5ECJE

Crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYAQYYYRGWYVGSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 14,Protein CBFA2T2
publication title ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/transcription
total genus 12
structure length 93
sequence length 93
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ecjE00
4MB3A 4NN7C 4WO4D 3PWPE 3TZVD 1MAML 2IG2H 1J1XH 4YLQT 4Z7QF 4N0FA 4F7MA 5CEZL 3X3FL 3K4AA 2IQAB 3VXUB 4LEOA 4G9FB 4MNQB 2VXQL 2JJWA 4G8EA 2MKLC 1CDGA 2YD5A 2VE6A 3ZDZE 1DUYB 5JA8B 2VZOA 35C8H 4LSSL 1NCBL 2CPCA 4OLWL 5I73B 3O4OC 4LKCB 1E4WL 4YC2C 4I0CC 2C4FU 5LBSH 1K3ZA 3HI5H 5E2UL 5H35A 4KK5C 4OGAD 1MY7A 1O7VA 1RZKL 3DX9A 3LKPB 4MQXD 5E6IB 1YQVH 5E00A 4CVWA 5F6IC 2BRRL 2GSIB 4DUWA 4TNVK 4LLYB 4I18A 4WFGD 3G9AB 4I18B 3BKML 4OCXH 3U4BH 4L1DA 4F7CA 4WV1B 2VNCA 2NLJB 1DBBH 3T2PA 5BV7C 1PKOA 1FFQA 2V2XA 5I8OL 3FFDA 3QEHA 5JOFA 4FTVA 4JRWA 4M9PA 3WHE0 3FFDB 3QEHB 4OKVA 3V4PL 4FTVB 5E70A 3C5ZD 5IB3A 1QZ1A 4NFCA 3ZTJH 3EYSH 2MCPH 1HI6A 1OTSC 1JGUH 3QEQA 3MRNA 5JW4M 3LS4H 1XF5A 1WZLA 1ZT7A 1ZHNB 3IDJA 3EYUH 4O02L 4PLOB 3IDJB 2CK2A 3PWUB 3JWNC 1R5WA 3BKJH 3O2DL 4L9LB 3ULVH 5D7IE 2IPKA 3C5SA 3L5WA 5HI4C 1PG7W 1UJ3A 4P5TB 1UJ3B 1WWAX 2YS4A 4XVSL 1V05A 5DURD 4ZTPL 1GGUA 4LEXL 5EU4A 1NJ9B 4X8JB 3GJEA 5FK9A 1WFUA 4JJ5B 4HMDA 2D03L 5FK9B 5C2UB 4ODWB 4G80B 4X0KB 4R4NC 4TUKL 2WQ8A 3Q6FA 2GY5A 3BN9D 2P48B 5EA0H 1T03H 4EQ2A 2D31B 1IRAY 1QLRB 1NEZA 4UTBH 4PTTB 3VG9C 2AEQL 3MV9E 1NGPH 5IB1B 1XMWA 4PJGB 2AJZA 3MRLB 3GO1H 1UM4H 4HW6A 3IETB 1KELH 4Z9KB 5JORA 4K3EH 4ZO7A 2RIKA 3NIDF 4NZTH 4X6FA 2EDDA 5D5MA 4PJ9C 1CZ8H 4BQ9A 4GS7C 4C56E 5IM7B 3PWPB 3LQZB 3NFSH 2VQ1B 4XCEB 3BP4A 1MCDA 1RK1B 5C7XL 1Q9KB 4D9LH 3BP4B 5F7HA 2GFBB 1RURL 1I1RA 3KHOA 4GUPB 1TNMA 1J7VR 1AO7E 2GK2A 3AM8C 5CJQL 1IM9A 5KG9A 2ATKA 2XNAA 1CG9A 4NQSB 1UCBL 1AGBA 1DFBL 5EBMA 1MUJA 4XVTH 5C0BA 5BZWB 5C0BB 3UTZA 3MV8E 3S34H 3ZSSA 1UH4A 5DQDH 5KJRH 3D9AH 3HTLX 1LGVA 1Q9WB 4DFHA 2HT4D 5DD6B 2YHGA 2WIIA 4FQQB 4CL7A 4JJHA 3V6OC 1MIMH 4Z77A 1DZBA 3ZZ1A 5SWSE 4U1IB 5FUCE 4E9LA 3TBTB 1JGVL 2O5XL 2VLJA 4F8QA 4GG6F 2BVPB 1DBMH 1UVQB 3SDAD 5IJKA 5FYKD 1OSPH 3BAEH 4FFZH 1G7IA 1DLHA 3EJJX 1XCTA 4DVBA 4DTGL 4XMKH 3HZMB 1XCTB 1AY1H 1Z9LA 3MRMA 3HUJE 2XV6B 5C3TA 2AJSL 1U8IB 4GH7B 5C07A 1FZOB 3WNMA 1FN4A 5CJXA 4MVBC 5I73C 4XBPB 3VFSA 1V3LA 1N26A 1IGIH 4XPFL 4GAFB 1BFVH 5D7KE 3RGHA 1D5IL 2P8LA 4PJ5A 1H3VA 1MFBL 2AGJH 3ARBB 3HC0A 5E6IC 1AR2A 4FZ8H 1C08B 1MFNA 3Q6GL 4UILH 3CMOH 4YNYA 4U1KA 2ZCLL 4NCDA 2CRIA 1YY9D 5F9OL 5A3ID 2ORBL 4I18C 3RVTC 3WS3A 5LWYH 4WV1C 2W1NA 5EO0B 5GGVY 5MERB 1ACZA 1LK3L 1D7FA 4HG4J 4YDIL 5HYJD 5I71B 4PRBA 2IPUK 5HHXL 1QOKA 1TJIL 1C5BH 3MREA 3D39A 4Z7OE 1MFCL 4M1CC 4Y0GA 4M7LT 4M7KL 3FOLB 1SM3L 5DTFB 2JELH 3MV9B 2PKDA 3GMRB 2FX7L 2R15A 4XP4H 1PAMA 3ZE1F 4LLDB 5DDHB 1EIBA 4P5KA 3P0VL 1U8PB 1I9IH 2P43B 2J88L 1UZ8A 4L9LC 1FFRA 4JM4L 4C56B 4OFDA 4JR9H 4P3DA 5LGJA 1UJ3C 4CAGA 2AV7A 5LGJB 3VFTA 3QT2A 1AO7B 5CHNA 5FCUL 4NQCE 1HHHA 2J4WH 5IWLA 4OF8A 3LEYH 1NGZA 5EC1A 1HNGA 4AEHH 1UGNA 3CDFA 4QHLB 3MV8B 3CX2A 5FYLL 4PYGA 3X13A 1F6AB 3EOYG 4XRCA 1GHFL 1F11A 3LKNB 2HKFL 4UIKL 5JHLH 3L3JB 4H26B 4U3HA 4RGMB 2NW2B 1JWMA 3MODH 5IQ9A 4HWBH 3K2UH 3SKMA 2Q76B 4N0CC 1BFTA 3PG2A 3MUZ1 1A5FL 2F15A 2PO6B 4ZOEA 4AH2B 4RGND 4BZ1H 4FA8A 3L3KB 1XCQB 3QRGH 2VKXA 4QWWD 2X4QA 1GSMA 1QSFD 3ULVF 1A7QH 5CSBA 4MS8C 1VACA 1DQLH 3NCJL 4LRNH 3VD4A 4EEEA 3MLTA 1WIUA 3S37L 2R2HB 3HUJB 2AQ1A 1XZ0B 4NUGL 2BC4A 5KN5B 5EO9B 1OAUH 3C5JA 1RU9L 4N0UA 1NCWL 5TJWK 4PJIE 3FONA 4HIXL 4PFEA 1MFAH 3FONB 4NWUH 3EGSA 1IEAB 3DRTA 3VFNB 1AD9B 3O6KL 4K9EH 1YNTB 1FJ1A 1LD9B 2GAZA 1WCQA 4IJ3B 5TH2A 4WW2A 1MCFA 3VFWA 3EHBC 3KHQA 1R3KB 1RI8A 2EDBA 1KGCD 1B2WL 4QY8A 4RGOH 3RWFA 3W9DB 1AQKH 4QY8B 2CMRL 4MGXA 3WIIL 1KC5H 4UNTA 2JJSC 3O45A 5HHNA 3BSZL 2VAAB 2ZP0T 5HHNB 5IJKC 2R4RL 4HWZB 1VCAA 1A6TA 1BZ7A 1CIDA 3HE7D 1RFDL 3OKOA 2FLRT 4NC0B 3IXTA 1X6LA 4JDTL 5FKAA 3RZWA 4UUJA 4KRMB 3RY5A 4NBYB 3UO1H 1OTTD 4LSRH 5DSCA 5I1DA 4L8DB 4UV4L 3GI9H 3PNWA 3AREA 4LU5H 2P47B 3GKWL 3LD8B 5DLML 4M7ZB 1CQKA 3ARBC 2D3VA 3UPRA 5GJTL 4NQCA 1KB5A 1K6QH 5DHXB 1N64L 3OKEA 4NQCB 3QUZD 1TVDA 1CFTB 4MXWL 1R5IB 3WNLA 3F62A 4HXBH 4L3AA 4OJFL 5KOMC 2YPVL 5IB5B 1ZV5A 1EV2E 3QNZA 2X40A 3RTQA 2CXKA 2X1XR 4U1JA 3HR5A 3RTQB 1U2CA 3HR5B 4HJ0C 3VRIA 3BP7A 4Y5VA 4R2GD 3VRIB 5E8PA 4OFVA 3QDMD 2VR5A 5ICYA 1LE9A 3MMEB 4UOW0 3U9UA 4KH2A 25C8L 4ESKA 4M6NL 2X4UA 2EO9A 1YEFH 1T1XA 5ID0A 2XTJB 3I02B 1EH9A 3RI5F 5ID0B 3UCRA 1A6UL 3MRFA 3GDBA 5LXGH 1FZMB 2AEPL 5T3XE 4NO0A 3P4NA 4ZSOE 3RWDB 2FBOJ 4ZO9A 3Q5YA 4MB5A 4NO0B 3P4NB 3LB6C 1JPSH 3ZE0F 3TBSA 2VC2L 4I0PB 4KJWD 4OF6A 5I0DA 3NABH 4JHAL 1I8LA 3O2WL 4CVZA 3GHBL 5F88A 5I16A 3FB7A 2R2EB 4KKAC 1CXKA 4YHLL 2GTWA 3LKQB 3OR6A 1N3NA 3DO7A 1QNZL 5T3ZH 3QIUA 4OLZH 4PJIB 3QO1B 1NUDA 5ALBL 3ULUE 1CFNA 3DBXA 1HCVA 1HKLH 3MJ9A 4PLKC 5KVGH 2Y5TA 3RZCB 1V3MA 5DGRA 2YOCA 4LLWB 3C6LA 4RGMC 2Y5TB 1FNGB 4UOJA 4CJ1A 1I9JL 1NL0H 4YZFF 4LCIH 3DVGA 1MPAL 1HILA 4X9HA 3LKOA 5KSAD 1MEXL 5FUCC 5JNYA 