6O A;  5CNW A;  2RUE A;  3UIW A;  1AIU A;  4F2I A;  5J4V A;  1GNW A;  1U88 A;  5B6N A;  5F0G A;  2WZS A;  4IQ1 A;  4PUR A;  2DKH A;  2YJH A;  3F3Q A;  2YCD A;  1TI3 A;  5A4U A;  3H8Q A;  3EUR A;  5GZZ B;  1M3J A;  1SK1 A;  2OE0 A;  1TXX A;  2CVK A;  1THX A;  1PKW A;  1E2Y A;  3ZFB A;  2HSH A;  4X1U A;  2ON7 A;  3N5O A;  3OR5 A;  4GF0 A;  1R26 A;  3GX0 A;  2D2Z A;  2YOI A;  5CRD A;  4V2L A;  3PIN A;  2TIR A;  1NW2 A;  2FWF A;  1ML6 A;  3WYW A;  3G7J A;  2HRK A;  5BRT A;  4YKF A;  1S3C A;  4GSN A;  1QQ2 A;  1NHO A;  2F8F A;  5EL8 A;  3ZL5 A;  3QAG A;  1TK8 B;  4G19 A;  4HOJ A;  2CX3 A; 
#chains in the Genus database with same CATH homology
 1EV9 A;  1PKZ A;  3R2Q A;  4KF9 A;  4JE1 A;  3ME8 A;  1OKT A;  2YJ7 A;  4ECC A;  4K5R A;  5D9V A;  2OKA A;  5L71 A;  2CVB A;  5HR3 A;  1I9D A;  2HRN A;  4YH2 A;  1XXU A;  2IPA A;  1T7P B;  2MBT A;  4DVC A;  1XW5 A;  1EV4 A;  1GTA A;  1TDI A;  2PPT A;  3A5W A;  4GDF A;  4I2U A;  1K0M A;  4Q5F A;  2OJL A;  3I69 A;  1K3Y A;  2PWJ A;  5DAK A;  5JWO B;  1F3B A;  4K2X A;  5C04 A;  2VLT A;  1FHE A;  2FWH A;  2V32 A;  1HNA A;  1OVN A;  5HFK A;  2MZC A;  1MTC A;  1R4W A;  4XS1 A;  2EIO A;  5IMA A;  3IAM 2;  5ECM B;  2DML A;  1BQ7 A;  2R0C A;  1Z3E A;  5ENU A;  1JZD A;  4IJ3 A;  2A2P A;  4Z2U A;  5IO2 A;  3K8N A;  1GSU A;  1VGL A;  5AGY A;  3TKP A;  5CRW A;  3RBT A;  1N25 A;  2K6V A;  4NMU A;  1PGT A;  2VCT A;  2R5G A;  3M9J A;  1MD3 A;  1VF3 A;  3S9F A;  3MYD A;  3VWV A;  1WMJ A;  2VL9 A;  1SYX A;  1ZZY A;  3VPQ A;  4FYU A;  2C0G A;  4JU5 A;  4F0C A;  1O73 A;  3L9V A;  3HCZ A;  2AAW A;  2B1K A;  5ELG A;  1OC9 B;  3KZQ A;  1O6J A;  2EFE A;  8GSS A;  2LNT A;  1BYE A;  1DE2 A;  1USB A;  3Q19 A;  19GS A;  1AQX A;  4HZ4 A;  1EP7 A;  2YWM A;  2R4V A;  5ECS A;  2B6M A;  3V1W A;  1XPV A;  1G7O A;  2V1M A;  1UA5 A;  3E3E A;  5HR1 A;  3QDN A;  4K7I A;  4V1A p;  3GKX A;  3ERF A;  4F82 A;  3HVS A;  5KOX A;  3E9J B;  5ECI B;  3H93 A;  2FA8 A;  2H70 A;  3ZVJ A;  