5ECJE

Crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
VSSVPTKLEVVAATPTSLLISWDAPAVTVDLYFITYGETGGNSPVQKFTVPGSKSTATISGLKPGVDYTITVYAQYYYRGWYVGSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ETO family protein Mtgr1 mediates Prdm14 functions in stem cell maintenance and primordial germ cell formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation/transcription
molecule keywords PR domain zinc finger protein 14,Protein CBFA2T2
total genus 12
structure length 93
sequence length 93
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ecjE00
2NXYD 4CN4A 4KPHL 4MNGE 4OLWL 5IEHA 2DJ4A 3SDYL 32C2A 4BSWB 1IKFH 5FDYA 1XF2A 2QLVB 2P49B 1Q9LA 4LFHG 3QIBA 5E24E 1ZS8B 3AMLA 3KYNB 3GMNA 4JHBA 3L5XL 5HHPB 1HHIA 1HXMA 4X6EA 5HI3C 3PWPA 5J6HB 4JFZH 4JPIB 2B0SL 3OR6B 4Y4HA 5CJQH 2LAGB 1QSED 1EO7A 2OX5A 3HG1B 1CFVH 4QRPB 5HHOB 3PL6C 5HHPA 1HXMB 1FZMB 5D96B 5IESL 1JZ2A 1DSFH 3AB0C 4Y4HB 3ZDXE 1IC7H 2EDLA 2NX5D 3VFNB 5F7DA 4R9HA 5FOJA 3VDBA 5HHOA 3S6CA 2NXYC 1VKXB 2EXYC 3UTSB 3K2UH 3MRKB 1WFOA 1CD0A 1HSBA 3EYVB 2EC9U 3KPLA 2FZ3B 4DW2H 2BRRL 2G60H 1K9TA 4FTVA 4N9OB 1TJGL 4JDVA 5EZJA 1JPST 4WI5A 4G8GA 1J1XH 3FFCE 5C07D 3EJZD 1T80A 3FONB 1U8OA 1IVLA 1RZFL 2MHAB 4FTVB 4HWBH 3T0ED 3O2DA 3QEUB 4YXKH 4HC1L 3MRMA 4QY8A 5DHVB 4KRPD 1LK3L 5IB5A 4RAVA 5IBTH 1I4FA 3RVVD 3WE6A 3QUZD 3KYOA 1A4KB 3K4AA 2XG5A 5F6IC 3I2CH 2NY1C 5TE4H 3LEYH 1S9XA 1QOKA 2W0LA 3ARDA 3RVTC 5IR1A 1IGFH 1ZT4A 4K8RH 3HA0A 3MCLH 1CZ8H 1FRGH 3B9VA 4XNMB 4NIKB 4HPOL 4LBEB 3SKJH 4XPTH 2F74A 3DSNA 5JPMB 4KJQD 3C5ZB 3DUUA 1QVOA 5IFHL 3GMRA 1LO5A 1T89A 3UTTB 4GUPB 4JY4A 1L6ZA 3QIBB 3FT4A 1JZ8A 5J89A 1NQBA 3O6LL 2BRRH 3E6HB 3EJZC 4U1HA 1Q1JH 4XPHL 3JWDL 1F4HA 4C55A 2Z8RA 3C87A 3KS0J 4OFVA 