5ECIB

Crystal structure of fin219-fip1 complex with ja, atp and mg
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 62
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5eciB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5eciB01
3GL3A 3RAZA 4EVMA 2GGTA 1ACVA 3Q74A 4PQ1A 4ID0A 2RUFA 4OFNA 3GV1A 4KA0A 4Q5NA 1G7EA 3EURA 1ON4A 1T1VA 3KM6A 3R3EA 1YY7A 2A2SA 1UA5A 2H1GA 1G6WA 2XC2A 3GH9A 3M9KA 4PX1A 5CRDA 4BWQA 2VM1A 4GQFA 2MMOA 1A2JA 4Z7XA 5D9XA 1JLVA 5ECSA 1JZRA 2H74A 5HR2A 4ECIA 1B9XC 5H5RA 3D0ZA 3QD9A 3GNJA 3D5JA 2G2QA 4PUFC 3APSA 5GZZB 2H76A 1B48A 1GL8A 5DVBA 5EVOA 1TK0B 4BVYA 2QGVA 2JSYA 5J9CA 2WS2A 2PBJA 4G0IA 1BYEA 1GSUA 2JU5A 2ALBA 1SKSB 2X99A 3GKNA 2HZFA 2MMAA 4IP1A 1PMTA 5G5FA 4MMMA 2LUSA 1JFUA 3IE3A 1PN9A 4TXOA 4ZB6A 5ECIB 5F8BA 2TIRA 1FHEA 5ECQB 2IMFA 5ABRA 1IYHA 3LWAA 4TR0A 1CQHA 2LEGA 5ECPB 4F03A 1Y25A 3M9JA 3NIVA 1TU8A 3TGZA 1B4QA 3ZLPA 2LJRA 1DSBA 5JWOB 1XW6A 2CV4A 2JZTA 1UN2A 2H6ZA 4KSMA 3LQ7A 1KEBA 2ZNMA 4RI7A 1YEPA 2L5LA 5CRGA 3HVSA 2YWIA 5C00A 5D96A 4IP6A 1K0DA 2ON7A 3P8WA 2OA7A 1UC7A 2A4VA 1R26A 2R5GA 1OKDA 4RUVA 2H0IA 4IELA 1GTUA 1Z6MA 5HQPA 1V98A 3EE2A 1K3OA 3QOUA 4EC0A 1Z6NA 1X0RA 4HDEA 2YNXA 1GRXA 5JWRB 3GL5A 1HD2A 2R2JA 2YANA 1F3AA 5DBQA 4BPYA 2B1LA 5ELGA 4GQCA 12GSA 3GA4A 1ERUA 1CQGA 5KN0A 3GTUB 4POLA 3DRNA 5ECNB 2VIMA 3UBLA 2P5QA 5CO3A 1J9BA 2OE0A 2B6MA 4WEYA 4NWYA 1PKWA 3F3QA 3ISOA 3GURA 1S3CA 2HRKB 1SU9A 1MTCA 1FVJA 2MMNA 4ZB9A 1QUWA 1GUKA 5JCUA 4ACSA 2L5OA 2QSIA 2EIQA 5GSTA 3GIXA 4IKHA 1XWGA 2B5XA 2MYGA 1PD21 3EINA 1YDKA 4K0NA 3TOTA 3FZ5A 3GRXA 2HFDA 1GSQA 3KP9A 1VF1A 3QMXA 3H1NA 3G7IA 5IMCA 3VI5A 1PRXA 4USSA 4BVXB 3F4SA 3BCIA 3A3TA 1PQNA 4AJ7A 4CDOA 1FOVA 1K0NA 1GLPA 2YP6A 2H73A 2A2RA 1ZMAA 3VPTA 1R7HA 2WFCA 1TRWA 2M46A 2YV7A 1BG5A 1OC9B 5FHIA 3F6FA 1BX9A 2K8VA 1O6JA 1B9YC 4E8HA 2VCXA 5B7CA 1AUCA 2HRAA 3UAPA 1TI3A 1YKCA 1M9BA 5IM9A 3W8SA 1H4OA 1SL0B 2PVOC 3LFLA 1U6TA 4XIHA 1W4VA 3LSZA 5B8AA 2KUCA 1ERTA 4N0VA 2C80A 1HNBA 3A5WA 3TJBA 2RM6A 2GLRA 1NHOA 4KCAA 5EPFA 3ERFA 2HQTA 2VL2C 1SENA 4V2NA 1YQ1A 3A2WA 4ECCA 2C0DA 1JZOA 4HQSA 4WETA 5E4WA 1M2BA 4IW9A 4PQHA 5ID2A 4MCUA 2C4JA 2DIYA 2H30A 3HZ4A 4MJAA 1XOAA 2X8CA 4EUYA 1EP7A 5F06A 4F0BA 3QFBC 1WRYA 4XCSA 2CZ2A 3ERWA 4K2DA 3LXZA 2LSTA 1GLQA 4EL1A 2LQQA 1XWBA 1NM3A 3FEUA 3ZYWA 2PVQA 4ZL8A 3C8EA 5KEJA 1TRVA 1YJ6A 2CVKA 1VGLA 1Z9HA 1EEMA 4J57E 3ME8A 1T3BA 3S9FA 1N2AA 13GSA 4ISDA 4MK3A 2IMEA 2DJJA 3AY8A 1A8YA 1ZL9A 5B8BA 4XRAA 3LORA 3VWXA 4BL7A 2FA8A 3C71A 2X8GA 1A2LA 1J0FA 2OJLA 3EU3A 4TKYA 2WGRA 2CX3A 1SL1B 4GLTA 3R2QA 2REMA 4LA1A 2VCVA 4JBBA 4KE3A 5INYA 2V6KA 4RQXA 4PURA 3CTGA 5FWGA 4V1Ag 1H75A 2J9HA 2C0EA 3I69A 4DSQA 4MPGA 2OE3A 1M2DA 4IJIA 3EMXA 2H1DA 2DIZA 3HVXA 2IFQB 1QGVA 5HR3A 1DE2A 2F51A 4TOPA 2M72A 3GUSA 1XWCA 3UARA 3IA1A 3ZTLA 3IXRA 1IYIA 2GQMA 2LJAA 2LV3A 4ZL9A 3F9UA 5J9BA 2C0FA 1F3BA 3FHKA 3TRQA 1VF4A 3CRTA 1XWKA 4FIWA 1G7OA 2ZCTA 4OO4A 1PKZA 3KJYA 4K6XA 3UEMA 2FLSA 4IQAA 2B7JA 2RLIA 4O92A 3N9JA 1U88A 1THXA 1R5PA 4IBPA 4RI6A 4WF4A 1ZOFA 3D21A 1JZDA 5J4UA 4HZ4A 2QKEA 1AAZA 5H5QA 1A0RP 1TTZA 1AW9A 4GSNA 4L5LA 5DAKB 3EMPA 3QR6A 5H5SA 3TJJA 17GSA 3L9SA 3IC4A 4NHWA 1EEJA 1SKWB 2IPAA 2N5AA 3EU4A 3L78A 2WULA 4KDUA 2XPDA 1ZYQB 4O7HA 4X1UA 3PR8A 1GNEA 2H70A 2HI7A 2DSAA 4HS1A 5COHA 1O8WA 4GTUA 2WRTA 3ME7A 4O32A 1GSFA 3HJMA 1TOFA 2DMLA 4V2MA 2HSMB 3W8JA 4EF0A 3CSJA 4G2EA 4ZXGA 2VCZA 2V1MA 2G0FA 4G19A 3C7MA 4MJBA 2D2ZA 5J5NA 5ENUA 4WR5A 3Q6OA 2H0HA 4F2IA 3IRAA 2LJKA 4OFMA 2VLTA 4H86A 2HRKA 4TR1B 4DEJA 5IMVA 4G10A 2XPEA 3DEXA 3P2AA 2EIOA 1EGRA 4Q5FA 4N0ZA 3FRCA 2UZ8A 1ZZYA 3E9JB 2IMIA 19GSA 5G1KA 2C1YA 1QMVA 2GS3A 20GSA 1XOBA 3GX8A 4K1FA 2VOCA 3HYPA 4DSSB 3TRXA 1G0TA 2BJXA 1V2AA 2H6XA 1NHYA 2L57A 3KH7A 4D73B 3UOMA 1N8JA 3ZRDA 3FZAA 3M3MA 2N5FA 1MDKA 4DVCA 2PU9C 3LYKA 4OCEA 3MWHA 5IO0A 5AISA 1T8EB 1OC9A 2IJYA 3M1GA 3GMFA 1XBSA 4XS4B 4HZ2A 4YQMA 3DVWA 3I6AA 2H66A 2PMTA 1B4PA 2X8HA 1YF1A 2PGTA 5D8IA 3F4TA 1OC3A 2FWGA 1U3IA 2LRNA 3CSIA 4ECJA 3ZL5A 1M7TA 4FYBA 3RPNA 3HCZA 4HU7A 4MP4A 2I3YA 6GSSA 3WGXA 1MD3A 1ERVA 3ZIVA 3KEBA 3QPMA 3IDVA 3GHAA 1NW2A 2KOKA 5IPHA 5DJMA 5G2ZA 2I9HA 1K0AA 2V32A 1PX7A 1TK5B 4N11A 1DBYA 1SL2B 3MDKA 3GN3A 3WT2A 4Q5QA 1C72A 2CAIA 1R4WA 2P31A 2NVLA 3P90A 3LGCA 2LQOA 1XFLA 3FZ4A 2CZ3A 2E2GA 1URMA 1AC1A 4EO3A 1SD8A 3VLNA 6GSWA 1WMJA 4KDXA 14GSA 1MD4A 1GTAA 3DWVA 1EV4A 3DD3A 5IPGA 1TXXA 1XW9A 5G5EA 3ZZXA 1K0OA 1M99A 3H79A 2VD1A 5DQYA 3DXBA 4ZBAA 1OE8A 1O7UA 1M9AA 1G6YA 4ZL7A 1GSSA 5ECHB 3WD6A 1O73A 1K0BA 3HJPA 10GSA 2O89A 3HY2A 2H0GA 3K8NA 1F6MC 4BWSA 3ZFLA 3TDGA 3RPPA 4OD7A 2OBKA 1SK2A 1K3YA 4WR4A 2ZUPA 3F0IA 4L5OA 2O85A 5AIVA 5CRHA 3UVTA 4G0KA 2F9SA 3HJOA 1ST9A 5AIXA 1UVZA 5J41A 2KHPA 3U6VA 4ZBBA 3TRPA 4GSSA 1LU4A 2VAFA 3HD5A 1GUMA 4LL1B 2HZEA 2NPBA 1V9WA 3UVHA 4G0LA 2R6KA 3APQA 1K0CA 3FY7A 4KB3A 2L4QA 4GSTA 4LMWA 4TN8A 3QDNA 2LS5A 3HKRA 2IMKA 3US3A 5ECKB 1FW1A 4XS6A 4JR4A 5IMFA 4KUNA 3VFIA 2BTOT 1F9MA 3F8UA 3GFKA 4X0XA 5GAPD 5G1LA 3IC8A 4HJ2A 1FG4A 5J3RA 2FGXA 2H72A 2PN8A 4OCFA 5DCHA 4NPBA 4NAXA 4TRXA 1MDIA 1PGTA 5D73A 4BVYB 4OMVA 1DE1A 1EP8A 1Q98A 2B5EA 2HXKA 1DUGA 4YQVA 3C73A 2WDUA 1SK1A 2YV9A 2CT6A 5HFKA 4TXOB 4KDYA 3D4TA 1ZYEA 3KP8A 3KXOA 1WIKA 2GSTA 5CRWA 16GSA 4NXIA 4K8MA 2HSMA 2AHEA 3HXSA 3HZ8A 5B6MA 2HRFA 3C1RA 3MNGA 4K7OA 1SJ6A 2F3MA 2H19A 4JU5A 4JE1A 5GSSA 1FVKA 3IR4A 4FYUA 5G30A 3CTFA 2AAWA 3HVVA 3ZVJA 2GZPA 2YN1A 1GTIA 2YWOA 3HHVA 4IJ3A 4FO5A 4TR1A 3PGTA 4WF5A 3H93A 4ILFA 4DSRA 5B6NA 1WP0A 1VRSD 1Z7RA 4I2UA 1QQ2A 2YPMA 1E6BA 4N30A 5BMUA 2CA8A 4GCIA 3I9V2 3MAKA 4PUAA 5DQSA 3IAM2 4WKWA 2LKUA 2VL3A 3J7Yb 1A2MA 5AGYA 3IPZA 3KH9A 2NTOA 2HSHA 3O3TA 3BBYA 1X5DA 2VCQA 1OVNA 3TKSA 2IN3A 4POKA 4HJMA 3CMIA 2B1KA 4JZQA 2N5BA 5C04A 1LBKA 4LMVA 1S3AA 3FK8A 2H6YA 4PTSA 5IQYA 2R37A 2PERA 1XVWA 2B7KA 3TKPA 1HYUA 4POBA 3CSHA 3OR5A 2GSRA 4EKZA 2GTUA 3KD0A 2GDRA 4PNGA 3DIEA 2LRCA 1V58A 3GYKA 4HU9A 22GSA 3LG6A 4KGIA 2KLXA 4MLYA 4NV5A 2ES7A 1AXDA 5JCGA 3LYPA 4ZIJA 3ZREA 1SYRA 1Z5YE 5KN3A 2KP1A 2DBCA 2OADA 3A2VA 1OKTA 3BOAA 3VWUA 1F2EA 1FO5A 2H1AA 5HR0A 1O8XA 1XIYA 1Q4JA 4F82A 3TOUA 2O87A 2B5YA 2GZZA 2L6CA 4PGTA 1K0MA 5A4VA 5IMDA 1RK4A 1B8XA 2JL4A 5DCGA 2H8LA 3BCKA 4X43A 1GH2A 2C8UA 3VI7A 1WE0A 1HNCA 4JEDA 5F07A 2VM2A 3FZ9A 8GSSA 1LJRA 1KTEA 2IWTA 3I43A 2PUKC 4TXVA 4GWRA 5L71A 3CRUA 1M0UA 4EE0A 1GSEA 3GKKA 3FYGA 1SD9A 2VUPA 4N10A 1XZOA 4BA7A 3LEFA 2PWJA 4TVEA 3E0UA 4IN0A 1T7PB 5AN1A 3L9UA 3L4NA 1SJIA 1XPVA 1AQWA 4KCEA 3GTUA 1X5CA 3FW2A 1S3DA 2HLSA 1K3LA 4OWYA 4F0CA 4PXOA 3ED3A 1MDJA 1BEDA 4I6XA 7GSSA 2DC5A 4LLRA 3ZIJA 2MBSA 4OFTA 2R4VA 1WJKA 3JCML 4KF9A 5ECRB 4I5QA 1JLWA 3M8NA 3M0FA 4KH7A 3APOA 3G9BA 3WGEA 1GUHA 4MH2A 2X64A 5E59A 2AV4A 2ON5A 2DJKA 2XBIA 5ID2B 4AJ8A 2H01A 1TJDA 1GULA 4HQZA 5GAND 3BD2A 3GKXA 3TKQA 2B3SA 1EV9A 4IGJA 2VCWA 4BVXA 1TW9A 2I1UA 4EDYA 2FY6A 1EOGA 3RHBA 1EGOA 4CHSA 1QFNA 1XCCA 4V1Ap 3LJRA 2HRNA 3RHCA 3F3RA 5D9WA 4PQIA 3NZNA 2F8AA 1PL2A 4K7IA 2HYXA 2O8VB 3W6GA 5A4UA 2XHFA 1XXUA 2H71A 4MZCA 4BL7B 3D6IA 4HUAA 1TDIA 2GVPA 2GSSA 2IL3A 1Z3EA 3UL3A 2OBIA 1TRUA 1TRSA 2FWFA 1AQXA 2HNLA 3TKSC 2L59A 3TJKA 4ML6A 5DALB 2LRTA 3GSSA 2CQ9A 2IMDA 1PSQA 5D93A 1THOA 4AGSA 2JACA 5KN1A 3TJFA 3SWLA 4NV2A 4POMA 2VL2A 4TR3A 1OAZA 3QCPA 2YZHA 2FWEA 3ZITA 3DVXA 2FNOA 5EL8A 5LD0A 3VPQA 5LCZA 1MEKA 2VLUA 2GT5A 2L4CA 3KTBA 6GSYA 1USBA 4QL9A 5CP1A 1YEXA 1X5EA 3LXTA 5EY6A 2AYTA 2CAQA 2MZCA 2K6VA 4QL7A 1GNWA 2E2MA 1WWJA 3EWLA 3D22A 1Y6EA 4L0UA 4I97A 1WOUA 3G7YA 3IK9A 4WBRD 1M2AA 4JRRA 4KSOA 2RIIA 3KTLA 2TRCP 4GF0A 1V57A 2J23A 1ZGNA 2C3QA 2DJ0A 3UJ1A 2HT9A 3CYNA 2FA4A 2WB9A 1EZKA 3CXGA 9GSSA 4I8BA 5DDLA 2KP2A 4MF7A 1AIUA 1XVQA 1A23A 1O85A 3MSZA 1GP1A 3ZVJD 3IBHA 6GSVA 2V6OA 3QAVA 5D9TA 2YJ7A 2AB6A 5IOXA 2JADA 4NHZA 1I9DA 1TK8B 3FR3A 4WXTA 1JHBA 4MZWA 1GSYA 1BAYA 4K9ZA 1SYXA 4GRFA 2EC4A 4YAPA 1HQOA 3KZQA 2CX4A 2RUEA 4IHUA 6GSTA 1GSDA 2Z9SA 4IQ1A 2FUG2 2LNSA 1HNAA 5ECOB 1NSWA 1ILOA 1T4ZA 4FH8A 5G31A 2H75A 4J2FA 3KCMA 3TJGA 3V1WA 1TP9A 3L9VA 2YCDA 3VK9A 4XHMA 6GSUA 5HFGA 4Q5RA 2IFQA 1SKRB 2JZSA 3A2XA 2OE1A 4YQUA 1E2YA 5HFIA 3HDCA 3TUEA 1R5AA 4KW6A 5IO2A 1J08A 2K18A 3ZMLA 3ZFBA 1VF3A 2DLXA 3VWVA 4KAEA 1ZCPA 1PX6A 3C1SA 4I2TA 4EXJA 2JSZA 1KNGA 4XS1A 2CVBA 1XW5A 2P5RA 5F0GA 3PPUA 3HA9A 2NBSA 2IIYA 1TKDB 1GTBA 1A0FA 1QXHA 1RQMA 4OO5A 2MBTA 2HSNB 1V40A 3KIJA 3TB2A 3GKMA 4KNDA 1OE7A 5DAKA 5A4WA 1YF0A 3U5RE 3D4MA 5F05A 3UIWA 1KBNA 3Q19A 2E7PA 4ZILA 4PNFA 3IAS2 4YAVA 4K0GA 2VD0A 2E0QA 3IOSA 1X9SB 4ZBDA 4NMUA 3TKSE 2OKAA 6GSXA 2GT6A 3EYTA 4RQRA 2R3XA 3EVIA 4IS0A 3G7JA 2YOIA 2RM5A 5ECLB 2DJ1A 2HE3A 3H8QA 2GQKA 2EIRA 2NDOA 5IMAA 3H4KA 1I5GA 4XRDA 3QAWA 1SJZA 1A8LA 4ULXA 2V2GA 4HOJA 3F6DA 1GWCA 4FYCA 1SK0A 1X9MB 1Z7PA 1AQVA 2YZUA 2WZ9A 3E3EA 4HI7A 3KMNA 3UMAA 1A24A 5CYYA 3RDWA 4ML1A 1VF2A 3VWWA 3DKSA 2GSQA 5LNKe 1OC8A 3FR6A 4IVFA 4DSSA 3BJ5A 2LNTA 4MDCA 2I81A 4D73A 3L0HA 2YWMA 3ZMKA 4WBJA 5IIZA 5KN2A 2GZYA 3F63A 1O81A 5JCWA 3N5OA 2DMMA 3GX0A 5IMZA 4JR6A 2F8FA 3EC3A 2QC7A 4YH2A 4F9ZA 4XS4A 1QK8A 2FWHA 3NOFA 3FR9A 2YJHA 4MA9A 4MF6A 1XWAA 1T00A 1WPIA 5CREA 2FCHA 3ERGA 2JZRA 4GXZA 4MF5A 2FHEA 2C3TA 5IOWA 4ZB8A 4P3YB 4MZBA 5CNWA 18GSA 3WT1A 4TW5A 4FQUA 5D9VA 4K7NA 2WJUA 2VO4A 1X9WB 5DALA 1W89A 2YWNA 4J56E 1FB0A 3TKRA 3O6TA 2OACA 3Q18A 2M80A 2I4AA 3QAGA 4MH3A 3PINA 1ABAA 3FKFA 4XTSA 4HEA2 4MJEA 2P0GA 5ELAA 2HZEB 4MPFA 3F4RA 2V41A 1EOHA 3RBTA 3WYWA 1F37A 3KMOA 3IHQA 2TRXA 3VURA 1BJXA 4G9HA 3DGQA 2VL9A 1EWXA 3PH9A 3GSTA 4E8EA 3KGKA 2WCIA 3DYRA 11GSA 4L0WA 3IK7A 2K8SA 2AUVA 2FD3A 4KX4A 4LL4B 5DJLA 2CVDA 1RW1A 5A5KA 2H1BA 2LTKA 2C3NA 2O7KA 1FAAA 5ECMB 1U87A 2DJ3A 2GQLA 1OYJA 3J7Yk 4ECBA 1ERWA 4QQ7A 2VCTA 1JZWA 3WGDA 2C0GA 3QFAC 3CBUA 2MMZA 2K9FA 4TR4A 2PPTA 5CAXA 3UBKA 1PL1A 1FB6A 2HSYA 1ML6A 1PA3A 4EDZA 4O5RA 1BQ7A 1TI1A 2XBQA 3P7XA 1YZXA 1T4YA 4AF2A 5JWQB 2VLVA 5FT3A 3TCOA 4L8EA 5HR1A 4V2LA 3IV4A 3SBCA 2DJ2A 4AJ6A 4MJCA 1TU7A 3O76A 4CW9A 3GH6A 4MABA 3DMLA 1YKAA 2AJQB 2BMXA 1U3AA 2L6DA
