5ECJE

Crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
b'VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYAQYYYRGWYVGSPISINYRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 14,Protein CBFA2T2
publication title ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/transcription
total genus 12
structure length 93
sequence length 93
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ecjE00
1VCAA 2FGWH 3MRHB 4FQIH 4KUZH 2G5RA 4NO0A 1P4BL 2A9NL 3C5JB 2OL3L 32C2B 3NIFE 2DQHH 2FECI 1FVCA 1MCSA 3H9YA 3QYCA 1KELL 5K59F 1S7VA 2YMXL 4Z5RA 2B39A 5I8KH 1CZ8L 4QHNA 1MCDA 4AEIH 1I7TB 4OGYH 3H42H 4O4YH 1YMME 5EZIL 4M7ZC 5IF0B 2PTTA 4JFQA 4EXPX 4MVBC 3W0WE 1R3LA 1EHAA 2RCSH 3PP4H 3SDXB 1Y6KR 3FZUC 1XIWA 2YEZB 1GXEA 1RIHH 4UINL 2BVPB 4J2XA 2VC2L 3V4UH 3K8MA 3B9DA 4EUPB 1ZT7A 1AR2A 4CMHB 1DBMH 4P23B 1DQTA 3F7PC 4OZIB 2NXYC 4HFUH 4WJ5A 5EZOH 3EYSH 3CVIH 4DKFL 1BJ8A 1N0LA 4GW5B 3TGXA 1CBVH 4XCYA 2J88H 4BQ8A 4OFPA 2ARWA 1JPGB 4YDJB 2BSSA 4NNPL 1Q1JH 5ESVA 1SY6A 3KPPB 5IOPB 2VR5A 4BQCA 3RIAF 3P40A 3FAWA 4OJFL 5JOPE 3K3QA 4I5BA 3QH3B 4UTAL 1H3UA 1NPUA 4Z78B 1RIUL 4GG8A 4KZEL 1MWAA 5DHVH 3WSQH 2R1WB 3JUZA 1BFVL 1T4KB 4XMPH 2VRAA 4LVEA 4Y88A 4WO4C 1QVOA 3S4SA 2GJZB 3REWB 3QIBA 1RZ7H 2CIKA 2IH3B 5SWZD 5KSAA 2I25N 5BV7H 2AJUL 5MI0B 4NM4H 1VPOL 4U0QB 4FZ8H 1X5YA 5GXBB 1VGKA 1JWSA 4HH9B 1TZIA 4EOWL 3GSRA 3V7MA 3ABZA 3FMGL 3IKKA 4U1SA 5HYJB 4L8SB 2L0DA 4KMLB 5E1AB 1IARB 1GRWA 2X4TA 3IU4L 1PKQE 1UJ3A 2WWKT 5E8NB 1UGNA 4JFOB 3P30L 2YPKB 2AK4B 4GFTB 3DRTB 5EUOB 3T2NH 1MHHB 2DQUH 1BAFH 5HHME 1R5WB 1S8DA 1N7MH 2UVEA 5MEOA 2MTPA 2P7TB 2R4RH 4NRXA 4PRAA 4OZGA 5DMGC 2IFFH 1U8IB 3MYZA 4HDIA 1D3CA 1X4XA 5DRZB 1PGRB 5DD6B 4FTVA 1CTOA 2VQ1A 2PO6B 2QLVB 3BPNC 4TPRL 1CI5A 1RY7B 3SKUD 5EBLA 4QRRA 3MBEC 4NO2A 3V6FA 4NC1C 5TF1L 3RBGA 3SGDH 4IRJD 1B4RA 2YD2A 5IMMA 3MGTB 4PJXF 2GUOB 5EBMB 3FO1A 2F74B 4N0UE 3UO1H 4QTHA 2Z93B 1KBGH 3TF7C 4WUUA 1QQDB 5DUML 4AJ0A 5DDHB 4OF6A 4HHAA 2ICWB 4FQLL 4O9HL 2AP2A 5J13C 3R06A 1UWEH 5T33H 3LKRB 1F02I 1J0HA 5IESH 5C8JA 4N1HB 2NY1C 3MCLL 2BSTA 3FRPG 1SEQL 4ZO9A 3ULSA 4WFFE 2KKQA 1JK8B 3OG4B 4DGVH 4KGJA 1ZLSH 2CKBA 5K93A 3SGJC 4NO3B 4MHHG 5GGVL 2XY2A 1SBBA 1I1RA 3RKDC 3T3MF 1RZFH 1NGXA 5BJTB 4PJIB 2VYRE 4PIRF 5I16B 4M8VA 3TJHC 3ZL4L 2XNAB 3MNVA 4WHTB 1XEDA 4JG0H 2H2PC 4QRUB 4P9ML 2Q8BL 3HC0B 1KIQA 4LGPB 4HXBH 3JWDL 4JO1L 4DVRH 2X4RB 5GS2H 3SEPA 4M3JA 1QFUH 1NMBH 4TTDD 5C6PB 5KN5B 5EIVA 4K71C 4MD4A 5DD0L 3C5ZC 1JTPA 2VLRB 1FNAA 5E2VH 2NTFB 2CDEA 3IJYA 4XNMB 2QKIB 1M7IA 2R56H 3JV4B 3T0AA 3KHQA 2EYSA 3ILPA 2IGFH 2R2BB 3BH8B 2VH5H 3H9SB 1WIOA 3I9GH 4RMSA 2PYEE 1LO2L 3EJZC 1ZEAH 1XF4A 4X7SH 5FIEA 3GI8L 5DK0B 3V0AC 1QRNE 3LRGA 2FCBA 2C4XA 3S8WA 4XBPA 4UILL 4F7TA 4PJ7F 2EDQA 1EHLL 3THMH 1Z6JT 1IAOB 1ZA3B 4R97C 2CO7B 2APBA 1M7DB 1UJTA 5DUPL 1CICD 4YHZL 1AGDB 2I9LB 5EU7E 3D2UD 1WK0A 2Z31C 2BJMH 4LVOC 2YPLE 3ME0A 4ZAKD 3K1KC 1G6RB 2UVFA 2V9RA 1YNLH 4RGNC 4XVUC 5ACMA 4G8IA 4QHLA 3TJEH 4CN1A 1YNKL 3OXRB 43C9B 1SJHA 1RJLB 2D7OA 3BAEL 5I15H 3KYOB 3MA9L 4MXVE 2JB5L 4B7IA 2GQHA 2ERJB 3M17B 12E8L 3QDAA 1HILB 1UACH 1T2QL 5ITBH 2ADFL 1K4DA 4H25A 5TE7H 1T83A 3D25A 1HYSC 3I6GA 2FH6A 5L2KE 4ZPTA 3UBXI 4NKMB 2PXYD 4HC1H 4JO2H 4RGMB 3FB7B 4XC1L 3L3DB 1CU4L 1EA9C 1A7NH 1BD2A 3HRZA 3PHOB 2I27N 2X4QB 4H5SB 3GZKA 1IGFL 4LF3A 3P4NA 3KLAB 4ZNCD 4U6HB 3U0WL 4PGDB 2KUTA 3B83A 4XI5C 3H0TB 2BP3A 2IBGA 5GZND 4NO5B 1L6XA 3SKJL 5C6TL 4NQEE 3ARYA 1U2HA 4QEGA 1ADQA 1MJJA 1D5MB 4YR6A 4PYGA 5CFHA 5IBTH 3BT2H 4PY8J 2C7UB 5C0GA 1JFQH 3DRQB 1HHKB 4HUXA 4LNRA 5MEQA 4QLRA 3U83A 8CGTA 5I8OL 3G6JB 2YXMA 1MQ8A 5IG7A 5EN2A 5EU3B 4KJWC 5CIPH 2QV2A 4FNLH 4JHZA 1EJ6A 4U6YA 2XKSA 3RIFF 1C1EL 4Y5YC 4JFEA 3U6RA 1WWWX 1Q94B 2VR4A 1WF5A 2JK5A 3SJVA 3GIVA 1F4WH 4NYLB 2VZSA 3GHBL 1L9MA 3SQOH 5I71C 1LVEA 2V9QA 5SWZB 2FX7L 2O5ZL 4BUGA 3H7BA 4POZD 3KPQB 3IDMB 5JLZB 4GLRI 4KTYA 4JB9L 3B8YA 3KYNA 1W72A 2EDBA 3CLFH 5KSVB 4KTEH 2DQEH 1P7KA 1J1OL 3AAZB 3KPRE 1P1ZB 5J12C 4UUJB 5CGYD 3DUHA 35C8L 3LOWA 4E41D 1G1YA 1LWRA 2ATPB 2D0HA 2E7HA 2NR6C 5EU4A 1NAKL 4MJIE 4R26L 3OAUL 2WUBL 4KFZC 5EU5A 3GMMB 3QPXL 4UAOB 1FNGB 2ICEA 4TVPL 1F11B 2DQJH 2UWEA 2C4FU 5DFVC 3KPLB 1KSRA 5C08D 2VOTA 2XQYK 4XPGH 4DAGL 4JDVB 3RI5F 2MJWA 1IILE 3O6LL 5C86A 3QG6A 4P46D 2A74A 1DBBL 1HDMB 3FT3B 2W0LA 2JIXD 1DANT 3GJFH 5ELIA 1XR9B 1XR8B 4IRJB 5CD3B 3BQUC 5DD1H 4PTUB 4GAYB 5DQDH 2APXA 4PJAB 3UC0L 3D85A 2OX5A 4XP4H 5DF0A 1HXYB 3EYOB 2J8HA 1U8JB 1NMAL 1KTDB 3UJJL 4HK3N 3PGCB 4CADB 4HMCA 1NGWA 1BX2B 2NTSP 4MA8L 5AYQA 3DYMA 5F1KC 1FIGH 4YO0B 5FYKH 3KPNB 5I1EH 3B9EA 1X6LA 2VDLH 4H1LG 4PV8B 1GYAA 3T1FA 3BDYH 4QHKI 1G0XA 3T2QA 5KVFH 2ZNWA 4K9EL 1HKFA 4ZFGH 4KU1A 1EEYB 2DDQL 2Y07H 5CJQH 3MRPA 1BEYL 3RVTD 4U49A 1OTTC 4GKNB 2OM5A 5GJSH 3ZE2F 3V7AG 2VXVL 4JDTL 1A1NA 1RU9L 4CJ0A 4JFYA 1WBXA 2VN7A 3O9WA 4P2QE 1OSPH 1O7SA 4JQXC 5ETUB 2Y36L 5KVMC 4NO0D 1WUNT 2VKWA 3IU3A 1R6VA 2YD1A 2F53E 4Y2DC 5KW9L 4I18B 4QGTA 3NFSL 1NUFA 2ZOLA 4WUKH 2OR7A 2WWKO 1L4IA 4J3VA 5FUCC 4W4OC 1CD1A 2OTWA 4X80H 1OAZL 2JE8A 3VD9A 1N64H 3BX7C 