2DQHH 1CGWA 4N8VA 1K85A 4MQSB 1AHWC 1X5IA 5TF1L 4XCCL 1OHQA 1Q9WA 3P73B 4S1RH 4NN5B 1NFDB 1MHEA 1PKQE 1Z9OA 5ID0B 4HFWA 4LLYB 1J0JA 5T1DH 2CR3A 4WUKH 2YPKB 1KEML 4GRWE 5SWSD 1BFVH 3OL2A 1RZGB 2BDNL 4U1NB 3P73A 3JSSA 1IM9A 2IAMB 2QADB 1N3NB 1NCAL 2PTUA 2UWEB 5DZNA 2VXSH 3NACH 1WWBX 3LN4A 4ZSOA 4NC1E 5D7LB 4TSAL 1Q0YL 4HHAA 1UJ3C 1AXSB 1U8LB 1UWGH 3KLHD 5I6XB 4K3JH 5ESVB 4KGJA 2ERJB 4M6AA 2QR0A 1G7IA 1G7HA 1MHHA 4RFOL 5KVDH 5I19L 4TTDD 5F3BB 1KCKA 2Q76A 4O2FA 1MSPA 1I7RB 4BM7A 2FJFB 4ZNCD 2ARJB 1MHHB 4AG4H 2O61A 4YDKL 3HZYB 1F6FB 3ARED 4PJXE 1S7WB 1RJYA 5D5MB 4ZAKD 4M7ZC 2XNAA 5SWZA 5IR1B 1TPXB 3UZVB 1TJIH 3Q5TA 4LSUH 4WHYH 3VXPA 1FGVL 1FG2A 1UCBH 1BLNB 1R3KA 2EH8L 3DWTA 3TO4D 3VFGH 1L9NA 1HKLH 4LKCB 3QEHB 1M71B 1GGYA 4D9RD 4CNIB 1XZ0A 1NEUA 1CG9A 2A1WH 4JO1H 2C7UA 2VXVH 1M4KA 4OLVH 5K33A 4FQIH 3U0PB 1EIBA 4FN0A 4TNWF 3BO8B 3EOBA 4HK0B 1DBMH 4U1GB 2CIKA 4OLXL 4KROC 1E27B 4JRYD 4BELD 2O5YL 3IAPA 5KSBA 1UACL 3B3IB 1BQLL 5AYUH 2VLRB 1OF2A 4P2RA 2GTWB 4TOYH 2Z92B 1MCIA 3KG5A 4H0HB 2JCCF 2P5EE 5CFHA 1KJVA 3IXTB 4Q2ZA 1GGIH 2ADFH 3R06A 1ORQB 1CFVL 1TJIL 1LDPL 5AZ2H 5CILL 3VFGL 3IXTA 3JVGA 2V2TA 5D1XC 3EYFA 4AT6B 1DTUA 5DSCA 2RIKA 1EAPA 4PJ9D 2DQJH 5DRXA 2A6JB 2ZKHH 4L9LB 3DMMB 4W6WB 4WNQA 5D2LF 3EOAA 2V7NB 1A6ZA 4WEUD 1OP5K 3WSQL 1QBMH 3H0TA 3MLUL 4CKVX 4L8SA 5F44A 2Q8BH 1Y18A 3WIIL 3WXVH 4OKVB 3CVIL 1IKNA 2E3VA 1OCWL 4XVSL 5D2NC 1BQHG 1U8NA 4YHIB 1EHLL 4Z77A 1QSEE 4Y4FC 3RDTD 4RISL 1DE4B 3CXHJ 3MODH 4L5FH 4R4ND 3QUYA 4HC1H 3H6JA 3CVHA 3P11L 4Y5VA 5EC1B 1KCRH 5ACZB 5IBTL 2DI9A 4QRUA 1A2YB 3GK8H 1KB9J 1QRKA 5IQ7L 4G8GD 3AS1A 4PG9A 4PRIA 1KEGL 1RY7B 1S7XB 4OD1H 1S5HB 3KPOA 1MFDH 2C3GA 4ZUSA 4XRCA 4H1LB 4U1MA 5CCKL 1FSKC 4YPGB 3BRGC 2HT4D 5AZ2L 