4N0Z A;  4AKX B;  4IN0 A;  3TKQ A;  3N9J A;  2H6X A;  3C7M A;  1WOU A;  4KCA A;  4AKG A;  4HEA 2;  2M72 A;  2N5B A;  1O7U A;  5F06 A;  4KW6 A;  3F3R A;  1M2B A;  5IOX A;  4GCI A;  2HFD A;  5FWG A;  4CDO A;  1SU9 A;  4AJ7 A;  4WET A;  1X9W B;  4FH8 A;  2VD1 A;  2IMK A;  3HXS A;  2V2G A;  2H66 A;  4K7N A;  1FOV A;  1PQN A;  4E8E A;  2B7K A;  1MD4 A;  2C0F A;  3GUS A;  1XWA A;  4ZBB A;  4JZQ A;  3Q18 A;  4K6X A;  3ZMK A;  4KAE A;  2VCZ A;  1TXU A;  1XW9 A;  2N5A A;  2ZUP A;  5B8A A;  1K3O A;  2H1A A;  4OFT A;  5D9T A;  3F4R A;  4K8M A;  3WT2 A;  1XVW A;  3UJ1 A;  2ALB A;  1ABA A;  5H5R A;  3ISO A;  1EOH A;  3L9U A;  3ZTL A;  2RM6 A;  1F37 A;  4WR5 A;  5ECR B;  2B3S A;  4MNN A;  5J47 A;  2XBQ A;  2HSY A;  1PN9 A;  4HU7 A;  4RUV A;  2HZE A;  3UAP A;  1BG5 A;  1YY7 A;  3GFK A;  1WIK A;  4G0I A;  4K7O A;  1O85 A;  1E6B A;  2HT9 A;  5CAX A;  2HSN B;  3EIN A;  3TUE A;  2P5R A;  3W6G A;  3M8N A;  1TRS A;  4AKH A;  1PRX A;  1ZYQ B;  1Y1U A;  2WB9 A;  1ZL9 A;  5ECK B;  2YP6 A;  4K0G A;  1PSQ A;  2AV4 A;  2BTO T;  2F9S A;  2LRN A;  4BPY A;  1SVL A;  4PX1 A;  3GTU A;  3FR9 A;  4EC0 A;  2DIY A;  4EIQ A;  2C4J A;  1K0O A;  1SYR A;  1K0D A;  2DJJ A;  4DSS A;  4O5Q A;  4Z2R A;  3GKK A;  2P0G A;  1EGO A;  3C71 A;  2YNX A;  4L5O A;  5IMF A;  2HSN A;  1EWX A;  3KIJ A;  2PBJ A;  4V1A g;  1XVQ A;  1EEJ A;  3VFI A;  3SBC A;  4MF6 A;  4KSM A;  3F63 A;  1I5G A;  4K1F A;  4KDX A;  3GN3 A;  1LU4 A;  18GS A;  4KSO A;  2REM A;  3CSI A;  4ZL8 A;  2H75 A;  1TRU A;  2I3Y A;  3Q6O A;  2LJR A;  2KUC A;  4F9Z A;  3IPZ A;  2VM1 A;  3D6I A;  4POL A;  6GSV A;  1MEK A;  5D73 A;  1GTB A;  2VD0 A;  1AXD A;  2IL3 A;  5D8I A;  1GSQ A;  2IIY A;  2YAN A;  2O87 A;  3TJG A;  3HMJ G;  5B8B A;  3APO A;  2OE3 A;  3PH9 A;  2RUF A;  5H5Q A;  3GL5 A;  1T8E B;  3C73 A;  4KDY A;  2M46 A;  5D93 A;  4NHZ A;  2VL2 C;  4XRA A;  3EWL A;  5AIV A;  3DD3 A;  4EDY A;  1OYJ A;  5CP1 A;  2DMM A;  2GZP A;  3ZRD A;  4XS4 B;  1ON4 A;  2VCX A;  