1X44A 4WU5A 3FRUB 4N5UA 2E27H 4WW1B 1NBQA 4M6MH 1KB5A 2Y4SA 4FQ2L 4Q58C 1AGEA 3IDGA 5F6IC 2LTQB 3V5HB 4WTWA 5CGMA 1XIWD 4OLUH 4MNGB 2ZNXA 3VWKA 1F6AB 4OJFH 3RAJH 4AIZA 4NQXA 1YY9C 4U2YA 3VGHA 4EDWH 3ARVA 3KR3L 1TFHA 2H32B 1LO0H 3OWEA 1KYOJ 4ODBD 4GRMA 5KAQF 3FO2B 5FAAA 3WFBL 4LLWB 4JZJC 5EBWB 4R7DA 4G3YL 3V6ZB 4ZYKA 2RIKA 5DJ0B 5T1DH 4OIBA 5J1AB 2E7CA 5DEGB 4F8TA 4MQSB 1AIFA 4G6JH 5EH1A 1JWUA 4PJ8A 1OCWH 1CICB 3QXDB 2P4AB 3PGFL 3QCUL 4JPWH 4MAUH 3ROLA 2V5SA 1PEWA 3D2UB 5DK2A 3L1OL 2D0GA 2YD7A 5FA3A 3P0VH 2VISB 1G7PB 1XF1A 5DYOB 4ZAKB 2CLRA 1S7WB 3RDTA 3ARGC 3MV8E 3H9ZA 2XTJE 2XKNB 3MO1B 1KULA 2WBJA 1I9EA 2E8YA 4KUCF 4TSBH 5TE4H 1IQWH 1QRKA 3KPOA 5DURD 1KLFA 4QTIL 3VXUE 1KOAA 1YEDB 4LEOA 3H9HB 5K9KB 4I3GA 1BVKA 3VFVB 5IB2A 5JPMB 3HC3H 4AH2A 3VA2C 4JANB 3HZMA 1R0AH 1X9QA 3QIBD 5LBSL 5B8CA 1MELA 4GUPA 4UOW1 1CF8H 2R29L 3CFEA 5KSAD 1K2DA 5LQBH 4FQXB 1K6QH 1OAQH 4ZFOA 2V17H 4HPYL 5EOCL 3FFDA 5J89A 1DQLH 2PXYB 3EFDH 3MFFB 4HF5L 4XXDB 3MV7E 2QQKL 1CGSH 1NGQH 1KPUB 5DHXB 2A0LC 3BSZH 3L5IA 3EW3B 1AQDB 5ITFA 5TF1H 2G9HA 1LNUB 3S5LB 4MS8D 4ZSOB 1FO0B 5FUOL 1RUML 2ADJA 3QIWA 3BPOC 4KTDH 1RK1B 4YE4H 5IFAL 1F2XK 3K46A 1FRGL 5JHLL 2APFA 2B0SL 3FAXA 1IMHC 1FGNL 3BPLC 3IS0X 1IZKA 2N1KA 4FQLH 2HTLC 2YZ1A 3F12B 1YPZE 4FTVD 5CJOL 1Z0MA 3I50H 3P9LA 2EDDA 1FBIH 2FECL 4QRRD 4MXVF 3VFPB 4HK0A 3F7VA 3C2AL 4GRWE 4Z9KB 1YEGL 1IAIM 1CGVA 2LFGA 1B2WL 2BNQE 1QFHA 4XP9L 3BZDA 3BN9D 3DOSA 1R5IB 1TPXB 4GBXB 4M6NH 4P4RB 3SDCA 1U3ZA 5J6HB 4WUUD 2VQTA 5DJDA 1YEKL 5D1QC 2IPTH 2OK0H 4G7VH 4XNQA 1NGPL 2X05A 1NCBL 5HHQB 2APWA 2VXTL 4XNXL 2FD6L 3CDYA 3WFHB 3OJDA 2ICCA 4DUVA 5FYLD 5C7XH 5ESQA 4GRLD 4U4BA 4NN6C 3T2PA 1ZS8A 4KK5C 1A9BA 3MLWL 4Y4HA 4E41B 4XMKL 3CU1A 3HG1E 4LPYA 3OAZK 1F4XL 2YC1A 4O2FB 1EPFA 3M8OL 4GW1B 4EJ1C 3GSNB 5TH2B 1VADB 4PGEA 4MCYA 5T5FL 1PZUB 4PJ9C 1ZHKA 3X14A 4IS6B 5CZXD 5C08B 3QHZL 2HVKB 5B38G 1MEXH 3X3FL 4LLMB 3GSQA 1MCBA 4P46B 1FNHA 3PWLB 1FPTH 1U8MB 2JIXB 4MCZA 5IB3B 3DUSA 4X6DE 2AGJL 3O2DL 3RTQC 4I9WE 3JTSB 3WO3B 5TDOB 1J8HA 1HH6B 2M1KA 3NACL 3WFDH 2XFXA 3WFZA 3O11A 1T89C 4ZXBA 1VEMA 1W8OA 1HKLH 2X4UA 5C92A 1NEZG 2GJ6A 4U1HB 5FM4A 2GFBB 4H8WL 5FGCB 5CCKH 5IGXH 2VZ3A 4NM8H 4MGXA 2W65A 2X4OA 3CU7A 3RL2B 1BP3B 1QD0A 3Q5YA 3U0PA 5EA0L 2ZUQB 4QHUB 1FFOA 4F15B 3X12A 2MNUA 2WMPA 4YNYB 5J11C 1DSFL 1KXQE 3FOLB 5FECA 1VFOA 5EU6B 4DJMA 2NY5H 3BAEH 3LH2L 2XI9A 5CJXC 5F1SA 3QUML 5EIIB 4Z8FL 4EEEA 1JGDA 3PWPE 3BEWB 4N5EC 4DGIH 5I2IB 3F7YB 3Q6GH 4AY0A 1LK2B 5IB1A 1I3GL 4AENA 4NO0B 4URTB 3CFBA 2DL9A 4ZO8A 5C0IA 1FVCB 4RBPH 5ICZB 4HZLA 3C8DA 5BXFA 3FQNA 5HI5D 4AMKL 5H2BA 2GITA 1S7VB 1C5CH 4Z5RB 5HPOA 4DTGH 1A1MA 1E27A 3KLSA 4QHNB 1A3RL 3T04D 1A6ZA 1V7MH 4HEME 2PTTB 3SDAA 4JFQB 1AFVL 3QIUC 1R3LB 4LLUA 1RAMA 5D2NE 3BXNA 2GAZA 3PHSA 2VZOA 1CYGA 4K8RD 1OP3H 4DFHA 3SKOA 1ZT7B 3NPZB 4X9GA 1OY3B 1BD2D 2AJSL 3GRWH 1QR4A 4WJ5B 1B88A 5TE6L 3R8QA 1JPTL 4XCYB 1YN7A 3QDMA 5GS1A 5DHVA 3MLPA 4NQDA 4LSRH 4P2RE 5F96L 2BSSB 2EO9A 3WLWD 4NNYA 2HTKC 3NCJH 4X7TA 3RX8A 3AMKA 3U1SH 1YYMH 5ESVB 5T3ZE 1MHPL 5IUSA 1ZHNA 2X6MA 1V3JA 1QUNA 2ZUSA 2J1KA 2DM2A 3N50A 5BO1L 1JMZA 4D0CA 4I5BB 4TOYL 5BQ7A 3P0YH 4U1MA 3P73A 4GKZA 2D7TL 3MJ8A 4KK8C 5DURB 35C8H 3EOTL 1MWAB 2UZYB 2FL5A 4G9FA 4JFED 3SJVD 4OQTL 1QVOB 4P3DA 5E7BA 3S4SB 2EKSA 3IDJA 3QIBB 2CIKB 5KVGL 5KSAB 1Z9MA 2VZUA 4KJQC 1WCQA 5KJRH 3LEYH 4N0CD 2B4CL 1VGKB 5GS0L 1TZIB 3GSRB 4FQHA 4LVHB 4U1SB 3LAFA 3TNNA 4QNPF 1MI5E 2H8PA 5EIQA 1FZOA 4ALAL 2ORBL 2DLFL 2Q3ZA 4P5TD 2X4TB 4L1HA 1UJ3B 1GGIH 4NHUA 5T5NG 2F9BT 5CBEA 1F8TH 4OKDA 4K07A 4ZFFA 1S8DB 2Z0BA 5D70L 5MEOB 2B8OT 4NRXB 15C8L 5D1ZC 3C60A 3SGEH 4PRAB 4OZGB 4O02H 2CLZB 4YK4C 1S7UA 5D7SL 5GS0C 4HDIB 1JNHA 4Y0GA 3RU8H 4FTVB 5E2UH 2VQ1B 3TFKC 5KTEH 1W2KT 4M5YH 4QRRB 5EBLB 2XXCB 3LQMA 4NO2B 3V6FB 5AG8A 5GGQL 5IMMB 5HYQA 4RFNC 3D85D 2O5YH 3FO1B 4KAQL 3NVQA 4QTHB 4PG2A 5E24E 2VXSL 4WUUB 3GK8L 3UYPA 4LLDA 2VLKE 3LN5A 3LD8B 4HHAB 1CLZL 5DWUH 4KMTL 4NQSA 2AK1L 3R06B 3ISWA 3WN5C 1FNFA 5HDQH 4XPHL 1UXWA 3MUHL 2BSTB 2EXWC 2LAAA 1GVIA 3ULSB 3T0EE 5E9DE 1LK3L 4NUJA 3SQBA 5LGJA 4GS7B 2CKBB 3LPGA 1RIVH 3TT1H 1NAMA 4P2YA 3ZHKA 2R0KH 5IP4A 1NGXB 4PR5A 5D7JC 4KGLA 1VA9A 1MREH 3O9WD 4KDTA 3B2VL 1UA6H 3MNVB 3HR5A 1YUHA 1OAKL 4LASH 4GRWF 4Y4KC 4LOUC 4NN5C 5CUSL 1KIQB 4YXLL 4KPHL 2VL4A 3I6KA 1I9JL 5F72S 5JUEH 1IC1A 1MQKL 4G6KL 2HKHL 4Y16A 2GTWA 4MD4B 4EI6A 2HH0L 4NKDA 1EAPA 4W6WB 4M02A 1MFEH 2CDEB 3IJYB 4CN6A 1BOYA 4HIEA 1SM3H 1M7IB 1Q0YL 4HQQL 2EYSB 3ILPB 2NY6B 2P5EA 4F9LA 3VWKD 5D2LE 1P2CA 5HYSA 1UM5L 5L6YL 1XF4B 1GGTA 3OL2A 5F9OH 1NLBH 4OSUL 1MH5A 1A3QA 4XBPB 2GSGA 4F7TB 1MVFA 3QEGH 4ONFH 1TITA 3GI9L 4RMUA 4GT7A 1D6VL 1QKZL 4PJ8D 1CLYL 4ZNEA 4P2CG 2NNAA 1T21A 1Q9OA 1AGFA 1TCMA 3S3PA 3RDTD 4X6DF 3V0WH 1EFQA 1UZ6E 2WBJD 1HSAA 4LVNB 5FV2A 4G8IB 4K2UH 4HC1A 1O0VA 4QHLB 2OBGA 1WLHA 4YGAB 1Q0XH 3BRFA 1SJHB 5HGHB 3OKKA 4GAJH 4G5ZH 4A2LA 5DMIL 4LL9A 2JTDA 4XAWH 2CUIA 1JHKL 3ULVD 1S5HA 5GRYA 1KN4H 3NABH 4KHTL 4H25B 1K4DB 1MCKA 4TSAH 4YDKH 4NBYB 4HS8L 4AM0A 1UH4A 3D25B 1GGCH 1NQBA 3I6GB 1EX0A 3F65A 