1KCLA 4ZUTB 2D03L 4ELMF 2WUCL 2X70A 1ES0B 1FN4B 1NMBH 3AROA 4ODUA 4P2CG 4LRNL 5C0GA 1H5BB 4DVBA 3MJ9A 2FB4L 1N5YH 2OJEA 4XWOC 4YHOL 5E5UB 1T0NA 3CXHK 1AFVH 1QSEA 4IIQA 5IV2A 3SPVA 3HNSL 3PP4H 2IQ9L 4P49A 5I1IL 4UINH 1UB5A 1RUMH 1T0NB 1X4YA 1W2KT 5IM7B 43CAB 2HMIC 5IROC 1AO7D 3BAEH 4KQ3H 3QDHA 4XAKE 1JNNL 3OXSB 4P23A 5C0AB 3F7PC 1GOFA 2DWEB 1BBDL 4U3CA 2ICCA 3DETD 1JHLH 4PRAA 4LSQH 3H3BC 3I6KB 1VFMA 1XGYH 2MQCA 2H9GA 3C5JA 4HW6A 5CIPH 5MP6H 2WUCH 3ETBF 4W81A 4G6KL 1KIRB 3PV6B 4LLWB 3N9GH 3G5YB 2FGWH 2I5YL 1PFCA 2PYEA 4OM0H 4L1HA 4YHOH 4LNRB 1K4CB 2C3HA 2D7OA 3MJ9L 3SKJL 2KPNA 5F7WC 4JFZL 3GBNL 5TDOA 3K8KA 1ZEAL 1DBAH 2EYTB 1TITA 2P7TB 3PWNB 3TF7C 5J0BA 2NY7H 1SJEA 3MNVA 3BPCB 4F8TA 5DJCA 3U7WH 1AGCB 2MWCA 3OKEB 5IW6B 3LKRA 5HGHA 2HKFH 1V3KA 3O3EA 4LPWA 3WKNA 5FEBA 4Y19E 3RUGB 2CR6A 3W39A 3A0OA 1WWAX 2A83B 2A74A 1ZOXA 2YD9A 2VO5A 4CW1A 3CVHL 1U8HA 1F11B 1X5ZA 3GEWB 1A1MB 1KEMH 4KY1H 1NC2A 5F9WB 2B1HH 1KCVH 2SEBB 3ZMRA 4R90H 3ARBB 4QHMA 4CW1B 5L0QC 3QCUL 2KZ1B 4JPWH 5BS0A 4RQQA 1X4XA 1ADQH 5JW4Q 2AJSL 1A1MA 3KPNA 4I0PD 2ED7A 1FZOB 3SCMB 4PGZA 4XMKH 4U3XA 5SWZD 4MJ4A 3P77A 4YDVA 5IG7B 1XGTB 4R97B 2QSCH 1URLA 1LE9A 1YY8B 1V3MA 1GGIL 4H25B 4ZPTA 4HIIA 5C0RL 4JVPA 1EGJA 3F12B 5J7CC 4LNVA 3HAEB 4FZ8H 5IT2H 1YEFL 1J12A 3OB0K 4MA8L 3LIZL 3UAJD 1JNHA 1RZIA 3GRWA 2X4SB 1ZKAA 4KXZI 2K3TA 2N7BA 4JPKH 2JJTA 2Q6WB 1KIUA 4L3ED 4NO3B 3RY6C 4BQCA 1KT2B 3T1FA 1G7QA 5HVHC 5IMLB 2XZZA 4BFBD 3VCLA 5GGRB 3VFTA 4HIEB 4UDTB 4M48H 4KDTA 5I73C 5DUPL 4BFIA 1BZ7B 1P9MA 5B8CA 1C1EL 3OAYK 1FGNL 2ITCB 2VN7A 5ESAB 2C4FU 2X1QA 4V1DA 3FO9B 5MI0C 3SO5A 1UA6L 3D2UB 3TPUA 1CFNB 1RIVH 3H9SA 3X17A 1EJOH 5C92A 3T3ME 1TCMA 2NY1D 4DVRL 1DEDA 1U8HB 3DXAA 3V8CA 5KSVB 3CDCA 