chains in the Genus database with same CATH superfamily
3GL3A 3RAZA 4EVMA 2GGTA 1ACVA 3Q74A 4PQ1A 4ID0A 2RUFA 4OFNA 3GV1A 2QA1A 4KA0A 4Q5NA 1G7EA 3EURA 1ON4A 1T1VA 3KM6A 3R3EA 1YY7A 2WW0A 2A2SA 1UA5A 2H1GA 1G6WA 2XC2A 2VKZG 3GH9A 3M9KA 4PX1A 1PFOA 5CRDA 4BWQA 4HSCX 5BMUB 2VM1A 4GQFA 2MMOA 1A2JA 4Z7XA 5D9XA 1JLVA 5ECSA 1JZRA 2H74A 5HR2A 4ECIA 1B9XC 5H5RA 3D0ZA 3QD9A 3GNJA 3D5JA 2G2QA 4PUFC 3APSA 5GZZB 2HSNA 2H76A 1B48A 1GL8A 5DVBA 5EVOA 1TK0B 4BVYA 2QGVA 2JSYA 5J9CA 2WS2A 2PBJA 4G0IA 1BYEA 1GSUA 2JU5A 2ALBA 1SKSB 2X99A 3GKNA 2HZFA 2MMAA 4IP1A 1PMTA 5G5FA 4MMMA 2LUSA 1JFUA 3IE3A 1PN9A 4TXOA 4ZB6A 5ECIB 5F8BA 2O3EA 2TIRA 2OT3A 1FHEA 5ECQB 2A4HA 4AI6A 2IMFA 5ABRA 1IYHA 3LWAA 4TR0A 1CQHA 2LEGA 5ECPB 4F03A 1Y25A 3M9JA 3NIVA 1TU8A 3TGZA 1B4QA 3ZLPA 2LJRA 1DSBA 5JWOB 1XW6A 2CV4A 2JZTA 1UN2A 2H6ZA 4KSMA 3LQ7A 1KEBA 2ZNMA 4RI7A 1YEPA 2L5LA 5CRGA 3HVSA 2YWIA 5C00A 5D96A 4IP6A 1K0DA 2ON7A 3P8WA 2OA7A 1UC7A 2A4VA 1R26A 2R5GA 1OKDA 4PI0C 4RUVA 2H0IA 2R0GA 4IELA 1GTUA 1Z6MA 5HQPA 1V98A 3EE2A 1K3OA 3CQFA 3QOUA 4EC0A 1Z6NA 1X0RA 4HDEA 2YNXA 1GRXA 5JWRB 3GL5A 1HD2A 2R2JA 2YANA 2WVYA 3MIXA 1F3AA 5DBQA 4BPYA 2B1LA 5ELGA 4GQCA 12GSA 3GA4A 1ERUA 1CQGA 3RFRC 5KN0A 3GTUB 4POLA 3DRNA 5ECNB 2VIMA 3UBLA 2P5QA 5CO3A 1J9BA 2OE0A 2B6MA 4WEYA 4NWYA 1PKWA 3F3QA 3ISOA 3GURA 1S3CA 2HRKB 1SU9A 1MTCA 5BRTA 1FVJA 2MMNA 4ZB9A 1QUWA 1GUKA 5JCUA 1M3JA 4ACSA 2L5OA 2QSIA 2EIQA 5GSTA 3GIXA 4MNNA 4IKHA 1XWGA 2B5XA 2MYGA 1PD21 3EINA 1YDKA 4K0NA 4AKGA 3TOTA 3FZ5A 3GRXA 2HFDA 1GSQA 3KP9A 1VF1A 3QMXA 3H1NA 3G7IA 5IMCA 3VI5A 1PRXA 4USSA 4BVXB 3F4SA 3BCIA 3A3TA 1PQNA 4AJ7A 4CDOA 1FOVA 1K0NA 1GLPA 2YP6A 2H73A 2A2RA 1ZMAA 3VPTA 1R7HA 2WFCA 1TRWA 2M46A 2YV7A 1BG5A 1OC9B 5FHIA 3F6FA 1BX9A 2K8VA 1O6JA 1B9YC 4E8HA 2VCXA 5B7CA 1AUCA 2HRAA 3UAPA 3IHGA 1TI3A 1YKCA 1M9BA 5IM9A 3W8SA 1H4OA 1SL0B 2PVOC 3LFLA 1U6TA 4XIHA 1W4VA 3LSZA 2X4AA 5B8AA 2KUCA 1ERTA 4N0VA 2C80A 1HNBA 3A5WA 3TJBA 2RM6A 2GLRA 5A34B 1NHOA 4KCAA 5EPFA 3ERFA 2HQTA 2VL2C 1SENA 4V2NA 1YQ1A 1YVLA 3A2WA 4ECCA 2C0DA 3MYDA 1JZOA 4HQSA 4WETA 5E4WA 1M2BA 4IW9A 4PQHA 5ID2A 4MCUA 2C4JA 2DIYA 3HZ4A 2H30A 4MJAA 1XOAA 2X8CA 4EUYA 1EP7A 5F06A 4F0BA 3QFBC 1WRYA 4XCSA 2CZ2A 3ERWA 4K2DA 3LXZA 4YKGA 2LSTA 1GLQA 4EL1A 2LQQA 1XWBA 1NM3A 3FEUA 3ZYWA 2PVQA 4ZL8A 3C8EA 5KEJA 1TRVA 1YJ6A 2CVKA 1VGLA 1Z9HA 1EEMA 4J57E 4Z2UA 3ME8A 1T3BA 4ZB7A 4PI2C 3S9FA 1N2AA 13GSA 4ISDA 4MK3A 2IMEA 2DJJA 3AY8A 1A8YA 1ZL9A 5B8BA 4XRAA 3LORA 3VWXA 4BL7A 2FA8A 3C71A 2X8GA 1A2LA 1J0FA 2UV8G 2OJLA 3EU3A 4TKYA 2WGRA 2CX3A 1SL1B 4GLTA 3R2QA 2REMA 4LA1A 2VCVA 4JBBA 4KE3A 5INYA 2V6KA 4AKIA 4RQXA 4PURA 3CTGA 5FWGA 4V1Ag 1H75A 2J9HA 2C0EA 3I69A 4DSQA 4MPGA 2OE3A 1M2DA 5KOXA 4IJIA 3EMXA 2H1DA 2DIZA 3HVXA 2IFQB 1QGVA 3CHXC 5HR3A 1DE2A 2F51A 4TOPA 2M72A 3GUSA 1XWCA 3UARA 3IA1A 5A1NA 3ZTLA 3IXRA 1IYIA 2GQMA 2LJAA 2LV3A 4ZL9A 3F9UA 5J9BA 2C0FA 4FXYP 1F3BA 2EFCA 3FHKA 3TRQA 1VF4A 3CRTA 1XWKA 4FIWA 1G7OA 2ZCTA 4OO4A 1PKZA 3KJYA 4K6XA 3UEMA 2FLSA 4IQAA 2B7JA 2RLIA 4O92A 3N9JA 1U88A 1THXA 1R5PA 4IBPA 4RI6A 4WF4A 1ZOFA 3D21A 1JZDA 5J4UA 4HZ4A 2QKEA 3TU3B 4EIQA 1AAZA 5H5QA 1A0RP 1TTZA 1AW9A 4GSNA 4L5LA 5DAKB 3EMPA 3QR6A 5H5SA 3TJJA 17GSA 3L9SA 3IC4A 4NHWA 1EEJA 1SKWB 2IPAA 2N5AA 3EU4A 3L78A 2WULA 4KDUA 2XPDA 1ZYQB 4O7HA 4X1UA 3PR8A 1GNEA 2H70A 2HI7A 2DSAA 4HS1A 5COHA 1O8WA 4GTUA 2WRTA 3ME7A 4O32A 1GSFA 3HJMA 1TOFA 2DMLA 4V2MA 2HSMB 3W8JA 4EF0A 3CSJA 4G2EA 4ZXGA 2VCZA 2V1MA 2G0FA 4G19A 3C7MA 4MJBA 2D2ZA 5J5NA 5ENUA 4WR5A 3Q6OA 2H0HA 4F2IA 3IRAA 2LJKA 4OFMA 2VLTA 4H86A 2HRKA 4TR1B 4DEJA 5IMVA 1ZYPA 2WVZA 4G10A 2XPEA 3DEXA 3P2AA 2EIOA 1EGRA 4Q5FA 4QMKA 4N0ZA 3FRCA 2UZ8A 1ZZYA 3E9JB 2IMIA 19GSA 5G1KA 2C1YA 1QMVA 2GS3A 20GSA 1XOBA 3GX8A 4K1FA 2VOCA 3HYPA 4DSSB 3TRXA 1G0TA 2BJXA 1V2AA 1BF5A 2H6XA 1NHYA 2L57A 3KH7A 4D73B 3UOMA 1N8JA 3ZRDA 3FZAA 3M3MA 2N5FA 1MDKA 4DVCA 2PU9C 3LYKA 4OCEA 3MWHA 5IO0A 5AISA 1T8EB 1OC9A 2IJYA 3M1GA 3GMFA 1XBSA 4XS4B 4HZ2A 4YQMA 3DVWA 3I6AA 2H66A 2PMTA 1B4PA 2X8HA 1YF1A 2PGTA 5D8IA 3F4TA 1OC3A 4YKFA 2FWGA 1U3IA 2LRNA 3CSIA 4ECJA 3ZL5A 1M7TA 4FYBA 4O5QA 3RPNA 1XG8A 3HCZA 4HU7A 4MP4A 2I3YA 6GSSA 3WGXA 1MD3A 1ERVA 3CWGA 3ZIVA 3KEBA 3QPMA 3IDVA 3GHAA 1NW2A 2KOKA 5IPHA 5DJMA 5G2ZA 2I9HA 1K0AA 2V32A 1PX7A 1TK5B 4N11A 1DBYA 1SL2B 3MDKA 3GN3A 3WT2A 4Q5QA 1C72A 2CAIA 1R4WA 2P31A 2NVLA 3P90A 2LQOA 3LGCA 1XFLA 3FZ4A 2CZ3A 2E2GA 1URMA 1S4BP 1AC1A 4EO3A 1SD8A 3VLNA 6GSWA 1WMJA 4KDXA 14GSA 1MD4A 1GTAA 3DWVA 1EV4A 3DD3A 5KOWA 5J40A 5IPGA 1TXXA 1XW9A 5G5EA 3ZZXA 5A5HB 1K0OA 1M99A 3H79A 2VD1A 5DQYA 3DXBA 4ZBAA 1OE8A 1O7UA 1M9AA 1G6YA 2WVXA 4ZL7A 1GSSA 5ECHB 3WD6A 1O73A 1K0BA 3HJPA 10GSA 2O89A 3HY2A 5J4YA 2H0GA 3K8NA 1F6MC 4BWSA 3ZFLA 3TDGA 3RPPA 4OD7A 2H1LA 1BG1A 2OBKA 1SK2A 1K3YA 4WR4A 2ZUPA 3F0IA 4L5OA 2O85A 5AIVA 5CRHA 3UVTA 1Y1UA 4G0KA 2F9SA 3HJOA 2WW3A 1ST9A 5AIXA 1UVZA 5J41A 2KHPA 1YEWC 3U6VA 4ZBBA 3TRPA 4GSSA 1LU4A 2VAFA 3HD5A 1GUMA 4LL1B 2HZEA 2NPBA 4EIPA 1V9WA 3UVHA 4G0LA 2R6KA 3APQA 1K0CA 3FY7A 2L4QA 4KB3A 4GSTA 4LMWA 4TN8A 3QDNA 1I1IP 2LS5A 3HKRA 2IMKA 3US3A 5ECKB 1FW1A 4XS6A 4JR4A 5IMFA 2DKIA 4KUNA 3VFIA 2BTOT 1F9MA 3F8UA 3GFKA 4X0XA 5GAPD 5G1LA 3IC8A 4HJ2A 1FG4A 5J3RA 2FGXA 2H72A 2PN8A 1TXUA 4OCFA 5DCHA 4NPBA 4NAXA 4TRXA 1MDIA 1PGTA 5D73A 4BVYB 4OMVA 1DE1A 1EP8A 1Q98A 2B5EA 2HXKA 1DUGA 4Z2TA 1S3RA 4YQVA 3C73A 2WDUA 1SK1A 2YV9A 2CT6A 5HFKA 4TXOB 4KDYA 3D4TA 1ZYEA 3KP8A 3KXOA 1WIKA 2GSTA 5CRWA 16GSA 4NXIA 4K8MA 2HSMA 2AHEA 3HXSA 3HZ8A 5B6MA 2HRFA 4CY8A 3C1RA 3MNGA 4K7OA 1SJ6A 2F3MA 2H19A 4JU5A 4JE1A 4K5SA 5GSSA 1FVKA 1M3IA 3IR4A 4FYUA 5G30A 3CTFA 2AAWA 3HVVA 3ZVJA 2GZPA 2YN1A 1GTIA 2YWOA 3HHVA 4IJ3A 4FO5A 4TR1A 3PGTA 4WF5A 4K5RA 3HMJG 3H93A 4ILFA 4DSRA 5B6NA 1WP0A 1VRSD 1Z7RA 4I2UA 1QQ2A 2YPMA 1E6BA 4N30A 5BMUA 2CA8A 4GCIA 3I9V2 3MAKA 4PUAA 5DQSA 3A5IA 3IAM2 4WKWA 2LKUA 2VL3A 2O5VA 3J7Yb 1A2MA 5AGYA 3IPZA 2WZSA 3KH9A 2NTOA 1PN0A 2HSHA 3O3TA 3BBYA 1X5DA 2VCQA 1OVNA 3TKSA 2IN3A 4POKA 4HJMA 3CMIA 2B1KA 4JZQA 2N5BA 5C04A 1LBKA 4LMVA 1S3AA 3FK8A 2H6YA 4PTSA 5IQYA 2R37A 2PERA 1XVWA 2B7KA 3TKPA 1HYUA 4POBA 3CSHA 3OR5A 2GSRA 4EKZA 2GTUA 3KD0A 2GDRA 4PNGA 3DIEA 1FOHA 2LRCA 1V58A 3GYKA 4HU9A 22GSA 3LG6A 4KGIA 2KLXA 4MLYA 4NV5A 2ES7A 1AXDA 5JCGA 3LYPA 4ZIJA 3ZREA 1SYRA 1Z5YE 5KN3A 2KP1A 2DBCA 2OADA 3A2VA 1OKTA 3EPTA 3BOAA 3VWUA 1F2EA 1FO5A 2H1AA 5HR0A 1O8XA 1XIYA 1Q4JA 4F82A 3TOUA 2O87A 2B5YA 2GZZA 2L6CA 4PGTA 1K0MA 5A4VA 5IMDA 1RK4A 1B8XA 2JL4A 5DCGA 2H8LA 3BCKA 4X43A 1GH2A 2C8UA 2DKHA 3VI7A 1WE0A 1HNCA 4JEDA 5F07A 2VM2A 5A5HA 3FZ9A 8GSSA 1LJRA 1KTEA 2IWTA 3I43A 2PUKC 4TXVA 4GWRA 5L71A 3CRUA 1M0UA 4EE0A 1GSEA 3GKKA 3FYGA 1SD9A 2VUPA 4N10A 1XZOA 4BA7A 3LEFA 2PWJA 4TVEA 3E0UA 4IN0A 1T7PB 5AN1A 3L9UA 4AKHA 3L4NA 1SJIA 1XPVA 1AQWA 4KCEA 3GTUA 1X5CA 1SVMA 3FW2A 1S3DA 2HLSA 1K3LA 4OWYA 4F0CA 4PXOA 3ED3A 1MDJA 1BEDA 4I6XA 7GSSA 2DC5A 4LLRA 3ZIJA 2MBSA 4OFTA 2R4VA 1WJKA 3JCML 4KF9A 5ECRB 4GDFA 4I5QA 1JLWA 3M8NA 3M0FA 4KH7A 1SVLA 3APOA 3G9BA 3WGEA 1GUHA 4MH2A 2X64A 5E59A 2AV4A 2ON5A 2DJKA 2XBIA 5ID2B 4AJ8A 2H01A 1TJDA 1GULA 4HQZA 5GAND 3BD2A 3GKXA 4PHZC 3TKQA 5J4VA 2B3SA 1EV9A 4IGJA 2VCWA 4BVXA 1TW9A 2I1UA 4EDYA 2FY6A 1EOGA 3RHBA 2X49A 4X4JA 1EGOA 4CHSA 1QFNA 1XCCA 4V1Ap 3LJRA 2HRNA 3RHCA 3F3RA 5D9WA 4PQIA 3NZNA 2F8AA 2WW2A 1PL2A 4K7IA 2HYXA 2O8VB 3W6GA 5A4UA 2XHFA 1XXUA 2H71A 4MZCA 4BL7B 3D6IA 1SVOA 4HUAA 1TDIA 2GVPA 2GSSA 2IL3A 1Z3EA 3UL3A 2OBIA 2QA2A 1TRUA 1TRSA 2FWFA 1AQXA 2HNLA 3TKSC 2L59A 2R0CA 3TJKA 4ML6A 5DALB 2LRTA 3GSSA 2CQ9A 2IMDA 1PSQA 5D93A 1THOA 4AGSA 2JACA 5KN1A 3TJFA 3SWLA 4NV2A 4POMA 2VL2A 4TR3A 1OAZA 3QCPA 2YZHA 2FWEA 3ZITA 3DVXA 2FNOA 5EL8A 5LD0A 3VPQA 5LCZA 1MEKA 2VLUA 5A34A 2GT5A 2L4CA 3KTBA 6GSYA 1USBA 4QL9A 5CP1A 2WW1A 1YEXA 1X5EA 3LXTA 5EY6A 2AYTA 2CAQA 2MZCA 2K6VA 4QL7A 5A1NB 1GNWA 2E2MA 1WWJA 3EWLA 3D22A 1Y6EA 4L0UA 4I97A 1WOUA 3G7YA 3IK9A 4WBRD 1M2AA 4JRRA 4KSOA 2RIIA 3KTLA 2TRCP 4GF0A 1V57A 2J23A 1ZGNA 2C3QA 2DJ0A 3UJ1A 2HT9A 3CYNA 2FA4A 2WB9A 1EZKA 3CXGA 9GSSA 4I8BA 5DDLA 2KP2A 4MF7A 1AIUA 1XVQA 1A23A 1O85A 3MSZA 1GP1A 4A5PA 3ZVJD 3IBHA 6GSVA 2V6OA 3QAVA 5D9TA 2YJ7A 2AB6A 5IOXA 2JADA 4NHZA 1I9DA 1TK8B 3FR3A 4WXTA 1JHBA 4MZWA 1GSYA 1BAYA 4K9ZA 1SYXA 4GRFA 2EC4A 4YAPA 1HQOA 3KZQA 2CX4A 2RUEA 4IHUA 6GSTA 1GSDA 2Z9SA 4IQ1A 2FUG2 2LNSA 1HNAA 5ECOB 1NSWA 1ILOA 1T4ZA 4FH8A 1ZYNA 3LW9A 5G31A 2H75A 4J2FA 3KCMA 3TJGA 3V1WA 2EFHA 1TP9A 3L9VA 2YCDA 3VK9A 4XHMA 6GSUA 5HFGA 4Q5RA 2IFQA 4Z2RA 1SKRB 2JZSA 3A2XA 2OE1A 4YQUA 1E2YA 5HFIA 3HDCA 3TUEA 1R5AA 4KW6A 5IO2A 1J08A 2K18A 3ZMLA 3ZFBA 1VF3A 2DLXA 3RGBC 3FMWA 4K2XA 3VWVA 4KAEA 1ZCPA 2A2PA 1PX6A 3C1SA 4I2TA 4EXJA 2JSZA 1KNGA 4XS1A 2CVBA 1XW5A 2P5RA 5F0GA 3PPUA 3HA9A 2NBSA 2IIYA 1TKDB 1GTBA 1A0FA 1QXHA 1RQMA 4OO5A 2MBTA 2HSNB 1V40A 3KIJA 3TB2A 3GKMA 4KNDA 1OE7A 4O5UA 5DAKA 5A4WA 1YF0A 4ICYA 3U5RE 3D4MA 5F05A 3UIWA 1KBNA 3Q19A 2E7PA 4ZILA 4PNFA 3IAS2 4YAVA 4K0GA 2VD0A 2E0QA 3IOSA 1X9SB 4ZBDA 4NMUA 4AKXB 3TKSE 2OKAA 6GSXA 2GT6A 3EYTA 4RQRA 2R3XA 3EVIA 4IS0A 3G7JA 2YOIA 2RM5A 5ECLB 2DJ1A 2HE3A 3H8QA 2GQKA 2EIRA 2NDOA 5IMAA 3H4KA 1I5GA 4XRDA 3QAWA 1SJZA 1A8LA 4ULXA 2V2GA 4HOJA 3F6DA 1GWCA 4FYCA 1SK0A 1X9MB 1Z7PA 1AQVA 2YZUA 2WZ9A 3E3EA 4HI7A 3KMNA 4W66A 3UMAA 1A24A 2R0PA 5CYYA 3RDWA 4ML1A 1VF2A 3VWWA 3DKSA 2GSQA 5LNKe 1OC8A 3FR6A 4IVFA 4E68A 4DSSA 3BJ5A 2LNTA 4MDCA 2I81A 4D73A 3L0HA 2YWMA 2O36A 3ZMKA 4WBJA 5IIZA 5KN2A 2GZYA 2WVXB 3F63A 1O81A 5JCWA 3N5OA 2DMMA 3GX0A 5IMZA 4JR6A 2F8FA 3EC3A 2QC7A 4YH2A 4F9ZA 4G01A 4XS4A 1QK8A 2FWHA 3NOFA 3FR9A 2YJHA 4MA9A 4MF6A 1XWAA 1T00A 1WPIA 5CREA 2FCHA 3ERGA 2JZRA 4GXZA 4MF5A 2FHEA 2C3TA 5IOWA 4ZB8A 4P3YB 4MZBA 5CNWA 18GSA 3WT1A 4TW5A 4FQUA 5D9VA 4K7NA 2WJUA 2VO4A 1X9WB 5DALA 1W89A 2YWNA 4J56E 1FB0A 3TKRA 3O6TA 2OACA 3Q18A 2M80A 2I4AA 3QAGA 4MH3A 1N25A 3PINA 1ABAA 3FKFA 4XTSA 4HEA2 4MJEA 2P0GA 5ELAA 2HZEB 2EFEA 4MPFA 3F4RA 2V41A 1EOHA 3RBTA 3WYWA 1F37A 3KMOA 3IHQA 2TRXA 3VURA 1BJXA 4G9HA 3DGQA 2VL9A 1EWXA 3PH9A 3GSTA 4E8EA 3KGKA 2WCIA 3DYRA 11GSA 4L0WA 3IK7A 2K8SA 2AUVA 2FD3A 4KX4A 4LL4B 5DJLA 2CVDA 1RW1A 5A5KA 2H1BA 2LTKA 2C3NA 2O7KA 1FAAA 5ECMB 1U87A 2DJ3A 2GQLA 1OYJA 3J7Yk 4ECBA 1ERWA 5J47A 4QQ7A 2VCTA 4BIKA 1JZWA 3WGDA 4CY6A 2C0GA 3QFAC 3CBUA 2MMZA 2K9FA 4TR4A 2PPTA 5CAXA 3UBKA 1PL1A 1FB6A 2HSYA 1ML6A 1PA3A 4EDZA 4O5RA 1BQ7A 1TI1A 2XBQA 3P7XA 1YZXA 1T4YA 4AF2A 5JWQB 2VLVA 4N3ZA 5FT3A 3TCOA 4L8EA 5HR1A 4V2LA 2EFDA 3IV4A 3SBCA 2DJ2A 4AJ6A 4MJCA 1TU7A 3O76A 4CW9A 3GH6A 4MABA 3DMLA 1YKAA 2AJQB 2BMXA 1U3AA 2L6DA 3HVNA
