5ECJE

Crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYAQYYYRGWYVGSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/transcription
molecule keywords PR domain zinc finger protein 14,Protein CBFA2T2
total genus 12
structure length 93
sequence length 93
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ecjE00
3RGVB 4Y4KC 4Q9RL 3ALPA 1MCHA 4XNZC 5FM4A 1AXSB 5HDQL 1LNUB 4WU7A 5JHLH 1JTTA 1S9VB 4OCYL 4HH9B 1JF1B 4M6NH 4TULH 4NIKB 1B90A 2P47B 1OSZB 2ZUWA 1ZANL 3QNZA 3NIDE 5E6YA 4TUOA 3WFDH 4LSVL 5D4QA 5BW7C 1YQVH 4HV8A 2OZ4L 4P46A 4P59L 1DUZB 4X6CF 2B1HL 5FGBC 1DN0A 5JDSA 4U1HA 4MA8H 4E9LA 4KRPB 5DI8B 4JJHA 5T5FL 4KJQD 1MCPL 3G5YA 3GI8L 2VXVH 4EN3C 4PGZA 3C5SA 4FA8A 1ZT4A 2YPLE 3PXJA 2X4PA 4KQ3L 3DIFB 2NXZC 3G04B 1ZHKB 5K9QI 3NFNB 1R3JB 1Q1JL 3LS5H 3WL9B 4KH2A 3GI9H 4GKSA 1DP0A 4ONGH 3RZCD 3D2UA 4NKQB 3VXMB 3EJJX 4L8CA 1P5VA 2HFGH 5C0AD 4J23A 4AL8L 1NGZA 3AAZA 3A67L 2G75B 4NQEB 5LXGL 1G9EA 4JY6B 1KPRB 3QZWB 4G9DB 1F2XK 5MENA 4AEHH 1INEH 2UZIL 3HAEG 2ARJA 4WWID 1AGFA 1X6NA 4MA1B 3Q6FB 5EU6B 2OQJA 1A4KB 2DQJL 5A2JH 12E8L 3SDDB 3CFBB 1NAKL 4F7CB 1T0MB 1NKOA 4FQXC 1P4BH 1YEIH 1ZLSH 4QOKE 3ARGC 1S5IH 3THMH 4GAYB 4Y5VC 1PX4A 2P48B 2HFFB 3W82A 4LSQH 5DHVH 1T5WB 3D39E 5ALCL 1JPGB 4ZTPH 1MJ7L 4PTTB 3EYUH 2AJXL 1R3KA 4HK0A 3BZEA 3QO0B 1HHGB 1PEWA 2CD0A 1KULA 7FABL 4RCAA 5IFJA 1RU9H 3FO2A 4RZCB 4YX2H 1CFSB 4HCRH 1YJDC 4K3JH 1BM3L 1C5BL 5F72S 3BAEL 3CK0H 3SHSA 3EBAA 2E8YA 4Z0XA 2V17H 3UTSE 1A9BB 4L4VD 3MNWB 3QXDA 1GL4B 1JWMB 4MMXC 5DQJA 3MACL 3L1OH 3STBA 3B9KC 5GGRA 4XCEA 4E0RB 2DJSA 1CT8B 3C2AH 2X44D 5JPMA 1ITBB 1FCGA 1NAMH 3DSFH 3SE4C 5TH2B 3M1BB 5TDOA 1R3IH 4MDIA 4QXUL 5JLZB 2ORBH 1A6ZA 2F15A 5KANI 3BKJH 2CRYA 5KBNC 5I17A 4WV1B 3GSRB 3X17A 4MXVE 1NCUA 1YQ2A 5DJAB 2NTFB 1U95B 4J3VA 2CK2A 4P9MH 5E1HB 4ZOBA 1V3KA 3GSWB 1VFBB 3F12A 3G6DH 2OM5A 2XT1B 2DM3A 1DZBA 1SMOA 3MUHL 1HI6A 3F7VB 5T3ZL 4K7FA 1G6RH 1PY9A 4KI1A 5IOPA 2DMCA 1WITA 4ENED 1KB9K 1NCDL 5KS9E 2Z35B 4LCCC 5DA0B 5EZOH 2ZOLA 5DJAA 3ZKND 3U83A 4JPVH 3C6SA 3IETB 2CDEA 4JY4B 1RK0A 5IBUG 1A1MB 1QKZL 1DQJB 3QI9A 3KYMB 4LKXA 3FONA 1JGDB 1AXIB 5GHWL 4EVNA 1P4BL 1YEIL 2ITDB 4NC1C 2HJKB 2NXYC 3LAFA 2QQKH 2R4SH 1AHWB 3KPLB 4W81A 2BOCB 4L4VA 4I3GA 2DD8H 3TBSB 1AY1H 5F1IB 4OLZH 1LK3H 4ZPVB 4LU5L 5E8PB 5GZOD 4NRYA 4KK6C 2OJZL 3VXRD 2EYRB 2CRMA 4ZYKB 1M6OA 2FGZA 2Q8BH 1DQMH 3CSPA 5CJBA 5E8DH 2FO4B 4JN1H 2ARWA 5D1XD 3QEQE 4JFZH 2HJKA 5D2NC 3MLSH 1OTUD 3BPOC 3BPLB 35C8L 5I8EB 5BV7B 1FL5B 4NO5A 2X6MA 5C0EB 4OGXH 5C6WH 3VFRA 3P0VL 2MKLC 3OAZK 4M6AA 4MJIA 2VTFA 4W4OA 3U0TB 3WKNA 5A3IC 4P57A 1IQWH 1OAZL 3DROA 1R3LB 5H94A 4FOMA 3VXTB 3FRUA 4ODTL 2YHGA 3PDGA 3U4BL 5MEND 3IJSA 1XH3A 2CQVA 2NX5E 3D18A 1T0MA 3MLYL 4KZEL 2DB8A 4XGZB 1BLNB 2P5WD 4IRJC 1FG2A 3EZJB 4OCYH 4G7VH 5EU3A 4PBXA 5FECB 3QWRD 4JDTL 3OMZA 4NYLA 4W6WB 3UBXB 1WZKA 4NO2A 2YRLA 5GGTA 1NFDA 1Y18A 3Q6GL 4JO2H 3HC0A 5HGDB 3BFOA 1G7LB 3QPQC 4XPTL 2YPLA 2NLJA 4QHUA 1CL7H 3DX7B 1J11A 2E7LC 3QQ4B 3JWNC 2W65B 3VXMD 5I19H 4W6YB 4QRTB 4TSCH 1PG7H 1S7VA 4M61A 3QNYB 3HPLA 3SDAB 1BM3H 1C5BH 2NY2B 4I0KA 3O9WD 4JZNB 4MVBC 4GRWH 1J0KA 2P5WE 1OM3H 1AXTH 2X1QA 3B83A 5LWYL 2VLKA 4ZD3H 1HYSD 4JFOB 1IGCH 5E2VH 4U1HB 1G84A 4L29B 2XZQH 4FMFA 3VE0B 1J86A 2LAGB 5C08A 3UO1H 3X12A 5C0AB 4QXUH 3RKDD 2ICWA 5KJRL 4DOHE 1TLKA 3OF6A 1TTUA 5C0BB 1WCBA 3PV7A 3REVA 3BQUC 1YC7A 2H9GB 1OQXA 4U3XA 1BVLB 1P1ZA 1A2YA 3BE1H 2F8OA 2X4NA 1JPGA 1QR4A 5D7IA 3TNMB 3D3VE 5KSBA 2FWOB 4JPIB 5A2KH 4TSAL 2KQNA 1LK2A 3V6FA 4M7JL 1MFEL 4LOUC 1QG3A 1YEHH 4PJXF 5E8OA 2JJWA 4G6ML 3BZFA 3BEWB 4R7DB 4RAVB 2E6QA 4Z7VE 1CVRA 2AERT 4M7LH 5KVDH 2DQIH 3EJYC 4TTDC 4Y19B 2IF7A 4ELMB 1ZSDA 4KHTL 4YDVB 2YKLL 4PRPA 5A2IH 4X6DA 4FP8H 1C16B 1B0WA 3E3QE 1FQ9C 4LGRB 3CVHA 5DD6A 5HPMB 5E0QA 3MRGB 3MJ6A 4U3HA 1J0JA 4O2EA 1LDPH 4F7TB 4WHYH 3RIAK 5CLWA 5I8OH 4OB5L 3VGGA 3D3VD 3VRJA 2BHZA 1K3ZA 4UILL 4JHWH 2CLRB 2RB8A 5F96H 3VXMA 1CIUA 5BS0D 2A74B 3PF2A 1AKJA 2YPKB 3WL9A 1HH9A 1KB5A 5FM5O 3TESA 5BRZB 1DN2A 4NM4L 4NO0B 1EZVY 1YMMB 5JIKA 3CFDB 4HC1A 1UKQA 1YNTA 5KSBB 3VFGH 4ZOAA 3MJGX 4PJDB 4OZ4B 5EZOL 4HIIB 3BXNA 4RBPK 1F11B 3O4LE 4GSDH 4X8JA 3IAGC 4DN4H 4AEIL 4NO0A 4EI5B 2Y07H 3GSXB 1RIVH 2XKNA 2B1AL 1WZLA 4ZUSB 1QQDA 3M45A 3RWFB 3EDDA 2W1NA 3X13A 2HTLC 4HXBH 4XP6L 4JFXB 2VUYA 4X8XA 1BFOB 1LEKB 5I1DB 3MRHA 2HRLA 3KLHC 2CO7B 4HIEB 3L6FB 4NP4H 3RBSA 2OXGA 4KI5C 3WXVH 1G1YA 3VWJD 5KVGH 3CJJA 2B0SH 3G5XB 3HMWH 5DVMA 2I9TB 5DMGD 1T0NB 5EU4B 4RIRB 1MCNA 3O81A 2VXQL 2EE2A 4JFYB 3ULUH 4S1QH 1U3HD 3B2UC 4PJEB 2MCPH 1LEGA 1CDBA 1PLGL 4RWYL 4DGVL 4Q0XH 4IHOB 3KYMA 4Q7DA 3S34H 5D7JA 1I3GL 5C6TH 3I6GA 1PKQE 4GRWF 4AIXA 1NANI 4ZTOL 4KZEH 3PWLB 2NY4B 5I1EL 1QA9A 4HX1B 3AXLA 4NZUL 1X5HA 4KJPC 4WHYG 1T0NA 2GFBB 1CFVL 4R97C 4NQUA 2D0HA 1A2YB 3H9SB 1T1WA 1FNHA 5SX4I 2NZ9D 4GRWB 3SE8H 3QIWC 2JJVA 3BPCA 1VPOH 1Q38A 2A1WL 2V9RA 3BKCL 2HKHH 1WV7T 4NQSB 4WWKD 4LMQE 4I4WB 2JCCF 4HMCA 3C5JB 4JFZL 2XTJD 4N0CC 2G5RA 5HVGB 4M1CD 3WS6C 4F58H 2BRRL 4FTVA 3S3PA 3UTPE 2DLEA 1DEEB 1M7XA 2XQBH 3DJ9A 4XH2A 3RGHA 