3FRUB 4RMSA 1F11A 4MNQA 4EN3D 2H45A 5AYUL 4QXTA 5CCKH 3UAJC 4JFEE 1HHKB 5GGTH 1ZLWK 3HE6C 4WTZA 1LP9B 3HE7B 1JPFA 1F6AB 2EE2A 1MCNA 5FOBA 5D2LA 4AIXA 5GGUA 3CLFL 1YJDH 4U4BA 2XA8H 1P4BH 1DLHB 4PRNB 4U1LB 4X6CF 2ERJC 1FP5A 1GSMA 4O51A 4JPKL 1O5DT 3M8OL 2YHGA 4RGOH 3Q6GH 4XPTL 2BVPA 3CDGB 4YFLF 1L0XA 4M48L 1EFXD 4IRJD 1EMTL 4WHCA 1VENA 4PR5B 4PUBH 1HZHL 3F58H 4YIQB 4MS8C 4KKCC 2QSTA 5DJ2B 1YDPB 3BAEL 4EDXB 3WS3B 2HRPL 3WCYA 4RAUA 3D6GA 4OLVL 2V6HA 3SDXE 2BVUA 1RJLA 4R8WL 1F97A 3DGGB 3QHZL 5HPMB 3MACL 4WUUA 5DQ9B 4YGVA 5TF1H 2OM5A 5EBMB 1G7QB 2WSKA 1F4YH 3DO7A 1OTTC 4YFDB 2Z4QB 3FQNB 2DYPA 4L8SC 1FVEB 4HEPG 3CLEL 1C5BH 3CSPA 4OZHF 4YDIH 4TSAH 1MFDL 4MWFA 3AXLB 2YN3A 1A6AA 1TVBB 2OZ4L 1N26A 4XNQB 1RZ7L 1DN0A 3HC4L 5D7JD 4ZPVA 3DURB 5F7LB 2AI0H 1P7KB 1TENA 2FX8L 4XI5D 1A6AB 1TVBA 3CMOH 1JJUA 2ZCLH 4U1KB 1L7TL 4LLMB 4PUBL 2B2XH 2YD1A 1U8JB 3BE1L 1J11A 1KXTB 4Z78B 4YHPB 3U7WL 2BNRD 1ZLUH 2IH3A 5FOBB 4DW2L 5TPWL 4JM4L 3UZQA 4JPVH 4GKZB 2VJXA 3HNSH 1D3CA 4PYGA 3U36B 4WTWA 1RUML 2VLJD 4O51B 3UPRA 2F54D 2OL3L 3CFEB 1CDYA 1JUFA 2PCPB 3MRPB 2Q8BL 3WDJA 5BO1H 3OXRA 4QTIH 1T4KA 4MDJA 1A3QA 4MXWL 3HUJE 4NZUH 1AD9B 4M6NL 5J3HC 5K59E 3MRPA 3CLEH 1D5ZB 3DVFA 4YIQA 3MUGA 4FQLH 3S8WA 4OV5B 1OW0C 1J18A 1O7SA 4Y0GA 3O3UN 5D7KE 2LE9A 1ZT1A 5FUOH 3BXNB 5KSBF 4RWYL 4G7VL 1A4JB 3O2VH 5CZKA 1XCTA 2ADGB 4R7DB 2CRIA 1NGWA 2VISB 2A6KB 1I75A 4M3JA 4TNVF 1DQJA 2FH6A 2FATL 4P3WA 2OP4L 3SE3C 1FL6B 3WN5B 1XGQA 3LIZH 1VACB 2UUDH 2BY0A 3MNWA 4FQCH 4YBQD 2JB6B 1YEEH 1MCRA 3V5HB 1DQDH 2ATKB 3CK0H 1ZVSA 1NC2D 3EDEA 5E00B 4S1RL 4F7MB 1WICA 1KUMA 4D3CH 4JQVC 4MYWB 1QFWM 4J3VA 5I16B 1NLDH 5LGHH 2DL9A 5D93C 3TA3B 3D48R 1UM5H 5D1ZA 3O8XA 2Q3ZA 3ZT5A 1GH7A 3LOWA 1INDL 4M9OA 1KACB 