The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
12
|
sequence length |
93
|
structure length |
93
|
Chain Sequence |
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYAQYYYRGWYVGSPISINYRT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation.
pubmed doi rcsb |
| molecule keywords |
PR domain zinc finger protein 14,Protein CBFA2T2
|
| source organism |
Mus musculus
|
| molecule tags |
Gene regulation/transcription
|
| total genus |
12
|
| structure length |
93
|
| sequence length |
93
|
| chains with identical sequence |
F
|
| ec nomenclature | |
| pdb deposition date | 2015-10-20 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