3HZYA 4ZPTB 1S7TA 3CJJA 3AS1A 1BD2B 1OAYL 3X3GL 1OW0A 2P42B 4FQCL 5BOZG 3DGGA 4LSTL 3C08L 4LF3B 3P4NB 4LDLB 1V7NL 3WS6C 1FQ9C 3ZKXC 1G6RL 4UIKL 3QIWD 2XWTA 5CIPA 1IGCH 1YDPA 2B1AH 1MJJB 4KHXH 1KN2L 4ZTOH 4YR6B 4IRSA 3UTOA 3EKCA 2HP4A 1QRNA 5FB8A 5C0GB 2VXTH 3L5WA 8FABA 4I13B 4HUXB 4LNRB 5MEQB 1QLEL 4XVJH 4OD1H 3LVEA 3VXOA 1FCGA 3VXTA 3G9AB 5C0FA 5IG7B 1VSCA 5EN2B 2CK2A 3QI9C 1H3PL 3KJ6L 5MENE 4U6YB 1IZJA 4D0BA 3DPBA 4P99A 2Y6SD 1QO3A 3NTCH 1J0JA 4JFEB 3U6RB 1R3KA 2JK5B 3SJVB 3GIVB 3SDCD 4MXQC 3NAAH 4GSDL 1UEMA 2W92A 3H7BB 1ZK9A 4KWUA 3G5YA 1EGJL 4IJ3C 4OT1L 5CEZE 2VDQL 3KYNB 1U8OA 4D9LH 5CGTA 1W72B 1I8LC 1FL6A 1P7KB 3HTLX 1MRDH 2IALB 4Y4HD 1U95A 4DUWA 4RGMC 1NL0H 4ELME 4HJJH 3GJFA 3O6FC 5EU4B 4P3CH 4BSWB 1NFDE 5HHNA 2XQBH 3TZVC 5EU5B 4KI5E 2V2WA 4EN3C 4RWYL 4Z6AT 3ARDA 5FYJU 4F57H 1RURL 2ICEB 4OCXL 2UWEB 2XRAL 2RR3A 3WUZA 4F58L 3I2CL 5K9QI 4PD4J 5ISZA 1J1XL 5E2WL 1QPPA 5GRVL 1CDYA 1ZKAA 4AYFA 5C0NC 5GZOD 5IW6A 2A74B 1FYHB 3ROOA 3ILQC 4DOHB 2FR4A 4C54A 5KANG 3SY0A 1HQ4A 3AB0C 1LDPH 3FO9A 1J8HD 2AI0H 2BVUA 2V7HA 5D7LA 3D85B 2A73A 4YUEH 5F6HI 1HI6A 3BIAX 4ZXBD 3LSOA 3SCMC 5HXMA 4QRPE 2GJ6D 1NGWB 4MQXD 4W6XB 2C5DC 1I7UA 4JO4H 4L9LA 2ZZUT 4M4PA 3HKFA 5D1XA 4YXKL 3GMNB 4DKAA 4M93B 1A6VH 4PV9A 3F62A 3T1FB 3EYQD 3GSVA 3QWQB 1RHHA 2X4NA 5KVDL 2W0PA 4OCYH 3AFLA 3AY4C 3F7QA 4JGUA 1MAJA 4LHUG 4QXTA 1J8KA 3Q5TA 4P3WA 3VFUA 4Z76A 1JF6A 1A14H 1A1NB 1CL7L 4JFYB 1WBXB 4JEGB 3O9WB 5T3XD 3VGFA 3IAQA 3HMXA 3SE9L 5ALBH 2EIEA 4NKIH 3GJFK 1YYLL 4UBDD 4DGYH 3IU3B 1DUYA 5L9DH 1D5IL 2YA1A 1AI1L 2ZOLB 2AABH 4X6BA 5GGTA 3VWJA 1CD1B 2OTWB 4IRZL 1UYWH 2QADD 1BECA 3OKOA 3IDYC 4WU5B 4NP4H 1HNFA 4MB4A 5HGDA 2R69H 3CMOL 5CLTA 1KB5B 3SDAD 2X7LA 1MNUH 1U3YA 1AGEB 3LMJL 3IDGB 2J4WL 2X44D 3AGVA 2FEDD 1VGEL 3BGFC 3QQ3A 4NQVA 2GI7A 3N1FC 3VWKB 4MJ5A 5BRZE 4AIZB 4NQXB 2DMBA 4U3HA 1XF2A 2Q8AL 4GRMB 2R0LL 2VWEC 4LP5A 3UTTD 3CSPA 4AT6A 4R7DB 1CK0L 4ZYKB 3QDMD 1E6JH 3RVXC 5KSBE 2GHWB 1LE9A 4NQDD 5ENWA 4YPJA 5F7FA 1AIFB 2JCCE 3JUYA 1JWUB 4M48H 4MB3A 4J6RL 4PJ8B 1HHGA 2D7MA 1NCCH 2B5IC 1KC5H 2YBRA 4IIQA 3ROLB 5DK2B 5FUZH 3BYTA 4YHMH 5LXGH 2BDNH 5FA3B 2X42A 2CLRB 3RDTB 3VJ6A 1T7ZA 1DANU 4FFWD 4LGSB 2AJ3B 5FKAA 1OTUD 1EZVX 4RDQG 2YK1H 3EDDA 4ZMAT 3KPOB 3FO0H 1T1YA 4JQIH 4LEOB 4G9FD 5A40E 1BVKB 3TO2A 5IB2B 2EC8A 4LIQE 4AH2B 1ZT1A 3HZMB 4QXUL 2MCPL 4X6EA 5B8CB 2YN5A 4GUPB 3CFEB 1K2DB 3G6DH 2BVQA 3QDGE 2IAMA 4ZFOB 1RFDH 3FFDB 3ZHDA 1VFBB 5C07A 2XPGA 4JFFA 2BMKA 5DMKA 2GK0A 5J1SC 3E3QE 3GSXA 5KOVC 1NCTA 1DBJH 2DAVA 5GRJL 5ITFB 1MVUA 4JFHE 5DJ6A 3HE6B 4WGWB 2G9HB 1ZANH 1N5YH 2HFEA 5A2LH 4LBEA 2ADJB 3QIWB 4ZG1A 5HPMA 1JI2A 1KJ2H 2HJLA 4GJTB 4MA3A 1DQDH 3GKWL 4I77L 3WIHL 3HCVA 3MLSH 2ZP0T 4UOW0 4DW2H 3GMPA 5DC0A 2DKSA 5E03A 3TVMC 5B38A 1EUUA 2I60L 4ONGH 1MFAH 1MRCL 4UTBH 2QR0A 3QQNA 3GNML 3P9LB 4HK0B 3DYOA 3F7VB 5JR1L 1PX4A 4O5LL 1CQKA 4M1DH 1YEEH 4HT1H 2AJVH 3UTSA 4LNVA 5D6CA 2HWZH 4L4JA 5TQ0H 4I48A 4QXGL 2HVJA 3SDCB 3QHTC 1HINL 1CWVA 1IKNC 5DJDB 5EWIL 3S34L 4DN3H 4KKCD 4S10A 4UV4H 3IRZA 4XNQB 5FK9A 4I3RH 1QFWH 2ESVE 2A6IA 1FO0L 2BFVH 1NEZA 4KVCH 3VXUA 3OJDB 1WTGT 5ESQB 1GGBH 4FQXC 1J7VR 3C6LA 5B3NA 1ZS8B 1A9BB 4Y4HB 4X9HA 3GBMH 2PCPA 4CNIA 5BS0A 1A3LL 3F6LA 3HNTL 4HCRL 5MERA 1KG0A 5GS2D 1DZBA 2YC1B 3EOBA 2AJZA 2IG2H 4K3EH 1QZ1A 1ZVSA 3SBWC 1ZHKB 3X14B 4DZ8A 1QBAA 4K3DH 4IMKC 2X1WL 2Q76A 1P5UA 4UT7H 1WSST 3KPSA 3MLZH 4DZBA 1XGTA 1JZ7A 2NXZD 3TN0A 5I1AA 3EO1A 4Y7MA 4S1RH 2AQ1A 4MCZB 4JFDE 1IEBA 3OJMB 3DUSB 1RUPH 2QQQA 4JKMA 4MD5A 4Y16D 5HDLA 3CXDL 1J8HB 4W68A 1BQHA 1F4HA 3QO1A 1KJMA 4OLXL 2BK8A 1EBAA 2XFXB 1IVLA 3O11B 3OKDA 4ZXBB 1HZHH 4L5FL 3OJ2C 1AY1L 2X4UB 5D72L 1IFHH 2GJ6B 4PRPB 3NFNA 1AR1C 1MAKA 2VMFA 5C0JA 4GBXC 3Q0HA 2COQA 4NC2B 1LO5A 3U7WL 2W65B 2P5ED 5F93C 5IJKA 5E8EA 4FFZL 3GSNL 1RUQL 3TV3H 1G7IA 2X4OB 4ELMF 3U0PB 3S35L 4HUVA 5L2JA 2NY4D 1NFDF 1FFOB 2X4SA 3X12B 4KI5F 3P3YA 2AJYL 3IFPA 5FECB 4S1DC 3UTZA 2I07A 1IGTA 4Z7WE 3O3EB 3MJ9H 3QHFL 1JGDB 3HA0A 4LQ1A 4XMLL 2VXUH 3STLA 5JXAL 2IANB 3QCTL 1QTYT 1FVDA 5IB1B 1BFSA 4AENB 4LCCA 5B3JE 3CFBB 1XGPA 2VLJE 1DQJA 4X7FC 5C0IB 4F3FA 3MCKA 2ITDA 4L4TA 3MOAH 3CFJA 4HZLB 4APQA 5BXFB 4RSVA 2QADB 5H2BB 1X5ZA 2GITB 3MGAA 4L8DA 5SX4I 5HHOE 1A1MB 1N6QH 1E27B 3VRLE 3DVFA 1A6ZB 1N8ZA 3SDAB 4XVTH 4TUKL 1JTOA 4LLUB 1T6WA 3BXNB 2GAZB 5DJYA 1JP5A 4KUCD 4WVRA 3SKOB 2DD8H 4JCMA 4ONHA 1SBSH 3HB3C 3MLUH 4LSSL 4GQ9H 4HULB 2C3XA 4EDXA 1E6OL 4O58L 1YN7B 3QDMB 2DTSA 4NJ9L 3RWGA 5GS1B 5DHVB 2BSED 3T2OA 4NQDB 2OCFD 4WTZA 1F90H 4NNYB 4WWKA 5A2IH 4OKVA 3ARPA 4IRSD 1ZHNB 3OR6A 4YC2B 1QRND 2YD9A 3D3VA 3DIFA 5ILTH 5F97E 2HAZA 4RBPK 4D0CB 4Y19A 2ITCB 5BQ7B 4U1MB 3P73B 4GKZB 2X2YA 5HTSA 3FB6A 2FX9H 5D9SA 4YHKL 3O4OC 4HWEH 2FL5B 4G9FB 2HMID 5LCVH 2WWMC 1BLNA 2CGRH 1IBGH 4P3DB 1QBLH 2EKSB 2HT4D 1KCVL 3IDJB 3LS4H 1SVCP 1INDL 1OP3K 2A1WH 4CDHA 2FBJL 2P24A 3QEHA 4H88L 4NZJA 1NLDH 1AO7A 4OLEA 4U7SA 2J6EA 1KCSL 4FQHB 3TNNB 2ZCKL 1EZVY 2H8PB 1SY6L 1RZJH 3MRDA 5FOJA 1FZOB 5I74B 1ZTXL 5KSBF 5T1LA 4R9HA 3MACH 5DGQA 2JCCF 5EU7C 2VDRL 3K4DA 5CP7A 4NHUB 4Q6IA 