chains in the Genus database with same CATH topology
3GL3A 3RAZA 4EVMA 2GGTA 1ACVA 3Q74A 4PQ1A 4ID0A 2RUFA 4OFNA 3GV1A 2QA1A 4KA0A 4Q5NA 1G7EA 3EURA 1ON4A 1T1VA 3KM6A 3R3EA 1YY7A 2A2SA 1UA5A 2H1GA 1G6WA 2XC2A 2VKZG 3GH9A 3M9KA 4PX1A 5CRDA 4BWQA 5BMUB 2VM1A 4GQFA 2MMOA 1A2JA 4Z7XA 5D9XA 1JLVA 5ECSA 1JZRA 2H74A 5HR2A 4ECIA 1B9XC 5H5RA 3D0ZA 3QD9A 3GNJA 3D5JA 2G2QA 4PUFC 3APSA 5GZZB 2HSNA 2H76A 1B48A 1GL8A 5DVBA 5EVOA 1TK0B 4BVYA 2QGVA 2JSYA 5J9CA 2WS2A 2PBJA 4G0IA 1BYEA 1GSUA 2JU5A 2ALBA 1SKSB 2X99A 3GKNA 2HZFA 2MMAA 4IP1A 1PMTA 5G5FA 4MMMA 2LUSA 1JFUA 3IE3A 1PN9A 4TXOA 4ZB6A 5ECIB 5F8BA 2TIRA 2OT3A 1FHEA 5ECQB 2A4HA 4AI6A 2IMFA 5ABRA 1IYHA 3LWAA 4TR0A 1CQHA 2LEGA 5ECPB 4F03A 1Y25A 3M9JA 3NIVA 1TU8A 3TGZA 1B4QA 3ZLPA 2LJRA 1DSBA 5JWOB 1XW6A 2CV4A 2JZTA 1UN2A 2H6ZA 4KSMA 3LQ7A 1KEBA 2ZNMA 4RI7A 1YEPA 2L5LA 5CRGA 3HVSA 2YWIA 5C00A 5D96A 4IP6A 1K0DA 2ON7A 3P8WA 2OA7A 1UC7A 2A4VA 1R26A 2R5GA 1OKDA 4RUVA 2H0IA 2R0GA 4IELA 1GTUA 1Z6MA 5HQPA 1V98A 3EE2A 1K3OA 3QOUA 4EC0A 1Z6NA 1X0RA 4HDEA 2YNXA 1GRXA 5JWRB 3GL5A 1HD2A 2R2JA 2YANA 3MIXA 1F3AA 5DBQA 4BPYA 2B1LA 5ELGA 4GQCA 12GSA 3GA4A 1ERUA 1CQGA 5KN0A 3GTUB 4POLA 3DRNA 5ECNB 2VIMA 3UBLA 2P5QA 5CO3A 1J9BA 2OE0A 2B6MA 4WEYA 4NWYA 1PKWA 3F3QA 3ISOA 3GURA 1S3CA 2HRKB 1SU9A 1MTCA 5BRTA 1FVJA 2MMNA 4ZB9A 1QUWA 1GUKA 5JCUA 4ACSA 2L5OA 2QSIA 2EIQA 5GSTA 3GIXA 4MNNA 4IKHA 1XWGA 2B5XA 2MYGA 1PD21 3EINA 1YDKA 4K0NA 4AKGA 3TOTA 3FZ5A 3GRXA 2HFDA 1GSQA 3KP9A 1VF1A 3QMXA 3H1NA 3G7IA 5IMCA 3VI5A 1PRXA 4USSA 4BVXB 3F4SA 3BCIA 3A3TA 1PQNA 4AJ7A 4CDOA 1FOVA 1K0NA 1GLPA 2YP6A 2H73A 2A2RA 1ZMAA 3VPTA 1R7HA 2WFCA 1TRWA 2M46A 2YV7A 1BG5A 1OC9B 5FHIA 3F6FA 1BX9A 2K8VA 1O6JA 1B9YC 4E8HA 2VCXA 5B7CA 1AUCA 2HRAA 3UAPA 3IHGA 1TI3A 1YKCA 1M9BA 5IM9A 3W8SA 1H4OA 1SL0B 2PVOC 3LFLA 1U6TA 4XIHA 1W4VA 3LSZA 2X4AA 5B8AA 2KUCA 1ERTA 4N0VA 2C80A 1HNBA 3A5WA 3TJBA 2RM6A 2GLRA 5A34B 1NHOA 4KCAA 5EPFA 3ERFA 2HQTA 2VL2C 1SENA 4V2NA 1YQ1A 1YVLA 3A2WA 4ECCA 2C0DA 3MYDA 1JZOA 4HQSA 4WETA 5E4WA 1M2BA 4IW9A 4PQHA 5ID2A 4MCUA 2C4JA 2DIYA 3HZ4A 2H30A 4MJAA 1XOAA 2X8CA 4EUYA 1EP7A 5F06A 4F0BA 3QFBC 1WRYA 4XCSA 2CZ2A 3ERWA 4K2DA 3LXZA 4YKGA 2LSTA 1GLQA 4EL1A 2LQQA 1XWBA 1NM3A 3FEUA 3ZYWA 2PVQA 4ZL8A 3C8EA 5KEJA 1TRVA 1YJ6A 2CVKA 1VGLA 1Z9HA 1EEMA 4J57E 4Z2UA 3ME8A 1T3BA 4ZB7A 3S9FA 1N2AA 13GSA 4ISDA 4MK3A 2IMEA 2DJJA 3AY8A 1A8YA 1ZL9A 5B8BA 4XRAA 3LORA 3VWXA 4BL7A 2FA8A 3C71A 2X8GA 1A2LA 1J0FA 2UV8G 2OJLA 3EU3A 4TKYA 2WGRA 2CX3A 1SL1B 4GLTA 3R2QA 2REMA 4LA1A 2VCVA 4JBBA 4KE3A 5INYA 2V6KA 4AKIA 4RQXA 4PURA 3CTGA 5FWGA 4V1Ag 1H75A 2J9HA 2C0EA 3I69A 4DSQA 4MPGA 2OE3A 1M2DA 5KOXA 4IJIA 3EMXA 2H1DA 2DIZA 3HVXA 2IFQB 1QGVA 5HR3A 1DE2A 2F51A 4TOPA 2M72A 3GUSA 1XWCA 3UARA 3IA1A 5A1NA 3ZTLA 3IXRA 1IYIA 2GQMA 2LJAA 2LV3A 4ZL9A 3F9UA 5J9BA 2C0FA 1F3BA 2EFCA 3FHKA 3TRQA 1VF4A 3CRTA 1XWKA 4FIWA 1G7OA 2ZCTA 4OO4A 1PKZA 3KJYA 4K6XA 3UEMA 2FLSA 4IQAA 2B7JA 2RLIA 4O92A 3N9JA 1U88A 1THXA 1R5PA 4IBPA 4RI6A 4WF4A 1ZOFA 3D21A 1JZDA 5J4UA 4HZ4A 2QKEA 3TU3B 4EIQA 1AAZA 5H5QA 1A0RP 1TTZA 1AW9A 4GSNA 4L5LA 5DAKB 3EMPA 3QR6A 5H5SA 3TJJA 17GSA 3L9SA 3IC4A 4NHWA 1EEJA 1SKWB 2IPAA 2N5AA 3EU4A 3L78A 2WULA 4KDUA 2XPDA 1ZYQB 4O7HA 4X1UA 3PR8A 1GNEA 2H70A 2HI7A 2DSAA 4HS1A 5COHA 1O8WA 4GTUA 2WRTA 3ME7A 4O32A 1GSFA 3HJMA 1TOFA 2DMLA 4V2MA 2HSMB 3W8JA 4EF0A 3CSJA 4G2EA 4ZXGA 2VCZA 2V1MA 2G0FA 4G19A 3C7MA 4MJBA 2D2ZA 5J5NA 5ENUA 4WR5A 3Q6OA 2H0HA 4F2IA 3IRAA 2LJKA 4OFMA 2VLTA 4H86A 2HRKA 4TR1B 4DEJA 5IMVA 1ZYPA 4G10A 2XPEA 3DEXA 3P2AA 2EIOA 1EGRA 4Q5FA 4QMKA 4N0ZA 3FRCA 2UZ8A 1ZZYA 3E9JB 2IMIA 19GSA 5G1KA 2C1YA 1QMVA 2GS3A 20GSA 1XOBA 3GX8A 4K1FA 2VOCA 3HYPA 4DSSB 3TRXA 1G0TA 2BJXA 1V2AA 1BF5A 2H6XA 1NHYA 2L57A 3KH7A 4D73B 3UOMA 1N8JA 3ZRDA 3FZAA 3M3MA 2N5FA 1MDKA 4DVCA 2PU9C 3LYKA 4OCEA 3MWHA 5IO0A 5AISA 1T8EB 1OC9A 2IJYA 3M1GA 3GMFA 1XBSA 4XS4B 4HZ2A 4YQMA 3DVWA 3I6AA 2H66A 2PMTA 1B4PA 2X8HA 1YF1A 2PGTA 5D8IA 3F4TA 1OC3A 4YKFA 2FWGA 1U3IA 2LRNA 3CSIA 4ECJA 3ZL5A 1M7TA 4FYBA 4O5QA 3RPNA 3HCZA 4HU7A 4MP4A 2I3YA 6GSSA 3WGXA 1MD3A 1ERVA 3CWGA 3ZIVA 3KEBA 3QPMA 3IDVA 3GHAA 1NW2A 2KOKA 5IPHA 5DJMA 5G2ZA 2I9HA 1K0AA 2V32A 1PX7A 1TK5B 4N11A 1DBYA 1SL2B 3MDKA 3GN3A 3WT2A 4Q5QA 1C72A 2CAIA 1R4WA 2P31A 2NVLA 3P90A 3LGCA 2LQOA 1XFLA 3FZ4A 2CZ3A 2E2GA 1URMA 1AC1A 4EO3A 1SD8A 3VLNA 6GSWA 1WMJA 4KDXA 14GSA 1MD4A 1GTAA 3DWVA 1EV4A 3DD3A 5KOWA 5J40A 5IPGA 1TXXA 1XW9A 5G5EA 3ZZXA 5A5HB 1K0OA 1M99A 3H79A 2VD1A 5DQYA 3DXBA 4ZBAA 1OE8A 1O7UA 1M9AA 1G6YA 4ZL7A 1GSSA 5ECHB 3WD6A 1O73A 1K0BA 3HJPA 10GSA 2O89A 3HY2A 5J4YA 2H0GA 3K8NA 1F6MC 4BWSA 3ZFLA 3TDGA 3RPPA 4OD7A 2H1LA 1BG1A 2OBKA 1SK2A 1K3YA 4WR4A 2ZUPA 3F0IA 4L5OA 2O85A 5AIVA 5CRHA 3UVTA 1Y1UA 4G0KA 2F9SA 3HJOA 1ST9A 5AIXA 1UVZA 5J41A 2KHPA 3U6VA 4ZBBA 3TRPA 4GSSA 1LU4A 2VAFA 3HD5A 1GUMA 4LL1B 2HZEA 2NPBA 4EIPA 1V9WA 3UVHA 4G0LA 2R6KA 3APQA 1K0CA 3FY7A 2L4QA 4KB3A 4GSTA 4LMWA 4TN8A 3QDNA 2LS5A 3HKRA 2IMKA 3US3A 5ECKB 1FW1A 4XS6A 4JR4A 5IMFA 2DKIA 4KUNA 3VFIA 2BTOT 1F9MA 3F8UA 3GFKA 4X0XA 5GAPD 5G1LA 3IC8A 4HJ2A 1FG4A 5J3RA 2FGXA 2H72A 2PN8A 1TXUA 4OCFA 5DCHA 4NPBA 4NAXA 4TRXA 1MDIA 1PGTA 5D73A 4BVYB 4OMVA 1DE1A 1EP8A 1Q98A 2B5EA 2HXKA 1DUGA 4Z2TA 4YQVA 3C73A 2WDUA 1SK1A 2YV9A 2CT6A 5HFKA 4TXOB 4KDYA 3D4TA 1ZYEA 3KP8A 3KXOA 1WIKA 2GSTA 5CRWA 16GSA 4NXIA 4K8MA 2HSMA 2AHEA 3HXSA 3HZ8A 5B6MA 2HRFA 4CY8A 3C1RA 3MNGA 4K7OA 1SJ6A 2F3MA 2H19A 4JU5A 4JE1A 4K5SA 5GSSA 1FVKA 3IR4A 4FYUA 5G30A 3CTFA 2AAWA 3HVVA 3ZVJA 2GZPA 2YN1A 1GTIA 2YWOA 3HHVA 4IJ3A 4FO5A 4TR1A 3PGTA 4WF5A 4K5RA 3HMJG 3H93A 4ILFA 4DSRA 5B6NA 1WP0A 1VRSD 1Z7RA 4I2UA 1QQ2A 2YPMA 1E6BA 4N30A 5BMUA 2CA8A 4GCIA 3I9V2 3MAKA 4PUAA 5DQSA 3A5IA 3IAM2 4WKWA 2LKUA 2VL3A 2O5VA 3J7Yb 1A2MA 5AGYA 3IPZA 3KH9A 2NTOA 1PN0A 2HSHA 3O3TA 3BBYA 1X5DA 2VCQA 1OVNA 3TKSA 2IN3A 4POKA 4HJMA 3CMIA 2B1KA 4JZQA 2N5BA 5C04A 1LBKA 4LMVA 1S3AA 3FK8A 2H6YA 4PTSA 5IQYA 2R37A 2PERA 1XVWA 2B7KA 3TKPA 1HYUA 4POBA 3CSHA 3OR5A 2GSRA 4EKZA 2GTUA 3KD0A 2GDRA 4PNGA 3DIEA 1FOHA 2LRCA 1V58A 3GYKA 4HU9A 22GSA 3LG6A 4KGIA 2KLXA 4MLYA 4NV5A 2ES7A 1AXDA 5JCGA 3LYPA 4ZIJA 3ZREA 1SYRA 1Z5YE 5KN3A 2KP1A 2DBCA 2OADA 3A2VA 1OKTA 3EPTA 3BOAA 3VWUA 1F2EA 1FO5A 2H1AA 5HR0A 1O8XA 1XIYA 1Q4JA 4F82A 3TOUA 2O87A 2B5YA 2GZZA 2L6CA 4PGTA 1K0MA 5A4VA 5IMDA 1RK4A 1B8XA 2JL4A 5DCGA 2H8LA 3BCKA 4X43A 1GH2A 2C8UA 2DKHA 3VI7A 1WE0A 1HNCA 4JEDA 5F07A 2VM2A 5A5HA 3FZ9A 8GSSA 1LJRA 1KTEA 2IWTA 3I43A 2PUKC 4TXVA 4GWRA 5L71A 3CRUA 1M0UA 4EE0A 1GSEA 3GKKA 3FYGA 1SD9A 2VUPA 4N10A 1XZOA 4BA7A 3LEFA 2PWJA 4TVEA 3E0UA 4IN0A 1T7PB 5AN1A 3L9UA 4AKHA 3L4NA 1SJIA 1XPVA 1AQWA 4KCEA 3GTUA 1X5CA 1SVMA 3FW2A 1S3DA 2HLSA 1K3LA 4OWYA 4F0CA 4PXOA 3ED3A 1MDJA 1BEDA 4I6XA 7GSSA 2DC5A 4LLRA 3ZIJA 2MBSA 4OFTA 2R4VA 1WJKA 3JCML 4KF9A 5ECRB 4GDFA 4I5QA 1JLWA 3M8NA 3M0FA 4KH7A 1SVLA 3APOA 3G9BA 3WGEA 1GUHA 4MH2A 2X64A 5E59A 2AV4A 2ON5A 2DJKA 2XBIA 5ID2B 4AJ8A 2H01A 1TJDA 1GULA 4HQZA 5GAND 3BD2A 3GKXA 3TKQA 5J4VA 2B3SA 1EV9A 4IGJA 2VCWA 4BVXA 1TW9A 2I1UA 4EDYA 2FY6A 1EOGA 3RHBA 2X49A 4X4JA 1EGOA 4CHSA 1QFNA 1XCCA 4V1Ap 3LJRA 2HRNA 3RHCA 3F3RA 5D9WA 4PQIA 3NZNA 2F8AA 1PL2A 4K7IA 2HYXA 2O8VB 3W6GA 5A4UA 2XHFA 1XXUA 2H71A 4MZCA 4BL7B 3D6IA 1SVOA 4HUAA 1TDIA 2GVPA 2GSSA 2IL3A 1Z3EA 3UL3A 2OBIA 2QA2A 1TRUA 1TRSA 2FWFA 1AQXA 2HNLA 3TKSC 2L59A 2R0CA 3TJKA 4ML6A 5DALB 2LRTA 3GSSA 2CQ9A 2IMDA 1PSQA 5D93A 1THOA 4AGSA 2JACA 5KN1A 3TJFA 3SWLA 4NV2A 4POMA 2VL2A 4TR3A 1OAZA 3QCPA 2YZHA 2FWEA 3ZITA 3DVXA 2FNOA 5EL8A 5LD0A 3VPQA 5LCZA 1MEKA 2VLUA 5A34A 2GT5A 2L4CA 3KTBA 6GSYA 1USBA 4QL9A 5CP1A 1YEXA 1X5EA 3LXTA 5EY6A 2AYTA 2CAQA 2MZCA 2K6VA 4QL7A 5A1NB 1GNWA 2E2MA 1WWJA 3EWLA 3D22A 1Y6EA 4L0UA 4I97A 1WOUA 3G7YA 3IK9A 4WBRD 1M2AA 4JRRA 4KSOA 2RIIA 3KTLA 2TRCP 4GF0A 1V57A 2J23A 1ZGNA 2C3QA 2DJ0A 3UJ1A 2HT9A 3CYNA 2FA4A 2WB9A 1EZKA 3CXGA 9GSSA 4I8BA 5DDLA 2KP2A 4MF7A 1AIUA 1XVQA 1A23A 1O85A 3MSZA 1GP1A 4A5PA 3ZVJD 3IBHA 6GSVA 2V6OA 3QAVA 5D9TA 2YJ7A 2AB6A 5IOXA 2JADA 4NHZA 1I9DA 1TK8B 3FR3A 4WXTA 1JHBA 4MZWA 1GSYA 1BAYA 4K9ZA 1SYXA 4GRFA 2EC4A 4YAPA 1HQOA 3KZQA 2CX4A 2RUEA 4IHUA 6GSTA 1GSDA 2Z9SA 4IQ1A 2FUG2 2LNSA 1HNAA 5ECOB 1NSWA 1ILOA 1T4ZA 4FH8A 1ZYNA 3LW9A 5G31A 2H75A 4J2FA 3KCMA 3TJGA 3V1WA 2EFHA 1TP9A 3L9VA 2YCDA 3VK9A 4XHMA 