3ABZA 3S4SG 2PO6C 3NTCL 1MH5A 2MPAL 3H9SA 3ZLQC 4LSVH 1KB9J 4ZS7L 2NW3A 1AIFA 4HH9A 1C5DB 4MJIE 5E8OB 4GXVL 4JB9L 4X7EC 5ANMA 1NGXA 5KS9E 1IC4H 4UQ2A 1T6WA 1LWRA 3G5YA 5L2KE 1HQRB 3U0PA 3B5TA 1E27A 3G5YB 1E27B 1BFOB 2BFVH 4IJ3C 2DB8A 1CGYA 4K8RH 5BS0D 4JRYE 3VJ6A 1KPVA 4Z95H 2GJ6D 4ZFGL 3VJ6B 2ZKHH 1UYWL 1JI2A 5KVFL 4M5ZH 1MHEA 1X5YA 1Z0NA 1UM6L 8FABB 1U8JA 1ADQA 1MHEB 4DCQB 3SKJH 4DUVA 4G6AD 1EEYB 2H41A 4NNXA 4JN2A 4OZGE 3DHJA 4ODXA 2BP3A 4S10A 5I66B 1G1YA 4TUJB 4K3GA 4CNIB 1X5XA 3B9KA 1HH6A 3B9KB 1CGTA 3KXFA 4GSDH 2I60H 3SPVA 3KXFB 1T2QL 3CK0L 4NNPH 3ARVA 1HWHB 3HB3D 5T1KB 1CDUA 1I1AB 1BIIA 1CGXA 2DIJA 3KPRD 5FYJU 2OR9H 2Y6SD 4Z7NE 1O0VA 3VWKD 3LD8C 3QFJE 1R6VA 1R3LA 4E42A 2G75B 4M7ZC 3ULSB 4DK3A 4X9GA 1QD0A 2A77L 4RCAA 1BAFL 4E0RA 4RDQF 1P2CB 1OY3B 2NXYB 4JFEE 3RVVD 3EYFB 5FF6A 1CDJA 5GS0C 4ZFZA 3OF6D 3RTQC 5DJDA 4P46D 5FF6B 3MXVL 1N7ML 4Y5VC 3GBNH 3HPLB 5DJ8B 4NKMA 3U0WL 1G6VK 1CLYH 1G7MA 5D1QD 1T21A 3TM6A 3HE6B 1G7MB 3PL6D 2DKSA 3BT2H 4R3SA 4F37K 2A1WL 1ZTXL 4OAWA 1D9KA 3OKNB 2XTJC 4F9LA 4OAWB 5F71A 5FUOH 5K93A 4FXKA 4K3JH 4KI5C 3TO2B 1IBGL 2R39A 4HIEA 5JQHC 1LO2L 1HSAB 3HRZA 4HIEB 5INCB 2QKIB 4J3XA 2DMBA 2EDNA 1HXYA 1I8LC 5FUZL 4MJIB 3T0WA 3GSNB 2V17H 1HXYB 3D5OF 1YUHA 3X3GL 4LSPH 1J5OH 5KS9B 1R3HB 4N90D 1VFOA 1A6VL 3MXWL 2VERN 5BZDA 3BWUC 4JPIB 3U30C 3QHZH 5BRZA 2DLEA 3R4DA 3LQAH 1SEQH 3NPSB 5I1KL 5BRZB 3C8KA 1T3FB 2PYFB 2I26N 3L9RA 1CU4L 3MTRA 5SX5H 1FNSL 3L9RB 4HUKB 3ZHLA 3C09B 2MOVA 1ZHBB 3ARTA 4ZOAA 1D5XB 4QT5B 4R90L 4GKNA 4KK9D 5F1IB 1MLBA 4XCNB 1DE4A 4HQQL 4PJBE 5IGXL 1PQZA 2FO4A 3QWOA 5FYJE 4DKAA 2NY5L 1LO4L 5IBTH 3EFFB 2X44D 2FJHA 2QR0A 2FJHB 2VLRD 5HDQH 4YO0B 4OZGB 1T5WA 4WI2A 5E0QA 1T5WB 5LGHL 1T22B 2C7UB 1JPTL 4JM2A 3IFPA 2ZCHH 4WI9A 4NIKB 4NN6B 3IRPX 4RAVA 2P44B 2WWMD 2XY1A 4L5FL 4LP4A 3L5HA 4HG4K 1P7QD 3ZDXF 1MJJA 4UDUB 3T0VA 4QXTB 5F21B 2RCSH 1JHKL 5L7XH 4CMMA 2I9LA 3FT3B 5KW9H 1X4YA 3RQ3A 4MA8L 3G6JF 3MRCB 1QPXA 3EO9H 3EOAA 2PNDA 4OM0L 2HFGL 5CBEB 3ZYIA 5C3LD 1KF9B 3UTTA 4HXAH 2OTWA 4L8SB 4YGAB 5DUMH 4JFEB 2P24B 4PJCF 3O8XA 2VN4A 1WIPA 5EC2A 2EIZB 4X9IA 5K33A 3NIGF 3IXAA 3BIKB 3QNYA 5EUOF 1R24A 3QNYB 3S36H 3SCMD 3B9KC 1H5BA 2OTUA 1H5BB 2ENSA 3BGFB 4KMQA 4OGXH 2R0WL 3K74B 3F6LA 1I1AC 1WZ1L 2VJXA 3TH2T 2A6DA 2B1HL 3BO8A 3QUYA 3PGFL 3CCHB 4XGZB 1SBSL 1YC8A 5T33H 1T5XA 4V2CB 2DM2A 4XMLL 3HAEG 3H9HB 4OLVL 3UJIL 1KEGL 5C0JB 4FP8H 4KKCC 3MOAH 2NXYC 4WI3A 2EYSA 5GIRB 1CD9B 4YR6B 2R0LH 4XNXL 2PTVA 3HI1B 3EDJA 4N8VA 1B0RA 3IFNL 2BHYA 5CGYC 2GT9B 4N8VB 1OAZH 5CZVH 3NOIA 3KGRA 4XXDA 4IMLB 4HIIA 4KV5F 3MGTA 5LAXA 5DK3A 1I1CA 4E41E 4R26H 1OTUC 2B39A 4PJAE 4YFDB 2Y9RT 5GZND 1MVFA 3ZKND 1D9KC 3WNOA 3CXHJ 3S35L 4HGWB 3DX7B 5HYSA 4DAGH 1CXFA 4H1LG 3VFGL 4GKSA 3GGWB 4YBQC 2VZ1A 3E6FA 3GSOB 1IILE 1JNHA 2VXTH 4D9QE 1SEBA 2BJML 1WFTA 1NAKL 1JNHB 5CEZE 5MEPA 3IJHB 2OS7A 2XN9A 4LP5A 5EBWB 3DVNA 3KNBB 5MEPB 3CXDH 1SJHB 4ONOA 5M7QA 5I9QB 1AP2B 2UV3A 3GMQA 2W9EL 4XVUC 3INUH 3GMQB 4XX1G 4L8CB 4ZUUA 4X6CF 4GW4B 4ZUUB 3T0XA 3NPSC 3B8SA 2XWJA 3M1BA 1CBVL 1WAAE 1H3UA 3C09C 3PE9A 4P57A 1BGXH 2O61A 2O61B 1XF4B 2DLFL 3T4YA 4LCCB 4GW1A 4NBZB 1RAMA 1IC7L 3CMGA 2R29L 2VXUH 2C1PA 4TUOA 3K2MC 2ZCKH 4TUOB 3PWLB 1E6OL 3SJVA 3M45A 1EVTC 3X14A 1S7SA 1FVEA 1X5GA 2DOCA 1IQWH 3C8HA 5C86A 2C9AA 4M7LL 1A8JH 3UJJL 5D71H 1EFXA 4KMLB 4I4WB 5CEYA 4DOHE 1ULVA 3MBXL 3ZL4H 1DBKH 2GK0A 2NY3B 4YXHL 5JLZB 4MZ3A 3UPAA 3I3BA 3MRKB 1NMAL 2V5YA 2VDLH 4TN9A 4DN4H 5HI4D 3T2OA 1MRFL 1I3RB 2YBRB 2VH5H 4XC1H 5I19H 3X11A 3UBXB 1NEUA 4H0HB 4KTYA 1CD1B 2AABL 2EDOA 4L8SC 1IMHC 3CLEL 3F7VB 4NM4H 4Z78B 4PS4H 4KZDL 2X10A 3U79A 1OD9A 1QFHA 2PW2B 2FB4L 1CD0A 3JUZA 4R4ND 3U83A 1WT5A 5CFHA 2R1XA 2X89D 4O58H 1AD0B 1JYXA 4K94C 4I2XE 1H5BC 3Q1SL 4KHTL 4MQ7A 3BGFC 3CNKA 5FB8A 4RMTA 4YHKH 4E41B 4PJAB 5IP4A 4WRLA 1MFDL 2VUYA 4EKXA 4F7EA 3W11C 4JQIH 3I3DA 5DQJB 2JJVA 3QUYC 5EOTA 3MLPA 5EOQH 3VXSD 1G9MC 4JPVL 4PJ9D 3QUXA 1U3JA 1S7WA 4DVRH 5CJ5A 4CU6A 2P8PA 1S7WB 4U0RB 2VLKE 3OKLB 3X12A 1FYTD 5JTWA 2A2QT 2P8PB 4XAWL 3EOBB 1WWCA 3EDEA 5GS3A 4Z6AT 1BQSA 2IH3A 4MNGE 2YMXL 4KDWA 4G8IA 5JDSA 3WEXA 4H0IA 4KROB 4G8IB 3JTTA 5JDSB 4MQTB 3G6AB 5JXED 1X6NA 1KB9K 5I8CA 4OD1H 2Q6WB 3JV6A 3IU3A 1KN2H 4NM8L 1U58A 1MJ7H 3LVEA 3F5WA 3UAJD 1PY4A 3HNVL 1MCEA 1PG7H 5L2JA 3F5WB 4S1QH 2R69L 4FFVC 3MRBB 5M95B 1FCCA 5IB2B 5IW6A 4RFOH 2X42A 3FO2A 4WI7A 3DSFL 3M17A 3MSPA 4OTXH 5TF1H 1AC6A 4OF3A 4EN3B 5E94A 5I1AA 3OAYH 4JN1H 1MCLA 5E94B 4AM0B 3LV3B 5T1LB 1KIQA 4UTAH 4PJDE 5BMFL 4G9FD 4MNQD 1AXSA 1YJDH 2X4TB 2IPUG 2P4AB 4ENEC 5J3HD 5I9QC 5JIHA 3V4VL 5IT2L 2R9HC 1U91B 1MCWM 3PGCA 4N8PA 1TETL 5I76B 3VGHA 5A40E 4MVBD 1UWGL 1T80A 1NSNL 2VN7A 5C2BH 5D9SA 5MP6H 3EIFA 4LCCC 3SN6N 3FT2A 3MOBH 1AXIB 4O9HL 3CU1A 4U6HB 3IFOA 5LCVH 5E6ID 2OJEA 2GJZB 3IFOB 4KRLB 2YA0A 1JK8B 4EDWL 3QDGE 4I3RL 1BQHB 5J13B 2VDOL 2J8HA 3HFML 1BECA 2GSGA 3P0YL 3QEGH 1A7RH 2ID5A 3WFHA 3DROA 4FTVD 4M1CD 4APQB 1YN6B 5JMOC 4PG2A 4I2XB 2DM7A 1CTNA 4D3CH 4Q9CA 2NY3C 2AI0L 5ITBL 1QA9A 1QFUL 1QA9B 3TA3B 4U1NA 2FRGP 4WUUA 4KVNL 4ZD3L 