3L95B 1UKQA 1RK0A 5C09B 2AVGA 4NKMB 1YNTB 3WS6C 4PJEF 1HWHB 4KY1L 4U6XB 9CGTA 4HIJA 5D9SB 1RK0B 5C09A 5I66A 3HZMB 2GFBA 5I19H 1EERB 1AO7B 4ZFFB 2YA0A 4JZJB 2IFFL 2HT4C 1D5ZA 4NJ9L 5FO8B 5GS2D 1MH5A 4JZJA 3ARXA 3VD5A 1PG7X 5EA0H 3KS0H 1ZMYA 3Q6GL 3I9GL 2OXHA 4PY8I 1CL7L 4ZTPH 4DGYL 4FZ8L 1ZEAH 2GTZB 3BKYL 5DRZA 5T1LD 3RWGA 2FBJH 1U92B 2OI9C 1XF4B 4JFPB 5KSAB 2R4RL 3ZDXF 2PO6D 3UZEA 4NN6B 4WHTB 3GSXB 1D5BB 4ZG1A 1RMFL 1NSNL 3MOAH 5IB5B 4R4BA 2R2HA 3WIHA 2O26U 2E27H 3TVMB 4KKCD 1UFUA 1ZANL 1J8HD 2AJUH 1IQWH 2Q86B 1FBIH 3EGSA 4NO0A 3SDDD 1HHGB 5I8OL 2A77H 4QHUA 4OZHA 5IJVA 2X4RB 4HXAL 1KB5B 4WI9A 4PJ7F 3VGHA 3C5ZA 1NC4B 3DUUB 1N6VA 5CEZD 3ARBC 2QHLA 3MV8A 4NKMA 3QWRD 5A40E 1ZGLB 4FQHB 3RRQA 4P2RE 5FGSA 1CL7H 4ZTPL 1BJMA 1I3GH 3R0NA 4PJAE 4U3HA 4HKXA 4QWWC 3GKWH 1UWEL 4Z18A 5IHUH 2FEDC 4OZIB 4L3CB 2DQIL 3F6LA 5F72S 4G8IA 1XGRB 2H1PH 2RHEA 1UZ8A 4MNGB 2CLVA 4NO2B 3VG9B 3OKNB 4LSDA 4U33A 4XPBL 5EOTA 3OX8B 4OCSH 1DBAL 3NABL 2DQHL 5D1QC 1FV1B 5B38G 4LEXH 4IOFD 1FBIL 4NT6B 2PTTB 1QYGL 2Z35A 3QQ3B 2WBWB 4DAGH 4MJIB 1U8OB 4QTIL 2BSRB 2E5EA 3BZEA 3OGCB 1Y6NR 3K80A 4Q9BA 4Z7QF 3QPQD 4M6NH 5EOCL 5D7IF 2VSCA 4QNPF 3AFLA 3IGAA 3HZVA 1Q8MA 2FNBA 3ARRA 5CZVL 1IC5L 3AAZB 4FNLL 4DN3L 4EXKA 3EDDA 1WBYB 5C07A 4PP1C 4HT1H 3GB7A 3ILPA 5K9QI 4OCLC 4MXQD 4PRID 1D6EB 2RCSH 2VDNL 1KULA 1ZWIA 2F54E 3GKWL 3KPRE 3MBXH 4Y2DB 3G6JB 2X2YA 4NO0B 5EO1A 2XTJD 3TIEA 2XKSA 2F8VA 4DOHE 3WN5C 3UTZB 4TULL 3GMRB 3A67H 3EW3B 4JQIH 3QG7H 3QIUC 2RB8A 5BRZE 1GGTA 3CLFH 3AY4A 4AEEA 2FX8H 5FFLA 3T8XB 3E6HA 5JA9A 2C1OB 4S1DC 2IQ9H 5CJXA 2RAMA 4QRTA 4RGOL 5IVZB 5MEPB 3SKOB 1M1SA 4RA0C 1MCPL 1VEPA 4LKXB 2VXQL 3W9EA 2E6QA 3MREB 3MYJA 1F02I 4NKDB 3FQXA 1Q94B 4Y4KA 2YK1H 3K2UL 3SKOA 5HSFA 