1P4LA 5F7YC 1MCEA 4P2OC 1DUZA 5CBEB 5E2TL 1A0QL 3ARDD 4OZFH 2D31A 5CINL 4XWOC 4ZFFB 3I3DA 4M6OL 4JM4L 5ISZD 2E6JA 3WD5L 3C60B 4JREB 4YHOH 4ERSL 4XCCH 1S7UB 3S88H 4S1SL 1JNHB 2EO1A 2WAHA 2ZCLL 1NJ9A 4OUUA 1JYXA 5ANMA 4L29A 5T1MA 4JGJA 5L88L 3V79C 3CLEH 4NHCL 1U9KA 4OD2A 1HWGB 5JIKA 4AEFA 2ZPKH 1MCCA 3LS5L 5HYQB 5D7LD 3DVNA 1JGVH 3TNMA 3KS0H 4OZFG 1EJOL 1JUFA 5L7XH 4LLDB 3TYGL 3LN5B 4GXVH 1OQOA 5E08L 4NQSB 4OLYL 5D1XD 3U36A 4QRSA 1EXUA 3B5GA 4NZUH 3ZMRA 3LQAL 3MLTA 1UXWB 4GO6B 4CW1A 1QFWM 2HRPL 1QG3A 1C7SA 3WUWA 3MTRA 5LGJB 4NUJB 1NCWH 3FQXA 3ARFC 3DTXA 3HUJA 4LVHC 3V8OA 3T0DA 4LCWA 1S7QA 1NAMB 2VAAA 3VG0H 4K7PH 3SDDA 5ABDE 3W5NA 4PR5B 3BVNA 4JZNA 1UJ3C 5DA0B 2QQNL 3NH7L 3ARTA 1YUHB 3LQAC 2DBLL 3PHQA 2NXZB 4Q9QL 1CXFA 3I6KB 3J8F7 5GRUL 4FMFA 4KV5E 5DFWH 3VWJD 4EQ2A 4Y16B 5MP6H 3HNVH 4LSDA 2GTWB 5FYLL 4EI6B 3BW9A 1RMFH 3BGAA 1EAPB 3PL6C 4OUOA 1QNZH 2IH1A 3WIIL 4HIEB 4AG4H 1I8MA 4LLVA 4ZUWA 2X9WA 1HXMA 2X9XA 2CKBL 1PG7L 3PQYA 2GSIA 2V5TA 2P5EB 3VGEA 4ORZC 1KEGL 4MWFA 5D5MA 1P2CB 3LD8C 3MRBA 5TPWL 5HYSB 1KIUA 1YECL 1JZ8A 3W9EA 1JF5A 5HI3C 2NY4B 4PJFA 2GT9A 1MH5B 2VAJA 3HE7C 2GSGB 1VHPA 1S9XA 1U8LB 1JHLL 2EZ0D 2HKFH 4KK9D 4ZO7A 3TT3H 4P9HH 2EDKA 1LP9E 4OD3L 3WV0A 5JW4Q 2H32H 2I5YH 3K4AA 2CUHA 2NNAB 1KCRH 4Y8AA 3UYOD 3WFCH 1T21B 1LILA 4OF5A 1Q9OB 1AGFB 4M43L 3L3HA 2OZ4H 4IEFB 1N2RA 2VSDA 1WWCA 5IFHL 4HUUA 4Y5VC 5EC1B 4JHAL 4LPWA 4J3WA 1HSAB 4POUB 5A3IC 4PJDF 1OAXH 3LDBB 3VD7A 2XN9A 3CD4A 4FZEL 2LU7A 3OKKB 4J3SA 4I0PA 2FDBP 1S5HB 1T0NA 4CKVX 1N0XL 4BQ9A 4X5WA 4AM0B 3VDAA 2YPVL 3NN8A 3HZYB 3SGDI 2XZZA 1S7TB 5BVPL 5C07D 4XPTL 4JFFD 1PD6A 5CEXA 4HUWA 3IF1A 4MHHI 1LHZA 1AHWC 4NRZA 4Z7WF 4JN1L 4LEXL 4Q0XL 2H1PL 3DGGB 2NY6C 3TBTA 4GMTL 2H2SC 5CIPB 2XWTB 4K3JL 1YDPB 3NZHH 5FHAH 5JHDE 5DRXB 1KGCE 4M7JL 3MLVL 2VL5A 1GL4B 1TETL 1T7WA 5JIIA 4IRSB 1CGYA 3RY4A 5E6IA 5I1CH 1JGUL 5FB8B 3L5WB 5EOTA 5CD5C 1IC4L 8FABB 5HD8D 2DYPA 1MHEA 3D39E 3D6GA 3PG2A 3DV6A 1BM3L 5F3HA 3VXOB 3RNQA 3VXTB 2FHFA 3CX5J 3MV9A 5C0FB 6CGTA 2FHCA 4U2ZA 4AL8L 2VLLA 1QHOA 4HW6A 5FUCE 5GSRA 3UTSD 4D0BB 3VRLF 2VDKL 3O6MH 5I1KL 2RJMA 3KHOA 2MHAA 1QO3B 4JRXA 3IJSA 4G6AC 5EORL 5J4MA 1R3KB 4YFLF 4JM2A 1CVRA 3RA7H 3IT8D 3V4VH 1OPGH 5IVNA 4GAGH 3G5YB 4XCFL 4YBLC 5D7IA 3S5LG 5L0QC 4C56E 3VW3H 1KJ3L 4NWUL 4XCNA 3VXUD 3VFNA 1MFBH 1U8OB 1FL6B 3B9KC 4UI2A 3C6LD 4Q74A 3EFFA 3MOBL 25C8H 4LRIA 1PQZA 1U95B 7CGTA 5DVKA 1DFBL 4XBEH 5BS0D 5D7KE 1G9NH 3GJFB 1BPVA 4XNZB 1QHPA 3CXDH 1R3IL 4DN4H 5HHNB 5IEKA 1MUJA 4M7LH 2V2WB 3ARDB 1FLRH 2XTJC 4LHUA 4F7EA 2V5MA 3STZA 3UDWC 4K7FA 5D72H 5ISZB 4M4RA 2EICA 3UP1A 4HXAH 1F58H 1B0RA 5IW6B 3DHJA 1CT8A 7FABL 1YEIH 2CDGA 1FAKT 4OLZL 4QHMA 5D71H 3KPSD 3ROOB 2DTML 1FAIH 3A6BL 4U1LA 3S97C 3FQWA 2DMKA 2X70A 1S7SA 3RUGE 2ADGA 2EE9A 3TN0D 2FR4B 3SY0B 1UVQA 1HQ4B 3BYYA 4FQJL 4XPBH 3EOAA 4OLWL 3O6KL 2HT3C 3PV7A 2V7HB 1W72L 5D7LB 3P9WB 3SOBH 3U79A 3VGAC 2A73B 1HI6B 2DOCA 1A9EA 3LHPH 4WW2C 3LSOB 4CVUA 2M2DA 5IV2A 1I7UB 1WAAE 4FFVD 4D9RD 4L9LB 5D1XB 1FZJA 3ALXA 4BFIA 3DGCR 3HRPA 4HWBA 1FC1A 5JDSA 4PV9B 1UZ8A 4LAQL 4X99A 1OARH 5JZ7D 1GJIA 3NBNA 3G08A 4PRNA 2BVTA 1XF5A 1RHHB 2X4NB 3Q1SH 4KK6D 1IJ9A 3KYAA 5HHPA 1Z3GH 2AEPL 2J8UE 3N0PB 4KQ3L 4OBSA 3HR6A 3UJIH 3IAGC 1UXSA 2NY0D 3OZ9L 4QXTB 1OTSC 3VFUB 3MRGA 3VD5A 3MC0A 4Z76B 1EV2E 4TUKH 4HIJA 4Y5XC 3L5XH 4Y2OA 4KY1H 4YDLB 2A9ML 3F6IA 2OMNA 3P4MA 4YFDB 2R1XA 1DUYB 1NFDA 3SKNA 1J18A 5HGBA 3UTQA 1CXKA 5B4MD 1VESA 5D8JH 4L4TD 4X6BB 5AYUH 3VWJB 3X13A 3N1QC 3EHBD 4APQD 4RRPA 3CX5K 5DRWA 4J3OC 4X4MA 1K3ZA 5J3HC 3WLBA 5HGDB 2BRRH 1MRFL 1GAFH 3PWUA 3QWOA 4AK1A 2X7LB 5IROA 1RVFL 1EH9A 4J4PC 5HSFA 4JKPH 4R0LC 2NX5A 2QHRL 2B2XH 3QQ3B 4NQVB 5LVEA 2F54E 2HT2D 3RVVD 3AREA 1KCKA 4MJ5B 1GC1L 4PJ5E 3VXSE 2VXQL 1XF2B 5HHVH 5EPMA 3LZFH 4N9OB 4HIXH 2EDFA 1IM9A 1QSZA 1CFSA 4AT6B 1DE4A 1NFIA 3FL7A 3T77A 1OOAA 2V2XA 1MCHA 4WI2A 1LE9B 5ENWB 1RZKH 4RAHA 1HHGB 4WWKD 5EOQL 2YBRB 1TQCC 1SJXA 4IIQB 5ESAB 3UZEA 3Q6FA 3D3VD 3OPZH 3VJ6B 2EYTA 3MLXL 1GC1C 1KB5L 3AXLA 3DXAE 4Y19D 3BWAA 4PJBA 5CZVL 5FKAB 4KRPD 3KLHD 3L7EA 2EKJA 3FHQA 1T1YB 1T3FA 3LIZH 3OKLA 4K7PX 1WV7T 2AVGA 1DN2A 3PDOA 3IFLL 3TO2B 4LPXA 2DWEA 3ZLQC 1ZT1B 2DQGL 4XT1C 1I85C 4ODSL 4X6EB 2IFGA 4XVSH 1J05A 1MLCA 3CFCL 4JM4H 1KJ2A 4F9PA 1MWAH 2BVQB 2IAMB 3BKCH 1RJYA 3AM8C 5C07B 4G6ML 1AO7D 2XPGB 4JFFB 2BMKB 5DMKB 2W59A 5F9WB 3JWOL 1MCWM 5FA4A 3LN9A 4GMSL 5CBAA 3QDHA 2GK0B 2ZKHH 4MNQA 1LP9F 2YXFA 3GSXB 1SYVA 4WV1A 1MVUB 1QYGL 3QUXC 5DJ6B 1A1OA 3INUL 4EBQL 1ES0A 1NMCC 2HFEB 4LBEB 5HPMB 3TPKA 1P6FA 5CILH 2HJLB 1CFBA 5CSZA 4MA3B 1I1AC 1CVSC 4XHQA 3FCTA 3HCVB 4CDGC 1ZVHA 4MA1B 2FIRT 3GMPB 4OLYH 5B38B 1A7QH 4LQFH 1SHMA 3TWCL 3WEXA 2QR0B 4YQXL 2HLFD 1CD8A 2HRPH 1D9KB 1KT2A 3QCVH 2J5LB 5FYJD 4PS4H 3UTSB 3WXVL 3HMWH 5D6CB 4UT6L 4P57A 5D2NC 4I48B 2HVJB 2DM7A 3DYPA 3C09B 3MUY1 2KDGA 2G2RA 1YJDH 1F3JA 5FK9B 2A6IB 1OWRM 1EERB 1NEZB 2KQNA 1FFPA 1UQSA 4FQQA 5JXEC 4NZRL 1T1ZA 2Q86A 5AAWA 2HLAA 3DV4A 3C6LB 1UCBL 1J1PH 3KYKL 2VO5A 2G60H 5F7EH 2LVEA 4ZS6C 3ZDZE 2PCPB 4CNIB 5BS0B 1BQLL 1NDMA 5FHBH 5MERB 