6GSUA 5HFGA 4Q5RA 2IFQA 4Z2RA 1SKRB 2JZSA 3A2XA 2OE1A 4YQUA 1E2YA 5HFIA 3HDCA 3TUEA 1R5AA 4KW6A 5IO2A 1J08A 2K18A 3ZMLA 3ZFBA 1VF3A 2DLXA 3FMWA 4K2XA 3VWVA 4KAEA 1ZCPA 2A2PA 1PX6A 3C1SA 4I2TA 4EXJA 2JSZA 1KNGA 4XS1A 2CVBA 1XW5A 2P5RA 5F0GA 3PPUA 3HA9A 2NBSA 2IIYA 1TKDB 1GTBA 1A0FA 1QXHA 1RQMA 4OO5A 2MBTA 2HSNB 1V40A 3KIJA 3TB2A 3GKMA 4KNDA 1OE7A 4O5UA 5DAKA 5A4WA 1YF0A 4ICYA 3U5RE 3D4MA 5F05A 3UIWA 1KBNA 3Q19A 2E7PA 4ZILA 4PNFA 3IAS2 4YAVA 4K0GA 2VD0A 2E0QA 3IOSA 1X9SB 4ZBDA 4NMUA 4AKXB 3TKSE 2OKAA 6GSXA 2GT6A 3EYTA 4RQRA 2R3XA 3EVIA 4IS0A 3G7JA 2YOIA 2RM5A 5ECLB 2DJ1A 2HE3A 3H8QA 2GQKA 2EIRA 2NDOA 5IMAA 3H4KA 1I5GA 4XRDA 3QAWA 1SJZA 1A8LA 4ULXA 2V2GA 4HOJA 3F6DA 1GWCA 4FYCA 1SK0A 1X9MB 1Z7PA 1AQVA 2YZUA 2WZ9A 3E3EA 4HI7A 3KMNA 4W66A 3UMAA 1A24A 2R0PA 5CYYA 3RDWA 4ML1A 1VF2A 3VWWA 3DKSA 2GSQA 5LNKe 1OC8A 3FR6A 4IVFA 4E68A 4DSSA 3BJ5A 2LNTA 4MDCA 2I81A 4D73A 3L0HA 2YWMA 3ZMKA 4WBJA 5IIZA 5KN2A 2GZYA 3F63A 1O81A 5JCWA 3N5OA 2DMMA 3GX0A 5IMZA 4JR6A 2F8FA 3EC3A 2QC7A 4YH2A 4F9ZA 4G01A 4XS4A 1QK8A 2FWHA 3NOFA 3FR9A 2YJHA 4MA9A 4MF6A 1XWAA 1T00A 1WPIA 5CREA 2FCHA 3ERGA 2JZRA 4GXZA 4MF5A 2FHEA 2C3TA 5IOWA 4ZB8A 4P3YB 4MZBA 5CNWA 18GSA 3WT1A 4TW5A 4FQUA 5D9VA 4K7NA 2WJUA 2VO4A 1X9WB 5DALA 1W89A 2YWNA 4J56E 1FB0A 3TKRA 3O6TA 2OACA 3Q18A 2M80A 2I4AA 3QAGA 4MH3A 1N25A 3PINA 1ABAA 3FKFA 4XTSA 4HEA2 4MJEA 2P0GA 5ELAA 2HZEB 2EFEA 4MPFA 3F4RA 2V41A 1EOHA 3RBTA 3WYWA 1F37A 3KMOA 3IHQA 2TRXA 3VURA 1BJXA 4G9HA 3DGQA 2VL9A 1EWXA 3PH9A 3GSTA 4E8EA 3KGKA 2WCIA 3DYRA 11GSA 4L0WA 3IK7A 2K8SA 2AUVA 2FD3A 4KX4A 4LL4B 5DJLA 2CVDA 1RW1A 5A5KA 2H1BA 2LTKA 2C3NA 2O7KA 1FAAA 5ECMB 1U87A 2DJ3A 2GQLA 1OYJA 3J7Yk 4ECBA 1ERWA 5J47A 4QQ7A 2VCTA 1JZWA 3WGDA 4CY6A 2C0GA 3QFAC 3CBUA 2MMZA 2K9FA 4TR4A 2PPTA 5CAXA 3UBKA 1PL1A 1FB6A 2HSYA 1ML6A 1PA3A 4EDZA 4O5RA 1BQ7A 1TI1A 2XBQA 3P7XA 1YZXA 1T4YA 4AF2A 5JWQB 2VLVA 4N3ZA 5FT3A 3TCOA 4L8EA 5HR1A 4V2LA 2EFDA 3IV4A 3SBCA 2DJ2A 4AJ6A 4MJCA 1TU7A 3O76A 4CW9A 3GH6A 4MABA 3DMLA 1YKAA 2AJQB 2BMXA 1U3AA 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL3 A;  3RAZ A;  4EVM A;  2GGT A;  1ACV A;  3Q74 A;  4PQ1 A;  4ID0 A;  2RUF A;  4OFN A;  3GV1 A;  4KA0 A;  4Q5N A;  1G7E A;  3EUR A;  1ON4 A;  1T1V A;  3KM6 A;  3R3E A;  1YY7 A;  2A2S A;  1UA5 A;  2H1G A;  1G6W A;  2XC2 A;  3GH9 A;  3M9K A;  4PX1 A;  5CRD A;  4BWQ A;  2VM1 A;  4GQF A;  2MMO A;  1A2J A;  4Z7X A;  5D9X A;  1JLV A;  5ECS A;  1JZR A;  2H74 A;  5HR2 A;  4ECI A;  1B9X C;  5H5R A;  3D0Z A;  3QD9 A;  3GNJ A;  3D5J A;  2G2Q A;  4PUF C;  3APS A;  5GZZ B;  2H76 A;  1B48 A;  1GL8 A;  5DVB A;  5EVO A;  1TK0 B;  4BVY A;  2QGV A;  2JSY A;  5J9C A;  2WS2 A;  2PBJ A;  4G0I A;  1BYE A;  1GSU A;  2JU5 A;  2ALB A;  1SKS B;  2X99 A;  3GKN A;  2HZF A;  2MMA A;  4IP1 A;  1PMT A;  5G5F A;  4MMM A;  2LUS A;  1JFU A;  3IE3 A;  1PN9 A;  4TXO A;  4ZB6 A;  5ECI B;  5F8B A;  2TIR A;  1FHE A;  5ECQ B;  2IMF A;  5ABR A;  1IYH A;  3LWA A;  4TR0 A;  1CQH A;  2LEG A;  5ECP B;  4F03 A;  1Y25 A;  3M9J A;  3NIV A;  1TU8 A;  3TGZ A;  1B4Q A;  3ZLP A;  2LJR A;  1DSB A;  5JWO B;  1XW6 A;  2CV4 A;  2JZT A;  1UN2 A;  2H6Z A;  4KSM A;  3LQ7 A;  1KEB A;  2ZNM A;  4RI7 A;  1YEP A;  2L5L A;  5CRG A;  3HVS A;  2YWI A;  5C00 A;  5D96 A;  4IP6 A;  1K0D A;  2ON7 A;  3P8W A;  2OA7 A;  1UC7 A;  2A4V A;  1R26 A;  2R5G A;  1OKD A;  4RUV A;  2H0I A;  4IEL A;  1GTU A;  1Z6M A;  5HQP A;  1V98 A;  3EE2 A;  1K3O A;  3QOU A;  4EC0 A;  1Z6N A;  1X0R A;  4HDE A;  2YNX A;  1GRX A;  5JWR B;  3GL5 A;  1HD2 A;  2R2J A;  2YAN A;  1F3A A;  5DBQ A;  4BPY A;  2B1L A;  5ELG A;  4GQC A;  12GS A;  3GA4 A;  1ERU A;  1CQG A;  5KN0 A;  3GTU B;  4POL A;  3DRN A;  5ECN B;  2VIM A;  3UBL A;  2P5Q A;  5CO3 A;  1J9B A;  2OE0 A;  2B6M A;  4WEY A;  4NWY A;  1PKW A;  3F3Q A;  3ISO A;  3GUR A;  1S3C A;  2HRK B;  1SU9 A;  1MTC A;  1FVJ A;  2MMN A;  4ZB9 A;  1QUW A;  1GUK A;  5JCU A;  4ACS A;  2L5O A;  2QSI A;  2EIQ A;  5GST A;  3GIX A;  4IKH A;  1XWG A;  2B5X A;  2MYG A;  1PD2 1;  3EIN A;  1YDK A;  4K0N A;  3TOT A;  3FZ5 A;  3GRX A;  2HFD A;  1GSQ A;  3KP9 A;  1VF1 A;  3QMX A;  3H1N A;  3G7I A;  5IMC A;  3VI5 A;  1PRX A;  4USS A;  4BVX B;  3F4S A;  3BCI A;  3A3T A;  1PQN A;  4AJ7 A;  4CDO A;  1FOV A;  1K0N A;  1GLP A;  2YP6 A;  2H73 A;  2A2R A;  1ZMA A;  3VPT A;  1R7H A;  2WFC A;  1TRW A;  2M46 A;  2YV7 A;  1BG5 A;  1OC9 B;  5FHI A;  3F6F A;  1BX9 A;  2K8V A;  1O6J A;  1B9Y C;  4E8H A;  2VCX A;  5B7C A;  1AUC A;  2HRA A;  3UAP A;  1TI3 A;  1YKC A;  1M9B A;  5IM9 A;  3W8S A;  1H4O A;  1SL0 B;  2PVO C;  3LFL A;  1U6T A;  4XIH A;  1W4V A;  3LSZ A;  5B8A A;  2KUC A;  1ERT A;  4N0V A;  2C80 A;  1HNB A;  3A5W A;  3TJB A;  2RM6 A;  2GLR A;  1NHO A;  4KCA A;  5EPF A;  3ERF A;  2HQT A;  2VL2 C;  1SEN A;  4V2N A;  1YQ1 A;  3A2W A;  4ECC A;  2C0D A;  1JZO A;  4HQS A;  4WET A;  5E4W A;  1M2B A;  4IW9 A;  4PQH A;  5ID2 A;  4MCU A;  2C4J A;  2DIY A;  2H30 A;  3HZ4 A;  4MJA A;  1XOA A;  2X8C A;  4EUY A;  1EP7 A;  5F06 A;  4F0B A;  3QFB C;  1WRY A;  4XCS A;  2CZ2 A;  3ERW A;  4K2D A;  3LXZ A;  2LST A;  1GLQ A;  4EL1 A;  2LQQ A;  1XWB A;  1NM3 A;  3FEU A;  3ZYW A;  2PVQ A;  4ZL8 A;  3C8E A;  5KEJ A;  1TRV A;  1YJ6 A;  2CVK A;  1VGL A;  1Z9H A;  1EEM A;  4J57 E;  3ME8 A;  1T3B A;  3S9F A;  1N2A A;  13GS A;  4ISD A;  4MK3 A;  2IME A;  2DJJ A;  3AY8 A;  1A8Y A;  1ZL9 A;  5B8B A;  4XRA A;  3LOR A;  3VWX A;  4BL7 A;  2FA8 A;  3C71 A;  2X8G A;  1A2L A;  1J0F A;  2OJL A;  3EU3 A;  4TKY A;  2WGR A;  2CX3 A;  1SL1 B;  4GLT A;  3R2Q A;  2REM A;  4LA1 A;  2VCV A;  4JBB A;  4KE3 A;  5INY A;  2V6K A;  4RQX A;  4PUR A;  3CTG A;  5FWG A;  4V1A g;  1H75 A;  2J9H A;  2C0E A;  3I69 A;  4DSQ A;  4MPG A;  2OE3 A;  1M2D A;  4IJI A;  3EMX A;  2H1D A;  2DIZ A;  3HVX A;  2IFQ B;  1QGV A;  5HR3 A;  1DE2 A;  2F51 A;  4TOP A;  2M72 A;  3GUS A;  1XWC A;  3UAR A;  3IA1 A;  3ZTL A;  3IXR A;  1IYI A;  2GQM A;  2LJA A;  2LV3 A;  4ZL9 A;  3F9U A;  5J9B A;  2C0F A;  1F3B A;  3FHK A;  3TRQ A;  1VF4 A;  3CRT A;  1XWK A;  4FIW A;  1G7O A;  2ZCT A;  4OO4 A;  1PKZ A;  3KJY A;  4K6X A;  3UEM A;  2FLS A;  4IQA A;  2B7J A;  2RLI A;  4O92 A;  3N9J A;  1U88 A;  1THX A;  1R5P A;  4IBP A;  4RI6 A;  4WF4 A;  1ZOF A;  3D21 A;  1JZD A;  5J4U A;  4HZ4 A;  2QKE A;  1AAZ A;  5H5Q A;  1A0R P;  1TTZ A;  1AW9 A;  4GSN A;  4L5L A;  5DAK B;  3EMP A;  3QR6 A;  5H5S A;  3TJJ A;  17GS A;  3L9S A;  3IC4 A;  4NHW A;  1EEJ A;  1SKW B;  2IPA A;  2N5A A;  3EU4 A;  3L78 A;  2WUL A;  4KDU A;  2XPD A;  1ZYQ B;  4O7H A;  4X1U A;  3PR8 A;  1GNE A;  2H70 A;  2HI7 A;  2DSA A;  4HS1 A;  5COH A;  1O8W A;  4GTU A;  2WRT A;  3ME7 A;  4O32 A;  1GSF A;  3HJM A;  1TOF A;  2DML A;  4V2M A;  2HSM B;  3W8J A;  4EF0 A;  3CSJ A;  4G2E A;  4ZXG A;  2VCZ A;  2V1M A;  2G0F A;  4G19 A;  3C7M A;  4MJB A;  2D2Z A;  5J5N A;  5ENU A;  4WR5 A;  3Q6O A;  2H0H A;  4F2I A;  3IRA A;  2LJK A;  4OFM A;  2VLT A;  4H86 A;  2HRK A;  4TR1 B;  4DEJ A;  5IMV A;  4G10 A;  2XPE A;  3DEX A;  3P2A A;  2EIO A;  1EGR A;  4Q5F A;  4N0Z A;  3FRC A;  2UZ8 A;  1ZZY A;  3E9J B;  2IMI A;  19GS A;  5G1K A;  2C1Y A;  1QMV A;  2GS3 A;  20GS A;  1XOB A;  3GX8 A;  4K1F A;  2VOC A;  3HYP A;  4DSS B;  3TRX A;  1G0T A;  2BJX A;  1V2A A;  2H6X A;  1NHY A;  2L57 A;  3KH7 A;  4D73 B;  3UOM A;  1N8J A;  3ZRD A;  3FZA A;  3M3M A;  2N5F A;  1MDK A;  4DVC A;  2PU9 C;  3LYK A;  4OCE A;  3MWH A;  5IO0 A;  5AIS A;  1T8E B;  1OC9 A;  2IJY A;  3M1G A;  3GMF A;  1XBS A;  4XS4 B;  4HZ2 A;  4YQM A;  3DVW A;  3I6A A;  2H66 A;  2PMT A;  1B4P A;  2X8H A;  1YF1 A;  2PGT A;  5D8I A;  3F4T A;  1OC3 A;  2FWG A;  1U3I A;  2LRN A;  3CSI A;  4ECJ A;  3ZL5 A;  1M7T A;  4FYB A;  3RPN A;  3HCZ A;  4HU7 A;  4MP4 A;  2I3Y A;  6GSS A;  3WGX A;  1MD3 A;  1ERV A;  3ZIV A;  3KEB A;  3QPM A;  3IDV A;  3GHA A;  1NW2 A;  2KOK A;  5IPH A;  5DJM A;  5G2Z A;  2I9H A;  1K0A A;  2V32 A;  1PX7 A;  1TK5 B;  4N11 A;  1DBY A;  1SL2 B;  3MDK A;  3GN3 A;  3WT2 A;  4Q5Q A;  1C72 A;  2CAI A;  1R4W A;  2P31 A;  2NVL A;  3P90 A;  3LGC A;  2LQO A;  1XFL A;  3FZ4 A;  2CZ3 A;  2E2G A;  1URM A;  1AC1 A;  4EO3 A;  1SD8 A;  3VLN A;  6GSW A;  1WMJ A;  4KDX A;  14GS A;  1MD4 A;  1GTA A;  3DWV A;  1EV4 A;  3DD3 A;  5IPG A;  1TXX A;  1XW9 A;  5G5E A;  3ZZX A;  1K0O A;  1M99 A;  3H79 A;  2VD1 A;  5DQY A;  3DXB A;  4ZBA A;  1OE8 A;  1O7U A;  1M9A A;  1G6Y A;  4ZL7 A;  1GSS A;  5ECH B;  3WD6 A;  1O73 A;  1K0B A;  3HJP A;  10GS A;  2O89 A;  3HY2 A;  2H0G A;  3K8N A;  1F6M C;  4BWS A;  3ZFL A;  3TDG A;  3RPP A;  4OD7 A;  2OBK A;  1SK2 A;  1K3Y A;  4WR4 A;  2ZUP A;  3F0I A;  4L5O A;  2O85 A;  5AIV A;  5CRH A;  3UVT A;  4G0K A;  2F9S A;  3HJO A;  1ST9 A;  5AIX A;  1UVZ A;  5J41 A;  2KHP A;  3U6V A;  4ZBB A;  3TRP A;  4GSS A;  1LU4 A;  2VAF A;  3HD5 A;  1GUM A;  4LL1 B;  2HZE A;  2NPB A;  1V9W A;  3UVH A;  4G0L A;  2R6K A;  3APQ A;  1K0C A;  3FY7 A;  4KB3 A;  2L4Q A;  4GST A;  4LMW A;  4TN8 A;  3QDN A;  2LS5 A;  3HKR A;  2IMK A;  3US3 A;  5ECK B;  1FW1 A;  4XS6 A;  4JR4 A;  5IMF A;  4KUN A;  3VFI A;  2BTO T;  1F9M A;  3F8U A;  3GFK A;  4X0X A;  5GAP D;  5G1L A;  3IC8 A;  4HJ2 A;  1FG4 A;  5J3R A;  2FGX A;  2H72 A;  2PN8 A;  4OCF A;  5DCH A;  4NPB A;  4NAX A;  4TRX A;  1MDI A;  1PGT A;  5D73 A;  4BVY B;  4OMV A;  1DE1 A;  1EP8 A;  1Q98 A;  2B5E A;  2HXK A;  1DUG A;  4YQV A;  3C73 A;  2WDU A;  1SK1 A;  2YV9 A;  2CT6 A;  5HFK A;  4TXO B;  4KDY A;  3D4T A;  1ZYE A;  3KP8 A;  3KXO A;  1WIK A;  2GST A;  5CRW A;  16GS