3JUZA 1W8NA 3ARSA 5JR1H 2GSIB 4MA7H 4KHTL 3B3IA 3B9KC 1ZXQA 4LDOB 1XIWC 2IALA 5DYOB 2AK4D 3MLRL 2LAAA 3QFJE 4KJWD 1C1EH 1JP5A 3QUMA 5F8RC 1LO0L 5CEZL 1IAOB 3ME0A 2OQJA 3K0WA 3QA3A 3RIFK 5DYOA 1LK3H 4PJXA 4GKNB 5T3ZE 1BIHA 4YUEL 1IM9D 4G9FE 4PJIE 1H3GA 1KJ2B 1UH2A 4PJBB 5IMOB 1T66D 3AAZA 1VADA 1RZ7H 3HC4H 3QRFM 1G7MB 5SWZB 1NGZA 2VKWA 1LO3L 2IC2A 1A02N 1VADB 2FJHB 4LCWB 3ROOB 5FHBH 4ONFH 1YJDL 5D7SL 2XA8L 4W68A 4XTRC 3T77B 1HNFA 4PD4J 2DIAA 3HMXA 2DIBA 2UZIL 3IU4L 3UBXI 3WJJC 2G2RB 4X4MA 1INEL 3UC0L 4NQCB 4LBEA 4WEBH 2X7LB 4CMMA 4RFNB 1T20A 4KHTH 3UJJL 3TBWB 3JWDH 1A7QH 2HTLC 1BD2D 3L3GB 4UI2A 5EU6D 2PO6C 5E70A 4CMMB 3ZHKA 2YD2A 4NBZB 5HHOE 2BNUA 5C0ND 4XP6L 1INDH 1UVQB 1YMMA 2AXFB 4OFYD 4NBYB 1UG9A 4Y4KB 3EYQD 1I85C 4QRRD 3D5OF 3EO1B 3GK8L 6FABL 3QHZH 4Z7VB 1I7TA 1VFAB 1JGEA 1Q9WB 2APTA 2RJMA 1MHEB 1T1XA 5H37H 3NFPB 4KPHH 5C09D 1NBZB 1WZ1L 3MLTB 3SE3A 3WIFA 1SEBA 2BHZA 1ORQA 1HE7A 3ZE0F 1B0RA 4N5ED 2D31A 3U46A 1ZLVH 2CDEA 5D6DC 1YPZB 1UWEH 4NSKB 2WBJA 2XWTA 4WY7H 3V4VL 4R0LB 4OKDA 3RKPA 2VZTA 5JZ7C 3VGAB 1EAPB 2DQUL 3HMXL 5FGCB 4TYUA 1KTDA 3KXFA 3HRZA 4OAWA 5BXFB 3LSOA 1QSFE 1JPGB 3QAZB 3O6KL 5ITFB 4MQTB 1T7XA 1UCBL 3FFCA 4MAYD 2DLGA 3TO4B 4OFDA 3LKOA 1YYMH 3DROA 5IOPA 5IVNA 3EBAA 1QSVA 3QAZC 5IB3B 1GOGA 2CSPA 1RMFH 1YZZA 2XPGB 4Z7VF 4HC1A 4OUOA 4BK4A 2X4OA 2YA1A 3SE4A 2YXFA 3RY5A 3N50A 2NY3C 5SV4A 4NHCL 5JXAH 5B21A 1IEAA 4PP2B 1T5WB 2YPLE 4WUKL 3ZYZA 4AL8L 4P46C 2R69H 3VFRA 3ARGD 2OXGA 4F3FB 5HYJE 1NCAH 4HWBL 5J12C 3L6FA 3BZFB 5ICYB 1F00I 1NDGA 1PZ5B 3HCVB 3EKCA 4RZCA 3PWPE 5D71H 2WQ8A 5ISZB 1OSZB 4MHHG 1D5MA 3BPCA 3TCLB 3M8OH 2JK5A 4PJCE 3QRGL 4FP8H 1TVHB 3O2VL 1MRFL 5F7FA 1H8OA 3IU3B 1VGKA 4X4YA 2VDML 2RFXB 3MRIB 1ND0B 4M1CD 4WFFE 