1IARB 1YECL 5F96L 1CXEA 1LO5A 4I77L 4P23D 1GOFA 3RRQA 1RI8A 1AO7B 1F4YH 3FQRB 1D5XA 4KK9C 4NDMB 3TT1H 3OKEB 2JJUA 5C08D 3SBWA 3CCHA 1AO7D 4JB9L 4H1LB 2OR7A 5J6HA 4CKVX 1V3MA 3TM6A 1R5VA 2VC2H 1DQLL 3C2SA 2G60H 1NGWB 3H7BA 4ZUSA 1NEUA 2VN7A 4Z9KB 4FZEL 2IPUK 1CBVH 3MYJB 3W5NA 1T89C 4U0QB 2UY7A 3O8XB 4NWUH 4YR6A 2VLKE 3MGTA 3H3KA 1CI5A 1LD9B 5TQ2L 3ARBD 4EVNB 3CD4A 4W4OC 1OLZA 3GSOA 4Y16D 3VXTA 3KPRB 4LLVB 4OLUL 3PABA 3BEWA 5SX5K 1I7UB 2ZCHH 1I8KA 2X2YA 1CR9L 3IU3B 2RHEA 1KACB 2FYYB 1MFAL 4AMKL 4XWOD 2XA3A 5SWZA 4NBZB 1MVUA 2X4QB 3GNMH 3EFFB 4XNQB 3QHFL 2A9ML 2C26A 3VRJB 3GMMA 2X4RB 4N8CH 2DD8L 4ELMF 5L6YL 3QEQA 5CD3B 5INDB 5GRJH 4OFYA 5E99L 4UINH 2NR6C 3TPUB 3FO9A 3HUJF 3BGAA 5J1AA 3SGJA 4IOSD 5D5MA 2NTFA 1WBYA 1RIHL 1QFWI 5EOTB 2CGRH 1XIWB 3CXHJ 1DBBH 4HBCH 4N8VB 2HFEA 1IM9A 5FEBA 4BFEA 3RWDA 2E7LA 4R7DA 5IB4A 4F9PA 5JZ7D 3E6HB 5DFVC 3G04A 4MD4A 3SDXB 5E2UH 4WJ5B 1BAFL 5M95B 3LKSB 5B22A 3QA3B 5IB1B 4XCCH 4U6YA 4OLXH 3D0LA 3H9HB 5E6IB 1YEDB 5AZ2L 1UM6H 4DN3L 1YA5A 4MNQD 4H88L 4L9DA 1U8OB 4P3CL 1L7IL 4M7LT 3HE6A 1N64L 3I6KA 2VXUL 4WTZG 3MYZA 1ZA3A 4RA0C 3QH3A 4PRHE 5F3HA 4WHDA 4OZIA 3P11H 3G6JF 5GRUL 3U1SL 2P8PB 3N1QC 4EQ2A 3BYYA 2QHRH 3KHQA 1OAUL 1H3GA 4U4BA 1NLBH 4HSQA 4ODWB 8CGTA 4XP1L 5EZJA 3CFKA 1DSFL 1KGCD 3VXPB 5I18H 4DVRH 3D0LB 1SM3L 5DZNA 1IGCL 1LO2H 5SWZD 2PO6D 5FYJL 3GIVB 3ZYOA 1ZMYA 3DX7A 5DRZB 3KPRE 3WN5B 3V79C 4LEXH 4QXWA 5L2JB 3CDYA 3WFBH 1U41A 4X7TA 3WKMH 4LKCA 2Z8SA 3P73B 2NY0B 4YXHH 3MZTA 1IEHA 3UJIL 5TDOB 1GHFL 1GCFA 3WHXB 2VRAA 4DEPB 4P2CG 1HQ4B 3SDCB 5JO5B 4OI7A 3O2VH 2EECA 4I9WD 3H2WA 3ZKQD 1MFDL 4NQCB 2EZ0C 1BQLH 5EN2A 4ORZC 1JHTB 1JPST 3T0BA 2DJ4A 4K9EL 5IBLD 3QRFM 2P8LA 5DC4B 3O6LH 3C8DA 2RBLA 4D0CA 1MLCB 5JXAL 3N9GL 5D93C 2XFXB 4PJHB 2OMBA 2UYLA 4XVTH 3NZHH 4P4KB 2XWBA 1SY6A 5E00B 3KPQB 5E8OB 2ADGA 4NOFA 3GBNL 5HDOA 3QDGD 5IFJB 3LH2L 1A47A 4HQQH 2H2PC 4U1KB 1T1YA 3GIVA 4GG8A 4K71C 4P23A 4OZHB 4OB5H 1QFUH 4JANA 1G9MH 1P7QA 4ZS7L 1FL5A 1GGCL 2L4OA 4NO5B 3SQOH 2UWEE 3FONB 3SEPA 1LD9A 1HXMA 2HJFB 4NPYB 1NFIB 3LQAC 5CJOH 4KUCF 4QCIB 1TJIL 2R1XA 3KPSA 5C92A 3L5XH 5D1ZC 3H7LA 2FEDD 1BZ9B 1ORSA 5D1QC 2H32B 4UOW0 1IGJB 3V0WH 4F7MB 1RZGB 5B8CC 3AS1A 4NRYB 4ODHL 2PUQT 3UYPA 1JTPA 3BPCB 4XCNA 5DYOB 4G80B 5DEZA 4WNQB 1C7TA 4RFNC 3MA7A 3GHEH 1ORQB 3KAAA 2R2HB 1MRDL 2V5RA 4XC1H 5GS2D 4E5XA 1D5ZB 2CR3A 3QPXL 3QAZB 3BP5A 4UT9H 1VEOA 4AEEA 3HCVA 4AIZB 2BNRB 5ACZB 4PJEE 1ZANH 4AK1A 5IQ9B 1XZ0A 2I25N 3QCTH 4EN3D 3DI3B 4NUJB 4NZUH 1ZWIA 1KV3A 4X9IA 5CEZH 5AZEL 4OZGA 5IMLB 3KJ4C 4QHMB 1EA9C 1RFDH 4LLQA 2OSLA 1HXYB 1OPGH 3G5XA 3WDHA 3MOAH 4F8TA 1ERNA 3ALXA 5GS2H 1KUMA 3MA7B 3K8LA 3IB4A 5E2UL 2P43B 1UEYA 3LZFL 3VGHA 4M3KB 4XMKL 4F7PB 1YEKH 5T1DH 3O6MH 5HBBA 2YBRA 3ECBA 5GGSY 2ORBL 3I02B 2BVEA 1YNLH 3L7FB 5I1GH 3TLRA 5C08B 5IHBA 3LMJL 3P9MB 4Y5YC 1MIEL 2EC9T 4R4FL 2YMXH 5BV7C 1LO4L 4F8QA 25C8L 1A6ZB 4K94L 4U6VL 5DEFB 4QRPD 1CE6B 1U3ZA 3ZT7A 5D70L 1G6RB 1Q9LB 4U1JB 1BMGA 5I6XB 1UCTA 1IGTB 2IPTH 5GZND 3RWJA 2A38A 2QSCH 1VACA 3EGSA 3U6RA 1EFXA 2Q86B 3RU8L 3C6LD 2QADB 3PWPE 4GG8B 4LCIH 4ZPTB 2X4OB 4X4ZA 2JIXB 5C6TL 2FECI 2BP3A 3B2VL 4YDIL 3PL6B 1MRCL 3PGCB 1A1NB 5IMOA 1HIMH 2V9TA 3FFCB 4I18C 4YDKL 1I9JH 4UT6H 4MX7A 1JNJA 2P7TA 5DLML 4BQ9A 5K9JH 4MA3A 4C56E 3RJQB 3VD5A 4Z5RA 5FO7A 5E5UB 1QZ1A 4HG4K 1Z5LB 4PJXE 2C3HA 3VG9C 5GS3A 3QEQB 4B50A 3SGDI 1D5MA 1LO3H 3GJEB 3WHXA 3PWPD 1NSNL 5E03A 5GISL 5DJ8B 4R9HA 4OCRL 4EUPA 2FCBA 3L9RB 4OLYL 4LGPB 1B2WH 1A0QL 2GHWB 5FYLL 3ULVC 5DS8B 2MQCA 4X9HA 2PCPA 4XB8A 1CK0L 2NY2C 2BERA 3QUMB 4JRYB 1PG7W 5GJSL 4LIQH 1FO0A 5D7JD 5GS0C 4TTGA 2A9MH 2D7TL 4JAMB 3CLEH 1YJDL 3E0GA 3VA2C 5EBMB 4OAWB 3DHJA 5AUMB 2BMKB 5DZLA 3GSUB 5L2KE 4YH6A 4FQIH 4ODWA 2EYSB 3CSYA 1OD9A 2CXKA 2FZ3A 1G6VK 4X9BA 4JM4H 3WIHL 5IM7A 1Y0LB 1WBXB 4XVTL 3L3IA 3U9PL 4FFYH 5CIPH 3SO3C 1T22A 3IFLL 3Q1SL 3AREC 1Y6MR 5A1AA 5DD3H 1KB9J 1OTTD 4JPVL 1I8MB 2PXYD 1BQLL 1Q9WA 1YQVL 4UDTB 5ESVA 4I48A 1CTOA 3UC0L 1JF5A 5F9JA 4D9LH 5DMKB 3KLAB 4WW1A 4CVUA 4JFEB 2E6PA 3HI6L 3H42H 4DVBB 2X4PB 4L1DA 5EU4A 1PEZA 2AXGA 3IDIB 4PJGA 3ZKNC 1FGVL 3H3PL 2H1PL 4JRXD 5DRNB 3UJIH 2X4NB 3O4LA 1Y6NR 1IGTA 3RWJB 3TYGH 1KLFA 5C3TA 1YYLH 4U1JA 1FPTH 2IG2L 1I8MA 5EIVA 3JTSB 4FQHB 1F3DH 1A1OA 3MLPA 4WDIA 1QRNE 4PRAB 1NCAH 4KV5E 4GLRI 3I9GH 4DGIL 1VFMA 3OKKA 1FFOB 4GQPH 4JFQA 2NY6D 2ZG1A 2XIDA 1IAKB 2IH3A 4NKOB 1BFSA 2JKXA 3DXAB 3BKYH 2MHAB 1C1EH 1NCWL 5HI3C 1OSZA 3KDMB 1BOYA 2PTTB 3BP6A 4XNMA 1MCDA 1YEJL 3ARWA 1KLUB 4OAWA 5AUMA 5DJCB 5FYJU 2J2ZA 2AS5M 3MROB 1GC1H 4L4TD 4PJ7E 3S5LG 3S3SA 1SVZA 2FH8A 1IC4L 5I2IA 1JV5B 4JRXE 3MCG1 4Y4HC 1E27B 2WBJD 5IBTL 2W9EL 4XMKH 4TRPH 3EJZD 3BRGC 2PETA 2GSGB 2QHLA 5ELIA 4EUPB 3VFWB 3VXRB 5JXEC 1NGQL 1IQWL 4ZXBB 2P44B 4I2XA 1G0YR 2A83B 4G8EB 1JNHA 5IJKC 3MUZ1 4HJJL 2H6PA 1FIEA 15C8L 1AD9A 2EEAA 2JB5H 3LV3B 2NZIA 2YSSA 4MJ5B 3EYUL 3MJ9A 3SDCC 1RZ7L 3PWJA 5ANME 4POZD 4CW1A 3W0WD 2YK1H 35C8H 3GIZL 4F7EB 2R1YB 5I8CA 3SCMC 2O5XL 4ZAKD 3MNWA 1FBIH 3ARFD 2HG5A 3WNMA 4S2SA 3OKOA 1QBAA 3EIFA 4HIXL 3T2QA 2D9CA 4BH8A 