A;  4NXI A;  4K8M A;  2HSM A;  2AHE A;  3HXS A;  3HZ8 A;  5B6M A;  2HRF A;  3C1R A;  3MNG A;  4K7O A;  1SJ6 A;  2F3M A;  2H19 A;  4JU5 A;  4JE1 A;  5GSS A;  1FVK A;  3IR4 A;  4FYU A;  5G30 A;  3CTF A;  2AAW A;  3HVV A;  3ZVJ A;  2GZP A;  2YN1 A;  1GTI A;  2YWO A;  3HHV A;  4IJ3 A;  4FO5 A;  4TR1 A;  3PGT A;  4WF5 A;  3H93 A;  4ILF A;  4DSR A;  5B6N A;  1WP0 A;  1VRS D;  1Z7R A;  4I2U A;  1QQ2 A;  2YPM A;  1E6B A;  4N30 A;  5BMU A;  2CA8 A;  4GCI A;  3I9V 2;  3MAK A;  4PUA A;  5DQS A;  3IAM 2;  4WKW A;  2LKU A;  2VL3 A;  3J7Y b;  1A2M A;  5AGY A;  3IPZ A;  3KH9 A;  2NTO A;  2HSH A;  3O3T A;  3BBY A;  1X5D A;  2VCQ A;  1OVN A;  3TKS A;  2IN3 A;  4POK A;  4HJM A;  3CMI A;  2B1K A;  4JZQ A;  2N5B A;  5C04 A;  1LBK A;  4LMV A;  1S3A A;  3FK8 A;  2H6Y A;  4PTS A;  5IQY A;  2R37 A;  2PER A;  1XVW A;  2B7K A;  3TKP A;  1HYU A;  4POB A;  3CSH A;  3OR5 A;  2GSR A;  4EKZ A;  2GTU A;  3KD0 A;  2GDR A;  4PNG A;  3DIE A;  2LRC A;  1V58 A;  3GYK A;  4HU9 A;  22GS A;  3LG6 A;  4KGI A;  2KLX A;  4MLY A;  4NV5 A;  2ES7 A;  1AXD A;  5JCG A;  3LYP A;  4ZIJ A;  3ZRE A;  1SYR A;  1Z5Y E;  5KN3 A;  2KP1 A;  2DBC A;  2OAD A;  3A2V A;  1OKT A;  3BOA A;  3VWU A;  1F2E A;  1FO5 A;  2H1A A;  5HR0 A;  1O8X A;  1XIY A;  1Q4J A;  4F82 A;  3TOU A;  2O87 A;  2B5Y A;  2GZZ A;  2L6C A;  4PGT A;  1K0M A;  5A4V A;  5IMD A;  1RK4 A;  1B8X A;  2JL4 A;  5DCG A;  2H8L A;  3BCK A;  4X43 A;  1GH2 A;  2C8U A;  3VI7 A;  1WE0 A;  1HNC A;  4JED A;  5F07 A;  2VM2 A;  3FZ9 A;  8GSS A;  1LJR A;  1KTE A;  2IWT A;  3I43 A;  2PUK C;  4TXV A;  4GWR A;  5L71 A;  3CRU A;  1M0U A;  4EE0 A;  1GSE A;  3GKK A;  3FYG A;  1SD9 A;  2VUP A;  4N10 A;  1XZO A;  4BA7 A;  3LEF A;  2PWJ A;  4TVE A;  3E0U A;  4IN0 A;  1T7P B;  5AN1 A;  3L9U A;  3L4N A;  1SJI A;  1XPV A;  1AQW A;  4KCE A;  3GTU A;  1X5C A;  3FW2 A;  1S3D A;  2HLS A;  1K3L A;  4OWY A;  4F0C A;  4PXO A;  3ED3 A;  1MDJ A;  1BED A;  4I6X A;  7GSS A;  2DC5 A;  4LLR A;  3ZIJ A;  2MBS A;  4OFT A;  2R4V A;  1WJK A;  3JCM L;  4KF9 A;  5ECR B;  4I5Q A;  1JLW A;  3M8N A;  3M0F A;  4KH7 A;  3APO A;  3G9B A;  3WGE A;  1GUH A;  4MH2 A;  2X64 A;  5E59 A;  2AV4 A;  2ON5 A;  2DJK A;  2XBI A;  5ID2 B;  4AJ8 A;  2H01 A;  1TJD A;  1GUL A;  4HQZ A;  5GAN D;  3BD2 A;  3GKX A;  3TKQ A;  2B3S A;  1EV9 A;  4IGJ A;  2VCW A;  4BVX A;  1TW9 A;  2I1U A;  4EDY A;  2FY6 A;  1EOG A;  3RHB A;  1EGO A;  4CHS A;  1QFN A;  1XCC A;  4V1A p;  3LJR A;  2HRN A;  3RHC A;  3F3R A;  5D9W A;  4PQI A;  3NZN A;  2F8A A;  1PL2 A;  4K7I A;  2HYX A;  2O8V B;  3W6G A;  5A4U A;  2XHF A;  1XXU A;  2H71 A;  4MZC A;  4BL7 B;  3D6I A;  4HUA A;  1TDI A;  2GVP A;  2GSS A;  2IL3 A;  1Z3E A;  3UL3 A;  2OBI A;  1TRU A;  1TRS A;  2FWF A;  1AQX A;  2HNL A;  3TKS C;  2L59 A;  3TJK A;  4ML6 A;  5DAL B;  2LRT A;  3GSS A;  2CQ9 A;  2IMD A;  1PSQ A;  5D93 A;  1THO A;  4AGS A;  2JAC A;  5KN1 A;  3TJF A;  3SWL A;  4NV2 A;  4POM A;  2VL2 A;  4TR3 A;  1OAZ A;  3QCP A;  2YZH A;  2FWE A;  3ZIT A;  3DVX A;  2FNO A;  5EL8 A;  5LD0 A;  3VPQ A;  5LCZ A;  1MEK A;  2VLU A;  2GT5 A;  2L4C A;  3KTB A;  6GSY A;  1USB A;  4QL9 A;  5CP1 A;  1YEX A;  1X5E A;  3LXT A;  5EY6 A;  2AYT A;  2CAQ A;  2MZC A;  2K6V A;  4QL7 A;  1GNW A;  2E2M A;  1WWJ A;  3EWL A;  3D22 A;  1Y6E A;  4L0U A;  4I97 A;  1WOU A;  3G7Y A;  3IK9 A;  4WBR D;  1M2A A;  4JRR A;  4KSO A;  2RII A;  3KTL A;  2TRC P;  4GF0 A;  1V57 A;  2J23 A;  1ZGN A;  2C3Q A;  2DJ0 A;  3UJ1 A;  2HT9 A;  3CYN A;  2FA4 A;  2WB9 A;  1EZK A;  3CXG A;  9GSS A;  4I8B A;  5DDL A;  2KP2 A;  4MF7 A;  1AIU A;  1XVQ A;  1A23 A;  1O85 A;  3MSZ A;  1GP1 A;  3ZVJ D;  3IBH A;  6GSV A;  2V6O A;  3QAV A;  5D9T A;  2YJ7 A;  2AB6 A;  5IOX A;  2JAD A;  4NHZ A;  1I9D A;  1TK8 B;  3FR3 A;  4WXT A;  1JHB A;  4MZW A;  1GSY A;  1BAY A;  4K9Z A;  1SYX A;  4GRF A;  2EC4 A;  4YAP A;  1HQO A;  3KZQ A;  2CX4 A;  2RUE A;  4IHU A;  6GST A;  1GSD A;  2Z9S A;  4IQ1 A;  2FUG 2;  2LNS A;  1HNA A;  5ECO B;  1NSW A;  1ILO A;  1T4Z A;  4FH8 A;  5G31 A;  2H75 A;  4J2F A;  3KCM A;  3TJG A;  3V1W A;  1TP9 A;  3L9V A;  2YCD A;  3VK9 A;  4XHM A;  6GSU A;  5HFG A;  4Q5R A;  2IFQ A;  1SKR B;  2JZS A;  3A2X A;  2OE1 A;  4YQU A;  1E2Y A;  5HFI A;  3HDC A;  3TUE A;  1R5A A;  4KW6 A;  5IO2 A;  1J08 A;  2K18 A;  3ZML A;  3ZFB A;  1VF3 A;  2DLX A;  3VWV A;  4KAE A;  1ZCP A;  1PX6 A;  3C1S A;  4I2T A;  4EXJ A;  2JSZ A;  1KNG A;  4XS1 A;  2CVB A;  1XW5 A;  2P5R A;  5F0G A;  3PPU A;  3HA9 A;  2NBS A;  2IIY A;  1TKD B;  1GTB A;  1A0F A;  1QXH A;  1RQM A;  4OO5 A;  2MBT A;  2HSN B;  1V40 A;  3KIJ A;  3TB2 A;  3GKM A;  4KND A;  1OE7 A;  5DAK A;  5A4W A;  1YF0 A;  3U5R E;  3D4M A;  5F05 A;  3UIW A;  1KBN A;  3Q19 A;  2E7P A;  4ZIL A;  4PNF A;  3IAS 2;  4YAV A;  4K0G A;  2VD0 A;  2E0Q A;  3IOS A;  1X9S B;  4ZBD A;  4NMU A;  3TKS E;  2OKA A;  6GSX A;  2GT6 A;  3EYT A;  4RQR A;  2R3X A;  3EVI A;  4IS0 A;  3G7J A;  2YOI A;  2RM5 A;  5ECL B;  2DJ1 A;  2HE3 A;  3H8Q A;  2GQK A;  2EIR A;  2NDO A;  5IMA A;  3H4K A;  1I5G A;  4XRD A;  3QAW A;  1SJZ A;  1A8L A;  4ULX A;  2V2G A;  4HOJ A;  3F6D A;  1GWC A;  4FYC A;  1SK0 A;  1X9M B;  1Z7P A;  1AQV A;  2YZU A;  2WZ9 A;  3E3E A;  4HI7 A;  3KMN A;  3UMA A;  1A24 A;  5CYY A;  3RDW A;  4ML1 A;  1VF2 A;  3VWW A;  3DKS A;  2GSQ A;  5LNK e;  1OC8 A;  3FR6 A;  4IVF A;  4DSS A;  3BJ5 A;  2LNT A;  4MDC A;  2I81 A;  4D73 A;  3L0H A;  2YWM A;  3ZMK A;  4WBJ A;  5IIZ A;  5KN2 A;  2GZY A;  3F63 A;  1O81 A;  5JCW A;  3N5O A;  2DMM A;  3GX0 A;  5IMZ A;  4JR6 A;  2F8F A;  3EC3 A;  2QC7 A;  4YH2 A;  4F9Z A;  4XS4 A;  1QK8 A;  2FWH A;  3NOF A;  3FR9 A;  2YJH A;  4MA9 A;  4MF6 A;  1XWA A;  1T00 A;  1WPI A;  5CRE A;  2FCH A;  3ERG A;  2JZR A;  4GXZ A;  4MF5 A;  2FHE A;  2C3T A;  5IOW A;  4ZB8 A;  4P3Y B;  4MZB A;  5CNW A;  18GS A;  3WT1 A;  4TW5 A;  4FQU A;  5D9V A;  4K7N A;  2WJU A;  2VO4 A;  1X9W B;  5DAL A;  1W89 A;  2YWN A;  4J56 E;  1FB0 A;  3TKR A;  3O6T A;  2OAC A;  3Q18 A;  2M80 A;  2I4A A;  3QAG A;  4MH3 A;  3PIN A;  1ABA A;  3FKF A;  4XTS A;  4HEA 2;  4MJE A;  2P0G A;  5ELA A;  2HZE B;  4MPF A;  3F4R A;  2V41 A;  1EOH A;  3RBT A;  3WYW A;  1F37 A;  3KMO A;  3IHQ A;  2TRX A;  3VUR A;  1BJX A;  4G9H A;  3DGQ A;  2VL9 A;  1EWX A;  3PH9 A;  3GST A;  4E8E A;  3KGK A;  2WCI A;  3DYR A;  11GS A;  4L0W A;  3IK7 A;  2K8S A;  2AUV A;  2FD3 A;  4KX4 A;  4LL4 B;  5DJL A;  2CVD A;  1RW1 A;  5A5K A;  2H1B A;  2LTK A;  2C3N A;  2O7K A;  1FAA A;  5ECM B;  1U87 A;  2DJ3 A;  2GQL A;  1OYJ A;  3J7Y k;  4ECB A;  1ERW A;  4QQ7 A;  2VCT A;  1JZW A;  3WGD A;  2C0G A;  3QFA C;  3CBU A;  2MMZ A;  2K9F A;  4TR4 A;  2PPT A;  5CAX A;  3UBK A;  1PL1 A;  1FB6 A;  2HSY A;  1ML6 A;  1PA3 A;  4EDZ A;  4O5R A;  1BQ7 A;  1TI1 A;  2XBQ A;  3P7X A;  1YZX A;  1T4Y A;  4AF2 A;  5JWQ B;  2VLV A;  5FT3 A;  3TCO A;  4L8E A;  5HR1 A;  4V2L A;  3IV4 A;  3SBC A;  2DJ2 A;  4AJ6 A;  4MJC A;  1TU7 A;  3O76 A;  4CW9 A;  3GH6 A;  4MAB A;  3DML A;  1YKA A;  2AJQ B;  2BMX A;  1U3A A;  2L6D A; 
#chains in the Genus database with same CATH topology
 3GL3 A;  3RAZ A;  4EVM A;  2GGT A;  1ACV A;  3Q74 A;  4PQ1 A;  4ID0 A;  2RUF A;  4OFN A;  3GV1 A;  2QA1 A;  4KA0 A;  4Q5N A;  1G7E A;  3EUR A;  1ON4 A;  1T1V A;  3KM6 A;  3R3E A;  1YY7 A;  2WW0 A;  2A2S A;  1UA5 A;  2H1G A;  1G6W A;  2XC2 A;  2VKZ G;  3GH9 A;  3M9K A;  4PX1 A;  1PFO A;  5CRD A;  4BWQ A;  4HSC X;  5BMU B;  2VM1 A;  4GQF A;  2MMO A;  1A2J A;  4Z7X A;  5D9X A;  1JLV A;  5ECS A;  1JZR A;  2H74 A;  5HR2 A;  4ECI A;  1B9X C;  5H5R A;  3D0Z A;  3QD9 A;  3GNJ A;  3D5J A;  2G2Q A;  4PUF C;  3APS A;  5GZZ B;  2HSN A;  2H76 A;  1B48 A;  1GL8 A;  5DVB A;  5EVO A;  1TK0 B;  4BVY A;  2QGV A;  2JSY A;  5J9C A;  2WS2 A;  2PBJ A;  4G0I A;  1BYE A;  1GSU A;  2JU5 A;  2ALB A;  1SKS B;  2X99 A;  3GKN A;  2HZF A;  2MMA A;  4IP1 A;  1PMT A;  5G5F A;  4MMM A;  2LUS A;  1JFU A;  3IE3 A;  1PN9 A;  4TXO A;  4ZB6 A;  5ECI B;  5F8B A;  2O3E A;  2TIR A;  2OT3 A;  1FHE A;  5ECQ B;  2A4H A;  4AI6 A;  2IMF A;  5ABR A;  1IYH A;  3LWA A;  4TR0 A;  1CQH A;  2LEG A;  5ECP B;  4F03 A;  1Y25 A;  3M9J A;  3NIV A;  1TU8 A;  3TGZ A;  1B4Q A;  3ZLP A;  2LJR A;  1DSB A;  5JWO B;  1XW6 A;  2CV4 A;  2JZT A;  1UN2 A;  2H6Z A;  4KSM A;  3LQ7 A;  1KEB A;  2ZNM A;  4RI7 A;  1YEP A;  2L5L A;  5CRG A;  3HVS A;  2YWI A;  5C00 A;  5D96 A;  4IP6 A;  1K0D A;  2ON7 A;  3P8W A;  2OA7 A;  1UC7 A;  2A4V A;  1R26 A;  2R5G A;  1OKD A;  4PI0 C;  4RUV A;  2H0I A;  2R0G A;  4IEL A;  1GTU A;  1Z6M A;  5HQP A;  1V98 A;  3EE2 A;  1K3O A;  3CQF A;  3QOU A;  4EC0 A;  1Z6N A;  1X0R A;  4HDE A;  2YNX A;  1GRX A;  5JWR B;  3GL5 A;  1HD2 A;  2R2J A;  2YAN A;  2WVY A;  3MIX A;  1F3A A;  5DBQ A;  4BPY A;  2B1L A;  5ELG A;  4GQC A;  12GS A;  3GA4 A;  1ERU A;  1CQG A;  3RFR C;  5KN0 A;  3GTU B;  4POL A;  3DRN A;  5ECN B;  2VIM A;  3UBL A;  2P5Q A;  5CO3 A;  1J9B A;  2OE0 A;  2B6M A;  4WEY A;  4NWY A;  1PKW A;  3F3Q A;  3ISO A;  3GUR A;  1S3C A;  2HRK B;  1SU9 A;  1MTC A;  5BRT A;  1FVJ A;  2MMN A;  4ZB9 A;  1QUW A;  1GUK A;  5JCU A;  1M3J A;  4ACS A;  2L5O A;  2QSI A;  2EIQ A;  5GST A;  3GIX A;  4MNN A;  4IKH A;  1XWG A;  2B5X A;  2MYG A;  1PD2 1;  3EIN A;  1YDK A;  4K0N A;  4AKG A;  3TOT A;  3FZ5 A;  3GRX A;  2HFD A;  1GSQ A;  3KP9 A;  1VF1 A;  3QMX A;  3H1N A;  3G7I A;  5IMC A;  3VI5 A;  1PRX A;  4USS A;  4BVX B;  3F4S A;  3BCI A;  3A3T A;  1PQN A;  4AJ7 A;  4CDO A;  1FOV A;  1K0N A;  1GLP A;  2YP6 A;  2H73 A;  2A2R A;  1ZMA