2R0WL 1KG0B 4HX1A 5AZEL 1ORSA 4LAJH 5E99L 3EAKA 5I6XB 1DVFA 1MIML 3FB5A 4LCWD 2AJZB 3W11C 2QQLL 1ZVSB 3MRKA 3SDDD 2GK2A 3HE6C 4P0DA 4DZ8B 4TULL 5F7WC 4NQCE 1AC0A 1TVBA 2Q76B 3HS0A 4HS6A 4YEEA 5DD5L 4ODHH 1OSZA 1KEMH 2X10A 4YGVA 1UWGH 1ZGLM 1JPSL 4KMQA 1BREA 3BP6A 3KPSB 4R4BA 1XGTB 4DZBB 3TN0B 5I1AB 4Z7UE 3EO1B 1IEBB 3KPMA 4MD5B 1CDHA 4AEHL 3B5HA 3FONA 5TQ2H 1B4JH 2YWYA 2DIBA 1BQHB 1U91A 4HJ0C 1C5DA 3QO1B 1KJMB 1NC2A 3KJ4C 5DS8B 43CAA 2IQ9L 3OKDB 2C1OB 4GKOA 3DUUA 3CDGA 5DUBA 3NFNB 5HBBA 2VZTA 3T3PE 5J8OA 1Q38A 5C0JB 3PQYD 5A16A 3KXFA 1LO5B 2NY3D 5E8EB 1FHGA 1G7IB 5I17A 5ERWA 3I84A 3GIZL 5IFHH 1A5FH 1DR9A 4IDLA 4HUVB 5L2JB 4PJCA 3EGSA 2X4SB 3SDXE 5IB4A 2LU4A 3BDBA 4OF0A 3IFPB 3BE1H 1HSBA 3UTZB 2I07B 1IGTB 1YN6A 4UV7H 2NY0B 2W9DH 5C0AA 1E0OB 4OZIE 2OL3A 1U8QA 3OKYA 1GCFA 1T03L 3AUVA 3MBXH 3BGMA 3STLB 1Z9LA 1LO4L 1TJHH 1FVDB 1KLUA 2NMSA 4TRPH 5INCA 3TA3C 4LCCB 2EXYD 3I6LE 5SWSA 3K2UL 1XGPB 1VFAA 1DQJB 3QRGL 4LSUH 1B9ZA 3F8UB 4YDIL 3MCKB 2ITDB 4OGAD 4L4TB 1FH5L 2JELH 4LCUA 1PLGH 2XN9D 4GMTH 4B41A 5DD3H 4I0PD 4Y89A 1BFOA 4L8DB 1WZ1L 2FGWL 1WAAF 4FQIL 4KUZL 3ZZ1A 2FJFA 2DQHL 5ADPH 4CU7A 3DVGA 5EBGA 3QFDA 5LAXA 1RJCA 3T0EC 3EDKA 3LEVH 4KJPC 5DJYB 1C8PA 1U3JA 4ONHB 3O8XC 1WFNA 2JKXA 3QNXA 5I8KL 4PJDA 4AEIL 4OGYL 3H42L 4O4YL 4WO4A 3QUYC 3IETA 5T3XL 4F7MA 5I73C 4EDXB 3EJJX 4BYHA 1HWHB 4K8RH 2RCSL 3PP4L 4JVWA 5HYFA 3ZTNH 3QP3A 5C2UB 3TH4T 5BZDA 1RIHL 2FHBA 3RWGB 4KKBC 5HYJE 4G7YH 3V4UL 5IR1A 2XT1B 1FSKC 1DBML 4UDUA 1UEYA 3JSSA 4WWKB 5F9AC 4OKVB 5E6ID 4X4XA 3OR6B 4HFUL 3HI5H 2AK4E 4I2XA 5EZOL 3EYSL 3CVIL 5EUOE 3D3VB 4XWGH 1CBVL 2DYPD 2J88L 3S98A 2OJZH 1ADQH 4Y19B 3MV9D 4KRPB 2WP3O 3FB6B 1IQDA 1G9MC 4Z18A 1Q1JL 5D9SB 3ULUD 5I1IH 4JKKA 1AJ7H 1BLNB 4JRXD 1R3IH 1YEJH 4JM2D 4M61A 4NJAL 2C1PA 4OZFA 2Y72A 2EE3A 5I1DA 2DLIA 2P24B 3QEHB 3MBEA 4EVNA 3WSQL 2NCMA 2Y5EA 5FM8A 1XGQA 1AO7B 1II4E 1PBYA 4WRLA 4XMPL 1LO3H 2GY7B 3LRSA 2DTMH 4GKSA 2E9IA 2P5WA 1NGZA 1AH1A 3MRDB 1RZ7L 5FXCH 4U1GC 3QB7C 5T1LB 4PLJC 3V6OC 5BV7L 3GB7A 4FG6C 4NM4L 2EIZA 5CP7B 1BFTA 2R0ZH 1NKRA 1P4LB 4FZ8L 4Q6IB 3V8CA 2CQVA 4M5ZH 3ZE0F 3HI6H 2D31B 2XWJA 3ARBC 4P59H 3RJQB 3WO4B 1DLFL 3WE6A 4XHJC 2XIDA 1KCUH 3T0BA 1A6UL 4KROC 5GS1C 5HDBF 3V52H 3ZSTA 3DMMD 3BRGC 2E9JA 3FT4A 1NJ9B 1GPOH 3P9MA 4Y1AA 4OUUB 5ANMB 3UAJD 4PJIE 4HWNA 4WTXA 5T1MB 3SGJA 3T2NL 2DQUL 1BAFL 1N7ML 3U82B 1H3WM 4OD2B 5FV1L 1RSFA 4OV6F 5BV7C 2R4RL 3VD4A 3DVNB 2VDPH 1L9NA 3TNMB 3LV3A 4EIGB 1QLFA 1JUFB 3CCHA 3O2VH 4WIQA 1JMXA 2OMBA 1G1CA 3TESA 3WNPA 1N6UA 2VLRE 4M1CC 3U36B 4QRSB 1EXUB 2KH2B 4OF3A 2QSCL 3QULA 3RPIA 4C55A 1T0PB 3MLTB 3C5ZA 5MEPA 3UO1L 4CW1B 1F3DJ 1KBGL 4FRWA 3L5JA 5HYIA 4OFYA 3KGRA 3WUWB 5IK3A 1WC7A 3FQXB 4KH2A 3DTXB 3H9SE 3HUJB 1UWEL 5T33L 4LCWB 1S7QB 2VAAB 5IESL 4LSQH 3SDDB 3BVNB 4JZNB 3S96A 1MCPH 3IRPX 4O00A 4RFOL 4DGVL 2ICES 1ZLSL 3PHQB 4LSPH 3C60C 5FF6A 1RZFL 3QJHB 4RIRA 1DP0A 3RVUD 1T22A 3BW9B 5HHXH 4JG0L 4MQ7A 2Z31A 5ICYB 1EO7A 3VH8G 3CSYA 1BWWA 1TNMA 2IH1B 2GKIA 5D93B 1I8MB 4HXBL 4ZFZA 3ALPA 4LLVB 4DVRL 2APTA 1J5OH 4JRWA 4ZUWB 3QNYA 1HXMB 1NMBL 2NX5D 3PQYB 2FGZA 2BY2A 2GSIB 1BGXH 2NY3B 4HV8A 4W4NA 4MWFB 3ZDZF 1FYTA 5D5MB 3ARED 1SEBA 3MRBB 1OGAA 4KI5C 2OZ4A 5E2VL 2M26A 3W9EB 5I1LA 2QEJA 4PJFB 4X9BA 5DT1H 2BVOA 2GT9B 1IM9D 3ZO0A 4OQ1A 1S9XB 2R56L 4OIIH 2E8ZA 1MSPA 2IGFL 2EDXA 1SQ2N 2VH5L 1AGCA 3I9GL 3OR7A 1H8OA 1ZEAL 5HI4D 4X7SL 4Z7UF 2NYYC 3D9AH 4PJGA 3HPLA 3L3HB 4DFIA 1N2RB 3THML 3BKMH 1NBZA 1CFTA 4HUUB 1CLCA 4F37F 2X1XR 1L7TH 3A6OA 2UV3A 1IC7H 3CPLA 2YRLA 2XN9B 3NPSC 4HKJA 2CPCA 3P0GB 2DRUA 4I0PB 3ZDYE 2BJML 4Z95H 3NZ8B 2XZCH 3G6JE 1SJEA 4MMXC 6FABH 3WIFA 4HUMB 5HGGS 1T0NB 3OBAA 1N4XL 3VRJA 1YNLL 3IFNH 4LP4A 3HZVA 4X5WB 4J1UA 3TJEL 2EDNA 1WBYA 3NIGE 2FJGA 4J3XA 3NN8B 3CVHH 3QT2A 3SDXF 3SGKC 5I15L 4XTRD 3ULVH 3TBVA 5CEXB 4HUWB 5SWZE 3IF1B 4Y5YA 1P7HL 1S5IH 2AQ2A 1UACL 5ITBL 3QBTB 3QPQC 4NRZB 4MNQD 4RMWA 4TSCH 3HLAA 5TE7L 4LKCA 4NUGH 3TBTB 5I1JH 4OZIF 4MAYD 4DK3A 1S7XA 4IMLA 4ENED 2IPKA 1P7QA 2DJSA 4HC1L 4JO2L 3HAEA 2VL5B 1A7NL 2EC9T 4FXLA 5E5RB 1I1FA 3UPAA 5I8CA 2R8SH 1RPQA 5E6IB 1H3VA 3L3KA 1CFVH 5T1KA 2DYPB 1MHEB 5F7MC 3DV6B 5F3HB 3RNQB 3VXRA 4DVBA 3NCCB 2OLDA 1FL3A 1B90A 1G7HA 3MV9B 4NZTH 4IDJH 2NW2A 1O7VA 2VLLB 3LKOA 5GSRB 2B1HH 3KNBA 5IMKA 4X6CF 5IBTL 3BT2L 2MHAB 4NN7B 5K9OA 4RMTA 4JRXB 3IJSB 1JFQL 4JM2B 4XZUA 2X5PA 2D03H 3D18A 2WUCH 4V1DA 4LPUA 2X1QA 2E9WA 4PJAE 3QFJA 1ZGLA 4WEBH 5D7IB 5I75C 4XCNB 1HHIA 3VFNB 3BQUA 4UMGA 4B5EA 5E6ZA 1MCLA 4UT9H 2K3TA 3B2UC 3EFFB 1F4WL 1FIEA 3MUJA 3SQOL 2YRZA 4RFEA 4JY4A 4AEHH 3UZQA 1G6VK 4D3CH 3AVEA 1QA9A 1Z9OA 1DVFD 3DHMA 3Q48A 4XGZA 5IEKB 1MUJB 1OW0C 1NBYA 2IADA 1H5BC 3SPVA 3CLFL 4LHUB 1B6DA 4KTEL 1J86A 2DQEL 3ARSA 4F7EB 4M62H 3STZB 2P44B 3GSWA 1FE8H 1B0RB 1CT8B 1T04A 2CDGB 4L3AA 3MXWH 3U46A 4QHMB 1SMAA 4U1LB 3FQWB 2X70B 3VI3E 1S7SB 2RHEA 2ADGB 4LDOB 4YBHA 2P8PA 5AWNH 1KLGA 3L95A 3DETC 4K55A 5AG9A 1UVQB 2DQJL 1MCJA 2OI9C 4XPGL 3EOAB 4M8QA 3G6AA 4OFDA 4XB8A 1TENA 4JQXA 1NC2D 4WI9A 5GJTH 1A9EB 4WHDA 5C0CA 1UB6A 4Y2DA 5IV2B 1G84A 3E3QC 4FMKA 