1BP3B 5SWSB 2NY1D 3S96A 1CLZH 1ZHKA 2BNRD 4NUGH 4PS4H 3LDBB 4YDJA 4MA7H 5HHOD 5DLMH 1EFXB 2Q86A 4Y88A 4O2FA 2G9HA 1PY4A 2E9WA 1WT5A 4Z76A 1YMMD 2AXFA 2Q87A 4HWEH 5E2TL 1W0WB 3ZL4H 5HYJE 5CP7A 5ESAA 5EB9A 5J6GA 4KFZC 3VW3H 1KCRL 4R2GC 3UZVB 3T2NH 5CEXA 1GXEA 5AG9A 5F7EH 1IC7H 2ITCA 2VXTL 4Y1AD 5IVXA 2XA8H 3L3DB 2WK2A 1KXTB 3QXTA 2Y72A 4OCSH 3IGAB 4HWBH 4NRZB 3O2DH 1T1XB 3QUZB 4IJ3B 1A4JB 1XR8B 5CSGA 3G9AB 4G6AC 5DUBA 4JFFA 3HAEH 3WSQL 3GSVB 1O5DT 2I60L 1T1WB 5E8DL 2PO6A 2FX9L 3MLUH 4PRNA 5IHLB 5IB5A 4UT6L 2DRUA 4D0BB 3S37X 2EH7H 4C56B 4ZS6D 2DDQH 1FFPB 5CHNB 3KPNA 3BRFA 1XF4B 2R0WL 3V7AE 3L3HB 1NMBH 3LRSA 3ZTJH 1LE9A 3PHQB 3S37H 3VH8A 5TH2A 3RHWF 1XR9A 4ZO8A 5FYKL 3MLTB 4U7SA 1INQB 4JDZB 4P5KB 5C8JB 5JHDD 5JPNA 1OD7A 4KV5F 2YD7A 4U6XA 3KR3H 5DRWA 3UMTA 3EJYD 4TNVK 5GJTL 2OTWB 4PLKD 2XWJB 3DETC 4FQ2H 3G6AB 4NRZA 3MJ7B 2VAJA 3K2UL 4G8IB 4Y5YA 1WTGT 4H0HB 1WFTA 1I3GH 4YK4C 2PW1B 3AU1A 1M7IB 3D6GA 5CGYC 5F89B 4KZDH 3EOTL 5CWSA 1MRDH 4PREB 4BK4A 3ULUF 4MSWB 5DR5L 2BCKA 4TVPH 4ODSL 3RTQB 2PYFA 1K8DA 3ZTNL 3F7QA 4J3SA 2V2TA 5E8NB 4PIRF 2VLJE 2C4XA 3RTQD 2ESVD 3OPZL 4QOKB 3O6FA 1YJDH 4I2XE 2ILLA 2CDGB 4OM1L 5EC1B 3DYMA 1W72L 4U05A 1U8QA 5HYJD 2IBZX 5EC2A 5D2LF 5F6HJ 4N8PA 3OX8A 3NPSC 4JN2B 3MRPA 5F71A 9CGTA 3TEUA 4TPRL 3ARUA 3OKLA 3O3AB 3TBYA 1IE5A 5DD3L 3D9AL 3DO7B 3SDCA 4GMSL 3QQ9D 2O5YL 4JDTH 3FO1A 4Y5VB 3SCMA 4H1LH 2D7MA 1A3LL 4EOWH 4D0BA 1MCJA 1MJUH 2C1PA 4FN0A 1JWUA 5IB5B 1X4XA 1JGVH 2D4FA 2A6IA 5FB8B 1S7WA 5GRZA 2QBWA 3MMEB 2W9DL 4IDLA 5TE6L 2P4AB 4X6CA 3RGVC 4YDIH 3H6JA 5DJ6A 5F1NA 4AEHL 3L3KA 2R23B 2OJEA 5I1LA 2VB5A 1GGUA 3X14B 4KHTH 1A7NH 2OL3A 1DUZA 4XMPL 3P77A 4KJPD 1I85C 2ZCKL 1OB1B 4W68A 4G6KH 4BM7A 1M6OB 2VDKH 1FDLH 2G5BA 1S9KC 4X7SL 5DD1H 1U8PA 3DUUB 5DHXB 1J5OL 1UWEH 3ORJA 3H9SE 1QNZH 1GOHA 3STLB 4LAJH 5J11C 3RUGB 3GI8H 3WFDL 1R3JA 3GSNB 3PQYB 4L3CA 5JNYA 3S5LB 1MLBA 1H0DA 4PJ9A 5F9OL 3TNNB 1YY8A 3MUGA 3FQXA 4H5SB 2QQNH 1H8SA 1AC0A 1TZHA 1ZTXH 1IAOB 5F3BA 3SGJC 1I8IB 4Y1AA 1MF2H 4MDJA 4RRPA 1KF9B 4NNPL 1DQJA 4JFPA 1DVFB 3QWOB 4PJCA 4XHJD 1CF8L 3QCVL 1N3NA 2HWZL 1OP3H 3L3IB 2LV4A 4NKMB 4RGOH 1OGTB 4I77H 3IKCA 5E7FA 4OJFH 4MNQB 4A6YB 4CDHA 5J9PB 4YHOH 3ME0A 4IRZH 1OAKL 4BUGA 1DDHA 1HILA 4N0RA 5C9JA 1N5AB 1ED3B 2I07B 4ZXBA 4CL7A 2Q8AH 4HH9A 3QNXB 4OSUH 3C08L 3BI9X 4LDLB 4QY8B 3L3GB 1RUQH 1NAML 3MLWL 1EO5A 3MV9A 5ICZB 5CINL 4XVSH 1IGYA 1I3RA 2YN5A 1I1AC 1U2CA 3MXWL 1BX2B 4BZ1L 4N9OB 1I8KB 5GJTH 4HBCL 3HZKB 1BQSA 1MHCA 1TETH 2CKNA 4PG2C 4QRRA 4HLJA 2XN9A 4MJIB 4F15C 5IJKA 4FFZH 1VGEH 4DAGH 4QY8A 4UOW1 3RVUC 3SKNA 5MERB 3BP6B 4XNMB 2EDNA 1KN4H 4RDQF 1IAIM 3K0WA 3S88L 5HHOB 1IGML 5C0BE 4ZTOH 1UB6A 2EDWA 1KJ3L 3ZT6A 4JFQB 3IJYA 4NGHL 3TCLB 1J8HE 2AK4D 4NKMA 4K7PH 2IFGA 2NY3C 3DRTA 1I1YA 2VDLH 2PKDA 5K93A 4A2MA 3CNKA 3JSSA 4FQQA 1T2XA 1UM5L 2EO9A 5GSRB 3QP3A 4LSRH 5I8KL 3VFSB 4FTVD 1LQSR 2AV7B 1BBDL 5DGQA 5HYFA 4C83B 1PDKA 4JHZA 2B4CL 1WBZA 4L4TB 3BPOB 3BPLC 4FZEH 5I15H 5CKAA 5KN5B 3DXAD 3UTTD 3IRPX 5F7NC 2CSPA 3MOBL 3DPBA 4J8RA 1T5XB 1T66D 2Y06H 4A6YH 3ARDD 3NVQA 1F42A 1YNTB 2Z4QA 2MQ0A 1IGIH 1CD1B 5MHSE 4JB9H 3O4LD 1EHLH 4ODVH 5IW3A 4ZFOA 5CJQL 3NN8A 4HKJB 5AYUL 1ZGLP 2BNUA 1AKJB 3ZT5A 4LNVA 1JPTH 4QT5A 1JYNA 2AEIT 5EUOB 3I2CL 1A64A 1QFWH 1PYWB 1CD0A 4GKNB 1WWCA 2DS4A 2OQJB 2GIYA 4U1MB 2LTQB 3HZVB 5J9PA 3G6JA 1FO0B 5D5MF 5I30H 5K59F 1S5IL 2VABB 1TFHA 3GHBH 3NN8B 5B3JE 5AEAA 1S9WA 1T04B 2FL5B 4Z7WB 2GFBA 1ZWIB 1TVBB 3PWNB 2X41A 5JXAH 1HKLL 2F58H 4TUKL 2VQUA 4MNGA 2XYCA 3PHSA 3MRKB 3U1SH 3V95A 2W38A 4N0UA 4Z18A 2GJ6B 3FCTA 1OTSC 4LLYB 3GJEA 1A7QH 5D1QA 2XZCH 5ITFB 2IANE 3EDKA 2HTKD 3LEVL 4DVBA 2NX5D 5F97E 4UIMB 4HIHB 3RWHB 1SQ2N 5JW4M 3GGWA 4G80A 2D7OA 2OMNA 1WTLA 5I1HL 5DC0A 2G2RB 3QIUD 3CZFB 3KJ6L 3OR6A 3CIQA 3SGEI 5CEYB 1AFVH 4KKBC 1F58H 2O61B 1GGYA 1KJVB 3DRTB 4XCFL 4RGNE 3RWCA 5CZXC 4HUWA 1YPZA 5C0IB 1ZA6A 2XZAH 3BH9A 2J8UE 1JHKH 3MLRH 3DHMA 1AJ7L 3HS0B 4MXQD 2P5EA 2HLFD 1VFOA 2AQ2A 3VCLA 5ICYB 4HBQA 5D7LD 1P7QB 3WJLC 2VERN 1DBAH 3QNYA 3MRLA 4LAQL 1FJ1B 4NZRL 4RFOH 4N8VG 4PJHE 2A74A 2HFFA 2V5MA 3S37L 1AXTL 4NN6C 4GG6A 4FABH 4PJHA 1A6WL 2H2PD 2FJGA 3HUJE 4JGMA 2YBRB 3ECBB 5DHVA 5T1LD 5KS9B 1CLYH 5CZVH 4ZUVB 3T65A 2CIKB 3L3GA 1DQDL 4KROC 1D5BB 2D31B 3I3BA 4PG2A 4UV4L 4B7LA 4EQ3A 3QHZL 5E9DE 4WGVB 3UBXA 4MJ5A 3N85H 5F7WC 5HGAB 4O4YH 4I0PB 3NCYP 1B0RB 4LSQL 2A83A 2FJFB 1UCBH 4HPYL 3SKNB 3C9NA 1F4WH 1V05A 1JMXA 1VERA 4P5TC 4CN4A 4Y19A 4QRRB 5DJZA 4JZJB 4MNGB 1XEDA 4PP2B 5D7SL 1JFQH 1A02N 4X99A 3UPCA 3ESUF 2OTUB 2IWGA 3SDAC 1YYMH 2XTJB 1KN2L 3HZVA 3U7YL 5T3XD 1FNSH 3OPZH 2QL1A 2W60B 1WIOA 4R3SA 1KIUA 4K07A 5DJ0A 2ZZUT 2AJZB 4JO1H 3CFCH 1UJTA 3QQ3A 4X5XA 4OCRH 2OP4L 2P8MA 4Z0BH 1VGEL 2X4UA 5HYSA 4NQDE 5CEYA 1A6UH 1BBJA 2A73B 1ZVSB 3LMJH 4XVSL 4YC2C 5E8PA 4UB0L 3BPNC 1BIIA 2HMID 2OSLB 4ERSL 1EEQA 3D85A 4NQXA 3O6ML 2VH5L 2OTUA 5E08H 4AEFA 3W11C 3W2DH 1WIUA 5EO9A 1FYTE 4KKAD 4OSUL 5EBWA 2X4SA 1RVFH 5CUSL 5HJ3A 3F5WA 3ROLA 3ILPB 2ZOKB 2XWBB 4KK8D 4CADA 2BZDA 2AV1A 4M4PA 1A7RL 5LGHH 1XF4A 2M26A 5D2NE 4M6MH 