1ST9 A;  1ILO A;  4IP1 A;  3IXR A;  2WZ9 A;  5IMD A;  4LMV A;  1U87 A;  4IGJ A;  4P3Y B;  4IKH A;  3A5I A;  4FQU A;  2LTK A;  1O8W A;  2MMO A;  2OT3 A;  1GSF A;  1H4O A;  5DJL A;  5A5H B;  3FY7 A;  4MH3 A;  1JZO A;  1MDK A;  2VL2 A;  1O8X A;  4HDE A;  1GTU A;  4AJ6 A;  4NAX A;  4N10 A;  2WFC A;  3LSZ A;  2JSZ A;  3DYR A;  4F03 A;  4YQV A;  4BVY A;  5IQY A;  3FHK A;  4I97 A;  4BWS A;  1XFL A;  1HD2 A;  4L0W A;  2R0P A;  4JRR A;  3TKR A;  3A2X A;  3LGC A;  2ES7 A;  3IK7 A;  2QGV A;  1K0B A;  1EEM A;  5DBQ A;  4XS4 A;  1K0A A;  2DJ1 A;  1AQW A;  4F0B A;  2KOK A;  3ZVJ D;  3ERG A;  5ELA A;  2QA2 A;  1A2M A;  1ZYN A;  5A5H A;  3RAZ A;  1SEN A;  3GRX A;  2K9F A;  1M99 A;  2EFD A;  4PNG A;  5CRH A;  3LXT A;  4MAB A;  2GT5 A;  3HJM A;  2XPE A;  3QR6 A;  1C72 A;  2J23 A;  4TR3 A;  3W8J A;  5GAP D;  4GSS A;  3TRX A;  4Z7X A;  5F05 A;  2KHP A;  1LJR A;  3KP9 A;  4L5L A;  4MH2 A;  2E0Q A;  4KCE A;  3GH9 A;  1Z9H A;  2NVL A;  4EF0 A;  1XZO A;  3U5R E;  3H79 A;  1TK5 B;  4GQF A;  2HRF A;  3MAK A;  2E7P A;  1GL8 A;  1M9B A;  5KN1 A;  4G2E A;  3EU3 A;  2QA1 A;  1F9M A;  2C80 A;  3M0F A;  1F2E A;  4KE3 A;  2OA7 A;  2V41 A;  1X5E A;  3R3E A;  1Q98 A;  2JSY A;  4I2T A;  4MLY A;  4JR4 A;  1BJX A;  3US3 A;  4ZIL A;  3KJY A;  4Q5N A;  1GUK A;  1YKA A;  3IK9 A;  4GRF A;  3UAR A;  2AUV A;  5E59 A;  3ZZX A;  1NHY A;  4XRD A;  1K3L A;  4MF5 A;  3C1S A;  5B7C A;  4EVM A;  4HQZ A;  3LYP A;  3L9S A;  1VRS D;  2R2J A;  4IJI A;  5ECH B;  5LCZ A;  3GSS A;  1WPI A;  3E0U A;  4L0U A;  4WEY A;  4KND A;  1FW1 A;  2OAD A;  5IMC A;  1R5A A;  4QL7 A;  4ZB8 A;  4A5P A;  4BWQ A;  2PN8 A;  3A2V A;  2B7J A;  3ZIJ A;  1FVJ A;  1V57 A;  3ZLP A;  1GLP A;  1HNC A;  4WBJ A;  1BG1 A;  3HY2 A;  2WUL A;  2RM5 A;  5DVB A;  3QPM A;  5LD0 A;  2GGT A;  2GS3 A;  3VWU A;  4MDC A;  2I1U A;  4POM A;  2GZY A;  3EVI A;  2FWG A;  1HYU A;  2L4Q A;  3IBH A;  4TKY A;  2CZ2 A;  2FCH A;  2DLX A;  4IQA A;  3MWH A;  2MMZ A;  1Q4J A;  2H73 A;  