1T03H 5I66A 4YHYC 3KXFD 3RL1A 5DD1L 1FZJB 4BFIB 5DQDL 5JDSB 1UZ8B 1UG9A 4XP4L 3GMLA 1FG2A 4X99B 1MCOH 3CGTA 4LFHD 1ZGLP 4PRNB 1EEQA 1M6OA 4X6FA 1XF5B 1P4IH 1MJ8H 5HHPB 2IF7A 4MNGE 1XAUA 4MVBD 3O3UN 1UXSB 2HRLA 1FIGL 4B0MM 3FZUD 3L7FA 5C0AD 5FYKL 5I1EL 2UYLA 4OGXL 1CGTA 3MRGB 1TNNA 2VDLL 3RX7A 4XNZC 5KSUA 3BDYL 3SO3B 5KVFL 4PJEA 1BIHA 4ZFGL 2NXYD 3P4MB 2Y07L 2R1XB 3SKNB 1QBBA 5SWSD 5CJQL 4JZJA 3E2HB 5HGBB 3UTQB 2NZ9C 4R96A 5GJSL 3RGHA 2YWZA 5T3XH 4R2GC 1OGTA 5IWLC 2ENSA 3X13B 4D0DA 5E00A 1OSPL 4HJGA 3WKMH 5DRWB 3MV01 5M95B 4O51A 3WLBB 4HZAA 4I3SH 1EHXA 2DQIH 5JTWA 1IGJA 2FATH 3ARGA 3PWUB 3QWOB 3GJEA 1OM3H 3QUZC 4WUKL 5GHWL 4JFDD 3GBNH 2NX5B 1EEUA 4X80L 1N64L 4RMQA 5IHUH 3AREB 2E27L 3IDXH 4WO4D 5EPMB 4LMQI 3EO0A 4M6ML 1IM9B 5DJZA 2V2TA 1CFSB 1DE4B 1NFIB 3T77B 2V2XB 3RNKA 4OLUL 2CJUH 4OCWH 1MFCH 3O45A 3C8HA 3RAJL 2Q7YA 2DM3A 4Z77A 1E28A 5DLMH 4NJAH 4OZHA 1T20A 4EDWL 4ZSOE 5KANI 1LO0L 1XH3A 1A22B 5IHLB 3Q6FB 1Y6NR 3R1GH 3WHE1 3JVGC 4ELKB 1W0VA 4MDJA 2EYTB 1T1XA 5T1DL 3AXLB 2V9TA 3BMVA 3BWAB 4PJBB 3JBG7 2AEIT 4G6JL 3DURA 2DKMA 1OCWL 3L7EB 2DL2A 3IXTA 1I9RH 1T3FB 3OKLB 3FN9A 1CCZA 5KS9A 4JPWL 4MAUL 3PDOB 3QZWA 4UIMA 1JHTA 3E6FA 3CAFA 1C5BH 2DWEB 3P0VL 5DMGD 4JFZH 5HVHC 4ZUVA 4YIQA 4XNYL 1IGIH 1DLFH 1J05B 1MLCB 3FFCB 3P4OA 4TSBL 5TE4L 1KJ2B 1IQWL 1RJYB 3MBED 2FYYA 1A6UH 5E8PA 4JPKH 1RV6X 4A2MA 1ERNA 3VG9B 4H0HB 4XX1E 4ZOEA 3ALWA 3HC3L 5LG1A 1KV3A 5FA4B 1R0AL 2P5WD 3V4PH 5CBAB 2F5BH 4MNQB 1CF8L 1SYVB 1CE6A 1PZ5A 4WV1B 5D1QA 5LQBL 2D9CA 3V6BR 1A1OB 1NC4A 5JW4R 1K6QL 2P49B 5EG6C 1OAQL 1RUAH 1U42A 4Z7VA 1ES0B 2V17L 2AQ3A 3BFOA 1J0KA 4JY6A 1DQLL 3EFDL 2PW2A 5CSZB 4E41E 1CGSL 1NGQL 4B7LA 2NY1D 3FCTB 3BSZL 5KVEH 4E42A 3M45A 3OGOE 1LQSR 3DSFH 4NOBA 1LGVA 2QSCH 4Y1AD 4KTDL 4YE4L 5C08E 5BOPA 5ALCH 3QJFA 3ZDYF 1QP1A 1JRHH 1KT2B 1YC7A 4WFGD 1XCTA 3RKDD 4PJ9A 1CXEA 3FQRA 3ARUA 3HC4H 2VDOH 3K4ZA 4J8RA 3B8SA 4P57B 3TJHD 3PXJA 5E70A 2VABA 4KXZH 2H2PD 3I50L 3BKJH 4GRLA 2AEWA 4PP2B 1FBIL 1F3JB 4XP1H 5DJXA 3NCEB 1FFPB 4RFOH 1T66C 1UQSB 3RTQA 3T65B 4XP6H 3BD3A 4FQQB 4HGMA 1T1ZB 2Q86B 3C5ZD 1FG9C 2HLAB 1NCDH 3DV4B 5KZCD 2IAMC 4M6NL 4AZ8A 4Y4FC 4OFYD 2Q87A 5D96C 5FGCE 2IPTL 3T0WA 2OK0L 1NDMB 4G7VL 5TGBA 3ZT5A 4HX1B 4YXHH 2ZCHH 1ORSB 3BIKA 3VGDA 2BHUA 5DEZA 1DVFB 3FB5B 4I0KA 3BIBX 2D2OA 2JJTC 2D9QB 2NZIA 5EFIA 3MRKB 5C7XL 5FO8A 2Q1EA 1WTLA 1EIBA 1XF3B 1TVBB 5EU6E 3EJZD 3HS0B 4HS6B 3O2DA 1OSZB 3VFTA 3K74B 1FDLH 4YGVB 1KB9J 1NAMH 1W0WA 1G7QA 4NRYB 4PRHA 2HFGH 3BP6B 4NCDA 2VKXA 4R4BB 3QQ9C 1PVHA 5CJXA 3B3IA 3KPMB 1EFXA 1ITCA 3O3AA 3FONB 4U33A 2FB4H 4TN9A 1NEUA 2W91A 3NIDE 2UZIL 1MEXL 4U0RB 1C5DB 3RWEA 1NC2B 4XPFL 3NA4A 2Z31D 1D9KC 4PJAF 1GHFH 43CAB 1FPTL 2QL1A 2MKWA 5DUBB 3JWDC 2EH8H 4YHLH 4RGND 1XGYH 3FKUS 4XVUD 1X5IA 4YLQT 4MX7A 3QEQA 5A16B 3KXFB 4CU8A 4Z7QE 1FYTD 5I17B 3T0VA 5ERWB 4ODUA 1OGAD 3WFDL 3WNNA 2V6HA 4W70A 4PJCB 3EGSB 3V95A 5IB4B 5INDA 2ZUUA 1HKLL 4M7ZB 1G7JA 1I3VA 1HSBB 4NPYA 2A6DA 5CCKL 3QIUA 1HYSD 4OM0H 5IGXL 1YN6B 4NM8L 5C0AB 5DR5H 2OL3B 1N4XH 1OL0A 1U8QB 2AV7A 4YX2H 1DBAH 4HK3J 2Y06H 3BGMB 4ZS7H 4Q97A 1FNSH 1KLUB 3O3DA 2NXYB 1VACA 5INCB 5JA8B 2NY5L 4HBCH 5SWSB 4XNUH 4QYOA 1VFAB 2NLJA 4XI5D 1A7OH 4G80A 1MLBA 1E4WH 4JE4B 1CE1H 2R4SH 3MLRH 4LCUB 3TO4C 4DGIL 3Q6GL 1BFOB 4PB9H 1WZKA 5JOFA 5HYSG 2HFTA 3WL9A 3X11B 5L8JB 1MF2H 4QY8A 1R3JA 2FJFB 1UCTA 5DQ9A 4JDZA 4GG6A 3E0GA 3QFDB 3OSKA 1UFUA 5LAXB 3LB6C 4UQ3A 4KJWD 1JPST 5E4EC 2NY5C 1C5CL 1W8NA 4UB0H 4DTGL 3QNXB 3OX8A 4PJDB 1JZ2A 4WO4B 2WQRA 4F7MB 3IETB 1V7ML 1IAMA 1Y18A 2JJSC 1VENA 1OF2A 5JIHA 5F21B 3V5KA 3DX7A 3NIFF 4OCRH 4LU5H 5BZDB 1P7QD 1ORQA 5IR1B 3TH3T 1IAIH 4UDUB 1KIPA 3GRWL 5ADOH 4PB0H 3L5HA 3CIQA 2DQFA 4PP1C 3WJJC 4I8DA 4X4XB 2XY1A 2ICWI 4I2XB 4PLNC 5T1KD 2NR6D 4EUPA 2A6KA 3RY6C 4P4KC 1U93A 3VXRD 1WT5C 4OQTA 4KI1A 4OZGE 4LSRL 1KB9K 4JVPA 4D9QD 1IQDB 3NCJL 3U1SL 2RAMA 5DFVD 1YYML 4FTVE 5IVXA 5D1ZA 2HN7A 1PSKH 4QRRE 2R2HA 4M61B 4V1DD 1IEAA 2C1PB 3P0YL 4OZFB 4XBGA 5C9KA 5I1DB 3WDIA 3QFJD 5F7NC 3MBEB 4GOSA 4EVNB 3BQUD 4P5TA 4WUUE 1XGQB 3LRSB 4GKSB 3IJHA 2AXFA 2P5WB 4TVPD 1A64A 4X6CA 5KJRL 5C09A 4ZODA 3LEYL 3RZCC 3GB7B 1HOCA 1LEIA 3ZE1E 3MUGA 4EI5C 2EIZB 5FYLE 1CGXA 3QG7H 5J13B 3WN5A 5FCUH 1DLHA 1FFQA 2XWJB 1MOEA 2BXZA 1P84J 3WE6B 5C0BA 2NY1B 1CG9A 2YD5A 3VFGH 4FHBD 4KKAC 1TJGH 2CLVA 3D69A 4BH7A 1GGIL 3FT4B 4HH9A 3L3JB 4WY7H 2AXJA 3P9MB 4Y1AB 5HYJA 1F8TL 5DRNA 2DMCA 1OTTD 4KDWA 1WISA 3SKMA 5KG9A 5D7JA 2NY7H 1BVLA 4O02L 3UBXA 3UJTH 2J6EL 4IOFC 1WEJL 4PJHA 3LV3B 1QLFB 3RU8L 1BWMA 3BP5A 4MB5A 1R5WA 5C0CD 5E2UL 2VNCA 3CCHB 2SEBA 2EEBA 2Y23A 4OGXH 4Y4KA 5I30H 5KTEL 3VH8A 4Y2DD 3QAZC 4M5YL 5BCAA 4JJ5A 3VXQA 3U7YH 3RPIB 3QULB 4K71B 4U6XA 2O5YL 3C5ZB 5MEPB 3FT2A 2UZXB 3L3GA 3FQTA 4RZCA 4KJYA 3AS0A 2YSSA 3I02A 3JZ7A 5IK3B 1WC7B 5A1AA 5DWUL 3C87A 2F5AH 4WHYH 5BMFH 2ZG2A 5HDQL 1ZWIA 3EZJB 3PNWA 1MJ7H 5A2JH 1RZIA 3S96B 1YY9D 3T8XA 2CRZA 5GHWH 4K9EC 4CJ1A 2NY2C 4TNWK 5D7KD 2I24N 3PV6A 1K8DA 1RIVL 3TT1L 1RQ5A 1U3HC 4HIHA 2AEQH 1T2JA 2R0KL 4R97B 4HD9A 5FF6B 3HMXH 4RIRB 1JK8A 1B0GA 1MREL 1WWBX 