A;  3VPT A;  1R7H A;  2WFC A;  1TRW A;  2M46 A;  2YV7 A;  1BG5 A;  1OC9 B;  5FHI A;  3F6F A;  1BX9 A;  2K8V A;  1O6J A;  1B9Y C;  4E8H A;  2VCX A;  5B7C A;  1AUC A;  2HRA A;  3UAP A;  3IHG A;  1TI3 A;  1YKC A;  1M9B A;  5IM9 A;  3W8S A;  1H4O A;  1SL0 B;  2PVO C;  3LFL A;  1U6T A;  4XIH A;  1W4V A;  3LSZ A;  2X4A A;  5B8A A;  2KUC A;  1ERT A;  4N0V A;  2C80 A;  1HNB A;  3A5W A;  3TJB A;  2RM6 A;  2GLR A;  5A34 B;  1NHO A;  4KCA A;  5EPF A;  3ERF A;  2HQT A;  2VL2 C;  1SEN A;  4V2N A;  1YQ1 A;  1YVL A;  3A2W A;  4ECC A;  2C0D A;  3MYD A;  1JZO A;  4HQS A;  4WET A;  5E4W A;  1M2B A;  4IW9 A;  4PQH A;  5ID2 A;  4MCU A;  2C4J A;  2DIY A;  3HZ4 A;  2H30 A;  4MJA A;  1XOA A;  2X8C A;  4EUY A;  1EP7 A;  5F06 A;  4F0B A;  3QFB C;  1WRY A;  4XCS A;  2CZ2 A;  3ERW A;  4K2D A;  3LXZ A;  4YKG A;  2LST A;  1GLQ A;  4EL1 A;  2LQQ A;  1XWB A;  1NM3 A;  3FEU A;  3ZYW A;  2PVQ A;  4ZL8 A;  3C8E A;  5KEJ A;  1TRV A;  1YJ6 A;  2CVK A;  1VGL A;  1Z9H A;  1EEM A;  4J57 E;  4Z2U A;  3ME8 A;  1T3B A;  4ZB7 A;  4PI2 C;  3S9F A;  1N2A A;  13GS A;  4ISD A;  4MK3 A;  2IME A;  2DJJ A;  3AY8 A;  1A8Y A;  1ZL9 A;  5B8B A;  4XRA A;  3LOR A;  3VWX A;  4BL7 A;  2FA8 A;  3C71 A;  2X8G A;  1A2L A;  1J0F A;  2UV8 G;  2OJL A;  3EU3 A;  4TKY A;  2WGR A;  2CX3 A;  1SL1 B;  4GLT A;  3R2Q A;  2REM A;  4LA1 A;  2VCV A;  4JBB A;  4KE3 A;  5INY A;  2V6K A;  4AKI A;  4RQX A;  4PUR A;  3CTG A;  5FWG A;  4V1A g;  1H75 A;  2J9H A;  2C0E A;  3I69 A;  4DSQ A;  4MPG A;  2OE3 A;  1M2D A;  5KOX A;  4IJI A;  3EMX A;  2H1D A;  2DIZ A;  3HVX A;  2IFQ B;  1QGV A;  3CHX C;  5HR3 A;  1DE2 A;  2F51 A;  4TOP A;  2M72 A;  3GUS A;  1XWC A;  3UAR A;  3IA1 A;  5A1N A;  3ZTL A;  3IXR A;  1IYI A;  2GQM A;  2LJA A;  2LV3 A;  4ZL9 A;  3F9U A;  5J9B A;  2C0F A;  4FXY P;  1F3B A;  2EFC A;  3FHK A;  3TRQ A;  1VF4 A;  3CRT A;  1XWK A;  4FIW A;  1G7O A;  2ZCT A;  4OO4 A;  1PKZ A;  3KJY A;  4K6X A;  3UEM A;  2FLS A;  4IQA A;  2B7J A;  2RLI A;  4O92 A;  3N9J A;  1U88 A;  1THX A;  1R5P A;  4IBP A;  4RI6 A;  4WF4 A;  1ZOF A;  3D21 A;  1JZD A;  5J4U A;  4HZ4 A;  2QKE A;  3TU3 B;  4EIQ A;  1AAZ A;  5H5Q A;  1A0R P;  1TTZ A;  1AW9 A;  4GSN A;  4L5L A;  5DAK B;  3EMP A;  3QR6 A;  5H5S A;  3TJJ A;  17GS A;  3L9S A;  3IC4 A;  4NHW A;  1EEJ A;  1SKW B;  2IPA A;  2N5A A;  3EU4 A;  3L78 A;  2WUL A;  4KDU A;  2XPD A;  1ZYQ B;  4O7H A;  4X1U A;  3PR8 A;  1GNE A;  2H70 A;  2HI7 A;  2DSA A;  4HS1 A;  5COH A;  1O8W A;  4GTU A;  2WRT A;  3ME7 A;  4O32 A;  1GSF A;  3HJM A;  1TOF A;  2DML A;  4V2M A;  2HSM B;  3W8J A;  4EF0 A;  3CSJ A;  4G2E A;  4ZXG A;  2VCZ A;  2V1M A;  2G0F A;  4G19 A;  3C7M A;  4MJB A;  2D2Z A;  5J5N A;  5ENU A;  4WR5 A;  3Q6O A;  2H0H A;  4F2I A;  3IRA A;  2LJK A;  4OFM A;  2VLT A;  4H86 A;  2HRK A;  4TR1 B;  4DEJ A;  5IMV A;  1ZYP A;  2WVZ A;  4G10 A;  2XPE A;  3DEX A;  3P2A A;  2EIO A;  1EGR A;  4Q5F A;  4QMK A;  4N0Z A;  3FRC A;  2UZ8 A;  1ZZY A;  3E9J B;  2IMI A;  19GS A;  5G1K A;  2C1Y A;  1QMV A;  2GS3 A;  20GS A;  1XOB A;  3GX8 A;  4K1F A;  2VOC A;  3HYP A;  4DSS B;  3TRX A;  1G0T A;  2BJX A;  1V2A A;  1BF5 A;  2H6X A;  1NHY A;  2L57 A;  3KH7 A;  4D73 B;  3UOM A;  1N8J A;  3ZRD A;  3FZA A;  3M3M A;  2N5F A;  1MDK A;  4DVC A;  2PU9 C;  3LYK A;  4OCE A;  3MWH A;  5IO0 A;  5AIS A;  1T8E B;  1OC9 A;  2IJY A;  3M1G A;  3GMF A;  1XBS A;  4XS4 B;  4HZ2 A;  4YQM A;  3DVW A;  3I6A A;  2H66 A;  2PMT A;  1B4P A;  2X8H A;  1YF1 A;  2PGT A;  5D8I A;  3F4T A;  1OC3 A;  4YKF A;  2FWG A;  1U3I A;  2LRN A;  3CSI A;  4ECJ A;  3ZL5 A;  1M7T A;  4FYB A;  4O5Q A;  3RPN A;  1XG8 A;  3HCZ A;  4HU7 A;  4MP4 A;  2I3Y A;  6GSS A;  3WGX A;  1MD3 A;  1ERV A;  3CWG A;  3ZIV A;  3KEB A;  3QPM A;  3IDV A;  3GHA A;  1NW2 A;  2KOK A;  5IPH A;  5DJM A;  5G2Z A;  2I9H A;  1K0A A;  2V32 A;  1PX7 A;  1TK5 B;  4N11 A;  1DBY A;  1SL2 B;  3MDK A;  3GN3 A;  3WT2 A;  4Q5Q A;  1C72 A;  2CAI A;  1R4W A;  2P31 A;  2NVL A;  3P90 A;  2LQO A;  3LGC A;  1XFL A;  3FZ4 A;  2CZ3 A;  2E2G A;  1URM A;  1S4B P;  1AC1 A;  4EO3 A;  1SD8 A;  3VLN A;  6GSW A;  1WMJ A;  4KDX A;  14GS A;  1MD4 A;  1GTA A;  3DWV A;  1EV4 A;  3DD3 A;  5KOW A;  5J40 A;  5IPG A;  1TXX A;  1XW9 A;  5G5E A;  3ZZX A;  5A5H B;  1K0O A;  1M99 A;  3H79 A;  2VD1 A;  5DQY A;  3DXB A;  4ZBA A;  1OE8 A;  1O7U A;  1M9A A;  1G6Y A;  2WVX A;  4ZL7 A;  1GSS A;  5ECH B;  3WD6 A;  1O73 A;  1K0B A;  3HJP A;  10GS A;  2O89 A;  3HY2 A;  5J4Y A;  2H0G A;  3K8N A;  1F6M C;  4BWS A;  3ZFL A;  3TDG A;  3RPP A;  4OD7 A;  2H1L A;  1BG1 A;  2OBK A;  1SK2 A;  1K3Y A;  4WR4 A;  2ZUP A;  3F0I A;  4L5O A;  2O85 A;  5AIV A;  5CRH A;  3UVT A;  1Y1U A;  4G0K A;  2F9S A;  3HJO A;  2WW3 A;  1ST9 A;  5AIX A;  1UVZ A;  5J41 A;  2KHP A;  1YEW C;  3U6V A;  4ZBB A;  3TRP A;  4GSS A;  1LU4 A;  2VAF A;  3HD5 A;  1GUM A;  4LL1 B;  2HZE A;  2NPB A;  4EIP A;  1V9W A;  3UVH A;  4G0L A;  2R6K A;  3APQ A;  1K0C A;  3FY7 A;  2L4Q A;  4KB3 A;  4GST A;  4LMW A;  4TN8 A;  3QDN A;  1I1I P;  2LS5 A;  3HKR A;  2IMK A;  3US3 A;  5ECK B;  1FW1 A;  4XS6 A;  4JR4 A;  5IMF A;  2DKI A;  4KUN A;  3VFI A;  2BTO T;  1F9M A;  3F8U A;  3GFK A;  4X0X A;  5GAP D;  5G1L A;  3IC8 A;  4HJ2 A;  1FG4 A;  5J3R A;  2FGX A;  2H72 A;  2PN8 A;  1TXU A;  4OCF A;  5DCH A;  4NPB A;  4NAX A;  4TRX A;  1MDI A;  1PGT A;  5D73 A;  4BVY B;  4OMV A;  1DE1 A;  1EP8 A;  1Q98 A;  2B5E A;  2HXK A;  1DUG A;  4Z2T A;  1S3R A;  4YQV A;  3C73 A;  2WDU A;  1SK1 A;  2YV9 A;  2CT6 A;  5HFK A;  4TXO B;  4KDY A;  3D4T A;  1ZYE A;  3KP8 A;  3KXO A;  1WIK A;  2GST A;  5CRW A;  16GS A;  4NXI A;  4K8M A;  2HSM A;  2AHE A;  3HXS A;  3HZ8 A;  5B6M A;  2HRF A;  4CY8 A;  3C1R A;  3MNG A;  4K7O A;  1SJ6 A;  2F3M A;  2H19 A;  4JU5 A;  4JE1 A;  4K5S A;  5GSS A;  1FVK A;  1M3I A;  3IR4 A;  4FYU A;  5G30 A;  3CTF A;  2AAW A;  3HVV A;  3ZVJ A;  2GZP A;  2YN1 A;  1GTI A;  2YWO A;  3HHV A;  4IJ3 A;  4FO5 A;  4TR1 A;  3PGT A;  4WF5 A;  4K5R A;  3HMJ G;  3H93 A;  4ILF A;  4DSR A;  5B6N A;  1WP0 A;  1VRS D;  1Z7R A;  4I2U A;  1QQ2 A;  2YPM A;  1E6B A;  4N30 A;  5BMU A;  2CA8 A;  4GCI A;  3I9V 2;  3MAK A;  4PUA A;  5DQS A;  3A5I A;  3IAM 2;  4WKW A;  2LKU A;  2VL3 A;  2O5V A;  3J7Y b;  1A2M A;  5AGY A;  3IPZ A;  2WZS A;  3KH9 A;  2NTO A;  1PN0 A;  2HSH A;  3O3T A;  3BBY A;  1X5D A;  2VCQ A;  1OVN A;  3TKS A;  2IN3 A;  4POK A;  4HJM A;  3CMI A;  2B1K A;  4JZQ A;  2N5B A;  5C04 A;  1LBK A;  4LMV A;  1S3A A;  3FK8 A;  2H6Y A;  4PTS A;  5IQY A;  2R37 A;  2PER A;  1XVW A;  2B7K A;  3TKP A;  1HYU A;  4POB A;  3CSH A;  3OR5 A;  2GSR A;  4EKZ A;  2GTU A;  3KD0 A;  2GDR A;  4PNG A;  3DIE A;  1FOH A;  2LRC A;  1V58 A;  3GYK A;  4HU9 A;  22GS A;  3LG6 A;  4KGI A;  2KLX A;  4MLY A;  4NV5 A;  2ES7 A;  1AXD A;  5JCG A;  3LYP A;  4ZIJ A;  3ZRE A;  1SYR A;  1Z5Y E;  5KN3 A;  2KP1 A;  2DBC A;  2OAD A;  3A2V A;  1OKT A;  3EPT A;  3BOA A;  3VWU A;  1F2E A;  1FO5 A;  2H1A A;  5HR0 A;  1O8X A;  1XIY A;  1Q4J A;  4F82 A;  3TOU A;  2O87 A;  2B5Y A;  2GZZ A;  2L6C A;  4PGT A;  1K0M A;  5A4V A;  5IMD A;  1RK4 A;  1B8X A;  2JL4 A;  5DCG A;  2H8L A;  3BCK A;  4X43 A;  1GH2 A;  2C8U A;  2DKH A;  3VI7 A;  1WE0 A;  1HNC A;  4JED A;  5F07 A;  2VM2 A;  5A5H A;  3FZ9 A;  8GSS A;  1LJR A;  1KTE A;  2IWT A;  3I43 A;  2PUK C;  4TXV A;  4GWR A;  5L71 A;  3CRU A;  1M0U A;  4EE0 A;  1GSE A;  3GKK A;  3FYG A;  1SD9 A;  2VUP A;  4N10 A;  1XZO A;  4BA7 A;  3LEF A;  2PWJ A;  4TVE A;  3E0U A;  4IN0 A;  1T7P B;  5AN1 A;  3L9U A;  4AKH A;  3L4N A;  1SJI A;  1XPV A;  1AQW A;  4KCE A;  3GTU A;  1X5C A;  1SVM A;  3FW2 A;  1S3D A;  2HLS A;  1K3L A;  4OWY A;  4F0C A;  4PXO A;  3ED3 A;  1MDJ A;  1BED A;  4I6X A;  7GSS A;  2DC5 A;  4LLR A;  3ZIJ A;  2MBS A;  4OFT A;  2R4V A;  1WJK A;  3JCM L;  4KF9 A;  5ECR B;  4GDF A;  4I5Q A;  1JLW A;  3M8N A;  3M0F A;  4KH7 A;  1SVL A;  3APO A;  3G9B A;  3WGE A;  1GUH A;  4MH2 A;  2X64 A;  5E59 A;  2AV4 A;  2ON5 A;  2DJK A;  2XBI A;  5ID2 B;  4AJ8 A;  2H01 A;  1TJD A;  1GUL A;  4HQZ A;  5GAN D;  3BD2 A;  3GKX A;  4PHZ C;  3TKQ A;  5J4V A;  2B3S A;  1EV9 A;  4IGJ A;  2VCW A;  4BVX A;  1TW9 A;  2I1U A;  4EDY A;  2FY6 A;  1EOG A;  3RHB A;  2X49 A;  4X4J A;  1EGO A;  4CHS A;  1QFN A;  1XCC A;  4V1A p;  3LJR A;  2HRN A;  3RHC A;  3F3R A;  5D9W A;  4PQI A;  3NZN A;  2F8A A;  2WW2 A;  1PL2 A;  4K7I A;  2HYX A;  2O8V B;  3W6G A;  5A4U A;  2XHF A;  1XXU A;  2H71 A;  4MZC A;  4BL7 B;  3D6I A;  1SVO A;  4HUA A;  1TDI A;  2GVP A;  2GSS A;  2IL3 A;  1Z3E A;  3UL3 A;  2OBI A;  2QA2 A;  1TRU A;  1TRS A;  2FWF A;  1AQX A;  2HNL A;  3TKS C;  2L59 A;  2R0C A;  3TJK A;  4ML6 A;  5DAL B;  2LRT A;  3GSS A;  2CQ9 A;  2IMD A;  1PSQ A;  5D93 A;  1THO A;  4AGS A;  2JAC A;  5KN1 A;  3TJF A;  3SWL A;  4NV2 A;  4POM A;  2VL2 A;  4TR3 A;  1OAZ A;  3QCP A;  2YZH A;  2FWE A;  3ZIT A;  3DVX A;  2FNO A;  5EL8 A;  5LD0 A;  3VPQ A;  5LCZ A;  1MEK A;  2VLU A;  5A34 A;  2GT5 A;  2L4C A;  3KTB A;  6GSY A;  1USB A;  4QL9 A;  5CP1 A;  2WW1 A;  1YEX A;  1X5E A;  3LXT A;  5EY6 A;  2AYT A;  2CAQ A;  2MZC A;  2K6V A;  4QL7 A;  5A1N B;  1GNW A;  2E2M A;  1WWJ A;  3EWL A;  3D22 A;  1Y6E A;  4L0U A;  4I97 A;  1WOU A;  3G7Y A;  3IK9 A;  4WBR D;  1M2A A;  4JRR A;  4KSO A;  2RII A;  3KTL A;  2TRC P;  4GF0 A;  1V57 A;  2J23 A;  1ZGN A;  2C3Q A;  2DJ0 A;  3UJ1 A;  2HT9 A;  3CYN A;  2FA4 A;  2WB9 A;  1EZK A;  3CXG A;  9GSS A;  4I8B A;  5DDL A;  2KP2 A;  4MF7 A;  1AIU A;  1XVQ A;  1A23 A;  1O85 A;  3MSZ A;  1GP1 A;  4A5P