1EGR A;  2G2Q A;  2KP2 A;  2XBI A;  4Z2T A;  3RHC A;  4OWY A;  2GQL A;  1PN0 A;  3G9B A;  14GS A;  4ID0 A;  1GUH A;  3CSJ A;  6GSX A;  3F9U A;  1VF1 A;  2K18 A;  4O5U A;  2X8H A;  1F6M C;  3NOF A;  5AIX A;  2PVO C;  4X4J A;  3KEB A;  3O6T A;  1BF5 A;  4KDU A;  3GV1 A;  3BJ5 A;  1WP0 A;  3IC8 A;  1VF2 A;  2FNO A;  4TRX A;  1TOF A;  1THO A;  5B6M A;  4RQX A;  3HZ4 A;  1WJK A;  3FR3 A;  3FK8 A;  4G01 A;  2VL3 A;  1M0U A;  4V2M A;  2H0G A;  1QMV A;  4IBP A;  4MCU A;  4J57 E;  3F8U A;  4MK3 A;  1OKD A;  2GSR A;  1GRX A;  3LXZ A;  2FHE A;  5A5K A;  1ZYP A;  2H71 A;  5A4W A;  2MYG A;  1GWC A;  5IIZ A;  4FIW A;  3J7Y b;  1XWG A;  2L59 A;  1RK4 A;  4ACS A;  2FY6 A;  1SL0 B;  5ECQ B;  3DIE A;  2R37 A;  3KH9 A;  2X8G A;  3Q74 A;  1TRW A;  5BMU B;  1QK8 A;  1EP8 A;  4PGT A;  4XTS A;  3IC4 A;  3RDW A;  2LST A;  3DVX A;  2H0H A;  2DJ0 A;  4QL9 A;  4Q5R A;  4FYC A;  9GSS A;  2DJK A;  3G7Y A;  3FZA A;  2OAC A;  1T4Z A;  3LW9 A;  2C8U A;  3GKN A;  1BX9 A;  5EY6 A;  5A4V A;  22GS A;  2C3T A;  1SL1 B;  4J56 E;  2VO4 A;  4PUA A;  3UEM A;  1G0T A;  5KOW A;  1SK0 A;  1OE7 A;  2XPD A;  3IRA A;  1PA3 A;  1OC9 A;  2DC5 A;  1ACV A;  2YWN A;  6GSY A;  2FA4 A;  4LLR A;  1URM A;  1YF1 A;  3GH6 A;  5ECP B;  4G10 A;  2CV4 A;  2JU5 A;  5BMU A;  4DSR A;  3BCK A;  5CRE A;  2LJK A;  1U6T A;  1B4Q A;  1SD9 A;  4PQ1 A;  4L8E A;  2H8L A;  1Z6M A;  2K8V A;  4YAP A;  2LRC A;  1Y25 A;  1XWC A;  1AUC A;  11GS A;  2C3Q A;  6GST A;  2H1D A;  1FAA A;  2LV3 A;  1V58 A;  1JZR A;  3KTB A;  5ABR A;  3GIX A;  2VAF A;  5ID2 B;  4EXJ A;  1G6W A;  3HJO A;  2DIZ A;  3IAS 2;  4NV5 A;  2MMN A;  3HD5 A;  5ECN B;  4ECI A;  2GQM A;  3HDC A;  2LKU A;  1B4P A;  1ZCP A;  5IPG A;  4IS0 A;  2NDO A;  4EKZ A;  2MMA A;  1BAY A;  2IN3 A;  1GP1 A;  2B5X A;  1XIY A;  4XCS A;  5E4W A;  3J7Y k;  2C0E A;  3FR6 A;  2P31 A;  2CAQ A;  3QMX A;  1K0N A;  2ON5 A;  1GUM A;  2AYT A;  7GSS A;  1FG4 A;  4O7H A;  1SJI A;  3EMP A;  1GUL A;  5ID2 A;  4OO5 