2HMIC 2VDPH 4YFLF 4WUUB 4WY7L 1OHQA 1QBML 4JFFA 5EPMB 1IKFH 1BBDH 2VLKB 5C8JB 1KNOB 4N0YH 5IESL 1Q8MA 4GLRI 3QUMA 2W38A 5AD0A 2AEIT 4HFUH 5IB4A 1A6AA 4IHOA 1PLGH 4MNGB 2D7TH 2IG2L 1J1XL 1A6AB 1YQ2A 3HZYA 5DJ2A 3MV7E 1VKXA 4FMKA 1UCTA 3OZ9H 1EGJH 1HEZA 1BZ9A 5IFHH 1BF2A 3FQTB 5FYLE 5B38A 5CD5D 3STBA 1JTPA 5B38B 35C8L 4OT1H 2HTKD 3VDBA 3FRUB 2DQTH 5IJVA 5IIEA 4JKPH 4N1HB 4TNWK 1ZVYA 4HCRA 1L0XA 4N0CD 3BQUB 3NACH 3CU7A 5LBSL 3HI5L 1FVDB 4Y1AE 4RQQB 3PWPD 3BYTA 2Z92B 2YC1A 4U0RC 3F7YA 4X7FC 3RL2A 3F7YB 1YQVL 1JFQH 4LGRB 2CUIA 4PJDB 5D7SH 3RL2B 2Z31B 3FB8A 4GLRH 3KPQA 3I75A 3DYOA 4U1GB 1LP9E 1UXSA 3FB8B 4P4RA 3ZE2F 3I75B 4MS8D 4OCXL 3U4BL 3T3MF 1DBBL 4KROC 4IMKA 4LASH 1QLFB 3VW3H 5C0BD 4PRAA 1WTGT 3CIQA 2LFGA 2PTUA 2A9ML 2CLVA 2Y4SA 5F96H 2CLVB 4JPWH 2PN5A 3NH7H 1INDH 2FBJH 2G5BA 3BH8B 1HHKB 3SO5A 3EYSL 2MCPL 5C70A 1J88A 1JGUL 4PGEA 4WFHE 2X4SB 3LS4L 4MCYA 5H2BA 3ARYA 3OG4B 2MSPA 4YHIA 3EYUL 2DTSA 4MCYB 5H2BB 5AYUH 3MBEB 2XYCA 3EHBD 2ADFH 4HIHB 4PJEA 2ICWI 3BKJL 3ULVL 4PJEB 3I50L 4OUUB 4EN3C 3QDGB 4NO2B 3WDHA 2OYPA 4HC1A 2VLJD 4PRIE 2J8UF 4LQFH 1XEDA 2F9BT 3TNNA 3C60B 4ZUVA 3EZ8A 5BO1H 4QRQA 3WN5B 1QHOA 3MZGB 5CWSB 3IDMA 1JGDB 3L6FB 5GGRB 5GRYA 3V0AC 4RA0C 1GOGA 4XP9H 2HT2C 1IGYA 5EA0L 1T03L 5EOCH 5C07D 4X9BA 2MQCA 4NOBA 4IRSB 4UTBL 5KSBE 1YEDB 1EZVX 2APWA 1NGPL 3OGOE 2H6PB 3GO1L 1UM4L 1KELL 5DQ9B 1FG2B 4K3EL 4NZTL 1CK0H 3FN3A 1K4DA 3ARBD 4WEMB 4JKKA 5D2NE 4U7SA 4I3GA 1D5ZA 4P23A 3NFSL 4YK4B 1D5ZB 5D2LA 5IQ7H 2FWOA 3RGVB 4D9LL 2JK5A 5D2LB 5J13C 1LE5A 1JPGB 2FWOB 2QQQA 2JK5B 5HI3C 4TULH 2OSLA 4GQ9H 5D7IF 4JVWA 4HJ0D 3TF7C 5F44A 1NAMA 1MHCA 1P7KB 4APQC 1MHCB 4XVTL 4D0DA 1TENA 4HK0A 4OQTH 5EORH 3GMNA 4HK0B 1NC4A 4NQEA 1REIA 1RUQH 2Z8RA 4NSKB 3A6BH 3S34L 5E08H 2VO5A 3TA3C 3G5XA 4XWGH 5DQDL 4G8FB 5KJRL 3D9AL 1OL0A 5E2WH 2E3VA 1TTUA 2FX9H 4Y1AB 2CKBH 3FQUB 4U1LA 3LB6D 3GJFH 5KZCB 1MIML 3TBVA 3L3GA 4HKXB 3CSYA 3MRIB 4ORGB 1CIUA 3FQXA 1UWXH 2W91A 3GSVA 5D4QA 3T77A 2Q1EA 1AO7D 2F5BH 1FZKA 2WBWB 2IC2A 1LP9B 3CXHK 4KKAD 1A7NH 1AGDA 3REWA 1XF2A 3QPQD 2E7LC 2XA8H 1DBML 3O11A 1ZGLP 1OSPL 1ZLVH 4FFZL 4DN3H 4HD9A 3MV8D 2JCCE 1LDPH 1TZHA 4XMKL 4NQXA 5JQ6H 1AY1L 3CFJB 4NQXB 2P7TA 4JFDE 1BOGB 1RJYB 4PLKD 5I8EA 2C3GA 4CU7A 3ARDB 2X4RA 4OFPA 4OLUH 1H3XA 3E8UH 2X4RB 3FHAA 5C71A 3BQUC 1FGVH 1IGIL 3DGCR 3U4EB 2Y07H 1BFVL 3CPLB 1S7QB 1NH6A 1OF2B 2IMNA 1JI1A 3T0EA 2CGRH 5E2JA 2AGJL 5ECJE 1RK0B 1S5IH 4FZ8L 4PV9A 4UILL 3CMOL 4PV9B 3V52L 4JRXE 3GHEH 1ZLWH 5LWYL 2IADB 2RHEA 3DUHA 4P2YA 1S9XB 1C5BL 4OV6F 3D1MC 1A64A 4G42B 3KPPB 1GC1H 4KKLD 4WNQA 1JJUA 5KSBB 2JELL 2VLME 3QXDB 4XP4L 4MNHA 4MJ4A 5ESQB 4C58B 4PYHA 3BUYA 3MRHA 3MBEC 5F89A 5C9KA 1I9IL 3OAZH 3AVEA 4PRDA 5D2NB 4MDIB 1ORQB 4JR9L 4F3FA 5EULV 3CD4A 1S9YA 5B8CA 5JUEH 2KZWA 1OGTB 1QG3A 4I48B 3KPSA 1MAJA 5MEQB 3C60C 2J4WL 1CGSH 3FZUC 4IOIA 4JKLA 4Z18A 3WN5C 3BJLA 3LEYL 4AEHL 5ESAB 5IUSA 5K9JH 2E9BA 3FJTA 4IEFB 5EZIH 3G08B 1VEOA 1OAXH 3CC5A 3U6RB 1ZA3B 1U92A 4NN5B 3ARQA 3CC5B 4IRSC 1U92B 2ARJB 1HE7A 3UDWC 2A73A 2MKWA 4PRPE 5JHLL 5HVWA 3ARED 4ZPVA 2O26U 2DLGA 4JY4B 3MODL 1ZLUK 4HWBL 3K2UL 2CQVA 4RFEB 3RP1A 3SE4A 3RJDA 4DGYH 1B90A 4NQCD 4ODTH 4AQOA 4XBEH 4YK4C 4BZ1L 3BPNB 4D0BB 1FP5A 4Z5RA 3EYVB 4KI1A 3RGVC 3QRGL 3OKDB 4GBXA 1X7QB 4JFZH 5GS0D 3RTQD 2CIKA 3FB6B 2JCCB 1A7QL 2WINA 4TSBH 3VRJB 4MSWB 1DQLL 3WUWB 4LRNL 1F6LL 5E4IA 3U4AA 4JFDB 3N06B 1Z6JT 5HYIA 4MZ2A 1HNFA 1AE6H 1OAUL 4CVXA 3AB0B 4M02A 3VMOA 2XTJD 4LKXB 1MFAL 3ROLA 5DI8A 4NWUL 4PGBA 5EO1B 3BE1H 5DI8B 1U8HB 4K9EL 2MTPA 1B0WA 1T0MB 1VSCA 3BIBX 4KI5D 2HYMA 4NO0D 5F70A 3PGDB 5CBAA 3GSQB 1JP5A 1XGTA 3CLFH 3Q3GB 1I7ZA 4LARH 3EZJB 4RGOL 2OMBA 5D70H 3HA0A 1BX2B 1AQKL 4JRXB 2MWCA 1KC5L 3RIFF 1RVFH 5BJTB 3EDFA 3BRFA 2EDKA 3K8LA 3MNWA 2HP4A 4U1SB 4BFEA 1TJGH 1U8LB 5ADOH 3QIUD 2DBJA 1SBBA 1XGQB 3MOQA 4XNMA 2ARWA 3BKYH 5C6PB 3ARDC 5L0QB 3ARXA 3UO1L 4LSRL 1K3IA 3U7WH 3IDYC 4G9DB 3GI9L 4RSVA 3P77B 4WFFD 3SDCA 3OL2A 4LU5L 3SDCB 2I5YH 2ITDA 3DV4B 3VI4E 5SWZE 2AJ3A 3STLB 4ZTOH 1OW0A 1K6QL 3TIDB 4Z0BH 3VXPA 4PB9H 4HXBL 4FFWC 4XXCA 1ZANH 3NA9H 4P59H 1OGAE 3CVHA 3AXLA 4U2YA 2NYYC 2IALA 5F1OB 1OT2A 4OBRA 1M4KA 1RSFA 1J8HE 1S7VB 2VDNH 3G04B 3D2UB 5IF0B 2WQRA 2M8XA 3P4LA 4PRPB 1MWAH 1OVZA 3BGMB 2DQIH 1YEFL 2JKXA 3OX8A 5D2NC 2QEJA 4XP1H 5LXGL 5E56A 5FOJA 2BOBB 3PP3H 3NCYP 2IAMB 1YEGH 2V7HB 1JPSL 4R4FH 4J23A 2CDFA 1OB1A 4J1UA 4XVJH 3NABL 1FPTH 5B8CC 2CDFB 5LQBH 4MA7H 3CFKA 3TH4T 1IGMH 2XZAH 3HAEH 4WW1B 5AZEH 3B9KD 1YEEH 2QQKH 4KUCD 3KXFD 2CH8A 3K46A 4PJXE 3MRRA 3B5HA 5T3ZL 4CN6A 3MRRB 4OLZL 5T1KD 1CQYA 2VL5A 5EU6A 1I1AD 3VE0B 4JFYA 4NN5C 5EU6B 5T3XD 1HKLL 3K80A 5KVGL 4GRWE 2K7PA 1YEKH 3VFPB 4EDXB 3GMLB 2J7LA 3W0WA 4KK6C 1NL0L 3E6HA 4LCIL 3W0WB 1KIRB 3D0VA 4KKCD 1I3VA 2YWYA 2AV1A 5CP7A 5DA4A 2G5RA 3BPNC 1G6RH 1QFWI 3QHFL 4LSVL 1IAII 4MYWB 2YUWA 2BY0A 2X4NB 1G7HA 4ERSL 4YPGB 4Z8FH 1NMBH 4M61B 5CGYD 4GBXC 2QSQA 4G7YH 1DJSA 4BYHA 4H1LH 1QO3A 3BPOB 4JG0H 2BNUA 1JF6A 4S0SD 1IC4L 2YR3A 4QRUB 1U6AH 1UH2A 1E28B 5GGTH 1OTUD 1Q9LA 3AB0C 4N9GB 4EI5B 2MQ3A 3JV4A 1D9KD 