2I5YH 3IDUA 3HR6A 5IVXE 4TSAH 5A16A 1YZZA 1S9WB 3RU8H 1FHGA 1NQBA 5HYJA 4D9RE 3LQZB 5L8LB 4LVNC 1WC7B 5E6IC 4K3EH 5C0GB 5INCA 4TNWF 3QPXH 1A4JA 1U9KA 1BGXH 3LS4H 4TVPE 3VFWA 3VXRA 1II4E 2AK4B 2EIZB 3QJFA 1YNLL 1Q9OB 4RAHA 4RGOL 5GRVK 3IFNH 3KPPA 3QR2A 4QO1A 4Z7QF 1ACYL 1HZHH 3TBWB 1HH6A 4DK6A 2NY6B 5BVJA 5TE7L 1KFAL 1MRFL 1RFDL 5I8EA 5D7KE 1CGTA 3WFCL 5BCAA 4LHQB 2AJYH 4LHJB 1FGVH 3KVQA 2BXYA 4ZODA 4OFYD 3K7UA 1WC7A 2JJTC 3IFOA 4QRRE 4ZS7H 5KSUA 1TPXB 1S7RB 3UDWC 4YXLH 1OWWA 3HE7A 3SKOB 4GXVL 3O3EB 1R5VB 2W59A 3S3JA 3QEQD 2ZUSA 1IGIL 1D6EB 3QDJB 2F53D 5CBEA 1P2CB 5H2BB 4OKDA 4APQB 5IFAL 4OLYH 1NGPL 4Z7UB 3V0AC 2AJSL 1H8OA 1CLCA 3JUYA 2EICA 3BT2L 4JRXA 5KVGL 1WZMA 3UTQA 4PJ7A 2D2OA 3UTZA 4U1NB 4M7KH 4XP9L 2DWDA 5HGGS 4HS6B 1GIGL 3D85B 5MERA 2Y5TB 1PKQB 4DFIA 1S7QB 4Q9QL 2YEZA 1A3RH 2YKLH 1P4IL 2HKFH 3ARFB 4P2OA 3VD9A 1U3JA 4Z8FL 3HNTH 2E27L 4XAWH 3OAZH 4KK5C 5H37G 2C3VA 1EXUB 1SEQL 1YEEL 3B2VH 3TV3H 4DKEH 5JW4N 5KS9F 1MWAH 1MRCH 3G6JB 3WDIA 4PS4L 2XI9A 3JV4B 2RQ8A 5D1ZB 1KLUA 3RL2B 3LEYL 4RFOL 4CVZB 5KSAC 2OI9C 4NZTH 1MI5B 1P7KA 4QHMA 3C60C 4N1CA 2NY6C 2O5XH 2WLZA 4HXAH 1FFNB 4YXKL 4RQQA 4LLVA 4F9LC 3VXSE 3O9WB 3OQ3B 4FFWC 4L4JA 3HI1B 3MRCA 5J6GB 1JPSL 3RIAF 1VPOL 5D8JH 2R39A 3OGCB 3I9GL 1X5KA 1EJOL 4KHXL 3BDXA 1FG9C 5FA4A 2GCYB 3O6KL 2ATKA 1T6WA 3BGFB 2VDPH 3BKYL 3UTQB 4HHAA 3MV8B 5ERWB 1U8LA 4PV9A 1TCRB 4M1CC 5EU6D 1X44A 2ADJA 4XAKD 5F7DA 1WEJH 5D7KD 2X70B 2EDXA 2WNGA 3IDNB 5IIEA 5DXWA 32C2B 5GGQH 4Z7NE 1D5BA 4UMGA 1IC4H 1MCEA 3W9DA 1A6PA 4KXZI 1OAXL 3OHXB 3SGDH 3NCJH 3S34L 1KTRL 3VXSD 3FHQA 1CFBA 3TJEH 1XF2A 2BVOB 3Q5TA 1O7SA 1GZQA 2VISB 4OV5A 1C1EL 4QHLA 3PE9A 1YEJH 4HKZA 1DJSA 4KUZH 4OGAD 3H9SD 5BVPL 4LCYA 4Z7NF 5CGTA 4LQFL 5A2FA 3VFUB 2PYED 1F58L 2FYYA 2GT9B 1KB5B 3VMNA 2QEJA 4HWBL 1T7XA 5E00A 3L9RA 5M7QA 4R0LC 3HE6C 3RWCB 5FM8A 1FH5L 2H1PH 4FNLH 4KQ4L 3ZSTA 3T2NL 1GH7A 2LU7A 1NMCB 4Q9RH 2VXQH 1T03H 5DRWB 2QSQA 1ZLVK 2AKRA 4WEUD 3MBEA 2E9JA 1SBBA 3DX6A 2K3TA 2DQGL 4EN3B 1MAML 1CDGA 2Z8WC 1U91B 4HUNB 4MCZB 3GO1H 3K4AA 4QRUB 4XWOC 2EKSA 4M5ZL 3DO3A 1WICA 1NGZB 4PJAA 1BJ1H 2R0ZL 2XWTA 1QSFE 3WD5H 1KT2A 4UAOC 1S9XB 5DFWH 5BS0B 3D48R 3OL2A 4G6AD 3MO1A 3BGMA 2CDGA 12E8H 3KLDA 3M8OH 1TTFA 5JW5B 3OKDA 3VWJA 4EI5D 2HFTA 5HHOE 3PNWA 5C70A 2CLVB 1J88A 1BHGA 3HNVH 4Z7WA 2V2TB 1Q0YL 5EBWB 1CCZA 1LO5B 5I8OL 3D1MC 1VKXA 3UPAA 2P5WA 3KYAA 5EFIA 3FQWB 3MTRA 3QIUA 1BIIB 4HGMA 4KPHH 3ARYA 1U6AH 4UIKH 4PGEA 3VG0L 1U92A 5TE7H 2D9QB 1FFOA 1A3LH 4EOWL 2D7QA 4XPHL 1GGIH 4WFHD 4K3DL 4XPFL 1EAPA 2Y5EA 1EEYA 3CVIL 1URLA 4S1RL 5IW6B 2DM7A 2YXMA 4O4YL 1OT2A 4BSWB 3ZTNH 1XAUA 2AXFB 4S10A 2XPGB 1EAJA 4QRTA 4OZHA 1KPVB 1YN7B 2QADD 2VDOH 4X4YA 2P1YA 4OF6A 1FVCB 2ICWI 3EOYG 1T4KB 2XTJC 4X80L 1XZ0B 4UDTA 1M7DB 1UXWA 1ZT1A 4P2YA 1W8OA 5FHBH 1BZ7A 1DUYB 3OG4B 4JO3H 5EOCH 1DBJL 4NQEE 2DQFB 1H9VA 4YBHA 4NO2B 4JY5H 1UH2A 2YRPA 1WBYB 5C0CA 3SDYH 1TITA 3MRJB 4IMKC 3IDYB 1TQBB 3WFCH 3BDYH 1ORQA 1CXIA 2A6DB 3ARDA 5IB2B 5JO5A 4EIGB 3EO1A 4LASL 3VD4A 4B5EA 3D18B 3MBEB 2X4TB 1JNHB 1L9NA 1U0QA 3L3OB 3NACL 5D9SB 1IFHH 4OTXL 1NBVH 4CVWA 3CC5A 1KCKA 1NGXA 2B5IC 2VL5B 1DBKH 2A6JA 1TIUA 1IKFH 2VDKL 1HSAB 3HPJA 4O2CA 2FD6L 4YBQD 5K33A 3BO8A 2EZ0D 5E7BA 5J06A 3ZE0F 2IQ9L 2H2SD 3LPFA 5T5NG 1F11A 4M6OL 4GW1A 2UWEB 2IALA 3DV6A 2JB6A 4GOSA 4NN6B 2ED9A 2G9HB 4WTXA 4YE4H 3EYFA 1B9ZA 4L4VE 3MCLH 5DT1H 1UJ3C 5C2BH 1AIFA 1OW0C 3FOLA 5BRZA 4Z5RB 4PP1D 3AU1B 3QXVA 3MRQB 2NYYC 3GBMH 3CMGA 3DBXA 4FQ1L 4QYOA 2VNCA 1CDHA 4KKNA 4UT7L 4AYFA 1J5OH 4DJMA 4PRAA 1DFBH 2HLAA 5MEPA 3OXSB 3MJ9L 3U82B 1RJCA 1HE7A 5FCUL 5FUCE 3MRBA 2YPVH 4OZHF 5H35A 1P4LB 3FRPG 4Q6IC 5EULV 4ONFH 2FIRT 2UVEA 3IDJB 5D1ZD 1TNNA 5KSVA 1WQVT 4HCRA 1MLBB 3RDTA 4JN1L 4JFEE 1MQKL 4WFED 3RZCB 1JN6A 4ODTH 3U4BH 5ITFA 3QI9B 1IM9B 2LQRA 4D9QE 4OLVH 2J8UB 4NM8L 3EOAA 2Q8BL 3CH1B 3MV7A 3IFPA 1QPXA 4WTWA 1EUUA 4G8GE 4YDKH 5D71L 4M8QA 3FN0H 3V6OE 1INDL 4XPBL 1LP9A 5C86A 5I15L 4KMTH 1IGMH 1HI6B 4Y2DD 3OGOE 1TQCB 5J12C 5L88L 2R9HD 5IF0B 5JW3H 4OGYH 1AR1D 2WZPD 3WUWA 5F3HB 5CMAB 2AEWA 1PQZB 1V7MH 2BOBA 4M48H 2X9WA 5L0QC 5FB8A 2AJSH 4BFGA 3JV6B 1NUFA 5I17B 4P2RD 1K2DA 3T0EE 1UM5H 2ED7A 3VGEA 3P0GB 2V7HB 3S97C 3MXWH 4GFTB 4GAFB 5TDNA 1KTLA 4TUJB 2Y5TA 5F8RC 2XRAL 3VFOB 1C12B 1EBAA 1SBSH 5BS0E 3MPCA 3KWWB 1J1XH 4RA3A 4ZQKA 1QSFB 2UZXB 1LE5B 1I1AD 4ODUA 1FFQA 1CD9B 4OCMC 2ADGB 1SEBB 4GBXC 3IT8D 3VGDA 4YFDB 5EDXA 4JO4L 3W9DB 3DURA 3TF7C 4RSVA 3BSZH 1VADA 4Q97A 4ZSOE 4TVSa 5I19L 4WW2F 2GTZA 1ZLVH 3B8YA 5I18L 1A7QL 3PP4H 2XXMB 2VKXA 5D93B 5GGSA 2NXYD 4KTDL 1N7ML 5EC1A 3HI5L 4Z7VB 1FG2B 5EU3B 4QHKI 4QOKA 1AGEA 4OLXL 4XBPA 3QYCA 3WN5A 4YHPB 2X4OA 1JI1A 1RUML 4W70A 1FO0L 4UV7L 5JMRA 1IM3B 5I30L 4JJ5A 5EH1A 3LKQB 4NFBA 1SYVB 5J11B 4HPOH 3T3MF 2GJZA 5ALBL 3BUYB 5CZKA 1YN6A 3RWEB 4K9EC 2GW5A 4GMTL 4APQC 4KGJA 4U1GC 4Z7QE 3SGKA 5E2VL 3WUWG 5CEZL 4NNPH 1XCTA 2RIKA 4RX4D 1IQDB 1RQ5A 1X7QA 3VFRB 4LPYA 4XWGH 5FV1L 1X5AA 4JJ5B 3QFDA 4MA1C 5EU5A 3CPLB 3CFKB 1A4KA 2DBJA 4P48A 2VXSL 4HUXB 2PTTA 1KXQE 3JVGA 5D2NB 1H3VA 4IOFD 4LIQL 