A;  4ECJ A;  4HUA A;  3FZ5 A;  4K9Z A;  3U6V A;  5DJM A;  3MIX A;  3LJR A;  4E8H A;  3I9V 2;  4DEJ A;  4X43 A;  5CRG A;  1CQG A;  3IHG A;  2PGT A;  1O81 A;  2HSM B;  2VCW A;  4ZXG A;  4TN8 A;  1OC8 A;  3QFB C;  4IVF A;  3CMI A;  2C0D A;  4NWY A;  3FYG A;  2HI7 A;  3DML A;  1ERW A;  2H19 A;  3I43 A;  2GLR A;  4ZB9 A;  2L5L A;  4D73 B;  4OO4 A;  2MBS A;  4MJE A;  3NZN A;  3LWA A;  3HYP A;  4HQS A;  1Z5Y E;  5G5E A;  3HVV A;  3QCP A;  4WKW A;  3KGK A;  3HHV A;  2CAI A;  4IP6 A;  1H75 A;  2DJ3 A;  5GSS A;  1V40 A;  1FVK A;  2H1B A;  4I5Q A;  3JCM L;  5G30 A;  2HSM A;  13GS A;  1FO5 A;  1A0F A;  3D5J A;  4GST A;  2ZCT A;  5G1K A;  4FYB A;  4KGI A;  5DQS A;  3TGZ A;  4E68 A;  2X4A A;  2L4C A;  3CTG A;  4CY8 A;  2A2R A;  3UL3 A;  3F4S A;  2O85 A;  1QGV A;  3TB2 A;  4D73 A;  4CHS A;  2CA8 A;  3L4N A;  5C00 A;  1X0R A;  2M80 A;  2XC2 A;  5KN3 A;  1A8Y A;  4GTU A;  3VI7 A;  4BA7 A;  4ZL9 A;  1ERV A;  5J9C A;  4RI7 A;  4QQ7 A;  1TRV A;  4OFM A;  5JCW A;  2DKI A;  4TR1 B;  3HJP A;  1X9M B;  3A3T A;  3BD2 A;  3TKS C;  5AN1 A;  3HA9 A;  1AW9 A;  4WR4 A;  1TTZ A;  3PGT A;  4H86 A;  3UMA A;  3AY8 A;  5JCU A;  3L78 A;  4TOP A;  5KN2 A;  4IHU A;  4NXI A;  3TJJ A;  3KCM A;  3TRP A;  2CX4 A;  3VK9 A;  4LA1 A;  4IEL A;  4OFN A;  1XOA A;  1PL1 A;  2KP1 A;  4MZW A;  3TDG A;  1SK2 A;  2V6K A;  3GKM A;  3ZIV A;  1S3D A;  5IMV A;  4NV2 A;  1A0R P;  3TKS A;  5J4Y A;  3FMW A;  2JZS A;  3QOU A;  4MP4 A;  3MNG A;  3DGQ A;  1KEB A;  2I9H A;  2B1L A;  2GTU A;  1X9S B;  1BED A;  1FB0 A;  2PER A;  3TOU A;  1NM3 A;  2LNS A;  2L5O A;  3LEF A;  2EFC A;  5GAN D;  4V2N A;  4YKG A;  3RPP A;  3IHQ A;  3EU4 A;  3A2W A;  1GSE A;  2J9H A;  4BVX B;  1DBY A;  1ZGN A;  3EMX A;  4HZ2 A;  5H5S A;  2VLV A;  5KN0 A;  1GSD A;  3EYT A;  3ED3 A;  3F6D A;  3D4M A;  5IM9 A;  3DRN A;  2OBK A;  3CBU A;  2L57 A;  4YQU A;  4WF4 A;  4I8B A;  4MF7 A;  1UC7 A;  2IFQ B;  1JLW A;  2H01 A;  2I81 A;  4N11 A;  4ILF A;  4XIH A;  12GS A;  20GS