A;  3ZVJ D;  3IBH A;  6GSV A;  2V6O A;  3QAV A;  5D9T A;  2YJ7 A;  2AB6 A;  5IOX A;  2JAD A;  4NHZ A;  1I9D A;  1TK8 B;  3FR3 A;  4WXT A;  1JHB A;  4MZW A;  1GSY A;  1BAY A;  4K9Z A;  1SYX A;  4GRF A;  2EC4 A;  4YAP A;  1HQO A;  3KZQ A;  2CX4 A;  2RUE A;  4IHU A;  6GST A;  1GSD A;  2Z9S A;  4IQ1 A;  2FUG 2;  2LNS A;  1HNA A;  5ECO B;  1NSW A;  1ILO A;  1T4Z A;  4FH8 A;  1ZYN A;  3LW9 A;  5G31 A;  2H75 A;  4J2F A;  3KCM A;  3TJG A;  3V1W A;  2EFH A;  1TP9 A;  3L9V A;  2YCD A;  3VK9 A;  4XHM A;  6GSU A;  5HFG A;  4Q5R A;  2IFQ A;  4Z2R A;  1SKR B;  2JZS A;  3A2X A;  2OE1 A;  4YQU A;  1E2Y A;  5HFI A;  3HDC A;  3TUE A;  1R5A A;  4KW6 A;  5IO2 A;  1J08 A;  2K18 A;  3ZML A;  3ZFB A;  1VF3 A;  2DLX A;  3RGB C;  3FMW A;  4K2X A;  3VWV A;  4KAE A;  1ZCP A;  2A2P A;  1PX6 A;  3C1S A;  4I2T A;  4EXJ A;  2JSZ A;  1KNG A;  4XS1 A;  2CVB A;  1XW5 A;  2P5R A;  5F0G A;  3PPU A;  3HA9 A;  2NBS A;  2IIY A;  1TKD B;  1GTB A;  1A0F A;  1QXH A;  1RQM A;  4OO5 A;  2MBT A;  2HSN B;  1V40 A;  3KIJ A;  3TB2 A;  3GKM A;  4KND A;  1OE7 A;  4O5U A;  5DAK A;  5A4W A;  1YF0 A;  4ICY A;  3U5R E;  3D4M A;  5F05 A;  3UIW A;  1KBN A;  3Q19 A;  2E7P A;  4ZIL A;  4PNF A;  3IAS 2;  4YAV A;  4K0G A;  2VD0 A;  2E0Q A;  3IOS A;  1X9S B;  4ZBD A;  4NMU A;  4AKX B;  3TKS E;  2OKA A;  6GSX A;  2GT6 A;  3EYT A;  4RQR A;  2R3X A;  3EVI A;  4IS0 A;  3G7J A;  2YOI A;  2RM5 A;  5ECL B;  2DJ1 A;  2HE3 A;  3H8Q A;  2GQK A;  2EIR A;  2NDO A;  5IMA A;  3H4K A;  1I5G A;  4XRD A;  3QAW A;  1SJZ A;  1A8L A;  4ULX A;  2V2G A;  4HOJ A;  3F6D A;  1GWC A;  4FYC A;  1SK0 A;  1X9M B;  1Z7P A;  1AQV A;  2YZU A;  2WZ9 A;  3E3E A;  4HI7 A;  3KMN A;  4W66 A;  3UMA A;  1A24 A;  2R0P A;  5CYY A;  3RDW A;  4ML1 A;  1VF2 A;  3VWW A;  3DKS A;  2GSQ A;  5LNK e;  1OC8 A;  3FR6 A;  4IVF A;  4E68 A;  4DSS A;  3BJ5 A;  2LNT A;  4MDC A;  2I81 A;  4D73 A;  3L0H A;  2YWM A;  2O36 A;  3ZMK A;  4WBJ A;  5IIZ A;  5KN2 A;  2GZY A;  2WVX B;  3F63 A;  1O81 A;  5JCW A;  3N5O A;  2DMM A;  3GX0 A;  5IMZ A;  4JR6 A;  2F8F A;  3EC3 A;  2QC7 A;  4YH2 A;  4F9Z A;  4G01 A;  4XS4 A;  1QK8 A;  2FWH A;  3NOF A;  3FR9 A;  2YJH A;  4MA9 A;  4MF6 A;  1XWA A;  1T00 A;  1WPI A;  5CRE A;  2FCH A;  3ERG A;  2JZR A;  4GXZ A;  4MF5 A;  2FHE A;  2C3T A;  5IOW A;  4ZB8 A;  4P3Y B;  4MZB A;  5CNW A;  18GS A;  3WT1 A;  4TW5 A;  4FQU A;  5D9V A;  4K7N A;  2WJU A;  2VO4 A;  1X9W B;  5DAL A;  1W89 A;  2YWN A;  4J56 E;  1FB0 A;  3TKR A;  3O6T A;  2OAC A;  3Q18 A;  2M80 A;  2I4A A;  3QAG A;  4MH3 A;  1N25 A;  3PIN A;  1ABA A;  3FKF A;  4XTS A;  4HEA 2;  4MJE A;  2P0G A;  5ELA A;  2HZE B;  2EFE A;  4MPF A;  3F4R A;  2V41 A;  1EOH A;  3RBT A;  3WYW A;  1F37 A;  3KMO A;  3IHQ A;  2TRX A;  3VUR A;  1BJX A;  4G9H A;  3DGQ A;  2VL9 A;  1EWX A;  3PH9 A;  3GST A;  4E8E A;  3KGK A;  2WCI A;  3DYR A;  11GS A;  4L0W A;  3IK7 A;  2K8S A;  2AUV A;  2FD3 A;  4KX4 A;  4LL4 B;  5DJL A;  2CVD A;  1RW1 A;  5A5K A;  2H1B A;  2LTK A;  2C3N A;  2O7K A;  1FAA A;  5ECM B;  1U87 A;  2DJ3 A;  2GQL A;  1OYJ A;  3J7Y k;  4ECB A;  1ERW A;  5J47 A;  4QQ7 A;  2VCT A;  4BIK A;  1JZW A;  3WGD A;  4CY6 A;  2C0G A;  3QFA C;  3CBU A;  2MMZ A;  2K9F A;  4TR4 A;  2PPT A;  5CAX A;  3UBK A;  1PL1 A;  1FB6 A;  2HSY A;  1ML6 A;  1PA3 A;  4EDZ A;  4O5R A;  1BQ7 A;  1TI1 A;  2XBQ A;  3P7X A;  1YZX A;  1T4Y A;  4AF2 A;  5JWQ B;  2VLV A;  4N3Z A;  5FT3 A;  3TCO A;  4L8E A;  5HR1 A;  4V2L A;  2EFD A;  3IV4 A;  3SBC A;  2DJ2 A;  4AJ6 A;  4MJC A;  1TU7 A;  3O76 A;  4CW9 A;  3GH6 A;  4MAB A;  3DML A;  1YKA A;  2AJQ B;  2BMX A;  1U3A A;  2L6D A;  3HVN A; 
#chains in the Genus database with same CATH homology
 3GL3 A;  3RAZ A;  4EVM A;  2GGT A;  1ACV A;  3Q74 A;  4PQ1 A;  4ID0 A;  2RUF A;  4OFN A;  3GV1 A;  2QA1 A;  4KA0 A;  4Q5N A;  1G7E A;  3EUR A;  1ON4 A;  1T1V A;  3KM6 A;  3R3E A;  1YY7 A;  2A2S A;  1UA5 A;  2H1G A;  1G6W A;  2XC2 A;  2VKZ G;  3GH9 A;  3M9K A;  4PX1 A;  5CRD A;  4BWQ A;  5BMU B;  2VM1 A;  4GQF A;  2MMO A;  1A2J A;  4Z7X A;  5D9X A;  1JLV A;  5ECS A;  1JZR A;  2H74 A;  5HR2 A;  4ECI A;  1B9X C;  5H5R A;  3D0Z A;  3QD9 A;  3GNJ A;  3D5J A;  2G2Q A;  4PUF C;  3APS A;  5GZZ B;  2HSN A;  2H76 A;  1B48 A;  1GL8 A;  5DVB A;  5EVO A;  1TK0 B;  4BVY A;  2QGV A;  2JSY A;  5J9C A;  2WS2 A;  2PBJ A;  4G0I A;  1BYE A;  1GSU A;  2JU5 A;  2ALB A;  1SKS B;  2X99 A;  3GKN A;  2HZF A;  2MMA A;  4IP1 A;  1PMT A;  5G5F A;  4MMM A;  2LUS A;  1JFU A;  3IE3 A;  1PN9 A;  4TXO A;  4ZB6 A;  5ECI B;  5F8B A;  2TIR A;  2OT3 A;  1FHE A;  5ECQ B;  2A4H A;  4AI6 A;  2IMF A;  5ABR A;  1IYH A;  3LWA A;  4TR0 A;  1CQH A;  2LEG A;  5ECP B;  4F03 A;  1Y25 A;  3M9J A;  3NIV A;  1TU8 A;  3TGZ A;  1B4Q A;  3ZLP A;  2LJR A;  1DSB A;  5JWO B;  1XW6 A;  2CV4 A;  2JZT A;  1UN2 A;  2H6Z A;  4KSM A;  3LQ7 A;  1KEB A;  2ZNM A;  4RI7 A;  1YEP A;  2L5L A;  5CRG A;  3HVS A;  2YWI A;  5C00 A;  5D96 A;  4IP6 A;  1K0D A;  2ON7 A;  3P8W A;  2OA7 A;  1UC7 A;  2A4V A;  1R26 A;  2R5G A;  1OKD A;  4RUV A;  2H0I A;  2R0G A;  4IEL A;  1GTU A;  1Z6M A;  5HQP A;  1V98 A;  3EE2 A;  1K3O A;  3QOU A;  4EC0 A;  1Z6N A;  1X0R A;  4HDE A;  2YNX A;  1GRX A;  5JWR B;  3GL5 A;  1HD2 A;  2R2J A;  2YAN A;  3MIX A;  1F3A A;  5DBQ A;  4BPY A;  2B1L A;  5ELG A;  4GQC A;  12GS A;  3GA4 A;  1ERU A;  1CQG A;  5KN0 A;  3GTU B;  4POL A;  3DRN A;  5ECN B;  2VIM A;  3UBL A;  2P5Q A;  5CO3 A;  1J9B A;  2OE0 A;  2B6M A;  4WEY A;  4NWY A;  1PKW A;  3F3Q A;  3ISO A;  3GUR A;  1S3C A;  2HRK B;  1SU9 A;  1MTC A;  5BRT A;  1FVJ A;  2MMN A;  4ZB9 A;  1QUW A;  1GUK A;  5JCU A;  4ACS A;  2L5O A;  2QSI A;  2EIQ A;  5GST A;  3GIX A;  4MNN A;  4IKH A;  1XWG A;  2B5X A;  2MYG A;  1PD2 1;  3EIN A;  1YDK A;  4K0N A;  4AKG A;  3TOT A;  3FZ5 A;  3GRX A;  2HFD A;  1GSQ A;  3KP9 A;  1VF1 A;  3QMX A;  3H1N A;  3G7I A;  5IMC A;  3VI5 A;  1PRX A;  4USS A;  4BVX B;  3F4S A;  3BCI A;  3A3T A;  1PQN A;  4AJ7 A;  4CDO A;  1FOV A;  1K0N A;  1GLP A;  2YP6 A;  2H73 A;  2A2R A;  1ZMA A;  3VPT A;  1R7H A;  2WFC A;  1TRW A;  2M46 A;  2YV7 A;  1BG5 A;  1OC9 B;  5FHI A;  3F6F A;  1BX9 A;  2K8V A;  1O6J A;  1B9Y C;  4E8H A;  2VCX A;  5B7C A;  1AUC A;  2HRA A;  3UAP A;  3IHG A;  1TI3 A;  1YKC A;  1M9B A;  5IM9 A;  3W8S A;  1H4O A;  1SL0 B;  2PVO C;  3LFL A;  1U6T A;  4XIH A;  1W4V A;  3LSZ A;  2X4A A;  5B8A A;  2KUC A;  1ERT A;  4N0V A;  2C80 A;  1HNB A;  3A5W A;  3TJB A;  2RM6 A;  2GLR A;  5A34 B;  1NHO A;  4KCA A;  5EPF A;  3ERF A;  2HQT A;  2VL2 C;  1SEN A;  4V2N A;  1YQ1 A;  1YVL A;  3A2W A;  4ECC A;  2C0D A;  3MYD A;  1JZO A;  4HQS A;  4WET A;  5E4W A;  1M2B A;  4IW9 A;  4PQH A;  5ID2 A;  4MCU A;  2C4J A;  2DIY A;  3HZ4 A;  2H30 A;  4MJA A;  1XOA A;  2X8C A;  4EUY A;  1EP7 A;  5F06 A;  4F0B A;  3QFB C;  1WRY A;  4XCS A;  2CZ2 A;  3ERW A;  4K2D A;  3LXZ A;  4YKG A;  2LST A;  1GLQ A;  4EL1 A;  2LQQ A;  1XWB A;  1NM3 A;  3FEU A;  3ZYW A;  2PVQ A;  4ZL8 A;  3C8E A;  5KEJ A;  1TRV A;  1YJ6 A;  2CVK A;  1VGL A;  1Z9H A;  1EEM A;  4J57 E;  4Z2U A;  3ME8 A;  1T3B A;  4ZB7 A;  3S9F A;  1N2A A;  13GS A;  4ISD A;  4MK3 A;  2IME A;  2DJJ A;  3AY8 A;  1A8Y A;  1ZL9 A;  5B8B A;  4XRA A;  3LOR A;  3VWX A;  4BL7 A;  2FA8 A;  3C71 A;  2X8G A;  1A2L A;  1J0F A;  2UV8 G;  2OJL A;  3EU3 A;  4TKY A;  2WGR A;  2CX3 A;  1SL1 B;  4GLT A;  3R2Q A;  2REM A;  4LA1 A;  2VCV A;  4JBB A;  4KE3 A;  5INY A;  2V6K A;  4AKI A;  4RQX A;  4PUR A;  3CTG A;  5FWG A;  4V1A g;  1H75 A;  2J9H A;  2C0E A;  3I69 A;  4DSQ A;  4MPG A;  2OE3 A;  1M2D A;  5KOX A;  4IJI A;  3EMX A;  2H1D A;  2DIZ A;  3HVX A;  2IFQ B;  1QGV A;  5HR3 A;  1DE2 A;  2F51 A;  4TOP A;  2M72 A;  3GUS A;  1XWC A;  3UAR A;  3IA1 A;  5A1N A;  3ZTL A;  3IXR A;  1IYI A;  2GQM A;  2LJA A;  2LV3 A;  4ZL9 A;  3F9U A;  5J9B A;  2C0F A;  1F3B A;  2EFC A;  3FHK A;  3TRQ A;  1VF4 A;  3CRT A;  1XWK A;  4FIW A;  1G7O A;  2ZCT A;  4OO4 A;  1PKZ A;  3KJY A;  4K6X A;  3UEM A;  2FLS A;  4IQA A;  2B7J A;  2RLI A;  4O92 A;  3N9J A;  1U88 A;  1THX A;  1R5P A;  4IBP A;  4RI6 A;  4WF4 A;  1ZOF A;  3D21 A;  1JZD A;  5J4U A;  4HZ4 A;  2QKE A;  3TU3 B;  4EIQ A;  1AAZ A;  5H5Q A;  1A0R P;  1TTZ A;  1AW9 A;  4GSN A;  4L5L A;  5DAK B;  3EMP A;  3QR6 A;  5H5S A;  3TJJ A;  17GS A;  3L9S A;  3IC4 A;  4NHW A;  1EEJ A;  1SKW B;  2IPA A;  2N5A A;  3EU4 A;  3L78 A;  2WUL A;  4KDU A;  2XPD A;  1ZYQ B;  4O7H A;  4X1U A;  3PR8 A;  1GNE A;  2H70 A;  2HI7 A;  2DSA A;  4HS1 A;  5COH A;  1O8W A;  4GTU A;  2WRT A;  3ME7 A;  4O32 A;  1GSF A;  3HJM A;  1TOF A;  2DML A;  4V2M A;  2HSM B;  3W8J A;  4EF0 A;  3CSJ A;  4G2E A;  4ZXG A;  2VCZ A;  2V1M A;  2G0F A;  4G19 A;  3C7M A;  4MJB A;  2D2Z A;  5J5N A;  5ENU A;  4WR5 A;  3Q6O A;  2H0H A;  4F2I A;  3IRA A;  2LJK A;  4OFM A;  2VLT A;  4H86 A;  2HRK A;  4TR1 B;  4DEJ A;  5IMV A;  1ZYP A;  4G10 A;  2XPE A;  3DEX A;  3P2A A;  2EIO A;  1EGR A;  4Q5F A;  4QMK A;  4N0Z A;  3FRC A;  2UZ8 A;  1ZZY A;  3E9J B;  2IMI A;  19GS A;  5G1K A;  2C1Y A;  1QMV A;  2GS3 A;  20GS A;  1XOB A;  3GX8 A;  4K1F A;  2VOC A;  3HYP A;  4DSS B;  3TRX A;  1G0T A;  2BJX A;  1V2A A;  1BF5 A;  2H6X A;  1NHY A;  2L57 A;  3KH7 A;  4D73 B;  3UOM A;  1N8J A;  3ZRD A;  3FZA A;  3M3M A;  2N5F A;  1MDK A;  4DVC A;  2PU9 C;  3LYK A;  4OCE A;  3MWH A;  5IO0 A;  5AIS A;  1T8E B;  1OC9 A;  2IJY A;  3M1G A;  3GMF A;  1XBS A;  4XS4 B;  4HZ2 A;  4YQM A;  3DVW A;  3I6A A;  2H66 A;  2PMT A;  1B4P A;  2X8H A;  1YF1 A;  2PGT A;  5D8I A;  3F4T A;  1OC3 A;  