5DF0A 1MHHB 3UTTB 1PVHA 4M7ZB 4E41A 4JVWA 4U1SB 4PJ5A 4FTVE 2IBGA 4MZ2A 4QHNA 2R1WB 5F7FA 3CFEA 1D5XB 4J4PC 3V4UL 1YEDA 5L2JA 5JXEA 3LKPB 1I1FA 4ESKA 4GQ9H 5SX4H 3SO5A 4AQOA 3FQTB 4NO3B 3F62A 2K7PA 2ITDA 5HYSG 5JHDA 5GGRB 2APWA 2D03L 4WUKH 5GGTH 1F3RB 4KVCH 4MMZC 4PJCE 3LKNA 1IGFH 1OTTC 4OZFB 5FK9A 4PJIF 1K2DB 2P8PA 3ES6B 3ROOB 3V7AG 4PB9H 2DQIL 4PFEA 2EO1A 3QPQD 4L29A 3VDBA 5LAXA 4JVUA 3GSXA 4K8RL 2J88H 1F4XL 4FZ8H 4Y5YB 3RWIB 4JKPL 1LEIB 5IV2B 3SPVB 4JRYD 1M71B 2JCCE 1S9VA 2F53E 3GO1L 3CPLA 4AH2A 1KNOB 3NPSB 1VKXB 3HPLB 3SDAA 3IDMA 2V9QA 3H9SA 2FLRT 3DV6B 3S36H 5CSZB 3MRFB 2APVA 1T1YB 4PRIE 2WIIA 3KLSA 1GSMA 1TZIB 5EBGA 3PP3H 5CZVL 2C5DC 5ICXB 2Z31C 5IB3A 4MXQC 3SCMB 4MAYA 1OF2A 1X3DA 3QUXC 3KXFB 3BVNB 1KB5L 4LRIC 4IMKA 1CTNA 4W6XB 5KSBF 3HC3L 4JFDA 4JM2F 1DLFH 2L7UA 1JP5A 4GMTH 2GAZA 3BDBA 5FECA 5EG6C 4CJ1A 2FDBP 1R3HB 3D0VB 2EC9U 1KPRA 3QAZC 4KAQH 5DYOA 1H5BC 5CLTA 1MJJB 2IFFH 1L0YA 1LEKA 5I1DA 4OTXH 1CQKA 3F7PC 1UWGL 1HINL 2AVGA 4N5EC 4V1DD 1MNUL 4Y16B 3C6LB 3MODH 5ICXA 3PGCA 2CDFA 4QHKJ 4LVOB 3ULUL 1MQ8A 1A7OH 1GGBL 5TGBB 4WHTB 3U0TA 4QTHA 3O8XD 2CLZB 3QDME 3FQUB 5LQBH 3B5GA 3ARBB 2DQCH 3WIHH 2RAMA 4MJ4A 1ZLWH 3C5ZA 4XNZB 1I3UA 1DEEA 5DA4A 4ZAKC 1T3FA 2XACC 2P45B 2DKSA 4H25A 4PJ8A 5DSCB 5HGBB 4UQ2A 1G7MB 3QQ3B 4X5XB 4X6DE 1ZA6B 2XRAH 2X1PA 5KTEH 4LHUB 4EXPX 4BZYA 3RVWC 3SDAD 2VLJA 1H15A 3U4EB 5IQ7H 5LGKA 7CGTA 3GGWB 2FRGP 1Q94A 5KZCB 3KS0J 4M4RA 1EMTH 3UTOA 4EJ1C 2G2RA 3HZYA 2CUMA 3FQRA 5SX5H 3ULUE 1T6VN 2NCMA 3A0OA 4R2GD 3TYFB 2XY2A 4P3WA 4ZNEA 4WO4B 5JDJA 2CJUL 1ZS8B 4U3CA 5C0DA 3DRQB 1K8IA 2NLJB 1JGEB 4ZQKB 4XP6H 3FL7A 4PRHA 5CKGA 4ELMA 3NIFE 4OT1L 1HHJA 3A6BH 4BFBD 3O6FC 3ARED 5TDNB 1UM4H 4HFUL 3MRKA 4DN4L 3ZZ1A 1J8HB 1T21B 5FO9A 5JIHA 4LLYA 3JZ7A 4FQIL 4KI5D 2EKSB 1EUTA 2MMXA 5JR1L 5DRZA 3W11D 5IT2H 4X4YB 2EDKA 1TVBA 1MI5A 4MJ6A 3EO9L 3VWKC 2OYPA 5H35B 3AUVA 2R2CA 1AI1H 4KK8C 1YYML 2KH2B 5JORB 2NY1B 4P46D 2ICWJ 1RZKH 1WUNT 4E41D 4YHIB 5I1AB 4P46B 5T3XH 5IP4A 1H3PH 2ARJQ 4ALAL 1N4XL 5SWZB 5FOBB 1BOGA 1NAKH 4PJIA 3E2HB 4MS8C 4R4ND 4FXKA 1G7MA 5DS8A 5IVXB 5CIPB 4ZOEA 3VMOA 4UQ3A 4KMQA 2NY5C 3SQBA 5I73C 2YEZB 3UTTE 2EXWC 2R1XB 1A1OB 1JZ6A 1S7QA 1ZLUH 1J1OL 1P53A 4WI4A 1TPXC 3V5KB 3EZ8A 3RZCA 2DOCA 1YDPB 3U30C 2ENYA 5T3ZH 2APTA 2A1WH 1FIGL 4OV5B 5M94B 3RGVA 4XP5H 1OSPH 5KN5A 4WI3A 4EKXA 1V7NH 4QTHB 3ARQA 4OLVL 5AWNL 5SWZE 5SWSA 3S96B 3OHXA 4KRPD 4YXHL 1A6VL 2DQCL 1GHFH 4H1LG 2DQHH 1DCLA 3GJFH 1I85A 1Z0NA 2J8HA 5J6HB 1NDMA 4X98A 2I5YL 4JM2C 3VJ6B 5D8JL 5HYQB 4P3DB 1F13A 4MJIE 3CVHH 4S0TD 5HHOA 3PWJB 1ROWA 3AMKA 3KPLA 4L3EE 1RUMH 5EIQA 2QLVB 2VE6A 4KKLD 1DQTA 1PAMA 1CGSL 4POZC 1T3FB 4UV7H 5ECJE 3VXUB 4N5UA 4NC0B 4X6DB 3WFZA 3OJVC 3C09B 4JPWL 1QVOB 5EA0L 2YD1A 4NHCH 1MHCB 4JREB 1FL3A 3KS0H 3SOBL 1HQRA 4G9FA 5F21B 2HT3D 2V17L 1ULVA 1MWAL 1MF2L 2BHUA 2FHBA 1CG9A 2PYEB 2Z35A 3UAJC 2F54E 3GMOA 1ZLWK 3I02A 4PJIE 3SDXF 5C0EA 1KCRH 5INCB 3SDDA 1CFTB 3KPOA 1RJZA 1U8HB 3FAXA 3FN9A 3VFPB 2VE6B 3QEHB 1DDHB 1HWGB 1AGEB 4ZFFA 2MHAA 4POUB 4HUUA 1DBBL 1XF1A 2AJXH 3TVMD 3RHWK 2Q76A 3V7MA 3LN4A 2HTLD 1ETZB 3O2DA 5E1AA 5HTSA 4L5FH 2Y6SC 5A2LH 4D8PA 3WBDA 1LEGB 2A9NH 1JI2A 5IEHB 5SWSD 2OX5A 1I9RH 5LVEA 4XPAH 1RJLB 3N9GH 3VG9B 3LKSA 4G3YH 4KDTA 4D0DA 1CLOL 5B4MD 3B6SA 4ZNEE 2PN5A 5T5NF 1E4XI 1MJ7H 1Q9LA 1MWAB 1KTLB 4JQXA 4TUJA 5T3XE 3NCBB 5HGDA 5T33H 5IW6A 2VZ1A 2LABA 1XIWA 3RIFF 4XP5L 2Q76B 4AT6B 4F37F 3A6BL 4LIQE 1OGAB 2DQTH 2VKWA 1U8NA 4KY1L 1L0QA 3OAUH 3RFZC 3VI3E 4ZFFB 1YEGH 2DI7A 3KXFE 4ZG1A 4K71B 1F3DJ 4IRJB 4IEFB 2EE3A 3F12B 4M1DL 1FNEB 5IFAH 1RUQL 1T5WA 1FZKB 1GAFH 4MA8L 3FQTA 1MVUB 1U6AL 4C58B 5DURB 1B3JA 1I1FB 3LCYA 3G08B 4X6BB 4WWKC 4YBLC 5IMMA 4YHOL 3PWLA 5FFLA 5EZIH 3Q3GB 5FO9B 1OAUH 3BN9D 3PP3K 1NCBH 3LRGA 3M17A 4LGSB 1JZ2A 2M2DA 1ED3A 1BQHB 5I76A 5CSBA 3KPRD 3K1DA 1RULH 43CAB 3VFMB 3CDCA 4G6JL 4OF3A 1KN4L 2QQKL 1U8MA 3DOSA 1JZ8A 1ZEAH 3G5ZA 5K9QG 3L3JB 4AENA 2I27N 5KANG 3PGDB 1GC1C 2P42B 4NHUB 5LBSH 2A2QT 4YIQA 3WKML 1CXHA 3BP4A 5I73B 4LPXA 2YMXL 1S8DA 1NKRA 3O2WL 5EO1A 4XPGH 4YUEH 1Z0MA 5KSUB 1ITCA 5FHAH 3ZYJA 3IFOB 1TZIA 4UT9L 3TJHD 5FUCC 2BVQA 1F02I 3C5ZC 1G7HA 4P2RE 2Y4SA 5TFSL 1QOKA 3CX5J 3EKCA 3ARZA 3MV11 4DCQA 4M62L 4HAFA 2W0LA 1MCOH 4PJ5E 2BXZA 1ZOXA 1EGJA 1DVFD 5MENE 1OM3L 4WHCA 3HC3H 2O61A 2BY1A 3VE0A 3X12B 1JPFA 3ELAT 3MXVL 4NC1E 1IC5L 2R4RL 2Y25A 3G6AA 1IJ9A 1FC2D 1FN4B 4ZYKA 1N6QH 3HC4H 4Z95H 2VLKB 1MJJA 3GJFK 4WVRA 2IJ0C 3EO1B 1T66C 1NSNH 5GISH 2P5WB 4LEOB 1OAQL 4BQCA 3VMPA 3OKYA 4GW5B 4BFIB 5MENB 4X7SH 5DD1L 3MACH 3DTXA 3CH1A 1RHFA 3PHQA 3U2SA 2FEDC 4XPHH 2Q3AA 3QZWG 2J4WL 5D1QB 4OV6F 3LHPH 3VFOA 5CBAB 1JIBA 3MRCB 3OZ9H 3O9WA 4YK4B 1VB9A 5C71A 4XNYH 4GKSB 3LOWA 4GW5A 2PO6B 5IMMB 1Q9KB 1CLYL 3QI9D 4E41E 1U58B 4Y0GA 1U91A 3IAQA 4NNYA 4FXGA 3PGFH 2V5YA 5DUBB 2R2HA 4OLZL 4LBEB 3KPSD 5FM5M 5FUOH 1ZVSA 3MLVH 3ABZA 4Z7WF 3R1GH 2R4SL 4G3YL 1OAYL 4LK4A 4EUPG 4GAJH 3B9KB 1B6DA 1P84J 5JOPE 1Q72L 4ETYA 3HMXA 2PNDA 5J7CC 1F3JB 4FFZL 4HDIB 1MCCA 2HTKC 5LAXB 5IK3A 4TUOB 3O4OB 4WY7L 3ET9F 3GSRA 4JHWL 1VGKB 