1DN2A 3MGAA 2BFVL 1SHMA 1K5NB 5A2JH 1D5MB 4K8RL 1OAYH 5DJAB 4ODUA 5SWZB 3D85B 4Z95L 1XGYH 2AJXH 4YBQD 3KLHC 3UXFA 5IOPA 2ZKHL 2BVUA 2ATPB 4NQTA 5IOPB 4MD0A 2QL1A 4M5ZL 4MJID 4MD0B 1DTUA 3JTSB 5IK3B 4LVOC 2DTMH 4Y2OA 4YDKH 3SKJL 2H8PA 1KTLA 1Q94A 5E2TH 1W8NA 1MLCA 1IAIH 3B8YA 5TDPB 4XVUD 1Q94B 4Q74A 4IRJA 3V4UH 1J8HB 1NBZB 1EFQA 1GYAA 4GSDL 5BRZD 1NFDE 2I60L 4OCWH 3MLVH 4J3SA 1MVUB 3RJQB 4NNPL 1DQTA 3I84A 5L0QC 3RUGE 1G7LB 3DUSA 1H0DB 3SY0A 2OCFD 1JV5B 2AP2A 5DMKB 4UNVA 4RAUA 2BVYA 3O6FA 2VTFA 4PG9A 2OR9L 3LH2H 3O6FB 4Z7QE 2XA3A 4PG9B 2QTEA 2I24N 3SDCC 5AZ2H 1UB5A 4JKWA 3BH9A 4RZCB 1UB5B 1EBAA 1FFNA 1TMCB 1UENA 4PBWD 2ZJSH 3PWVA 1M71A 1NGWB 1CF8H 4Y5XA 3U0TB 3VH8A 1QRKA 4F80A 3IGAB 3PQYE 3VH8B 3D3VE 4AY0A 1U8OB 2FR4B 4D8PA 3DURB 1AGEA 3LRHA 4D8PB 1AGEB 3O6MH 4PJXB 1RZIB 2ZG2A 4XNYH 1XIWB 1KCVH 4WWKB 1RZ8B 1SMAA 1YPZA 1XGUB 3GBNL 5E9DA 3BI9X 1CLYL 4GRWB 1YYLH 3BT2L 1HOCA 4YDVA 1V3KA 2DLIA 2YPLA 4Y16A 5MI0B 5SV4A 1K4CA 5FUOL 4NZJA 3D0LB 2AXGA 2P8MA 4L3EA 3N1FC 4K3JL 2P8MB 4L3EB 5E7FA 2G9HA 5JO5B 4YH6A 3MJ7B 4JFED 1TTGA 3N1PC 2NY4B 1QBAA 2UVEA 4Z7NF 1CFSB 3LHPH 1FLRH 2V17L 4JZJA 5C0DA 5T1MB 2EH8H 5EFIA 4OZHF 2DRUA 4LSPL 3U7YH 1J5OL 4JLRB 2VOTA 4S1DD 1A1NA 2BOCB 4HUXA 3LN5A 3QH3A 1U3HA 2XZZA 3QHZL 3FT4B 3LQAL 1SEQL 3Q48A 3MLSH 4JDVB 3W11D 3W2DH 2QQLH 3LRSA 5GS1B 3QUYD 3OXSA 32C2A 1VPOH 2D0HA 3SBWA 4PJ8B 1JIBA 3T08A 3KPMB 4AMKH 5GZOC 3DYMA 3O81A 4ZFOA 5ACZB 2PCPA 5IBTL 4U6YB 4JHZA 1DN0A 4D94A 5FO8A 5L8LB 3MLZH 3IJYA 2E8YA 4L3CB 1QQDA 1CI5A 5HDQL 1AGCA 3OGCB 3JWOL 3QIWA 2CLRA 2Q3AA 4Z0XA 3UPCA 4YAQA 1MELA 1U8NA 2ZCHL 1NFDB 4YAQB 5L9DH 4U6VH 3NIDE 5FA3B 5IMKB 1X4XA 3RUGB 4FFVD 3TBWB 3FN0H 3VXMA 4G6JH 4JFQA 2RCSL 3HNTH 1JF1A 4NWTH 4IBLT 5L7XL 4Y88A 4OZFB 5FYJD 5KW9L 3EO9L 3VXRA 3QJHA 3SDDA 5C09A 3QHTC 3QJHB 3ZT7A 3BPLB 4HXAL 3GUTB 4TRPH 1ZAGA 2A6JA 4WU5B 4AENA 4NP4H 3PQYB 4X80H 5DUML 1S9KC 4ENED 5TPWH 2VL4A 4QYOA 1ORSA 4QYOB 4IOSD 5FIEA 2R9HD 1FL3A 3ARFA 3S36L 2B2XH 2UZYB 4C59B 5IBLD 1ZT1A 4ZPTA 4OGXL 2A83A 4HIJB 4QHNA 3WDJA 1VFMA 1I8KA 4X4MA 4M8VA 3QDJE 2IBZX 1I8KB 1R3JB 5KSUB 5D6DA 2HLAA 4TNVF 5T33L 2UWEA 4LCYB 3O6FC 4GG6E 2J6EH 4NNYA 2HLAB 4RBPK 4A6YA 4WUKH 1XGRB 3LDBB 1OSZA 3VFVA 4GRMA 2AJVH 2X05A 1ND0A 3VFVB 3MOAL 4GRMB 2OI9B 5F7LB 2OZ4A 3HG1E 3RY6A 3IAGC 5FO7B 2R0LL 1FSKB 1EFXD 2YA1A 1KG0B 1T0NB 4QRSB 5INDA 1AGFB 1D3CA 3MNVB 1OAZL 4N8VG 1XIWC 3AFLA 5CZVL 4WWKC 5FGCE 4M3JA 4HUMB 4F7PB 3MJGX 3P4MA 4IIQA 4HKJA 3VXQB 3C5ZA 4IIQB 1BVZA 4Q6YA 1TQCC 4R26L 5HXMA 1PBYA 4BSVA 4OD3H 5MENA 1MJUH 4BSVB 3S37X 5MI0C 1I9EA 4Y16C 5MENB 5EZLA 2ZUWA 4DAGL 3WFDH 3ARRA 1EX0A 3FFCA 5SX4I 5HYSG 3FFCB 4UZGA 2VXTL 2XZQH 3RAJH 4M7JH 5ELIA 5TGBA 5E6ZA 2NXZD 5TGBB 2DBLH 1N8ZA 3JVGA 3O0RH 4HEME 3ZE1E 4ZUWA 3INUL 4ZUWB 4ZFFB 5JW5B 4QHMB 1BPVA 2R23B 4UU9B 3WL9B 3QRFM 4Z7UF 1K8DA 5I17B 4QTIH 1U3HC 4BSWA 4J3VA 4XHJC 3UYOD 1YDPB 2BCKB 5GS1C 3HNSH 2D0GA 1BGXL 3UJTH 4QRTA 4Q0XH 3QUXD 4QHUA 4PJ8C 43C9B 4LLVB 3EO0A 3RL1A 2ZSWA 4WJ5A 2Z93B 4MCZB 3RL1B 2VXUL 1C16B 2ZSWB 1FVCB 3CX5K 4D9QD 5CEZD 2ZCKL 5CUSH 4HHAA 4LBEB 1BFSA 4UV7H 1IQWL 4KROD 4J4PA 3AU1A 3ZDYF 3BDXA 3EYQC 4LCWE 2LAAA 5D71L 1TVBB 2EICA 2X4PA 5L6YH 4IRZH 3RPIB 3TH3T 4G5ZH 3ZL4L 3VGAB 1DBKL 3FQNB 5KVDH 4XCYA 1TVHB 4LRIC 3QDJB 4XCYB 4J2XA 2F74A 5DJ0B 4HLZG 3STZA 2F74B 1RJLA 4GG6B 4XZUB 1IC1A 3L3OB 2EDYA 1G7PA 2VDLL 4YGVB 4DN4L 1KJMB 5J12B 3ULVE 4EN3D 3D25B 4PUBH 3PV6A 2VH5L 4XC1L 5I19L 2LVCA 1JYNA 3SDDC 2GTZB 3BPLC 3HG1B 3UBXG 2J5LB 4X6DF 2DKMA 3QXAA 4NM4L 3FO9A 4PS4L 3HLAB 4Z7WE 1RULH 2LABA 2HLFD 4ELMF 3BZ4A 5ID1A 5CSZA 2ICWJ 1FFOB 4MA3B 5FGCB 4OZIA 2XICA 1DDHB 2HT2D 4O58L 2I07B 3TCLA 2BSTB 3BZFB 3TCLB 1DQJB 4KXZI 3MRPB 1WC7B 4YHKL 3GKZA 2QSVA 2ADJB 2R56H 2JIXA 4HZAA 4HV8B 4JQIL 4WVRA 1AR1C 5EOQL 4JO3H 1XH3B 4DVRL 3LDBC 4YHNA 4I13B 4LLMB 3IDIB 2V2WA 4EOWH 5DK2B 2V2WB 4YBHA 5HYQA 1WF5A 2OI9C 2BNQA 5HI3D 3P9LA 2BNQB 1S5HA 4EZMA 3RY6C 1FSKC 1S5HB 4MD4A 4TOYH 4APQD 2R2BA 1W8OA 3HS0A 4NKDB 1XFPA 3HS0B 3PXJA 4OD1L 5HGAB 4XH2A 3TA3D 4NHUA 5LG1A 1WVZA 2PYEE 2DJ4A 1KN2L 4IIQC 4WUUD 1MJ7L 1PG7L 3WKMH 4S1QL 2WW8A 2CIIA 2V6HA 2KQMA 3WFBH 2VLKD 3OAUH 4K7FA 4L4JA 1M6OA 2ZUVA 2EDJA 4Y19E 3DLQR 4RFOL 3ZO0A 4OTXL 5TF1L 3S8WA 1U3ZA 5CGTA 5D7JB 1B0GA 1FO0A 1XGPB 2YD1A 4QHKJ 4JN1L 1P84J 4L4VA 4UTAL 4LCWB 3CAFA 4L4VB 4M3KB 1YJDL 2ADGB 2ZOKB 2Z4QB 4PJFA 5GRVL 5JPNA 1IAKB 3UYPA 2LQRA 3JVGC 1IE5A 1EERB 4WCYH 4PR5A 5C6WH 4PR5B 5GSVB 3EJYC 2PXYB 4JFXB 5I2IA 4W4OA 3ZE0E 3BQUD 1KCSH 5C2BL 3OSKA 5MP6L 3VFUB 5IVZB 3MOBL 3FTGB 5D1XB 4FXGA 3WSQH 1FNEA 5I15H 2NY0C 3SKUD 3N1MC 2LE9A 4WU7B 1CL7H 4EXPX 3C6SA 1CR9H 4QLRA 5L8JB 2DYPA 1NCCH 5GRJH 2VXSH 2AK1H 2AEWA 3ISWA 4J4PC 4PRNA 5F8RC 1OP3H 1R0AH 4MD5B 1QSFA 3QEGL 1A7RL 4HX1A 1ED3A 4I3SH 2FEEI 4M00A 4WDIA 1ZSDA 1RPQA 2ICWA 5DRWA 4LLUA 1BVLB 1ZT4B 2O5ZH 3S3SA 3KDMB 5GRUH 1KXQE 3VGAC 4YZFE 3WXWH 4D3CL 1F4WH 4K55A 1F42A 5KOVC 2X09A 3DSNA 3H7LA 4ZQKB 3MBED 2BVQB 3S9DB 5DC0A 3O41B 2VDPL 2XXCB 1DEEB 1H8SA 1I8MA 3WJJC 1S78C 2HFEB 3RWJB 5J12C 2OMNA 1IKFL 1BBDL 3QDGD 1IEBA 