1UA6L 4WU7A 1T22B 4MQ7B 2Z31B 4LVOB 4LASL 3CSYB 3GEWB 3OQ3B 3ARGD 4CVXA 4ZFZB 5GGTH 4RGNB 4MSWA 3QNYB 4Z0BH 5JUEL 1I3UA 4C4KT 3O0RH 2FJHA 1QSEA 4HV8B 4QHKJ 1FYTB 4N90D 1SEBB 1OGAB 3R0NA 3U30C 4I0CC 5I1LB 1MFEL 4WFHD 1O5DT 2BVOB 3ZKMC 1SM3L 3PABB 4DK6A 1TXKA 4FXGB 2BNUA 3UEZA 1T7YA 3BUYA 4JG1H 5I18H 3MREA 1BD2E 3O2WH 3KDMA 5E8DH 5J1TC 1ZLUH 1AGCB 1GGYA 4XNMA 4XNYH 2WLYA 5BW7C 3OR7B 2A0LD 1X5HA 5F9OL 1NLBL 4LCIH 4N0YH 4PJGB 3HPLB 2PNDA 4PRIA 3KYMB 3TEUA 3BKYH 1NBZB 1CFTB 3WS6A 3QEGL 4ONFL 1VB9A 3CVHA 1I75A 2GJJA 2MPAH 3CPLB 4HKJB 3TIDA 1AD9A 1SJEB 2HTLD 4ZDHA 1RZ8A 1X5XA 3WIFB 1S3KL 3V0WL 3VRJB 4K2UL 4F7CA 2C4FT 3HZVB 2O5XH 3CDFA 4J1UB 1WBYB 1YC8A 2FJGB 4JFEE 1ZSDA 4HLJA 1Q0XL 3QI9A 5IQ7H 3SJVE 1AD0A 3W2DH 5I9QB 4GAJL 4MZ3A 4G5ZL 3BZ4A 3TBVB 4EXKA 4Y5YB 4XAWL 2BY0A 4NBZB 2A77H 1KN4L 1S9WA 3NABL 3MR9A 4TSAL 1F4YH 4E0RB 1HNGA 3HLAB 4YDKL 4LKCB 5I71B 5D1QD 3O4LA 3RGVC 3SDYH 1NC4D 2DQTH 1S7XB 1QBMH 1CLOH 1GGCL 2VLMD 4IMLB 1CL7I 4JQVC 1NCAH 4WFED 2IPKB 1P7QB 4QOKA 3HAEB 4G9DA 5TJWK 3V5DA 3EYVA 2P46B 1I8LA 1I1FB 3ARRA 3D0VA 4IHOA 5I8CB 3VXMA 5JW4M 4KK5D 1QSFA 3TBSA 5JNYA 3L3KB 5J12B 3MMEA 4G8GA 5T1KB 1P9MC 5IFJA 2UWEE 3O6FA 1IGCL 5IVZB 3TZVA 3VXRB 4DVBB 1FL3B 1IT9H 1G7HB 4EN3A 3KG5A 2B1AL 4OFIA 2NW2B 2VZVA 5A2KH 3S35X 1TZGH 4PJ9D 3LKOB 4KHXL 4TVSa 4ZTOL 1L7IH 1ZT4A 3KNBB 5IMKB 1WZMA 5F3BA 1A2YA 5K9OB 4FXKA 4DOHE 3TYFA 4LGRB 4XZUB 4OTXH 3D18B 1VKXA 2I9TA 4XVJL 1MIEH 4OD1L 4V1DB 4L4VA 3QFJB 1ZGLB 1YEFH 3UYRL 3KAAA 2NQCA 4QGYA 4PJXA 3RTQD 1HHIB 3BQUB 2Z8WC 3WJLC 3RIAK 3NTCL 4YDVA 1KYOK 2X1PA 3VMPA 3VI4E 3NGBC 4RFEB 3NAAL 4JY4B 3SCMA 3CFIC 1QA9B 4XGZB 2PTVA 2P43B 2OP4H 2UZIH 4M7KL 4HG4J 1NBYB 2IADB 4XPFH 4JRYA 4D9LL 3SPVB 1SVZA 1X5GA 4JZOA 1MRDL 2FNBA 3GSWB 2P8LA 4RMRA 1NL0L 4HJJL 1T04B 4OZGF 4PRHD 1PKOA 3U46B 2NPLX 4P3CL 2XQBL 3AY4A 3UCRA 1JCKA 2P8PB 4M9OA 1KLGB 3L95B 4F57L 3ESVF 1EFXD 3QXWA 4M8QB 3D48R 3G6AB 2HJKA 4N5ED 3H3BC 4J3UA 5C0CB 5AAMA 1UB6B 5M94B 5GS3A 5LWYH 3MRJA 4Y2DB 1KTLA 4K94H 4N9GA 5I66B 3QEQD 1LDPL 3RL1B 5FO7A 3U7AA 2AI0L 2ZG3A 3OXSB 4L3EA 3FHAA 4YUEL 3GMLB 1FG2B 2J12B 3LKNA 4F8QA 3VFOA 3QQ4B 3PGDA 4H0IA 5FDWB 1M6OB 5FDYA 4X6FB 5JQ6H 1ZXQA 4H8WC 1TJIH 2A83A 4JO4L 5IJVA 3BESR 3H3KA 3QIUD 5F6IB 4N68A 1U36A 3L7FB 4KKLC 2EC9U 1A6VL 2YKLH 3UTPE 2UYLB 3UPCA 4H20H 3HFMH 1K8IA 1DN0A 2RB8A 5KSUB 5DJCA 4PJ7A 4PJEB 1BQHG 1WCBA 4OCYL 3W9DA 4JZJB 2RFXA 5I1HH 4R96B 4ODVH 2C26A 1A14L 4L9DA 4U1IA 4YBQC 1OGTB 4P5KA 3DARA 4D0DB 2HTKD 5E00B 4HPOH 4HJGB 3W5MA 3QUKA 5AEAA 3TBYA 4HGWA 5ALBL 5JMOC 3EYFA 4NKIL 4O51B 1XIWB 4DGYL 5K9JL 5L9DL 2BOCA 1IGJB 2Z92A 3ARGB 3DX8A 3GJEB 3ARWA 4R4NC 2AABL 5I1GH 4KK8D 1UWXH 1UYWL 5F89A 4QF1A 3UTTA 3ULVE 4TUOA 3P11H 4XC3H 1FGVH 4NP4L 1HK6A 3QDJA 5CS7A 2H45A 2H9GA 2R69L 5DC4B 3EO0B 1X5AA 1G9EA 5JDJA 5DJZB 1MNUL 2V2TB 2OS7A 3DSNA 4KJQD 2O61A 3BZFA 2XXMB 4YAQA 3RNKB 2ARJA 5DJ2A 1IKFH 3REVA 3O45B 2Q7YB 4Z77B 1E28B 2QSQA 3EJYC 5GRXG 4OZHB 1T20B 5F8QC 1XH3B 4HG4K 3B6SA 1IGMH 5KOMC 1ZA6A 5JO5A 4GG8B 4RISH 2N7AA 2Y25A 5E5UB 1W0VB 4MDJB 1L0QA 1T1WA 4BZ1H 1T1XB 1E6JL 2M8XA 2BNRA 3JV6A 3BPOB 3WS3A 1NCUA 3E8UH 4M48L 3DURB 3S36H 1NCCL 3IXTB 1K5NA 1KC5L 5KS9B 3BPLB 3UMTA 1ULVA 5D1ZD 3QZWB 4UIMB 1JHTB 3E6FB 5FUZL 1X5KA 4YHML 5LXGL 2BDNL 2J7LA 5J56B 3TVMA 5GS0D 1JWSB 4ZUVB 1Z0NA 4YIQB 2ZSWA 3P4OB 3TFKD 2YK1L 2ZUWA 5DO2C 3FO0L 1YMMA 2FYYB 5DA4A 5E8PB 4JQIL 1G7PA 4JN2A 1ACYH 3W0WA 1CDJA 4CMHC 2YA0A 4P23C 1MPAH 4G42A 4WTZG 5JORA 1ED3A 1KXTB 4KDVA 4FN0A 2CK0H 2R9HC 3WHE0 1KIRA 1CE6B 1PZ5B 1IKNA 2BVYA 3G6DL 5C09D 2F58H 3WIHA 2PKDA 5JMRA 1NC4B 3DO3A 4AIXA 4Z7VB 3RWFA 1RFDL 1ONQA 2GYSA 4JY6B 2J6EH 1WEJH 2B4CC 1CDGA 1E4KC 1A7BA 2EE6A 2GEEA 2PW2B 3QO0A 5C0BD 2XOTA 4ZD3H 5JW3H 4FQXA 4NN6B 4E42B 1OVZA 2EXWD 1DBJL 2I26N 4HKBA 2OTUA 1ZANL 1N5YL 3SE3C 5I0DA 1HCVA 3GO1H 2VB5A 2X40A 4K3GA 5HYJD 1KJ2L 3QJFB 1DQDL 1XCTB 1S78C 3SBWA 1GSMA 4PJ9B 5D7JD 3FQRB 3MLSL 4WW2F 4U3CA 4IMKA 4J8RB 4DW2L 1BBDH 4HH8A 3BJ91 1KNOA 2VABB 4ONGL 3OKNA 1MFAL 4UTBL 3EDFA 2GY5A 3MLYL 5C8JB 4Y4KD 2HJFA 4GRLB 4LOUD 5FYJH 1T0MA 4PLKC 1J8HE 5MI0C 4QWWC 3ZSSA 5DJXB 4OI8A 3QRFM 2EDWA 4M1DL 1YEEL 2CXKA 4HT1L 2AJVL 4V2BA 3T3ME 3RTQB 1JN6A 1I3RA 5A43C 2HWZL 3SE8H 3G5XA 1BVZA 5TQ0L 4L8SC 2GJ6E 4PRPE 3IDNA 1YA5A 4DN3L 2BRQA 2F8VA 1IC5H 4UV4L 1JNNH 3M07A 1YPZF 1QFWL 4I3RL 2BFVL 3RIFK 1FV1A 2JB6A 1F2QA 4KVCL 1F5WA 3I75A 5D6DC 5EFIB 1PKQA 5FO8B 1CS6A 1QSVA 3MJ7A 1GGBL 4LCYA 4XCEA 2UWEF 3GBML 4FOMA 4G8FA 3VFTB 1K85A 4JO3H 4K3HA 5J11B 1W0WB 4PRHB 1G7QB 1DEDA 2DIAA 1PW3A 2PO6C 5E4IA 1ZMYA 4WCYH 3N1MC 1ZLWH 2IG2L 4K3EL 4CN4A 5T3XE 3B3IB 4ZUSA 4N1CA 1EFXB 2IANE 3S37H 3O3AB 4K3DL 5E5MA 1ND0A 3BD5A 2PETA 1YY8A 3RWEB 4UT7L 3MGOA 4OF8A 3MLZL 5IT2H 1OHQA 1Q9WA 2F19H 1NANI 4N0UA 4S1RL 4TQEH 3WUWG 2HVKA 1HE7A 1RUPL 3JWNC 4MX7B 3QEQB 1U6AH 3RI5K 4O2EA 1QSED 2JLLA 4E9LA 3VI4F 2PF6A 1PYWA 4M6AA 4ODUB 3L9RA 2EE2A 2QHLA 4PGCA 1HZHL 5INDB 1UM6H 1IFHL 1G7JB 3V6OE 1JYWA 2ZWLT 4NPYB 3A67H 2A6DB 4U3XA 3QIUB 1C7TA 3RVWC 4CU6A 3TV3L 2V7NA 4XAKD 1S3KH 4B50A 2AV7B 1WGOA 3VFMA 3K81A 1DL7H 