A;  3MSZ A;  5IOW A;  4XS6 A;  2FWE A;  3C8E A;  3LFL A;  1PX6 A;  3FZ4 A;  3BOA A;  4ML1 A;  1V2A A;  2ZNM A;  3ZRE A;  1RW1 A;  1AQV A;  2F51 A;  4N3Z A;  3UOM A;  3APS A;  1YEX A;  3RPN A;  1SKR B;  1M2D A;  3D22 A;  3LYK A;  5J3R A;  1YVL A;  2UV8 G;  1PD2 1;  3QFA C;  5ECL B;  3FEU A;  5FHI A;  3IA1 A;  1PMT A;  3ZIT A;  1TI1 A;  2XHF A;  3D4T A;  2IFQ A;  2YV7 A;  2IJY A;  4J2F A;  2WDU A;  5F8B A;  3LQ7 A;  2HRK B;  2PVQ A;  2OE1 A;  2YWI A;  2JL4 A;  1XWB A;  4AKI A;  1QUW A;  1V98 A;  1A2J A;  4ZL7 A;  1JFU A;  3H1N A;  2VCQ A;  1J08 A;  2FD3 A;  1GSY A;  2DSA A;  1FOH A;  4KA0 A;  1OC3 A;  2FLS A;  1W4V A;  3DEX A;  4TVE A;  1J9B A;  2JAD A;  3KTL A;  4I6X A;  6GSS A;  2C1Y A;  5G31 A;  2BMX A;  2H1L A;  3UBL A;  2LUS A;  3O3T A;  2B5Y A;  1QFN A;  1EOG A;  3P2A A;  3F6F A;  1CQH A;  4LL1 B;  4ULX A;  4Q5Q A;  4HJM A;  3H4K A;  1YEP A;  1A2L A;  2VOC A;  3WGD A;  2EIQ A;  1Z7R A;  5DAK B;  2PMT A;  1YJ6 A;  5A34 B;  3CSH A;  3IOS A;  4GQC A;  5IPH A;  3IR4 A;  3EC3 A;  5HQP A;  3WGX A;  5LNK e;  2HE3 A;  1SKS B;  3KD0 A;  3TCO A;  1A24 A;  5EPF A;  4MJB A;  4EE0 A;  1DE1 A;  3M9K A;  1DSB A;  1WWJ A;  1TKD B;  1KTE A;  2X99 A;  1S3A A;  1G6Y A;  1Z6N A;  4JBB A;  2P5Q A;  1MDI A;  3TJK A;  1TP9 A;  2GSQ A;  1TK0 B;  1AC1 A;  3F0I A;  5A34 A;  3C1R A;  2FUG 2;  1B9Y C;  3APQ A;  1MDJ A;  2TRC P;  1LBK A;  4PXO A;  3FW2 A;  2GVP A;  3KH7 A;  3L0H A;  2G0F A;  1WE0 A;  2JZR A;  2LQO A;  4EIP A;  3UVT A;  2NTO A;  2VIM A;  2JAC A;  4AJ8 A;  3CYN A;  3D0Z A;  1XOB A;  1EZK A;  1JHB A;  2NBS A;  2WCI A;  3O76 A;  2I4A A;  3M3M A;  4JR6 A;  2H6Z A;  1AAZ A;  1T00 A;  4K2D A;  2GSS A;  2AJQ B;  2L6C A;  2IME A;  2YZU A;  2LS5 A;  4TR0 A;  1IYI A;  2E2M A;  3ERW A;  2WJU A;  2F8A A;  2H6Y A;  2IMF A;  1XBS A;  4MZB A;  5DQY A;  3ME7 A;  3KXO A;  2EIR A;  2CT6 A;  5IO0 A;  3I6A A;  5J41 A;  4WXT A;  2GQK A;  2AB6 A;  4PQI A;  2X64 A;  3W8S A;  4QMK A;  5GST A;  1ZMA A;  3GHA