3F7RA 4MJ6A 3ZHDA 2FIKA 4ZDHA 5JOPE 4N0YL 1IEBB 1RY7B 3OQ3B 4MJ6B 3IVKA 2FIKB 1FLTX 2J5LC 4RX4A 4HFUL 3C60D 3KLAA 1PLGL 1XR8B 2D7TL 3FZUD 4NCC1 1N6UA 1B9ZA 3L5IA 3PHQB 1J11A 4LF3B 1QRNE 4NQDE 3LKSB 5EN2A 4XBGA 3OZ9L 1EGJL 5IFHL 2D9QB 2PYEB 9CGTA 3DVFA 3HE7A 4OT1L 1LO3H 1T1ZA 3VCLA 5B38G 4KY1H 2NMSA 2DQTL 4V1DE 2HJLA 3VCLB 3CFCH 1I1FB 4S2SB 4GW5A 4JKPL 2EKSA 5IMMA 1IQDB 2UYLA 4P2RE 2OP4H 4K23H 4Y19B 3MROB 3THMH 2B8OT 3PP4H 3NACL 4FQIH 4Y8DC 5EU3B 4F9PA 1NGYA 3QZWB 3BEVA 3RGVD 2BSRB 4ZYKB 1JFQL 1MNUH 5D7SL 5D1ZB 3QUZA 3TFKC 1NANH 4JGMA 1KLGA 4Q2ZB 5FYLD 4OIIH 3ARWA 4LASL 3VW3L 3W9EB 3EO1B 3VMNA 3DMMB 2ZUQB 4RRPA 2FD6H 3OJVC 5F96L 4DJMA 4OFYD 3EDDA 4JPWL 1UQSB 3OB8A 3NH7L 1INDL 1VGKA 2FBJL 2OL3A 3MO1B 5IVXA 3VRLF 4Y1AD 1SYVB 3KPOB 3S98A 5J57B 5D5MF 5AYUL 1T2XA 4QF1A 3T09A 5BW7A 5KZCD 4XMPH 3P4OA 4MHHI 2ADFL 1S7XB 1G9NC 5DD0H 5FCSH 5IEHA 5D7JC 4F7TB 1N59B 3ZTNH 4K7PX 3BHBA 4XPGH 4NUJB 1Q1JH 3DUUB 5HGBB 4WI8A 3BW9A 4LQFL 4HWEL 1HHIB 5C08E 5BO1L 5KTEH 1N6QL 2HFFA 1HKFA 5GS2D 5ABDE 3A67H 3ARDD 1ZMYA 4XP9L 3BPCB 2L7UA 2LU3A 5EOCL 4ZOBA 2PXYC 3DTXA 3QFDB 1PJ9A 2EE6A 5F1SA 1KB5H 3U82B 1I7TB 3ZT5A 1FC1A 3GK8H 5D7LE 1E6JH 1K2DA 4MAYA 3K4DA 1K2DB 4HPYH 3ULVC 4MAYB 3NGBB 3BISA 5GS0H 3GMOB 1CK0L 4HUUB 5D1XC 1MCSA 3JXAA 1GGYA 4HUNB 3HRPA 1T83A 3MUGB 2DMCA 3H0TA 5JMRA 3V7AE 4FFWD 5IQ7L 2H2SC 1QRNB 4NQDB 2W60A 1WEJH 2C4XA 4YUEH 4TULL 5A2KH 2LVEA 2NYYD 4GQ9L 4X4YA 5DWUH 3JV5A 4KJYA 4TTDC 5MEOB 1A9BA 1PGRB 4EUPA 2FZ3A 4KJYB 2EDEA 4EUPB 4OQTL 5EIIB 3L95B 3RNQA 5IHBA 3DX6A 1RUQL 4V1DB 3A6BL 3RNQB 3TPUA 5E08L 4J3UA 3DX6B 5CILH 2YA2A 4XWGL 4OD2B 5J1AB 1LEGB 4P2RB 5E2WL 3D18B 2FX9L 2CKBL 4PIRF 1NBYA 4Y4FB 4N1CA 1FAKT 5D6CB 4MJ5A 1UB6B 3PWNB 5E1AB 5JHDA 5F1KC 5JHDB 1NCDH 2F5BL 5E2VH 1EAPA 3O3AB 3BP5A 5F7WC 1A7NL 5C0GB 1EAPB 2XA8L 3MJ9H 1KTRL 3E0GA 3ZDXE 2RQ8A 4DN3L 3S35X 2EYRB 3WLBB 4XNQA 2VITA 1LDPL 2B5IC 4WHDA 5JQ6L 6CGTA 3G6JE 3J8F7 3BUTA 1KTKE 1KJ2A 5K9KA 3I6KB 3SQOH 4P9HC 3U1SH 4CGTA 4OLUL 2HRPH 4KK6D 3E8UL 1BM3H 4G7VH 5TDNA 3VD7A 3OR7A 2F53A 2XFXB 1FGVL 3KYOB 4PJCE 3OXRA 2Y07L 4GKZA 5HDLA 1HHGB 5GRWA 5C0CE 1BD2E 1JNLH 4FFYH 3NIGE 5BXFA 1ROWA 3FCTB 5EUOE 2VQTA 1FL6A 2CGRL 1LNUA 5HJ3B 1S5IL 1FL6B 1LNUB 2H26A 3IS1X 5F3HA 5D1ZC 4GBXD 3FAWA 4TVPE 4F33A 5C08B 1PKQA 3GHEL 1FG9C 4RMVA 4X99B 4MX7A 2OQJA 1OD7A 5LJYH 4ODSH 15C8H 4JFDD 1INQB 2ZUQC 4F37F 3RU8H 4P46A 5J1TC 4XB8A 4Y5YA 1OLZA 5EBLA 4EXKA 1G7QA 4Y5YB 1WTLA 4UINH 3WHXB 1AHWA 1YNLH 2F54A 3CUPA 1U36A 1P4IH 5D1QA 2F54B 2BZDA 4PP2A 1ADQH 1QSEE 4QGTA 4PP2B 1JCKA 5I30H 4EI6A 5DJ6A 5DD5H 3S96A 2P5WA 3MR9A 5DJ6B 3KLHD 2P5WB 1YMHB 1T20B 1ZXQA 5HD8D 1X5HA 5ETUA 2IANE 4QOKE 4AIZB 4ORZC 5A1AA 5DR5H 5HPMB 5DHVA 2HTLC 1T04B 1MWAA 3GSRA 5JUEL 4KGLA 4ZOCA 3M8OH 4KV5E 2VR4A 1CGSL 4G8GA 4JY6A 1C1EH 5J6HA 5K9JL 1DQDL 2HJKB 2MHAB 5EZIL 3CFBB 2H32A 1W72A 2EH7H 1GZPB 1OAXL 1CE6B 5IMOA 5FKPA 1JHTA 1IFHH 1JHTB 4WW2F 1ZHLA 4WFEE 3SDXA 1FBIH 4MAYC 3NGBC 3SDCD 4KVCH 4NO5A 3QJFA 3PIQA 3BP6A 4YHYB 4IS6B 3QJFB 5LGKA 3U36A 3MCKA 2AKRA 5DZNA 1E4XH 4DGYL 1UC6A 4ODTL 1T83C 4XBEL 3ECBB 4U1HB 1NDMA 1EHLH 4X6CE 5J9PB 4JFZL 1VA9A 1GGTA 1IZJA 1KUMA 4TSBL 4L8BB 2A74A 3G6JB 1BIHA 3CZJA 3L7EA 3L7EB 2AK4E 1AE6L 2XWBB 1VADA 5LKNA 4ISVB 4V2BA 4Y2DA 4X4ZA 3GSNH 4HS3B 5EG6C 3BE1L 4YFEA 4Y2DB 4PJCB 4XPHH 3WD5H 1CVSC 5C0CB 4Y4FC 1BD2B 1KPUB 1A22B 3CLFL 5EUOB 4OF0A 5F9JB 3BRGC 4LLQA 4LARL 2QADC 5GGTA 4TQEH 3C9NA 4DFIA 5D70L 3QXVA 4M48H 5B22A 3MUJA 2GITA 3KPNA 1WSST 5TF0A 2Q8BH 1M05B 5CD3A 1RVFL 3B2UC 4FQHA 3O9WB 2EEDA 2V2TB 4FQHB 5JW3H 1ZGLA 1P84K 2WBJA 1TJGL 5ADOL 2W9DH 5DFVC 2WBJB 4HUWA 2BNRE 5EU6D 4Z7VA 3MYJB 3BKYL 5C0RH 3TVMA 4O2FA 2VDQH 4H25B 1QSEB 3TVMB 2XG4A 4O2FB 5GHWL 4YXKH 2VABA 4UIMB 3U7WL 3T4AA 3W0WD 4KI5F 3T4AB 3NVQA 1FL5B 4QOKB 7CGTA 1F45A 2I5YL 2X70A 1U95B 4ZTOL 3BESR 1J0HA 5C0EA 4OLYH 2P5EA 2ICES 3MA9H 2P5EB 5EU5A 1QR4A 4PB9L 4P2OA 2X7LB 1ZANL 3NA9L 4P59L 4ETYA 2BK8A 2EXWC 1I7RA 1TLKA 2QSCH 1QP1A 4A2LA 5DUPH 1WWBX 2DM4A 5DJYA 5MHSD 4HAGA 3IF1A 4Y5YC 5DJYB 2VDNL 1R5VB 2HG5B 3VXTA 3N1QC 1MWAL 1QLEH 2DQIL 4O2CA 5SWZD 1UKQA 3PHSA 4R7DB 3D85D 5E8EA 4XP5H 1CN4A 4LNRB 1W0VA 2VDKH 4LGSB 4BH8A 4XP1L 4HUVB 3BMVA 5HGHB 2XKNA 1YEGL 5TDOB 3O4LE 4FZEH 4X6CB 4R4FL 5IV2A 4XVJL 4OV5A 1FPTL 1J1PH 5IV2B 5LQBL 5GGVH 4MA7L 5ISZE 4OV5B 1YZZA 5HHOE 5E5MA 5HHQA 2DQCL 1IGML 2XZAL 3RY4A 2NX5A 5AZEL 1EEZA 1YEEL 2QQKL 1J0YA 2I25N 3L3IB 1VFBB 2AK4B 3TIEA 1SJVA 1T2JA 4CKVX 4DQOH 1W0WA 2MQ0A 3CZFA 4KJQC 3HR6A 1YEKL 3O6FD 2KPNA 4WGWB 1ZOXA 1JWUB 2X41A 4HWUA 3N1GC 2ESVE 4YHYC 1A0QH 1MI5A 4BFIB 3L7FA 3HPJA 1MI5B 3RNKA 1ONQB 4CJ0A 1G6RL 4BZ2H 2XPGA 5DJZA 4Z8FL 1NMBL 4X5WA 1KYOJ 4G7YL 3QUKB 2WP3O 5FYJH 1P4BH 4PY8I 2BNRB 4JG0L 4AT6A 4P2QA 1U6AL 3TNMB 5GSRB 5GGTL 2AXFA 3OHXA 1AQDB 3FB5A 4BKLA 2AQ3A 2ZNXA 5E5UB 4PP1C 4Y2DC 2YPLD 4Y16D 3SE8H 1OAYL 3T1FB 4L3ED 1F3RB 4BFBD 4MMXC 1XGYL 2AJXL 4Z76A 1TCRB 4WEUD 2CSPA 4Z76B 1LMKA 1IGJA 1F3DJ 2DTML 4YDKL 5I1GH 5E2TL 1IAIL 3FQWA 3O9WC 1DBJH 4XWOC 3V4UL 4GXUM 3UBXI 2CDEA 1U0QA 3RWHA 2WBJC 2X89A 1U3HD 1RZGA 