2DWEA 5GGUA 2ERJB 5HHPB 4LL9A 4MSWA 4MXWH 4QHLB 4R8WH 2DM2A 2BVQB 3HS0A 3FHAA 2OI9B 3O8XA 4OM0H 4NQDA 4OI9A 5F93C 1CT8A 1JGUL 2J8OA 4DAGL 3LKOA 2WWMD 3ULVL 4OKVA 2VDML 5CP3H 3VRLE 5D6CB 2AP2A 1LO0H 2UY6A 2FGWL 4WWKA 2OR8A 1K4DA 3VRIA 1MFBL 2W0FA 3IJHB 2HLAB 5MEPB 1FZOB 5LWYH 1CDCA 4ONFL 1DBKL 4X6EA 4OD3L 1FPTL 4F7TA 5JOFB 2DM4A 4PRIB 4XCYB 5BMFH 2ARJB 2YSSB 3QCUH 3CVHB 4YZFF 3KNBB 1QLFA 3LY6A 1HQ4A 4F37K 2G75A 3KWWA 4D94A 4NJ9L 1N0LA 4KI5F 3KPNB 1NCWH 4YHZL 4KK6D 3GZKA 4UI2A 2R0LH 3QXWA 2HAZA 1FP5A 4F57L 4FQXD 1QFWL 1XGQB 4PY7A 2ICES 1KJ2H 2RJMA 1IAIH 3OKNB 1ZEAL 5B38G 1I75A 1AGDA 3MROA 2ZNWA 4GO6B 2HVKA 1FNAA 4ZO7A 4FXLA 1IZJA 1CL7L 1J0YA 2HJLA 5JQ6L 3ZLQC 3LQZA 2SEBB 3DMMD 4GSDL 4A6YA 3E3QC 3GSWA 5I1JL 1UA6H 1JK8B 5ALBH 4KJWC 4OFDA 1IFHL 3LS4L 1N2RB 1F45A 3ILQD 3CFIC 4MGXA 2YWYA 4NBXB 3MV7E 1I7RA 3OKMA 1KENL 4C56D 4U7MA 4MNHB 4PTUB 2WQRA 1YPZF 3H9ZA 3V52H 1C5DB 4PLJD 3GHBL 1JN6B 2HT2C 2A6KB 4H5SA 4M1GH 4UB0H 2B1AH 4KDTC 3F7YB 5A43C 1RV6X 3NFNA 5E99H 3VGAB 4JFEA 1R5WB 5L7XH 3DIFA 2Y7QA 4KKCC 1A22B 4RISH 3ETBF 1KPVA 5J89A 2JIXD 2VXTH 4KMTL 4Y4KB 2JJTA 4GH7B 4OCSL 1FC1A 5DURD 3V5KA 1Z3GL 3UDWA 4WFFD 3DNKA 3HE7C 1V3LA 2XWTB 1ETZA 2PXYC 5E1AB 5KAQF 4O51A 5DUPH 3X13B 1MHHA 5IM7B 1CFNA 4HUUB 4XTRD 2VN4A 3L5WB 3PL6D 1IBGL 2HN7A 4ONOA 1JVKA 2VAAA 4G5ZH 2VLRB 4G8FB 5EZLB 4HS8H 2GKIA 5L9DL 1VDGA 2DBLH 3IDGA 4KKBD 3DVIA 1MHEB 4ENEC 3PNWB 2ZUTA 3HC4L 4Z95L 2PCPB 3GMPA 4RBPH 3ARFA 2V6HA 5TF1L 3GMLA 4O2CB 4JKMA 2EIZA 1T5XA 3WLWC 1J8KA 2AK1L 1REIA 1U36A 3TN0B 1KLGB 4G9FE 3RAJL 2R56L 4NSKA 1CD8A 2HLFC 4JFHD 3V4VL 3V2AR 1JNNL 1MH5B 1AFVL 3G5VB 5J8OA 3SE4A 5DD0H 1WWBX 4K55A 1C5CL 3HB3C 3X3FL 3BZ4B 4OCLC 4Y4HD 1KJ2L 5KW9H 3FT4B 1Z9LA 3K74B 1CFVH 1MPAL 5J13B 1AGBB 4EDWH 2CIKA 3GK8L 3OXSA 1EZVX 3EYOB 3FB8A 4WGWB 2WP3T 5H37H 4JZJC 1NMBL 2XN9D 2W0KA 4NT6A 3EHBD 4LRIA 4PJGB 2QJDA 4F33A 1FVCA 3U6RB 3MJ9H 5HVHB 2DICA 5DMKA 4HIJA 2X1WL 4FG6D 5LBSL 5JTWA 4I48B 4TSBL 1Z6JT 1RIUH 1ZT7B 4OIIH 4P59H 4LCCA 3WNNA 2A73A 2VDPL 2F5BL 1T7YA 4PJAE 4AZ8A 1F90H 1MFNA 1U3HA 4U31A 4CJ0A 5ACLA 1JCKA 1WGOA 3W39B 2UUDH 4RWYH 3QDAA 2WP3O 1KB5H 4M5YL 4Z7UF 5C07B 5ICZA 4HUKB 4U1MA 4PGEB 4JFOA 5I75B 5GS0D 4CVZA 1KBGL 4OLUH 1RD6A 2EDQA 5FDWB 5EUOA 3FO0L 3IDXL 5C0JA 5IFHL 5IB2A 4RMUA 3MQIA 4J1UA 2JLLA 3P0YL 4UAOB 4PJ9D 1I9IL 4HWBA 1QBLL 3NCFB 5LG1A 3V6OC 4O02H 4WEBL 4D2NA 4NZTL 4R0LA 5I1CL 2FBJL 4V2CB 1S5HA 7FABH 5F6IB 2F53B 3WE6B 1EJOH 1IMHC 3MSPA 3PGFL 3T3PF 1QFHA 5ESQA 4E5XB 4QTIH 4Y8AA 2LVEA 4PYHA 4G9FD 2LE9A 5E2WL 1JGVL 4YHYB 5ALCH 3OZ9L 2DQUH 4J6RL 5EO0A 3U9UA 3AREB 4OFVA 5EU7E 3HA0A 4S11A 3DBXB 4QYOB 3TBVB 2OL3B 4HT1L 4RGNB 5DO2D 5ENWA 3WJJA 4QCIA 5L7XL 5SWQB 3MRLB 2OJEB 2OJZH 3QQNA 5I1LB 4JKPH 3DGCR 3MV9D 1NCDH 4JANB 2NZ9C 3Q2CA 5ICYA 4WFGD 1ZVHA 4N5ED 4X99B 4YJZL 1WWWX 4L4TA 3CXHK 4YDLC 4U1KA 2C1PB 4XNYL 2B1HH 2IPKA 3DVNA 5BRZD 1QFWM 1U93A 3HPJB 3QXUA 1HH9B 3NAAH 4P99A 2AK4A 4V2BA 4QWWC 4CMHC 4BZ2H 2FHFA 4YBLB 3L3OA 5D9SA 2R1YA 4HUVB 1ZGLA 3TH2T 4H88H 1F90L 4ZPVA 4MQXC 1NUNB 2BVYA 5CINH 1TXKA 3GSQA 4J7RA 4CVXB 3GSNH 4BUHA 3N1FC 2BOCA 2MJWA 2CIIB 2FLBT 2AKRB 1BQHA 5I76B 1BAFH 5EC2B 3MLUL 3EYQC 1F4HA 4AM0B 5BZDB 3K2MC 1WSST 3B43A 4LPVA 4YHZH 2GTWB 2GY7B 5ACZA 3BVNA 1JJUA 1BD2D 1SJEA 1P9MA 4U2ZA 4N0YL 2OK0H 4GG6B 1UXWB 4K3HA 3QDMD 4RRPG 3F6LA 3PWNA 4KTYA 4WI6A 1N64H 3BQUA 1HKFA 1KIRA 1DQQA 3MBXL 3MRFA 3N0PB 2MCG1 4MQSB 4U6HB 4BQ8A 3PWUB 3O11A 3MR9B 3SY0B 3REVB 2VQ1B 2WBJB 3FZUD 2H32A 4F57H 3BKJL 5DJ2B 1M1SA 4Z7VA 4XNUH 1OGTA 4MWFB 4Y4FD 2W9DH 3ZKXB 4DUXA 5GS1A 1H5BB 5I1KH 4JG1L 3X14A 4P46C 3P4NA 1BEYL 4R3SB 4LSSL 3RGVD 3QCUL 3TVMB 5E95B 4G7VL 1AR2A 4KC3B 5KW9L 4X6CB 4PRDA 2C7UA 3HAEA 4N68A 5BZWA 5I0ZA 5D72L 2FX7H 1P84K 2GJJA 4P9HC 5KVFL 4MS8D 4R4NC 3C60D 4PJEF 5T1MB 3QUYD 3RWGA 2ZG3A 1TJGL 1JGLH 1UJ3A 2Z0BA 5TQ0H 1BPVA 4PJ8D 1N59B 5IB4B 1JPTL 3ZYIA 3EYSL 4LKXB 1PSKH 2GTWA 4E41B 1KT2B 1GOGA 2CRZA 3O6KH 3QDHA 4OF0A 3HE7B 3VD3A 1VEPA 3TBYB 4FQJL 3QEHA 2KUTA 3DGGA 3GUTA 3OX8B 4KTEH 3S98A 1G7JA 2H6PB 4G5ZL 3SKJH 5IVZA 4JQIL 3GRWA 2YPLD 4U6HA 2EYTA 4Z78B 5E9DD 1UQSB 3QG6A 3R06B 5D96B 4WEBH 3K8KA 3DLQR 3FRUB 1H3PL 3GM0A 5H8DA 4FQXA 4K9EH 5CEXB 1CGXA 3EDFA 4OFIA 4GAYA 3SKMA 4NKIL 1OGAD 3FO1B 1W0YT 1SJEB 4Y5VA 4RMQA 2FX8L 3RWEA 4PJAF 4P2OD 4DCQB 2N1KA 3DV4B 1O0VA 2BNRE 4YR6B 4YAQB 2CIIA 1GRWA 2Q3ZA 3CDFA 3WIIL 1U8NB 5DT1L 5GRVL 1JUFB 3TZVC 4OLEA 2Z93B 5HYQA 1CFNB 4MNQA 5T3ZD 4AT6A 1J18A 5T1LB 3MBXH 3HE6D 2OL3L 2NY4D 1C7SA 1UACH 3T0WA 3LKOB 2UWEF 1I8LA 3EW3B 2MCPL 2EH8L 5J13C 4JO2L 4ZPTA 2X7LA 4PJ9B 3TNNA 5CILH 4EI6B 1QSFA 4YQXL 4ODUB 2RR3A 1H3TA 4YC2B 1FYTA 4DKFH 1A5FH 3RUGA 4HF5H 1EEUA 5HHPA 1WJ3A 1KLGA 3GSNL 3FQNA 3F58H 4QRRD 3C8KA 1IL1B 1K3IA 3CFJA 3W0WA 3ZDYE 1EHXA 2BDNH 5FGBA 4O9HL 4IRSC 4OCNC 3SOBH 3QXAA 5TJWK 4PRBB 2PW1A 2XZCL 5FV2A 5IMKB 4XBGB 4PD4K 3NCCB 5E9DA 4EDXA 1C5CH 2WIMA 1AJ7H 1RIUL 4OIIL 1BJ8A 3L5XL 4LSUH 2IPUG 1PYWA 3I75B 1HEZA 1GAFL 3H42L 5EPMA 5J57B 1KEGL 1JRHI 4A6YL 3KXFD 4HWEL 1MELA 4N1HB 4GXUM 4HWZB 3I6LE 1U8JA 2ZJSH 4O00A 3V6OA 