A;  4MMM A;  4O32 A;  4AGS A;  3HZ8 A;  3KMN A;  2K8S A;  1M2A A;  3FZ9 A;  3GL3 A;  2YV9 A;  5CYY A;  1A8L A;  1YF0 A;  2DBC A;  3VWW A;  3P7X A;  2YN1 A;  3CRT A;  2H72 A;  4IW9 A;  3LG6 A;  1TU7 A;  2H76 A;  4LL4 B;  3QD9 A;  3MDK A;  2E2G A;  16GS A;  5FT3 A;  2HYX A;  1GLQ A;  3GUR A;  1B9X C;  1ERT A;  2IWT A;  4MJA A;  4G9H A;  3VLN A;  1XW6 A;  4USS A;  1UN2 A;  4DSQ A;  5COH A;  2O8V B;  2N5F A;  2QKE A;  4KUN A;  3ZFL A;  4EL1 A;  1QXH A;  4KB3 A;  5IMZ A;  1RQM A;  4PQH A;  2DJ2 A;  2PUK C;  1SL2 B;  3PPU A;  1X5D A;  2QSI A;  3TKS E;  4TR4 A;  4CY6 A;  2GST A;  2OBI A;  1GNE A;  5HFG A;  1SD8 A;  4G0K A;  1B48 A;  2WGR A;  2WRT A;  5D9W A;  2F3M A;  3KM6 A;  3KP8 A;  4PNF A;  5CO3 A;  2HZF A;  1M9A A;  4KH7 A;  2HZE B;  3VI5 A;  3DKS A;  3IV4 A;  5JCG A;  3F4T A;  4WBR D;  4EO3 A;  2L6D A;  4ICY A;  2RLI A;  4N0V A;  2TRX A;  1JLV A;  4TXV A;  2JZT A;  4POK A;  3VUR A;  3BCI A;  2UZ8 A;  3ZYW A;  2BJX A;  4HU9 A;  1U3A A;  1FB6 A;  4CW9 A;  3FKF A;  2PU9 C;  5A1N B;  5F07 A;  3FRC A;  1GTI A;  4HJ2 A;  5G5F A;  3GTU B;  2X8C A;  3UBK A;  4JED A;  2H74 A;  5JWQ B;  1TJD A;  2FGX A;  4DSS B;  5J4U A;  1F3A A;  4HI7 A;  1SJ6 A;  3IDV A;  1N2A A;  5DAL B;  4YAV A;  1ZYE A;  4N30 A;  4POB A;  2HLS A;  2R6K A;  1T3B A;  1IYH A;  5J5N A;  3CXG A;  4ZB6 A;  1UVZ A;  1YZX A;  2VKZ G;  4G0L A;  4WF5 A;  1R5P A;  2HQT A;  5HR2 A;  2QC7 A;  3WT1 A;  4AI6 A;  1V9W A;  4ZBD A;  5A1N A;  2O5V A;  5HFI A;  4EUY A;  3GNJ A;  4O5R A;  2O7K A;  1T4Y A;  3DWV A;  2C3N A;  5G1L A;  1PL2 A;  2Z9S A;  4EDZ A;  3IE3 A;  4OCE A;  3G7I A;  3HVX A;  4HS1 A;  3M1G A;  6GSU A;  1SKW B;  1M7T A;  4OCF A;  1OE8 A;  2NPB A;  1YQ1 A;  4NHW A;  1XCC A;  4FO5 A;  5DAL A;  2VLU A;  3TU3 B;  4ZIJ A;  1VF4 A;  1ZOF A;  4MPF A;  5DCG A;  3UVH A;  2H30 A;  3WGE A;  2WS2 A;  1XWK A;  4OD7 A;  3SWL A;  3RHB A;  2B5E A;  1SVM A;  3PR8 A;  3NIV A;  2RII A;  3BBY A;  3TOT A;  5KEJ A;  4GLT A;  2A4V A;  1TU8 