4GRLA 3RWHB 2FL5B 1H3PH 4OCWL 4XHJD 3MLVL 5DMIH 5ERWA 5DVOA 4IOFC 4GRLB 2EC9T 2LV4A 4NKOB 5E5RB 1XAUA 4L9DA 3TVMC 3IYLW 3E1F1 1WBZB 1YN7A 3TN0B 4D0CA 3MNZA 4GAYA 4Q9QH 1K9TA 3K1KC 4D0CB 3LH2L 3MNZB 3VXSA 4PJ9A 4ZXBA 1KXVC 5AZ2L 4ZXBB 2YPKA 3O4LB 3SE3A 3CVIH 3MRJA 2YPKB 1IZKA 1FYTA 1HINH 1DSFH 3PDOB 5JIKA 2ZJSL 3P9MA 3OKKB 2EDQA 3EYQD 1CF8L 5ISZB 4HLZH 3NFPA 4F2MA 3AM8A 3GRWA 1P9MA 2W0LA 3VH8G 1CCZA 1MHHB 1A9EA 2A9NH 1P4LB 4Y4HB 3O6ML 4PJHA 2FHCA 4XNYL 1KCVL 2FHFA 4PJHB 3AC0A 1WBXB 2O5YH 2BMKA 5GGUB 2JJTA 1LEKB 3RVXC 2BMKB 3WCYA 1PZUB 1YYLL 2UUDK 1QEWA 1PYWB 4ZNEA 3QA3B 3QEUA 1X4ZA 3QEUB 2VDMH 2ESVB 2MMXA 3V6OA 3ZE2E 4JCMA 5I1EH 1BEYH 4NRZB 1P6FA 2NTSP 3QULA 3T3ME 3FOMB 3SDDD 2W07A 5C09D 2Y1VA 5A2FA 5C0ND 3PQYD 2W65B 1QACA 1QYGH 4LVNB 3V8CA 3R8BB 1RUAH 4U7MA 3EJZC 1A7PH 4H8WH 4U6XB 5HHVH 2ZUYA 2DICA 3AROA 3ES6A 3LHPL 1FLRL 2EE3A 2IQAA 3QG7H 3VXUA 4G9FA 3ES6B 4MNQA 5F7MC 4JM2F 1JHLH 1U2HA 2EH8L 3D6GA 2OLDA 3ARFD 4JKMA 3U7YL 1DUYA 2YN3A 5IHLB 1P1ZB 3MLSL 1FORH 3W2DL 2QQLL 4LKCA 5FOBB 1JN6B 1VPOL 4IDJH 3F12B 1JMZA 2J8UE 4AMKL 2E8ZA 1AKJB 3ILPB 3MCG1 1FCGA 5HBBA 3LKPA 5E6IA 5ITFB 2GSIA 2DJUA 4LLYA 1YC7A 3ZKQD 1F58H 1FZJB 4KRPB 1IGCH 3MLZL 4WV1A 1E4JA 2NLJA 3KLDA 3V7MA 2QLVB 4PB0H 5L9DL 4U6VL 1FV1B 2DWDA 1DANT 4CN4A 2EXYC 2D2OA 1ZHNA 3FN0L 5I1CH 2DWDB 4G6JL 2M1KA 4R96B 5DS8B 2EE9A 1EZVY 3HNTL 3PWUA 4NWTL 5MEND 5I8OH 4L9LA 4R7NB 2DS4A 5GGQH 3VDAA 1UKSA 2DI7A 3FFCD 4X5XB 4P5TA 3LKRA 2WSKA 1G9EA 3LKRB 4TRPL 3IS0X 4NP4L 2D7NA 4X80L 5F7KC 1NJ9A 4X8JA 3W5NA 3JWOC 5IVOA 5TPWL 4JJ5A 3TGXA 3WLWC 3EW3B 4ODWA 4M4PA 4G80A 4X0KA 5CINH 3RA7L 4XB7A 2Y36H 4TNWF 1V8HA 4LMQE 2B2XL 5F3BB 1JZ2A 3I6GA 4KDTC 2D31A 1QLRA 3I6GB 2L0DA 4GRLC 4PTTA 4WO4B 3TZVB 1F8TH 5IB1A 2V7NB 4PJGA 3RKDC 3MRLA 2DKUA 2E27H 2FJFA 3IETA 2FJFB 2EDXA 2J6EL 3VXNA 2NY0D 3JSSA 5IM7A 3PWPA 4WUKL 4ZXBC 3VXNB 1JWSA 2J1KA 4X6BB 3LQZA 2VQ1A 3MJ8B 4XCEA 4UT6H 5F9AC 3SE3C 1JWSB 1RK1A 2AJVL 4PGDB 1Q9KA 1H3WM 2GFBA 4GUPA 3U2SB 4J4PD 3E3QC 5H94B 5TFSH 5HYEA 2OR7A 1UADC 1ZLUH 5K9QG 4NQSA 1P9MC 3DVIA 4GKOA 1SY6A 5BZWA 2ADIB 5HGGS 1A4JB 3QDJD 3QUMH 3GIVB 1AFVH 1Q9WA 1WQVT 2JJTC 3KAAA 5DD6A 4P9MH 1S9WB 3KWWB 2J8UB 1Z5LB 2FYYB 4FQQA 4OD3L 1MJUL 4MAUH 1DLFH 3HG1D 2ZUTA 3WFDL 4U1IA 4I8DA 3TBTA 5EUKB 4B5EA 3TJEH 2BVPA 2XZQL 1UVQA 2JJSA 3VU2A 3UTSE 3X17A 3RAJL 2NZIA 4TSAH 2E9WA 4M7JL 1V7MH 3BWAB 4HCRH 1RMFH 4HS6B 3HZMA 4RISH 2DBLL 2ZOLA 3O0RL 4W81A 2ZOLB 1EUTA 1MCBA 3CH8A 4R97B 4R0LB 4YX2H 2D9CA 1U8IA 5DUBB 1ZHKB 4QTIL 1FZOA 1JF5A 5DURB 2JIXD 4U1MB 2FNBA 3HNSL 4XBPA 3KPTA 3WNNA 5F93C 3UJTL 5D7IA 3RBGA 4Q0XL 3VGEA 4KDVA 5D7IB 3T65B 2K9UA 5HYJE 2WLYA 5GGSA 3ARBA 2GCYB 1C08A 2BNQD 5GGSB 5CUSL 5I1HH 4KRPC 4UV7L 4QRPE 5C0IB 5J6GB 1OOAA 5EO0A 5MERA 3IJSB 1RV6X 5DK0B 2Q3ZA 3BIAX 1IGFH 1VFAB 5DRNB 3QO0B 1SVCP 4XTRC 4JZOB 4YIQA 5L6YL 2CXGA 4IRZL 2KUTA 3O2VH 2F19H 4YIQB 4PREB 3FOLA 4G5ZL 5DTFA 3MV9A 5E8NB 3GMRA 5KVDL 5EZOH 2E6JA 4LLDA 5IKCB 4HC1H 5DDHA 1TITA 1U8PA 5AUMA 2HVJB 5AUMB 4C56A 1CFQB 3REVB 1QHPA 1RZJH 2X1PA 1AH1A 4PUBL 2G2RA 2XY2A 1J0IA 3S88H 2G2RB 4P5TC 1HXMA 4L4VD 1AO7A 2J12B 4OUOA 5FXCH 1HXMB 4MDJA 1BP3B 1RULL 5GRZA 4JQXA 4MDJB 4F15B 4FQCH 4I9WE 2XWTB 5FO9B 4QHLA 3MV8A 1B6DA 5IMLA 1F6AA 2BY2A 2PXYD 5IMLB 4OB5H 2MCG1 5I8KH 1IVLA 4CRPA 3ESUF 3LKNA 3GB7B 3CH1B 2R56L 1P5UA 3TLRA 3GMPB 3L3JA 1G7JB 4RGNE 4H26A 4X7DC 1HYRC 1OLLA 2NW2A 5EIQA 5J8OA 3SDAB 4FQJH 2YD8A 5D1XD 2Q76A 4JO3L 3WXVH 4HS8H 3ZMRA 5SWSA 1NAMH 2KZ1B 5SWSB 4N5EC 1KJVB 3WE6B 2PO6A 4AH2A 4EOWL 3DIFB 2H2SD 3BGAA 5IEKA 3L3KA 1XCQA 3MC0A 3UTSB 3I2CH 5IEKB 2DYPD 4LOUC 1HHJB 4TTDD 4TOYL 5DMJB 4B7IA 3H9ZA 3ZKMC 2X4OB 2R1YA 1EO8H 2R2HA 3HUJA 5FM5M 1LO5B 1A5FH 2R1YB 3I85A 4MXQC 4R8WH 1XZ0A 5KN5A 5F8QC 1IGTB 5EO9A 4Z7WF 4N1EA 1KYOK 4HPOH 4MQXC 1KGCE 1GZQB 1IEAA 3VFNA 1AD9A 3WKML 1YNTA 1HZHL 1LD9A 2G60H 3EYOB 3WFBL 3OAUL 3HZKA 5HYJB 1R3KA 1YMME 1KCKA 3HZKB 3RWEB 2V5SA 4G6KH 1Y18B 3SGJC 2WP3T 4CDHA 3W9DA 5I1LB 1MCNA 2PR4H 4RX4D 1MJ8H 5GS2H 4QRPB 5HYFA 4OI7A 4LSUH 2B20A 2VAAA 3PDGA 2ICEB 3CDGA 3VMPA 3BVNB 4C83A 4RA3A 4HWZA 3CDGB 5J4MA 2PYED 4C83B 2RFXB 2VB5A 1W0YT 4R97C 4OLXH 1UZ6E 1KPRB 4WCYL 4R0LC 3VGGA 4FNLH 4QRRE 3AAZB 4ZO8A 2PUQT 1LK2B 3QDHA 1IAOB 3A6CH 3NN8A 3KYMB 4HBCH 2IPTH 3NN8B 4L8DA 1RIUH 1KCSL 2IFFH 4NO3A 1NFKA 4NO3B 1YNKH 3HZVB 2GYSA 3WSQL 5I15L 2HA1A 2OTPA 1DR9A 1ZA6A 4H5SB 4WI6A 1CFTA 1CL7L 1R5IA 1P7HL 3MLXH 3IDGB 1ZA6B 3QDME 4HEPG 1CR9L 4ZODA 1PVHA 3OKMA 3VFMB 1T1WB 5IB5A 5KSVA 1NCCL 1JPFB 1YEHH 5GRJL 3OKMB 5KSVB 2VXSL 2AK1L 1R0AL 2XOTA 1PEZA 5I71C 4FRWA 1T4KB 4I3SL 4M9OA 1DQMH 4PRHE 1I85C 3RWGB 1MF2H 5BOPA 3QB7C 2O5ZL 3OJ2C 3WXWL 5JW4N 3S3PA 1F4WL 3MMEA 3KS0J 2FDBP 3O3EB 4RGNB 4LAJH 3FRPG 2EEAA 3I02A 3GMMB 1ZLSH 3S7GA 2VLLA 1KOAA 1FZMA 1T1YB 2VLLB 4Q97A 2E6PA 3RWDA 1DP0A 3MACH 2HTLD 2IH1B 5HY9B 2DJSA 2Y5EA 4I0PA 1I9RH 5E99H 3RWIB 1MQKH 2R2EA 4JGUA 3HCVA 3KPLB 3LKQA 2CUMA 2SEBB 3HCVB 4JQXC 2HKHH 1LO0H 1S9VB 1S8DB 1K85A 4J7RA 1BQLH 4JFOB 4PJIA 3QO1A 4JHAH 1LO3L 2ERJB 4KY1L 2AXHA 3CFCL 3ZYOA 3RZCA 4BH7B 4F57H 4MAYD 