4YKF A;  2FWG A;  1U3I A;  2LRN A;  3CSI A;  4ECJ A;  3ZL5 A;  1M7T A;  4FYB A;  4O5Q A;  3RPN A;  3HCZ A;  4HU7 A;  4MP4 A;  2I3Y A;  6GSS A;  3WGX A;  1MD3 A;  1ERV A;  3CWG A;  3ZIV A;  3KEB A;  3QPM A;  3IDV A;  3GHA A;  1NW2 A;  2KOK A;  5IPH A;  5DJM A;  5G2Z A;  2I9H A;  1K0A A;  2V32 A;  1PX7 A;  1TK5 B;  4N11 A;  1DBY A;  1SL2 B;  3MDK A;  3GN3 A;  3WT2 A;  4Q5Q A;  1C72 A;  2CAI A;  1R4W A;  2P31 A;  2NVL A;  3P90 A;  3LGC A;  2LQO A;  1XFL A;  3FZ4 A;  2CZ3 A;  2E2G A;  1URM A;  1AC1 A;  4EO3 A;  1SD8 A;  3VLN A;  6GSW A;  1WMJ A;  4KDX A;  14GS A;  1MD4 A;  1GTA A;  3DWV A;  1EV4 A;  3DD3 A;  5KOW A;  5J40 A;  5IPG A;  1TXX A;  1XW9 A;  5G5E A;  3ZZX A;  5A5H B;  1K0O A;  1M99 A;  3H79 A;  2VD1 A;  5DQY A;  3DXB A;  4ZBA A;  1OE8 A;  1O7U A;  1M9A A;  1G6Y A;  4ZL7 A;  1GSS A;  5ECH B;  3WD6 A;  1O73 A;  1K0B A;  3HJP A;  10GS A;  2O89 A;  3HY2 A;  5J4Y A;  2H0G A;  3K8N A;  1F6M C;  4BWS A;  3ZFL A;  3TDG A;  3RPP A;  4OD7 A;  2H1L A;  1BG1 A;  2OBK A;  1SK2 A;  1K3Y A;  4WR4 A;  2ZUP A;  3F0I A;  4L5O A;  2O85 A;  5AIV A;  5CRH A;  3UVT A;  1Y1U A;  4G0K A;  2F9S A;  3HJO A;  1ST9 A;  5AIX A;  1UVZ A;  5J41 A;  2KHP A;  3U6V A;  4ZBB A;  3TRP A;  4GSS A;  1LU4 A;  2VAF A;  3HD5 A;  1GUM A;  4LL1 B;  2HZE A;  2NPB A;  4EIP A;  1V9W A;  3UVH A;  4G0L A;  2R6K A;  3APQ A;  1K0C A;  3FY7 A;  2L4Q A;  4KB3 A;  4GST A;  4LMW A;  4TN8 A;  3QDN A;  2LS5 A;  3HKR A;  2IMK A;  3US3 A;  5ECK B;  1FW1 A;  4XS6 A;  4JR4 A;  5IMF A;  2DKI A;  4KUN A;  3VFI A;  2BTO T;  1F9M A;  3F8U A;  3GFK A;  4X0X A;  5GAP D;  5G1L A;  3IC8 A;  4HJ2 A;  1FG4 A;  5J3R A;  2FGX A;  2H72 A;  2PN8 A;  1TXU A;  4OCF A;  5DCH A;  4NPB A;  4NAX A;  4TRX A;  1MDI A;  1PGT A;  5D73 A;  4BVY B;  4OMV A;  1DE1 A;  1EP8 A;  1Q98 A;  2B5E A;  2HXK A;  1DUG A;  4Z2T A;  4YQV A;  3C73 A;  2WDU A;  1SK1 A;  2YV9 A;  2CT6 A;  5HFK A;  4TXO B;  4KDY A;  3D4T A;  1ZYE A;  3KP8 A;  3KXO A;  1WIK A;  2GST A;  5CRW A;  16GS A;  4NXI A;  4K8M A;  2HSM A;  2AHE A;  3HXS A;  3HZ8 A;  5B6M A;  2HRF A;  4CY8 A;  3C1R A;  3MNG A;  4K7O A;  1SJ6 A;  2F3M A;  2H19 A;  4JU5 A;  4JE1 A;  4K5S A;  5GSS A;  1FVK A;  3IR4 A;  4FYU A;  5G30 A;  3CTF A;  2AAW A;  3HVV A;  3ZVJ A;  2GZP A;  2YN1 A;  1GTI A;  2YWO A;  3HHV A;  4IJ3 A;  4FO5 A;  4TR1 A;  3PGT A;  4WF5 A;  4K5R A;  3HMJ G;  3H93 A;  4ILF A;  4DSR A;  5B6N A;  1WP0 A;  1VRS D;  1Z7R A;  4I2U A;  1QQ2 A;  2YPM A;  1E6B A;  4N30 A;  5BMU A;  2CA8 A;  4GCI A;  3I9V 2;  3MAK A;  4PUA A;  5DQS A;  3A5I A;  3IAM 2;  4WKW A;  2LKU A;  2VL3 A;  2O5V A;  3J7Y b;  1A2M A;  5AGY A;  3IPZ A;  3KH9 A;  2NTO A;  1PN0 A;  2HSH A;  3O3T A;  3BBY A;  1X5D A;  2VCQ A;  1OVN A;  3TKS A;  2IN3 A;  4POK A;  4HJM A;  3CMI A;  2B1K A;  4JZQ A;  2N5B A;  5C04 A;  1LBK A;  4LMV A;  1S3A A;  3FK8 A;  2H6Y A;  4PTS A;  5IQY A;  2R37 A;  2PER A;  1XVW A;  2B7K A;  3TKP A;  1HYU A;  4POB A;  3CSH A;  3OR5 A;  2GSR A;  4EKZ A;  2GTU A;  3KD0 A;  2GDR A;  4PNG A;  3DIE A;  1FOH A;  2LRC A;  1V58 A;  3GYK A;  4HU9 A;  22GS A;  3LG6 A;  4KGI A;  2KLX A;  4MLY A;  4NV5 A;  2ES7 A;  1AXD A;  5JCG A;  3LYP A;  4ZIJ A;  3ZRE A;  1SYR A;  1Z5Y E;  5KN3 A;  2KP1 A;  2DBC A;  2OAD A;  3A2V A;  1OKT A;  3EPT A;  3BOA A;  3VWU A;  1F2E A;  1FO5 A;  2H1A A;  5HR0 A;  1O8X A;  1XIY A;  1Q4J A;  4F82 A;  3TOU A;  2O87 A;  2B5Y A;  2GZZ A;  2L6C A;  4PGT A;  1K0M A;  5A4V A;  5IMD A;  1RK4 A;  1B8X A;  2JL4 A;  5DCG A;  2H8L A;  3BCK A;  4X43 A;  1GH2 A;  2C8U A;  2DKH A;  3VI7 A;  1WE0 A;  1HNC A;  4JED A;  5F07 A;  2VM2 A;  5A5H A;  3FZ9 A;  8GSS A;  1LJR A;  1KTE A;  2IWT A;  3I43 A;  2PUK C;  4TXV A;  4GWR A;  5L71 A;  3CRU A;  1M0U A;  4EE0 A;  1GSE A;  3GKK A;  3FYG A;  1SD9 A;  2VUP A;  4N10 A;  1XZO A;  4BA7 A;  3LEF A;  2PWJ A;  4TVE A;  3E0U A;  4IN0 A;  1T7P B;  5AN1 A;  3L9U A;  4AKH A;  3L4N A;  1SJI A;  1XPV A;  1AQW A;  4KCE A;  3GTU A;  1X5C A;  1SVM A;  3FW2 A;  1S3D A;  2HLS A;  1K3L A;  4OWY A;  4F0C A;  4PXO A;  3ED3 A;  1MDJ A;  1BED A;  4I6X A;  7GSS A;  2DC5 A;  4LLR A;  3ZIJ A;  2MBS A;  4OFT A;  2R4V A;  1WJK A;  3JCM L;  4KF9 A;  5ECR B;  4GDF A;  4I5Q A;  1JLW A;  3M8N A;  3M0F A;  4KH7 A;  1SVL A;  3APO A;  3G9B A;  3WGE A;  1GUH A;  4MH2 A;  2X64 A;  5E59 A;  2AV4 A;  2ON5 A;  2DJK A;  2XBI A;  5ID2 B;  4AJ8 A;  2H01 A;  1TJD A;  1GUL A;  4HQZ A;  5GAN D;  3BD2 A;  3GKX A;  3TKQ A;  5J4V A;  2B3S A;  1EV9 A;  4IGJ A;  2VCW A;  4BVX A;  1TW9 A;  2I1U A;  4EDY A;  2FY6 A;  1EOG A;  3RHB A;  2X49 A;  4X4J A;  1EGO A;  4CHS A;  1QFN A;  1XCC A;  4V1A p;  3LJR A;  2HRN A;  3RHC A;  3F3R A;  5D9W A;  4PQI A;  3NZN A;  2F8A A;  1PL2 A;  4K7I A;  2HYX A;  2O8V B;  3W6G A;  5A4U A;  2XHF A;  1XXU A;  2H71 A;  4MZC A;  4BL7 B;  3D6I A;  1SVO A;  4HUA A;  1TDI A;  2GVP A;  2GSS A;  2IL3 A;  1Z3E A;  3UL3 A;  2OBI A;  2QA2 A;  1TRU A;  1TRS A;  2FWF A;  1AQX A;  2HNL A;  3TKS C;  2L59 A;  2R0C A;  3TJK A;  4ML6 A;  5DAL B;  2LRT A;  3GSS A;  2CQ9 A;  2IMD A;  1PSQ A;  5D93 A;  1THO A;  4AGS A;  2JAC A;  5KN1 A;  3TJF A;  3SWL A;  4NV2 A;  4POM A;  2VL2 A;  4TR3 A;  1OAZ A;  3QCP A;  2YZH A;  2FWE A;  3ZIT A;  3DVX A;  2FNO A;  5EL8 A;  5LD0 A;  3VPQ A;  5LCZ A;  1MEK A;  2VLU A;  5A34 A;  2GT5 A;  2L4C A;  3KTB A;  6GSY A;  1USB A;  4QL9 A;  5CP1 A;  1YEX A;  1X5E A;  3LXT A;  5EY6 A;  2AYT A;  2CAQ A;  2MZC A;  2K6V A;  4QL7 A;  5A1N B;  1GNW A;  2E2M A;  1WWJ A;  3EWL A;  3D22 A;  1Y6E A;  4L0U A;  4I97 A;  1WOU A;  3G7Y A;  3IK9 A;  4WBR D;  1M2A A;  4JRR A;  4KSO A;  2RII A;  3KTL A;  2TRC P;  4GF0 A;  1V57 A;  2J23 A;  1ZGN A;  2C3Q A;  2DJ0 A;  3UJ1 A;  2HT9 A;  3CYN A;  2FA4 A;  2WB9 A;  1EZK A;  3CXG A;  9GSS A;  4I8B A;  5DDL A;  2KP2 A;  4MF7 A;  1AIU A;  1XVQ A;  1A23 A;  1O85 A;  3MSZ A;  1GP1 A;  4A5P A;  3ZVJ D;  3IBH A;  6GSV A;  2V6O A;  3QAV A;  5D9T A;  2YJ7 A;  2AB6 A;  5IOX A;  2JAD A;  4NHZ A;  1I9D A;  1TK8 B;  3FR3 A;  4WXT A;  1JHB A;  4MZW A;  1GSY A;  1BAY A;  4K9Z A;  1SYX A;  4GRF A;  2EC4 A;  4YAP A;  1HQO A;  3KZQ A;  2CX4 A;  2RUE A;  4IHU A;  6GST A;  1GSD A;  2Z9S A;  4IQ1 A;  2FUG 2;  2LNS A;  1HNA A;  5ECO B;  1NSW A;  1ILO A;  1T4Z A;  4FH8 A;  1ZYN A;  3LW9 A;  5G31 A;  2H75 A;  4J2F A;  3KCM A;  3TJG A;  3V1W A;  2EFH A;  1TP9 A;  3L9V A;  2YCD A;  3VK9 A;  4XHM A;  6GSU A;  5HFG A;  4Q5R A;  2IFQ A;  4Z2R A;  1SKR B;  2JZS A;  3A2X A;  2OE1 A;  4YQU A;  1E2Y A;  5HFI A;  3HDC A;  3TUE A;  1R5A A;  4KW6 A;  5IO2 A;  1J08 A;  2K18 A;  3ZML A;  3ZFB A;  1VF3 A;  2DLX A;  3FMW A;  4K2X A;  3VWV A;  4KAE A;  1ZCP A;  2A2P A;  1PX6 A;  3C1S A;  4I2T A;  4EXJ A;  2JSZ A;  1KNG A;  4XS1 A;  2CVB A;  1XW5 A;  2P5R A;  5F0G A;  3PPU A;  3HA9 A;  2NBS A;  2IIY A;  1TKD B;  1GTB A;  1A0F A;  1QXH A;  1RQM A;  4OO5 A;  2MBT A;  2HSN B;  1V40 A;  3KIJ A;  3TB2 A;  3GKM A;  4KND A;  1OE7 A;  4O5U A;  5DAK A;  5A4W A;  1YF0 A;  4ICY A;  3U5R E;  3D4M A;  5F05 A;  3UIW A;  1KBN A;  3Q19 A;  2E7P A;  4ZIL A;  4PNF A;  3IAS 2;  4YAV A;  4K0G A;  2VD0 A;  2E0Q A;  3IOS A;  1X9S B;  4ZBD A;  4NMU A;  4AKX B;  3TKS E;  2OKA A;  6GSX A;  2GT6 A;  3EYT A;  4RQR A;  2R3X A;  3EVI A;  4IS0 A;  3G7J A;  2YOI A;  2RM5 A;  5ECL B;  2DJ1 A;  2HE3 A;  3H8Q A;  2GQK A;  2EIR A;  2NDO A;  5IMA A;  3H4K A;  1I5G A;  4XRD A;  3QAW A;  1SJZ A;  1A8L A;  4ULX A;  2V2G A;  4HOJ A;  3F6D A;  1GWC A;  4FYC A;  1SK0 A;  1X9M B;  1Z7P A;  1AQV A;  2YZU A;  2WZ9 A;  3E3E A;  4HI7 A;  3KMN A;  4W66 A;  3UMA A;  1A24 A;  2R0P A;  5CYY A;  3RDW A;  4ML1 A;  1VF2 A;  3VWW A;  3DKS A;  2GSQ A;  5LNK e;  1OC8 A;  3FR6 A;  4IVF A;  4E68 A;  4DSS A;  3BJ5 A;  2LNT A;  4MDC A;  2I81 A;  4D73 A;  3L0H A;  2YWM A;  3ZMK A;  4WBJ A;  5IIZ A;  5KN2 A;  2GZY A;  3F63 A;  1O81 A;  5JCW A;  3N5O A;  2DMM A;  3GX0 A;  5IMZ A;  4JR6 A;  2F8F A;  3EC3 A;  2QC7 A;  4YH2 A;  4F9Z A;  4G01 A;  4XS4 A;  1QK8 A;  2FWH A;  3NOF A;  3FR9 A;  2YJH A;  4MA9 A;  4MF6 A;  1XWA A;  1T00 A;  1WPI A;  5CRE A;  2FCH A;  3ERG A;  2JZR A;  4GXZ A;  4MF5 A;  2FHE A;  2C3T A;  5IOW A;  4ZB8 A;  4P3Y B;  4MZB A;  5CNW A;  18GS A;  3WT1 A;  4TW5 A;  4FQU A;  5D9V A;  4K7N A;  2WJU A;  2VO4 A;  1X9W B;  5DAL A;  1W89 A;  2YWN A;  4J56 E;  1FB0 A;  3TKR A;  3O6T A;  2OAC A;  3Q18 A;  2M80 A;  2I4A A;  3QAG A;  4MH3 A;  1N25 A;  3PIN A;  1ABA A;  3FKF A;  4XTS A;  4HEA 2;  4MJE A;  2P0G A;  5ELA A;  2HZE B;  2EFE A;  4MPF A;  3F4R A;  2V41 A;  1EOH A;  3RBT A;  3WYW A;  1F37 A;  3KMO A;  3IHQ A;  2TRX A;  3VUR A;  1BJX A;  4G9H A;  3DGQ A;  2VL9 A;  1EWX A;  3PH9 A;  3GST A;  4E8E A;  3KGK A;  2WCI A;  3DYR A;  11GS A;  4L0W A;  3IK7 A;  2K8S A;  2AUV A;  2FD3 A;  4KX4 A;  4LL4 B;  5DJL A;  2CVD A;  1RW1 A;  5A5K A;  2H1B A;  2LTK A;  2C3N A;  2O7K A;  1FAA A;  5ECM B;  1U87 A;  2DJ3 A;  2GQL A;  1OYJ A;  3J7Y k;  4ECB A;  1ERW A;  5J47 A;  4QQ7 A;  2VCT A;  1JZW A;  3WGD A;  4CY6 A;  2C0G A;  3QFA C;  3CBU A;  2MMZ A;  2K9F A;  4TR4 A;  2PPT A;  5CAX A;  3UBK A;  1PL1 A;  1FB6 A;  2HSY A;  1ML6 A;  1PA3 A;  4EDZ A;  4O5R A;  1BQ7 A;  1TI1 A;  2XBQ A;  3P7X A;  1YZX A;  1T4Y A;  4AF2 A;  5JWQ B;  2VLV A;  4N3Z A;  5FT3 A;  3TCO A;  4L8E A;  5HR1 A;  4V2L A;  2EFD A;  3IV4 A;  3SBC A;  2DJ2 A;  4AJ6 A;  4MJC A;  1TU7 A;  3O76 A;  4CW9 A;  3GH6 A;  4MAB A;  3DML A;  1YKA A;  2AJQ B;  2BMX A;  1U3A A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...