3IFPB 5B8CB 2BNQE 2Z4QB 3HNSH 3IU4L 3QDMA 5FYLE 5B39B 1XF5A 4PJDF 4G6FB 4HT1H 1N4XH 1VEMA 2IANB 3MRDB 4S1DD 4I0PC 4GG6F 2BHYA 5IHZB 1K8IB 3BP5B 1UZ6E 2FH6A 4K7PY 4AEIH 3CXDH 4EI6A 1WT5C 5JZ7C 3KYKH 1ZGLM 1LP9F 5EOCL 3TA3D 2WAHA 4TOYL 1DEDA 3WEXB 3STLA 4K94C 4MXVF 4NGHH 2NW2B 3VGAC 1D9KB 2ZKHL 1CYGA 3CMOL 1JWMA 4GLRH 1KJ2B 2J1KA 4GW4A 5EIIA 1X9QA 5T1LA 5TQ2H 3ZE1F 4CW1B 1ONQA 4PJGE 5FYLD 1S7RA 1U8IB 1FE8L 4NQDB 1M4KA 4GBXD 1F4WL 4PLOB 5E2JA 5BRZE 3N85L 1RUPL 4V1DA 3BKCH 4NFDA 5F7LB 2VC2L 1DQQB 1GC1L 1AXSA 1TJHH 1S7XB 2IH1A 4PREA 4HEPG 4Q9BA 3VXNB 1GJIA 4PJ5D 3UTSA 1I7ZB 4BYHA 4PP2A 1EJ6A 4WRLA 1K85A 3RI5F 3L7FA 2M1KA 1FNSL 1NH6A 1X5ZA 1CLOH 4AL8H 3B9KA 3LB6C 1B0GB 3GJFB 5FYJD 1DBMH 2IAMC 3K4ZA 2W91A 3AC0A 3VU2A 4LLMB 1IZKA 4M62H 1NUGA 1N5YL 5D96C 3D0VA 4U1IB 3BPNB 1T2QL 4MB3A 4M8VA 3V6BR 5IMLA 2BK8A 1PZ5A 4U2YA 2BNQB 4YDVA 4LVNB 4BK5A 4ONHB 4LSUL 3T04D 5I0DA 2VDNL 5C0CE 2B0SL 4XNUL 4LSTL 2ZWLT 3VD7A 4N0YH 2OK0L 2VLRE 3O2WH 4LDEB 2Y36H 3UC0H 2C3XA 4N0UB 4L8CB 4MAYC 3DVNB 4PGDB 2VLMD 4N0UE 4TQEH 2RFXB 1MHEA 2I9TA 5DQ9A 2EC8A 1P7HL 1EIBA 3TIDA 1FL6A 2CXGA 3D85D 1XF3B 4JCMA 5IGXL 4YGAB 5HY9B 4LCWA 2F54D 1N5AA 4L9LB 3L5JA 1FAIH 2XKSA 3WYRA 4XNXH 4J4PD 4WI2A 1H5BA 1B4RA 4DGVH 3BH9B 4NO0D 2BRQA 3QEGL 3P9MA 2BY0A 1Z9SA 2YXFA 2R0WH 2YD6A 5L0QB 3ARXA 3QIUB 1FO0H 1R6VA 3VDAA 3AS3A 3H0TA 3QFJE 4L9LA 5JORA 5LJYH 4Y2DA 4L8DA 3C2AL 5D6DC 3ZHKA 4HKBB 5D7LB 2J6EH 4JQVC 4Q6YA 2FR4A 2DKUA 2R9HC 1CICB 1K4CB 2B2XL 2YPLB 4F33B 2V5TA 2MTPA 4U1LA 4IRJD 4PJFB 5I16B 3U7WH 3QIBD 2QQLH 4RGNC 1MFBH 1Q9WB 4D8PB 3GNML 1D6VL 1K5NB 4KU1A 5C09A 3KG5A 3TV3L 2D7PA 4YDLB 4UUJA 3HI1A 4IIQB 3IS0X 3T4YA 5GS0H 1CICC 1NFDB 1Y18B 1MFCL 4YHYC 5HSFA 4CRPA 5EUKB 3QEUB 4ZO9A 5F9DC 2EDLA 4I0PA 3L3JA 1AC6A 1MOEA 4HUXA 2YR3A 2P5ED 2A77L 2K1MA 4OD2A 4WNQA 4M7KL 4XP9H 1JGLL 5TQ0L 5AYQA 4LPUA 3RA7H 3SE3A 3DYOA 4HUMB 5D1ZA 1OGAE 4MAYB 2DMBA 2FSEB 4I3RH 1HCVA 2XQYK 3UYRL 3V8OA 5CAYB 1E6JH 3RY6C 1FCCA 5E24E 2C3VB 1I1AB 1LILA 4XX1E 3I85A 1CD1A 4P4RA 4RNRA 3PABB 3P9LB 4CUCA 2PXYA 2L0DA 3EOTH 1QRNB 4DGYH 5CJ5A 1IGYB 5CP7B 1A14L 5ESAB 4LNRA 3DSNA 4PY8J 1M71A 2WMPA 4HGKC 1OARH 5F9WC 3E8UH 3VXUE 1P5UA 1UA6L 2K7QA 2CLZA 3HNTL 4WI7A 3BQUD 4K23H 4M6NL 4TULL 4XBPB 1U2HA 1P6FA 2JK5A 5GGVY 2Q7YB 5SWQA 5B38B 3TN0D 4JR9L 1BVZA 1MEXL 2IAMB 5GZNC 3DGGB 5GHWH 4Q9QH 1NGQH 1FH5H 3P4OA 4KQ4H 5DJDB 3FB6A 1A6TA 1HZHL 4HW6A 3ROOA 4ODXA 5B3JF 1MCLA 2O5ZH 3V4PL 1L6XA 1PBYA 3QSKB 4X6CE 4Y4FA 3OB8A 3DMMC 4L4VB 5BVPH 1KEML 2VSDA 2Z92A 3IJYB 1TCRA 3VFMA 1UZ6F 3S35H 2V2XB 1KEGH 3ILQC 3VWKB 3UJTH 1C12A 3RVWD 1JTOA 1G7LA 4MLSA 4XWGL 2GK0B 3M17B 1B6UA 4R0LB 2HFEB 3SCMD 3FFDB 2HWZH 1UACL 3PP4L 4O9HH 5ETUB 1E28A 4CMMA 4JEGB 4FQ2L 4GT7A 4M6ML 4EEEA 1EVUA 3V6ZB 4OZFH 3HUJA 5J1SC 4JHAL 3IS1X 3ULVH 3UX9B 1F6LL 2VMFA 1CZ8H 4Y89A 4LLWA 1GGBH 2HYMA 4XCCL 5DWUL 3MR9A 1ZXQA 1MIEH 2I07A 1FLTX 1L6ZA 2R15A 4M43L 3P0VH 1UWGH 4JDVB 3LD8B 1NMAL 3IGAA 4YXKH 3QUMA 3OXRA 4F15B 1D9KD 1PZUB 2P5EE 4XTRC 2J8UA 4N1EA 5HHVL 1NFIA 1MWAA 4NN7B 1FGNH 1RK1A 2P24A 3LEYH 4Y5XC 3PV6B 4LCCB 4NQVA 4XMPH 3KLHD 1QLFB 4D0DB 3DTXB 4DQOH 1YY8B 2EDJA 3MUGB 5HHMD 1UZ8B 4GRLC 1LK3L 4MD5A 4K8RH 4LEOA 3MNZA 1OWRM 3F6IA 4JPKH 1P2CA 2QTEA 5DMGC 5TF1H 1MCWM 1AE6H 1H3WM 4GAGL 4PJ5B 4JZOB 2WLYA 4FFWD 2PF6A 1T20B 4ZS6C 3NCMA 4MZ3A 1Q0XL 3O3EA 5JUEL 1H8NA 4ZXBD 1T22B 3WXWL 2YA0A 3FRPA 1NGYA 3GHEL 2R2EB 5DJDA 1QKZH 4NQCA 5HGBA 5FOJA 2CJUH 3V8CA 4GUPA 4RFEB 3MBED 4NQVB 43C9A 3CSBA 2Q7YA 3B9VA 2XXCB 2BSRB 4K3DH 1CVSC 2VDQH 3SKUD 4ETQA 1R3KB 3DETD 1G7HB 3P30H 3NFSH 5FYKU 2OLDA 1VGKA 1X5GA 1A3RL 1XGQA 2BVUA 2VLJD 2DAVA 2ZOLB 5T33L 2FNBA 4KJQC 4QGYA 3HG1E 2NY7H 4H20H 4JG0H 1HIML 3GB7A 5CCKL 3RY4A 3EO0A 3O0RH 2FSEA 3JTTB 3BP7A 5EZLA 1Q0YH 3QNXA 5C0GA 4YHPA 3C09C 5FYJH 3KDMA 3QO1B 1KIPA 4LAQH 1CDJA 2NY5L 2HT3C 5DC9B 3H7BB 4HGWA 1NCNA 4X4MA 4YWGH 4JLRB 3PDOB 3NIGE 5IROC 3VGBA 3ZMRA 2FD6H 4QF1A 1XCQA 3MRNA 4O51B 1LO4H 2Y9RT 2PR4H 5DK2A 3HI6H 1C08B 3LRSB 1LE9B 3LQMA 4IHOA 3T65B 4TPRH 3BZFB 5HDBE 3Q3GA 3MLWH 1XGRB 1K5NA 3IDXH 2DQGH 1EO8H 2CMRH 4NJAL 4X6FA 3UPRB 1LE5A 1D5ZA 1RZFL 2Y7QB 2WSKA 3P4LA 5DVLA 4MD4B 5IGXH 5C0JB 4GXUN 4PRDB 4J3WA 3NFPA 4G6JH 3OB0K 4JY5L 4TSCL 5TDPA 5MHSD 1J05A 5C0BA 3SDYL 3O6FD 1G7QB 5DGRA 2CR6A 1CF8H 3P4NB 3QCVH 3RX7A 2IQAA 3QB7C 4R2GB 2XICA 1X5JA 1U92B 4Y16C 5FO8B 4LCUB 3QCTL 3RVTC 3TBVA 3I6KB 2H26A 4XPGL 1S7SB 4LCWE 4G8IA 2DN7A 3IFLH 3Q1SH 3MV8E 5BQ7B 1W0VB 3D69A 3GMNB 3NOIA 3U0WH 2GQHA 3MV9E 4OGXL 5KSAD 3H9YA 1IAII 1U58A 2KBGA 3MRMA 2DYPD 1CXKA 3HG1B 1FL3B 1JMZA 1MAKA 3CLEL 5GGVH 5DRXA 5F9OH 2CKBA 3BEVB 2Y06L 4MCZA 3PIQB 1HHKA 2N56A 4D3CH 4QXTB 3TYFA 3EFDH 4P5MB 3GSVA 4KRPC 43CAA 4XPAL 4X6EB 2D31A 1MH5A 1KIQB 1ZHBA 3ZKSD 4KWUA 1T7WA 4WFHE 3VRIB 4L5FL 1U8QB 5D7IF 3ULSA 4PLKC 1UCBL 1BBDH 4XHJC 5KVEH 1YY9D 4MQTB 1WCQA 4LMQI 1AGCA 3GIZH 5KJRH 3BRDA 1WZ1L 3MZGB 3VXSA 2IMMA 1KPUA 3WFHB 5D7IB 4HJGA 4KKLC 5CGYD 3TP4A 3RVVC 4QLRA 1D5MB 5E4IA 2XZZA 2XA8L 4CU8A 4RGMB 3O3BB 4DTGH 1I1CA 5JDSB 4FRWA 3RWIA 1JE6A 3RVXD 2R2EA 4NQED 1VSCA 