4LLWA 2CKBB 3KR3H 1FNGA 4PJEF 3SDAC 2OP4L 4K23L 5KBNC 1YMMB 3THML 3GJFB 2D7MA 1NC2B 3PP4L 4FQIL 1J1OH 4D9RE 4JANA 4JANB 4ODHH 1NCAH 1QRND 4NQDD 3QCVH 1MHPH 4TSCH 1AJ7H 1MNUL 1HDMB 4YBLB 4DEPB 1CWVA 1JZ6A 3VD9A 1C5DA 5E8OA 1J10A 2K1MA 3V5DB 4NFDA 5J11B 4OIIL 1U3YA 1EUUA 4UNUA 3L1OH 4XP6H 2GI7A 3S4SB 2YEZA 2FD6L 5BS0E 1Y6NR 3NCMA 4QRRB 3WUZA 5C9JB 1TXKA 4KQ3H 2YEZB 1HQRA 4O2EB 2GJ6E 4RRPG 5I75B 2CK0H 2IBBA 4P2RD 2NR6D 4GAGH 4X83A 1SYSB 1A6ZB 1X44A 1Q0YH 1BFOA 5A3IC 4YEFA 1EO5A 4Y4FD 5EDXA 4XMPL 1A2YB 5F7FA 4CADB 2QADD 2Q7YA 3FO0H 5DD0L 5JHDD 3MLYH 1HCFX 3G5VB 2KQNA 2Q7YB 1NBVH 4R2GB 1DQQB 2JLLA 5CEXA 3EKCA 3ZTNL 4PV8B 3QDMB 8FABA 4XPGL 5CEXB 4FQLH 1Q1JL 4DCQA 1PZ5B 3BZEB 3B2UD 1EEYA 1W2KT 5I66A 4TUJA 4CNIA 4ZFGH 4PRHB 3TYGH 1KTDB 3KPRE 3B6SB 5DFVD 1TNNA 3NZ8B 5KTEL 2GY7B 3A67L 5EZJB 1Q9OB 4PJ7E 5T1KA 2LU7A 1I1AA 1KB5L 2EC8A 4HGMA 3GK8L 3RVUC 1NCNA 1OT1A 4NZUL 1E6JL 2F53D 4P4KA 4ZSOA 5JPMB 3VA2C 4HPYL 4P4KB 5GS0L 1F4HA 4ZSOB 1L6XA 3CVHH 1DVFB 2G75A 5IFAL 1ZGLM 3ULSA 2XG5A 4OZHE 1U8QB 4X8XA 1P2CA 1BBJB 3SE9H 5DZLA 5DVNA 1F13A 4BUHA 1WEJL 1QFWM 1JRHI 2V9QA 4YUEL 1ZK9A 1IAIM 3EYFA 2BX5A 1NKOA 4RBPH 4JO1H 5DWUL 5CKGA 4HBQA 4Q9RH 4DKFH 5E4EB 1WBYB 4FQ2H 4ONGH 3HPLA 4EUPG 5KSAB 5DJ8A 1U42A 2F54D 4CBPA 3HE6A 5CILL 4RGNC 2ZPKH 3OKNA 3T2NH 2YZ8A 3ORJA 1UEYA 2P5WD 4FMFA 2Q20A 2CLZB 5JW4Q 2K7QA 3TO2A 2M26A 4S1SH 3BDYH 1HSAA 4J3WA 1F02I 5INCA 4N90E 2FJGB 2QKIA 1NCDL 4I0PC 3GM0A 5E2VL 4NJ9H 1ZTXH 2E7BA 4MJIA 3GSNA 4G8GD 3MJ9L 5FV1L 2VR9A 1JRHH 4ETQA 5KS9A 1R3HA 1T6VN 5BS0B 2FX8H 4ETQB 5L2KA 2GJ6B 1A02N 4KGJA 4JPIA 5L2KB 4LAQH 3MRGB 1X9QA 5DEFB 1T3FA 2PYFA 4KJQD 2ERJC 5FUZH 3SQOL 3U1SL 5KAQF 1CDCA 1ZHBA 1D5XA 4QT5A 4RDQG 5KVEH 2HRPL 4JRYA 3RZCC 3ZKXB 1BM3L 4G7VL 2VLRE 5CP3A 4JRYB 1I8IA 4XCNA 5F1IA 1I8IB 2H1PL 3DXAE 2KL6A 4AIXA 2WK2A 3EFFA 1JNLL 4FFYL 5GGRY 5DVLA 2NNAB 2Q87A 4YBLC 4YO0A 4DEPC 4OZGA 1MRCH 1CGUA 4BQ8A 1JYVA 3V79C 5J11C 5IG7A 1J05B 2EDLA 3KPRB 1T22A 2C7UA 2GW5A 4UI2A 5IG7B 4ODSL 15C8L 3VWKB 3TC9A 1EBPA 3RU8L 4L4TE 3O3BB 1XF3B 3I3EA 4WHYG 4DWHA 2WUBH 1SJEA 5I75C 4UINL 1YNLL 1SJEB 4UDUA 3AY4C 4PP1D 4Y2DD 4QXTA 2FO1A 1RHHB 1P4IL 1ADQL 6FABH 4AK1A 3FT3A 3QFJA 4AL8H 1BD2D 5C0CD 5I30L 5L88H 3MRCA 1JPTH 2IBZY 3QFJB 5DD5L 3GI8H 5CBEA 4PY8J 4NC1E 1A4KB 4XX1E 4OZHB 5DR5L 4R2GC 4TVPD 4L8SA 4K7PH 3V7AG 4OCYH 4JFEA 2P24A 2EIZA 1KT2B 2FH8A 3O9WD 3PL6B 4OGYH 4XWOD 3M8OL 4I5BB 2HN7B 3C08H 3BIKA 1C1EL 2WBJD 4G43B 1Y0LB 1RIHH 4IOFD 1OP5K 4LLAA 3TVMD 2EH7L 3G6DL 5IHZB 2XKUA 1IFHL 2JB6A 3CCHA 1SMOA 4XGZA 2JB6B 1C12B 4QOKD 1EMTH 3WS6C 5DRXA 3OB0K 1FBIL 4JE4B 4P4KC 4OZ4B 3H9HA 4KVCL 5DRXB 2BDNH 2RGSA 3B9EA 1DVFC 3RIFK 3K1DA 4O5LH 3LQMA 5C0JA 1E4XL 1WIOA 2P5ED 3RWCB 5GIRA 2WBKA 4JQVC 4LL9A 4YR6A 3TO4A 3V0WH 12E8H 1BJMA 1EHLL 1JNNH 4P2OD 3TO4B 3HI1A 5BQ7B 4Z7UE 3HAEB 5IROC 5FHBH 2GT9A 3ME0A 3WV0A 1G84A 1Z3GH 4XHQA 2X5PA 4Q58C 4OSUH 5DXWA 3U46B 1QVOB 3F6IA 2X9WA 5E4EC 1LEIB 4IMLA 3IDXH 5KSAC 2BVTA 3RVXD 3ULUC 2Z91B 3UC0H 3HE6C 1G1CA 4GO6B 5CCKH 2VLRB 1KN4H 4NHCH 2A6KB 3GSNL 4PJBA 4XPHL 3WD5L 3ZDYE 1B88A 3DXAB 2FEDC 3DX7A 4HGWA 4PJBB 4IM8A 2ZSVB 5DRZB 4HKZA 3GGWA 3GJFK 4HKZB 4M1GH 5I0ZA 1S7TA 1JGEA 3EJZD 3GSOA 3FN9A 1S7TB 1JGEB 4TQEL 4M48L 3AGVA 3IJHA 3PV7A 5EBWA 3KNBA 3JWDC 1SJHA 2Q8BL 4MA1B 1AP2A 2NX5D 4HKBB 4H1LB 4L4TB 1ZVSB 1K8IB 2AK4D 5JW3L 1EHNA 4L8CA 2JF1A 3PWJB 4GW4A 2W9DL 3TCXA 5K59F 2UZXB 5C0RL 2BJMH 5FA4A 2VDQL 5DO2C 5FA4B 4YXKL 4CU8A 4X6DE 4EBQH 1XF4A 1D6VH 4G6AC 4LCCA 4XNUH 4KK5D 4KMTH 1QUNA 4F58H 1MI5D 4A2MA 4ELME 3SCMB 3VWJA 3PWLA 4GQPH 1EEUA 1SQ2N 1X5ZA 4JREB 3VWJB 1T66C 3K81A 2H45A 4KJPC 4OLYL 2W0FB 3DV6B 2B4CC 3JV0A 3UTQB 1CICA 3MA9L 1CICB 3WJLC 3VGDA 2EYTA 4Q7DA 4I4WA 2EYTB 4GMSH 1FH5H 2QSCL 3KJ6H 4P2QD 4YHPB 4NN6C 2EXYD 4EVNB 5JLZA 1OTSD 5K9QI 3V6ZB 4BQ6A 4NBXB 1NCTA 3MRKA 3MGOB 3U9PH 4DZBA 1QLEL 2N7BA 4DZBB 3VGFA 1L6ZA 3FO1B 2IJ0C 4X4XB 4XP5L 5F7YC 3O3DA 2KBGA 1I3RA 5F72S 2FSEB 2VDKL 2YBRA 1P5VA 3O3DB 3UBXA 3TBYB 1CD1A 4FG6C 3F7VA 1UFUA 4FZEL 1M7IB 4Z78A 4Z7UB 5AG8A 2PW2A 5B4MC 3BJ91 1J1PL 8CGTA 5GGVL 1WV7T 2MFNA 2KDGA 4G6FD 1JPST 1CLOH 4AEEA 1AD0A 4M6OH 4GRLD 4A6YH 1MQ8A 4E41A 1EJOH 1A1OB 4PJAA 4DQOL 3UYRH 2OZ4H 4X7TB 5DQJA 4AQ1B 5DJXB 1XF1A 2BVEA 1MRDH 2X9XA 3V6FB 4ZXBD 1ETZB 3GSXB 3O4LD 3OJDA 3HI6H 1IL1B 1FIEA 4R4BA 3OKLA 5D93B 3OJDB 1A0QL 4R4BB 5FM4A 2O93L 3FL7A 3EOBA 2R0KH 1T89A 2XQYK 3TO4C 4BZ2L 2C3VB 2YSSB 4NPYB 3BDBA 1I3GH 3G6AA 5F7DA 1HSBB 4KK9C 3G5ZB 2Q6WA 5F7DB 5C0FA 5FYJL 1P4BL 4U05A 3VI3E 5C0FB 5T1DH 3VXOB 5C0AE 5K9OB 1WAAA 4LQ1A 1BJ1J 4X6DB 3MRBA 4LSQH 4WI5A 1KBGH 1EXUB 2FGWH 2NZ9C 3SKNB 5IB2A 4N0RA 3QG6B 3SE8L 3PABB 3LEVH 2YUZA 1A7OH 4YDJB 4EN3A 2VISB 5E1HB 5E24E 1DUZB 3QNXA 4NYLB 4AM0A 2YD2A 1MCPH 3LV3A 5T1LA 1LDSA 3QNXB 4OIBA 4TYUA 2R69H 5SWQB 1PY9A 3VXUD 5JOEA 2BY1A 2X4TA 4HDIB 1XR9B 2DQFB 2DWEB 4MA1C 5AG9A 3F7QA 2IBGA 5I1GL 2H3NB 1PEWA 1WWWX 4DOHB 1DBJL 5C6TH 2PW1B 1U91A 1YPZF 1CT8B 2BHUA 3SGEI 2F5AL 4KC3B 1J0KA 5I76A 3QPXH 4NQVB 1H3PL 5DMIL 4HFWB 5ESVB 4PLJC 3N85H 4B7LA 1OQOA 1GIGH 4NC1C 