A;  1DUG A;  4MPG A;  1WRY A;  3DXB A;  3VWX A;  4X0X A;  2H1G A;  1YDK A;  4RQR A;  1Y6E A;  1HNB A;  3QAW A;  2IMI A;  4XHM A;  3CWG A;  1JZW A;  2CQ9 A;  3LOR A;  4AF2 A;  2R0G A;  4BVY B;  1X5C A;  2CZ3 A;  3GA4 A;  2H0I A;  4LMW A;  2YWO A;  4ECB A;  1GH2 A;  2EFH A;  2GDR A;  4OMV A;  2HXK A;  1KNG A;  2O89 A;  4ZBA A;  4TXO B;  3QAV A;  2KLX A;  17GS A;  3HKR A;  1N8J A;  3GX8 A;  2GT6 A;  1Z7P A;  4TR1 A;  1A23 A;  5J9B A;  5D9X A;  4W66 A;  2GZZ A;  4MJC A;  2LEG A;  4O92 A;  3CRU A;  4BL7 B;  2VM2 A;  4ML6 A;  5EVO A;  1R7H A;  1PX7 A;  1G7E A;  1T1V A;  4ISD A;  1KBN A;  4YQM A;  3KMO A;  5J40 A;  1OAZ A;  4PTS A;  10GS A;  1K0C A;  1NSW A;  3TRQ A;  2A4H A;  4TXO A;  4GWR A;  4PUF C;  2YZH A;  3ZML A;  3GMF A;  4MA9 A;  1SVO A;  2VUP A;  2HNL A;  4K0N A;  1TW9 A;  2A2S A;  1GSS A;  6GSW A;  5INY A;  4ZB7 A;  2YPM A;  5HR0 A;  4NPB A;  3EPT A;  3CTF A;  3DVW A;  4GXZ A;  2LRT A;  5G2Z A;  4BL7 A;  1W89 A;  1B8X A;  1SJZ A;  2HRA A;  2AHE A;  2LJA A;  3GYK A;  5AIS A;  3WD6 A;  2LQQ A;  3D21 A;  4TW5 A;  2CVD A;  5ECO B;  4RI6 A;  4KX4 A;  1YKC A;  5DDL A;  3VPT A;  1ERU A;  1HQO A;  2IMD A;  5D96 A;  5JWR B;  2R3X A;  3EE2 A;  1U3I A;  2EC4 A;  2X49 A;  3P8W A;  4BVX A;  5DCH A;  3TJB A;  3P90 A;  4K5S A;  1J0F A;  2VCV A;  4MZC A;  3TJF A;  3GST A;  2V6O A;  5CNW A;  2RUE A;  3UIW A;  1AIU A;  4F2I A;  5J4V A;  1GNW A;  1U88 A;  5B6N A;  5F0G A;  4IQ1 A;  4PUR A;  2DKH A;  2YJH A;  3F3Q A;  2YCD A;  1TI3 A;  5A4U A;  3H8Q A;  3EUR A;  5GZZ B;  1SK1 A;  2OE0 A;  1TXX A;  2CVK A;  1THX A;  1PKW A;  1E2Y A;  3ZFB A;  2HSH A;  4X1U A;  2ON7 A;  3N5O A;  3OR5 A;  4GF0 A;  1R26 A;  3GX0 A;  2D2Z A;  2YOI A;  5CRD A;  4V2L A;  3PIN A;  2TIR A;  1NW2 A;  2FWF A;  1ML6 A;  3WYW A;  3G7J A;  2HRK A;  5BRT A;  4YKF A;  1S3C A;  4GSN A;  1QQ2 A;  1NHO A;  2F8F A;  5EL8 A;  3ZL5 A;  3QAG A;  1TK8 B;  4G19 A;  4HOJ A;  2CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...