1AQDB 4FXKB 4NM8H 4G6MH 4NNXA 2A9NL 3QH3B 4BSVB 3VFVA 3LS5L 4X9GA 1A6WH 1EEZB 4M6OH 1ACYH 2YN3A 5HHNA 3LKNB 2X4TA 1SYSB 3IXTB 1CE1H 5SV3A 4YE4L 4M7JH 3LQAL 1E6OH 1KCVL 1LNUA 1CGVA 4WU7B 4F7EA 4HIXH 1AO7A 4OLWL 5C0ND 4GRMA 4QXTA 4LSSH 4WJ5A 3UJTL 1KBGH 4FQPA 1HYRC 4YFLI 3VWJB 1QA9B 4S1SH 1DQDH 3BWUC 3TVMC 2H8PB 1FRGL 5CS7A 2DLTA 3RWDB 5KG9A 5CEZD 2Z91A 4NSKB 2IANA 4HAGA 4HC1L 2VR5A 4YHLL 1OLLA 1DE4B 4YHMH 5DTFA 2C1OA 4MNHA 3V4PH 3QUXB 5HVWA 15C8H 3S4SG 3MRMB 1YECH 4DZBB 4JLRA 1I7TA 1ZS8A 5C0DB 3WNLA 2IG2H 2VDRL 2NXZB 2A0LD 2SEBA 5DHYA 2CMRL 4NJAH 1IKNC 3W2DL 1N8ZB 1WCBB 4XXCA 2ICWB 3IFNL 4JFXA 3MLXH 4XCFH 4H8WC 4JREC 4C55A 1OGAA 3ARSA 3QI9C 3EOAB 2FB4H 4R90L 3KR3L 5D7IE 2R69H 4XMLH 3BJLA 1UADC 4XRCB 4Z7VF 2GK0A 3C8KB 4X4XB 1FYTB 4QOKD 3N1PC 4Q6IB 4JFYA 4DK3A 5JW3L 2EEBA 4JM4L 1GZQB 3OR7A 5IW1A 5J4MA 2ATPB 4H20L 1QBMH 4JG0L 4KTEL 3D39D 5MEOA 4KY1H 3KLAA 1WBZB 4XCEB 3AM8C 1Q94B 2H3NA 4IJ3C 1EH9A 2CPCA 3UZQA 4QRPA 4ZFZA 1FZOA 3QRGH 2DKMA 2I26N 2JELH 3ZDYF 3LRHA 1I7RB 4HMEA 1EPFA 4DTGL 4M48L 3BESR 4BSVA 3MRIA 3WDJA 4HHAB 2VR4A 4UTBL 5D2NA 5F1KC 1GIGH 5DK3A 2HT4C 1S7UB 2EE6A 3JTTA 4JQIH 3FOMB 3V4UH 2ZSVB 3WFEH 1LO2L 3T1FB 4XNQA 1FNLA 4AG4L 1DTUA 2E27H 4QRQA 1AH1A 4P57B 2B39A 4UU9A 2CDEB 1S7WB 4JY4A 4OGZA 4PB9L 4BELD 4PG9B 1ZHLA 3ZE2F 1HQRB 3HZKA 3TJHC 5GRUH 1SYVA 1JZ3A 2H2SC 3VXQB 3FT2A 2R0KH 3SN6N 5DK0B 2NX5A 4YPGA 4IRJA 3CXDL 5I71C 1MVFA 4P5MA 4M3JA 1EGJH 1RZ8A 3TT3H 4ZFGH 1SM3H 1FNFA 4X4ME 4IRSD 5EUKA 1G9NL 2AABL 2ZSWA 3IU4H 2EXYC 5FO8A 1KFAH 1MRFH 2ADIB 3MRIB 5TFSH 2VZUA 3FMGL 3ULVE 5GSVA 4OQTA 5JLZA 1RZIB 3IF1A 2RCSL 5F1IA 3HG1A 2VITA 4PJEA 4Y19E 3MLXL 4JRWA 1T03L 2DWDB 4LSDA 3FQXB 4PBWD 3EDJA 1MY5A 2WIIB 1NCCL 1XGYL 1WFOA 4HKBA 3JWOH 5KTEL 3D69B 3GMNA 5I75C 1ZHNA 3WFBL 5CBEB 5GGUB 3TVMA 1J8HD 1A1MA 3LN9A 3F58L 4PLJC 1S7SA 5LCVL 1WEJL 1YUHA 3O0RL 2XQYG 1T1ZA 3QG7H 4ZAKB 3TA3C 3SY0A 4KJYB 5FK9B 1U8OA 4F7PA 4JCLA 4DKAA 3QO0A 2OTWA 3FQWA 4YPGB 5DHYB 3L3KB 4OZ4A 1VFBA 2CKBL 1ZLSL 3QFJB 4EBQL 4HJGB 5JW4Q 4K8RD 2VQTA 3J8F7 2Y23A 5FXCH 1IKNA 1R3LA 4MJID 4ODHH 5EWIH 5H94B 1OP5H 1D5IL 1AR1C 4P4RB 3CFDA 4RNRB 4X6FB 3K2UH 4CNIB 4FQXB 1FV1B 1CE1L 2J88L 1T80A 2VZOA 3QUZD 5E5MA 4KDVA 4JFHE 4OZFG 1EBPA 3T1FA 1JGUH 1DANU 1S7UA 4QRSA 5JA9A 4KHXH 4IS6B 2IC2A 4BFIA 4B7IA 4EN3A 1P4LA 5FO7B 1P6AB 3BIAX 2VZVA 3MOQA 2AK1H 4Y8DC 4HIEA 1T20A 3U4EA 5DHVB 2WUBL 1DUYA 1A9BA 2R8SL 1UM4L 4HFUH 2VR9A 3V52L 3FB6B 3I3EA 4CU7A 3F65A 3O6FB 2P46B 3QULA 3VDCA 4CGTA 3BYTA 4M9PA 1NFKA 5FIEA 1I7UA 1XGPA 3GEWB 1CICA 1K4CA 4WI5A 2ZJSL 2PTUA 3KPRA 4YEEA 4KRMB 1F6FB 2KDGA 4PJ7F 4G8GB 2P5EB 5ITBH 4ZSOB 1T89A 3U46B 5DI8A 5JR1H 4GW1B 1MFDH 5F89A 3SDDD 1EEYB 1B2WL 3W0WE 3OAYK 3EHBC 3ZE0E 3OSKA 3AREA 1AY1L 4PLNC 2CK0L 3C6LA 4OZIE 4FFVD 2ADFH 1MCBA 32C2A 5FUZH 3OF6D 2IQ9H 3EJZC 4LQFH 1ODAA 5BOPA 5HYIA 3BGFC 4LSPH 2C4FU 4U49A 5ID1A 1JYVA 4JZNA 4YHNB 4KROD 1G7IA 3AS2A 4LP4A 3MLTA 4CN1A 3MGOB 3TC9A 1QHPA 5F7YC 2W65A 1EHAA 3QZWA 4G9DA 5I6XC 1TVHA 2BFVL 4PUBH 3SDXA 1C16A 4IOFC 2Y1VA 2J7LA 1J0IA 4BQBA 3I6GB 1V3JA 5GPRA 1XF5B 5KOVC 2HH0H 4C56A 3C9NB 3ULUD 8FABA 2VJXA 1QUNA 4L8SB 5DJXB 4P5TD 3S88H 4X6BA 3B9AA 4QNPE 2IPTL 1DBJH 1ZV5A 1TVHB 3UCRA 3WJLA 3QIWA 3ARBC 3QFJA 2N7BA 1YYLL 2NY1C 4GKNA 2AJUL 5C0RH 1A9EB 4LF3A 1OSPL 4XXCC 5FDYA 1UVQA 2IMNA 5DJCA 4MB4A 1CFTA 5IV2A 2XZAL 3ZKMD 5IKCB 4OD1H 1EXUA 3CVHL 1XMWA 4HLZG 4NHCL 3UZEA 3FB7A 2VDNH 3DXAA 3OWEA 3R8QA 3WS6A 1V8HA 1YEKL 2QQQA 5T1DL 3AXLB 3WO4C 3VI4F 3ZDZF 4RZCA 3IU3A 1IT9H 5LGJB 5C1MB 3T0EB 5CD5D 1RUAL 2ICEA 3GSOB 1J7VR 4WFGE 2ZSVA 3VG0H 5JHDB 4HIJB 1I4FA 1RUKH 1MEXH 2JTDA 3WNKA 4OUUB 3MLYH 4RFEA 4RIRA 3QA3A 4MJ2A 5DVNA 2DLHA 1RJLA 4YHML 4O5LH 2N7AA 1OARL 3SBWC 2R29H 2CRIA 5EOQH 1NCBL 4I0CC 4YGVA 2OCFD 2DQTL 2Q6WB 3NAAL 2WM0A 4L8BA 2VLLA 3DX8B 1FVDB 3T8XA 4LVOC 1NDMB 5DFVD 4IRSB 5GS1C 5DVKA 4M1DH 5D5MB 1SEBA 3NMEA 4UILH 4M7LL 5KVDL 1MQKH 3G5ZB 3MNVB 2EDBA 3LH2H 5FUZL 4PYGA 3BJ91 2B2XH 4S1RH 4HIIA 4FS0A 1MAMH 1YDPA 5BO1H 3F8UB 2XV6B 5DUPL 3O4OC 4LRNH 3RIFK 2R2BB 1H3UA 3MFFA 3OJDA 4UT7H 2X40A 3NTCH 1Q9OA 3CGTA 1PSKL 2KKQA 3BUYA 4G7YH 2R0KL 2FR4B 4LCYB 3ULSB 1A14H 3C5SB 3LKQA 4HJJH 5IOPB 1J87A 2FECL 4NZRH 4R97B 4OGAC 2DMKA 3T3ME 1QRKA 1ONQB 4M8QB 4DEPC 3RBGA 5IBTH 3GKWH 4HX1A 3PHOB 4M7ZC 4MX7B 3ES6A 4HPYH 3UAJD 4I3SL 5CJ8A 5IFHH 2AEQH 2NW3A 3UEZA 2F74A 1IAMA 3BE1L 1HHJB 3HZMB 1CFQB 3HRZA 4LFHG 1MI5D 3H9HA 5E6IA 5EO9B 3EYVB 3EAKA 3UJJH 3A67H 5IBLC 3Q48A 3TNMA 4M00A 3OG6B 3TA3B 1E4WH 5EORH 4FABL 1I4FB 4PTUA 5F9JB 4APQA 3H0TB 3RQ3A 1G7PB 2YRZA 4XRCA 4NZDA 5B39A 5J3HD 4FTVB 3TWCH 1KOAA 1NL0H 4WTZA 4NQCD 1N2RA 4FQCH 1XCQB 1IEBB 3C6SB 3IETA 4HWZA 1PKOA 3O45B 1MCOL 2VXVL 1U8KA 4I4WA 3O3DB 1NBVL 1AQDA 1XT5A 3BMWA 1MIMH 4Q0XL 1I8LC 2JK5B 5EPMB 5B38A 1RZFH 2BFVH 5B4MC 2R23A 3CSYB 4PRPE 5C0CD 3RNQB 3BXNB 1KCLA 4MD0A 5F70A 1R5IB 1UVQB 2FEEI 1XF3A 3FFCE 2DLGA 4NRXA 1IVLA 3MLZL 1UEMA 1NBZA 1EDQA 3LPWA 3P9WB 1AGCB 5E56A 3KPPB 5ILTL 2ZUYA 1A7PL 1I1AA 3CFJB 4G9FB 5JHLL 1RZJL 1S7XA 2IH1B 4Y16A 5HD8D 5IQ9A 4HCRL 1NC4A 4HXBL