4JG1H 4Q9QL 4U6HA 3RRQA 2GJZA 5J56B 1Z9SA 4FTVE 3DRQB 1JK8A 4JREC 3CVIL 3C2AH 3N9GH 3VWJC 4B50A 1HINL 1DSFL 3RVTD 1KCUH 1BQHA 2ZUSA 3TESA 1CICC 3QEQE 4BUGA 1T7ZA 2YRLA 1KIPB 3H3KA 5E7BA 2DQUH 1YEIH 2A9NL 4NFBA 2Z35B 4APQA 1YN6A 3B43A 4I2XA 5HGDB 4ONHA 3NPZB 1GCFA 4ONHB 5TQ0H 3TA3A 2O5YL 4I3RH 4LDLB 3L5XH 3SGEH 1VDGA 4ZS6C 1U8KB 5BVPH 3UTPD 3QQ4A 1IARB 4P48A 3IAPA 3QQ4B 5EPMA 2VLKA 2VDML 3OPZH 3GSWB 5FYKH 1KNOA 3CFEB 5C8JA 5I1EL 1BEYL 2DM3A 3H7BA 3UX9B 4P5TD 3H7BB 1QYGL 4MNGA 4N8CH 2I9TB 1RUAL 1A7PL 2E7LA 4H8WL 4NRYB 1S7UB 5HHVL 2VXVH 4X98B 3QISA 3QG7L 2H9GB 3VRLE 1FFPB 1TZIB 3TPKA 1JHLL 1QBLH 3BEWB 4C57C 1MCQA 3FQTA 4PY7A 5C0AB 1BLNB 5D5ME 4JAMB 4PY7B 3MV01 2UZIH 3VDCA 1P53A 3FRUA 4I1NB 1FYHB 4DKDC 1FORL 4N0FB 4F7MB 1VEPA 4ELKA 3B9VA 1KV3A 3BQUA 4U3CA 4ELKB 2WIMA 3QBTB 4IDJL 4LEOB 1FVDA 4RQQA 4LSTH 4N5ED 2Z92A 4G8EB 4QNPF 4PLNC 2VE6B 5D93C 5C0BE 4CVUA 1MCRA 4PJDA 2Z31A 3BD5A 2VZTA 1F58L 1T7WA 4K7PY 4LOUD 2PF6A 1JBJA 1IGCL 2Z8WC 3ZKMD 1T89C 1EHXA 1CXHA 1QLFA 4NC2B 4MXQD 4PPTA 2R8SH 1N4XH 4UMGA 4YE4H 5H35B 1A7BA 5A2LH 4YPJA 1G9NH 1DEDA 4PB0L 3DX9B 4NKQB 2EO1A 3BH8A 1HHKA 5E00B 1FO0H 1X5LA 2X4SA 5I1CL 3WHE1 2IGFH 4F7CB 3MBEA 2VLJE 2UWEF 2AXJA 4HIHA 5IHUH 3BD4A 3DI2B 2A9MH 3VFOA 2V2XB 1RZKC 5GGQL 5JOFB 3VFOB 4OKVB 4OUUA 3QDGA 5IB3B 4NO2A 3BMWA 1HI6B 3QEQB 3MRNB 1XF5B 1ZT7B 3QDAA 5C07E 1G0XA 3C60A 4MXVF 3WN5A 1FRGH 5CWSA 1R5WB 2VYRE 3I50H 1JGDA 3L6FA 5GGRA 3GEWB 5CINL 2IPKB 1WUNT 3C5SB 3L5WB 2Y36L 4AEIH 4PJ5E 1GGCH 1BZQK 1SVZA 4IRSA 1YEDA 3UDWA 3GNMH 3V6BR 1EHAA 1F8TL 2H6PA 5EU4B 2E27L 1EPFA 3GJEB 5DQ9A 1FG2A 3CDCA 3BOVA 3F8UB 1KACB 3RX8A 3HKFA 3P30H 3Q6FB 3GM8A 1CZ8L 3D39E 3W39A 1EDQA 4Y4KA 2XRAH 4UT6L 3W39B 4Y4KB 3QQ9C 3RGVA 1NEZB 1JPGA 3MV7A 5TFSL 2AJZB 3MV7B 3CSPA 5JORB 1P7KA 4X6FB 5D5MB 2D4FA 4RMWA 3MV9D 2L7JA 4NSKA 2LAGB 2DL9A 4OFYA 4G8FA 3QUML 2EIBA 4QHKI 1HH9A 1AFVL 1HH9B 4N5UA 4Y1AA 5KG9B 4P9ML 1IM9B 3FQUA 2ATKB 2XNAB 1CG9B 4C56D 1AGBB 5EBMB 1MUJB 1YEJH 4MAUL 1DLFL 4HKXA 5JXEC 3MRIA 4ORGA 3UTZB 1LP9A 1NUNB 2EC9U 2DQDH 5FM8A 1NUGA 4P9HH 3TJEL 3UAJC 3ESVF 2WLZA 5I1IH 5D96B 4TSAL 2X2YA 1V7ML 2FGZA 3BAEL 2VSCA 4HCRL 1RMFL 2WIIB 4RISL 3V95A 4Z77B 3CFJA 5HHPA 4YWGH 4AIOA 5F7UA 3QCTH 1BOGA 2P1YA 5HHPB 1RJYA 3SHSA 4YX2L 1EK3A 3ARDA 3MLWH 4ZUTA 5I1JH 2VLJB 1LQSR 3LN9A 4LSDA 4ZUTB 3ET9F 1G7IB 1DLHB 4KUZH 5FGRA 3U4EA 4DVBB 3CPLA 5SWSD 3O3UN 1HIMH 1S7QA 1OF2A 5J3HC 1VERA 3TWCH 1L7TH 3MRMB 2PO6D 1RK0A 3UTSD 4PRIA 5I1HL 2Z9TA 3Q5OA 1CTOA 4PRIB 2Z31C 5C07B 4N0UE 1FN4B 2OL3H 4U1GC 2QQNH 2PETA 3ARGA 2IADA 3ARGB 1IGFL 3VFSB 5HI5C 4OZIF 1S9XA 4G42A 3KPPA 3O2VL 4J12A 2F19L 2P8LB 4PJ5B 1OM3H 2E7CA 5KSBA 1OAQH 3HC0B 3V52H 3QXDA 2Q8AH 4YNYB 4POZC 4U1KB 4P99A 5EZOL 5ESQA 2CRMA 4I77H 3WS3B 4HC1L 5D7KD 1AXTH 4DW2H 3RIAF 1CE1H 5D2NA 4PRBB 4YEEA 4MDIA 3EOTH 3MREB 1ORQA 3D39B 3V2AR 1RZJL 1IT9H 4NZDA 4QRPD 3S88L 1A3LH 2RBLA 2AW2A 1OGTA 4I48A 4ZO6A 5DZOA 5MEQA 5FM5O 3W82A 4DGVH 4P5KB 4FQCL 2P42B 1ZS8A 3SGDI 1UZ8B 5ESAA 4OM1H 3RX5A 4AJ0A 1NPUA 1ZS8B 4BQCA 2XT1B 1NMCB 3G08A 4XPAH 4P3DB 3U6RA 1ZA3A 4OB5L 2AV7B 5ALCH 5I8KL 1PFCA 3VFTB 2ARJA 3RVUD 1GAFH 5CHNB 3ZYZA 1HHHB 4NCC2 4JY4A 4FQJL 2Y7QA 4W70A 2Y7QB 5EC1B 1NGZB 3WXVL 3PUCA 4HS8L 4RFEA 1B4JH 1PSKH 2W92A 1NAML 4Q9BA 2DDQH 4EUPH 3MFGB 1B4RA 2YRZA 3X13B 5CD5C 4D0BA 4Y4KC 1DANU 3EYVA 4XRCB 1F11B 1Q72H 3QP3A 5ADPH 4I9WD 2HTKC 3I2CL 3OKDA 1X7QA 5F7EH 4PJFF 3FB6A 2JCCA 1MY5A 2YD7A 3VRJA 4MSWA 1JWMB 2XTJE 3WUWA 5IQ9B 3SKMB 2CD0A 2N1KA 4BA8A 1EO8L 4JFDA 4KI5E 4R8WL 1WJ3A 3SGDH 2Q7NA 4HPOL 3HMWH 4RMUA 4LKXA 5F6HI 5EO1A 1QTYT 2X4QB 1WGOA 1U8HA 1T0MA 4W6YB 2G60L 1KSRA 1VACB 4WI4A 3PGDA 2W59A 3GSQA 3Q3GA 1E4KA 3MLTB 4HGKC 2JJUA 4G6KL 4I0PD 4MWFA 2D0FA 2BC4B 1BX2A 2PR4L 4MWFB 3C5JB 4JRXA 1FIGH 4N0UB 1MJ8L 3BXNA 4K3DH 1KJ2H 2QJDA 4LSUL 5BJTA 2AJUH 5D96C 3T0BA 3BXNB 3EGSB 3DRTB 1FJ1B 2GAZB 5TH2B 3WIFA 4U1SA 4WW2B 4G3YH 5E6YA 1U8LA 3WIFB 4ONFH 3VFWB 1XGQA 1IJ9A 2W9LA 4WFFE 4OLXL 3RWFB 3UROR 4FNLL 1CXEA 3QWRA 1A1MA 3LPWA 5DVKA 3A6CL 1A1MB 3RZCD 5AEAA 4HBCL 5TE6H 1YMMD 2IPTL 3H9SE 1NC2D 3CX5J 3O45B 3QCUH 4G9DA 2EECA 1N5YH 3RBSA 1RIUL 3P77A 1IM3A 2IFFL 4GT7A 1IM3B 3DV4A 4M03A 1A6TB 1BZ7B 4WHYH 1YNKL 3STLA 4M1DH 3OKOB 5DA0B 5ANME 3MFFA 3H42H 3TIDA 3IXTB 3QI9A 3MFFB 5FKAB 3MLXL 4UUJB 5CJXC 3QI9B 2XQBH 5DSCB 5IBUB 1YEHL 5I1DB 3ARGC 3PNWB 3AREB 4QRRD 1DQML 4LHUA 4W4NA 1S7VA 1MF2L 4LHUB 4JHWH 5KANI 3G04A 3D2UA 5IF0A 3IFLH 4MHHG 3UPRB 1KB5B 4PRPA 4J8RA 3OKEB 5DHVH 3ZT6A 4J8RB 1A6WH 3BGMA 2EIEA 3RFZC 5JXAH 3QNZB 1ZLSL 4J6RH 4U1JB 1UZ6F 4UOW1 2HT3C 3BP7B 2BOBA 2IAMA 3MACL 4Y5VB 5E8PB 2V7HA 4B53A 5ICYB 1I9RL 3KXFE 5IW1A 2UUDH 1LE9B 3U9UB 1EJ6A 2H32H 5E99L 1W72H 5IW1B 1MQKL 3FHQA 3DOSA 2X4UB 3DYPA 2FCBA 2N7AA 4PRHD 1RQ5A 2R1WA 4C4KO 3QXTA 1T1XB 4P0DA 4WW1A 3T3PF 3UMTA 2R1WB 2HKHL 2NTFA 1LO0L 3MRFB 2NTFB 3J7HA 2V5MA 1BQLL 2X9YA 1NMCC 4YHZH 2Z8SA 5IVXF 3VE0A 1KENH 3B3IA 1UA6H 3TBSB 3H8NA 3B3IB 4JVPA 4CVZB 5F88B 4LVHB 3FB7B 4F57L 5I16B 3VFPA 3QPQC 1CD8A 4P4KD 4EDXA 3GMLA 3KR3L 5IWLC 2GTWB 1DVFD 1YA5A 2WANA 2VDRH