3QDME 4PRID 3O3DB 2Z8VC 3GSOA 1VACB 4NQDE 3RL2A 5EB9A 5IB5A 4QYOB 4BELD 2NLJB 5ICXA 2O93L 3MJ9L 5DZNA 3NA9H 4G80B 4D8PA 1MCWW 1MLBB 3ZKNC 2VSCA 3K2MC 2VXUL 5EU6A 5ACZA 3JV0A 2Z8RA 4N8VA 3P2TA 4S1QH 5GPRA 4ETQA 5JOFB 5IBLC 5MHSE 3RWIA 3WL9B 4QY8B 1R3JB 1JE6A 4WI8A 3C8KA 4JDZB 5DQ9B 4GG6B 3HRZB 4G9FE 2PN5A 3MOAL 2D3VA 3QI9D 2CO6B 3H3PH 4UQ3B 4JGMA 4RWHA 4LPVA 1RULH 3ETBF 2YHGA 5E95B 3OX8B 2VIRA 4S2SA 1N6QL 1MY7A 1YQVH 4MXQD 1Y18B 3O4LD 4HGKC 4Q9CA 4XVTL 4TNVK 5ICZA 2PYEA 1OF2B 2FWOA 3V5KB 3DX7B 1MCRA 2EH7H 4QOKD 1ORQB 4N8CH 5SWQA 4Q9RL 2DD8L 3UPRA 4L8CA 4FFYH 1SBSL 1KIPB 3PWJA 3MLUL 1BF2A 4GQ9L 1G9MH 4MA7H 4YHNA 3VXMD 2DQFB 1UADC 1QSFD 1WJ3A 3UX9B 5F1OB 3UYRH 4G8GD 1KJVA 5DVOA 3O6FD 2A6KB 5L8LB 1U93B 3TZVD 2G5BA 4C59B 2YPLA 4P2OA 4EN3D 5AZ2H 1F90L 1S7RA 4PRBA 1WBZA 1IE5A 3S3SA 3MA7A 5IVXB 5D1ZB 2ERJC 4O2CA 2HN7B 2WM0A 4NIKB 4YK4B 4M7KH 5C0ND 3C9NA 5E2JA 5ILTL 2R2HB 2BSRA 3U4BH 3ULVF 1IEAB 3O41A 4HSQA 4L4VD 3ILQD 4XBGB 3ULUH 1EAJA 2FX9L 1I1YA 5D4QA 2W9LA 1MCFA 2MWCA 2XICA 4HWEL 4P5TB 5LCVL 1M05A 4OM1H 4RFNB 4ZTPH 2CGRL 4ACPA 1NSNH 5L2KA 1IBGL 1QBLL 3IJHB 2AXFB 3LS4L 4X6CB 5J6GA 2BC4A 3PJSA 3GHEH 2A1WL 3SCMD 5C09B 1ZOXA 3WCYA 1HOCB 1LEIB 2EDTA 3MUGB 3N85H 3OV6A 2OR9H 2F8OA 5C0DA 3QG6B 3WN5B 1DLHB 4JRYD 1SMOA 1NLDL 5GRWA 2W38A 4J7RA 5C0BB 1OAUH 1FJ1A 1CG9B 1RZJL 4XH2A 4U05A 5DJAA 4NQEA 3MACL 1A7PH 3L3IA 2CLVB 3D69B 4BH7B 2H41A 3ARFA 4CMMA 1MCQA 4HMEA 5DRNB 5GIRA 3MRMA 2OXGA 2XZQH 3QA3A 5AUMA 3SKMB 5KG9B 5D7JB 1BVLB 4YHOL 3UBXB 5C0RH 4XCCL 3S88L 3PP3H 1TQBB 4PJHB 1NGYA 2VJXA 3BP5B 2VN4A 2SEBB 1OT2A 4Y4KB 3VH8B 1RZJC 4NN5B 3ES6A 3CLEL 4JJ5B 1MFDH 4WEUD 2CLZA 3VXQB 2ZSVA 2E6QA 3ZE2E 2ZPKL 4MMZC 3MXVH 2KL6A 4R8WH 3S36X 4L3ED 4X0KA 1J9CT 1JGVL 1KFAH 4U6XB 3FT2B 3W81A 1UKQA 3L3GB 2IPUK 3FQTB 4RZCB 3VGBA 5DFTA 4KJYB 3MRPB 5CKAA 4OCMC 3PL6A 3T08A 5L7XL 2YSSB 3I02B 2P5EE 5EZJA 1A7RL 4GXVL 4PREA 4HWBH 3KPRA 1JZ3A 4UAOC 1ZWIB 2BHZA 3PNWB 4NZUL 4JPVH 4IOIA 1RZIB 4MJIA 3IS1X 1AXSA 5K9JH 4EKXA 1Q72H 3LY6A 2WBKA 5IKCA 3T8XB 1CDCA 1RUKH 5CEZH 1NCWL 3HE7A 4N1EA 1C16A 3PV6B 1K8DB 1N3NA 4ZNEE 4HIHB 4NWTH 3RVXD 3VG0L 4K7PL 4IRJC 3RWHA 1FZKA 3WFEH 5F6HJ 1B0GB 1JI1A 1IEHA 4OLVH 2FH8A 1VFUA 2YRPA 4KQ4H 3FN0H 4WU7B 4F33A 1I9IL 5GSVA 4BZ2H 1LEGA 2D7QA 4PBWD 5DC9B 1B3JA 3CZFA 4U31A 4Y5VA 1RI8A 3SE4C 4CVXB 2VDMH 2P48B 4MSWB 3IKCA 1T7XA 3CSGA 1F13A 5MP6L 3HNVL 2FJHB 3VCLA 1QSEB 4XXCC 1RMFL 3QDJD 1FL5A 1QNZL 5A2FA 4AG4L 2OSLA 1MJUH 1FCCA 2BNUB 4JR9H 4ODXA 1L0XA 3BUYB 3DX9A 2XV6B 3MREB 2VE6A 3KDMB 5C2BH 1R3HA 4JCLA 3E6HA 4NFDA 1EDQA 4QCIA 1XGUA 3BZEA 1N6VA 3RZWA 4PD4K 1JZ5A 2ZUYA 2WBJB 1E4XH 1UH2A 4MJ4A 1MCIA 1AHWA 5HGAA 1DDHA 4RRPG 4PRIB 2HKFL 3TT3L 4P2QA 4LARH 4P9HL 3ZKXB 4TTGA 4I18C 3CVHB 4LHJB 2BNRD 2ED9A 4OCSH 4TTDC 2I5YL 2F53A 1KCRL 3BO8A 3WFCL 4UDTA 1BQSA 5D2LF 3TIDB 1LD9A 2OZ4L 3EZ8A 2CKNA 1AD9B 4ZDHB 3TVMD 1RZ8B 3U9PH 4R90H 2A38A 4PY8I 1HN1A 4F7CB 2LTQC 1YMMD 1ZSDB 1OAXL 3QI9B 4PPTA 3QNZA 1AD0B 1BHGA 1PDKA 3W0WD 4P9HC 3BZ4B 3S37X 4KZDH 2HFFA 1JYNA 1S9WB 3MR9B 3O4LB 1LE5A 5HGHA 1ZLUK 4E5XA 3BPCA 1UZ6F 3PXHA 4A6YH 4WI7A 3T4AA 1AKJA 2DQDL 2UY6A 4M1GL 4IJ3B 1CR9H 4QOKB 1M71A 5GGUA 2WNGA 4G9DB 3V5DB 3EYVB 3QXUA 2WZPD 1CICC 3D0VB 3MLYH 4FQXD 3B9KA 3HZKA 4IHOB 5CZKA 3VXMB 1QSFB 4RGOH 3TBSB 5JNYB 1T80A 3MMEB 4G8GB 1HIMH 1I7RA 4ZAKC 2BERA 5IFJB 2CDFA 3O6FB 1L6ZA 4OFVA 3KLDA 3NZHL 5FHAL 3TZVB 3WBDA 3WNOA 5ISZE 3V7AE 4EN3B 1UM4H 3MNWA 3MV8A 2DQCH 5JOPD 3K1DA 1EMTH 3RBSA 2Y9RT 3HNSH 1DBKH 4H26A 3MODH 4MXWH 1ZT4B 3UDWA 5F44A 2E7LC 5F3BB 3LRHA 3F58H 1A2YB 5I1CL 4FXKB 3TYFB 4CAGA 5FYKE 3GSUA 3RY5A 1VKXB 2I9TB 4FABH 1ZLVH 2J8OA 4L4VB 1DQMH 5D7LE 2AERT 4LSVH 4PJXB 2PXYC 3AB0B 3O6ML 4U6VH 2GCYA 3EYUH 1GZQA 1MAMH 4YDVB 1OWWA 2VDNH 3O3BA 3RA7L 3JXAA 1VDGA 3MV7A 3V4VL 4PGEB 4MCYB 4WW2A 5I9QC 3SCMB 1OPGL 4OF7A 1PG7W 4GAGL 5FOBA 1IM3A 2XA8L 5AD0A 3VW3L 4PUBL 1AR1D 3B9VA 2X89A 2J2ZA 3GSQB 4GBXD 1MFBL 2CMRH 4LIQH 4JRYB 5GZNC 1A4JA 4WI4A 4FQ1H 4JZOB 3GM0A 5TDNA 25C8L 1LEKA 2P8LB 5HHMD 2W0KA 2FO4A 4XBEL 1G9NL 3EO9H 4UNUA 5FGRA 5IBUG 4DN4L 4RQQA 4S1DD 2DF3A 2L7UA 1AE6H 4M7LL 2IALA 1JGLH 4X8JA 4WGVB 1FLRL 1JNLH 2YZ8A 1YPZA 2C3GA 4PRDA 3WXWH 2QSVA 3BWUC 4JLRA 4BSWA 2HJKB 4HXAL 5E1HB 1AC6A 1F58L 1PEZA 1TPXC 1YEIL 4Y5XA 4NGHH 5D71L 3IXAA 4X5XA 2AJXH 2BNQA 1FAIL 1X3DA 3MRJB 1KTLB 4POZC 2FZ3A 4N9GB 3WHXA 1G9NC 1UC6A 4XPBL 4KVNH 1CIDA 5FO7B 2ZUTA 1CDUA 3SOBL 4L3EB 3IDYB 4H1LH 3LKNB 3VFOB 3PGDB 5FKPA 2FSEA 2X9YA 2FX8H 5I19H 3LHPL 5CGYC 1EO8H 1H3GA 5E7FA 2WIIA 2A83B 5IJVB 4J4PA 4R0LA 4WFFD 1CXIA 3HG1A 3BGFB 5BZWA 5TFSH 1K8IB 1OARL 1DN0B 3OTTA 3HB3D 5F70A 2MCG1 3IDIA 3L6FA 2ZG1A 5DJCB 4PJ7B 3Q1SL 4HAGA 3MZGB 1WCBB 4P46C 3TPUA 1Z3GL 3GMNA 4ORGA 4G6FD 3UJIL 3W9DB 4POYA 1DEEA 2H3NA 3FQNB 5JW5A 1P4BH 2A9NH 2RFXB 2OL3H 2ARJQ 1WFUA 5CSBA 1JTTA 2WANA 4U1IB 3BRDA 4P5KB 1UENA 2VTFA 4WENB 5EU6D 3QUKB 2B5IB 1KELH 1AQKL 3L5XL 3TBYB 4KY1L 4HGWB 3EYFB 4X6DA 2YMXH 1CZ8H 2BOCB 4LFHG 4Q9RH 2Z92B 3DX8B 5EZIH 1M4KA 5D8JL 2ILLA 5AYUL 1ZV5A 5F89B 4QF1B 3UTTB 2CRYA 4TUOB 4UINH 2VC2H 4R7NA 3CC5A