3MRQA 4JFFB 3MBEB 1VGKB 5C08B 5FA3B 2D0FA 2CDEB 4NP4L 4P5MA 1TQCB 3DXAD 2NXZD 3Q0HA 5FKPA 1SYSB 4ZS7L 2BP3A 4R0LA 1C5DB 5F9OH 4OCSL 1E4KA 2R4RH 1JE6A 1KGCD 2F58L 3ARPA 2V17L 4JJHA 4HH9B 1BQSA 5F1IA 3ZE1E 5DK0A 1OOAA 1I1AA 4M5ZH 1NEZA 4G8FB 1Z9MA 1Q9LB 1KF9B 2ZUVA 1I9JH 1I1FA 5EFIB 4D8PA 3G9VA 5DK0B 5IKCB 1QFWL 3FN0L 5DMKA 4CU7A 2WIMA 1LO0H 1DDHA 2EIZA 1G1CA 3GSWA 4XB7A 5CKGA 1A14L 3KJ6H 4OLXH 3FQRA 5DZOA 5JNYA 4AMKL 3RVXC 3S34H 1S9WA 4HGWA 4J3OC 5EWIH 4L8CA 3FRPA 1VESA 3K46A 2G75A 5I1HL 3CH1A 3OR7A 2OR7A 5CGYC 5DJDB 3V7AE 4J1UA 1QKZL 1DVFA 2P1YA 4UQ3A 5IHBA 3ARFB 2EYTA 5H94B 3VH8B 3DV6B 3TO2A 3OAZK 2PXYB 4NRYB 1SY6A 5KVDL 4QYOB 1CFSB 1AGCA 1S5HA 3HI1B 3KLSA 3PQYB 3LKRB 3DSFH 4I1NB 1JTPA 3V4UL 4OZ4A 1EA9C 5LQBH 4QYOA 3UTSD 2DQFA 4U6HA 2FBOJ 5E1AA 1TVHA 2QTEA 4XPBH 5BO1L 3VA6A 4GRLC 2HFGH 2D2OA 3OWEA 4GBXC 1ND0A 3LZFH 4KQ4H 1FZKB 4MNQB 1JNNH 4AEIL 3QIUB 1JYNA 1YC7A 1EHLH 4RSVA 5EU6A 4RNRA 1GZQB 5DHXB 43CAA 1KTKE 2AJ3B 4F80A 4PGBA 4F15B 5CEZH 5I8OH 1D9KB 4G9DB 2XT1B 2R1YB 5EU6B 2UYLA 1BFSA 4BSVB 4OM1L 2AV1A 2H26A 1I1FB 4KV5E 5EG6C 4UIMB 3S3SA 4Q6IA 1RAMA 4LMQI 2P8LA 3LD8B 1EEYB 2F9BT 4G9DA 4X6FA 1M05B 3G5XB 1JWUB 4OD1L 3KVQA 2Z8SA 2V9QA 2VH5L 4PR5A 1BFOB 5DK3A 5L2KD 2VAAB 5JQHC 4KZDH 2EYRA 4LHQB 1S7UB 3QQ9C 2I9LA 4MS8D 5D93B 3MOBL 5HDQH 3CH1B 2VAAA 2PUQT 3BPNB 4ONFL 3L3IB 4U49A 1EBPA 3G5YA 4ELMB 3BH8A 5JPNB 3F5WB 5I8EA 3KPQA 5CJOH 1FAKT 1ZHBB 4JQVA 4DQOH 2HYMA 2ITCA 4JGJA 3IKCA 3NCJL 1IE5A 4AEIH 2VOTA 4M00A 1T7WA 3QO0B 1KLFA 3FHAA 3SKUD 3IKCB 4QKXB 2VL5B 1BF8A 4M93B 4QRSB 5DEGB 4U1SA 3SN6N 3FT3B 2C5DC 2I9TA 3MLRH 4MXVE 4YFLI 3P4OB 4G6MH 4NCDA 4FFVC 4NUGL 1MAJA 4HMEA 2Q76B 4O2FB 1CICC 4DTGL 1IT9H 4WFGD 3JUYA 1RJYB 5D5MA 4LLMA 3UYOD 1IC1A 4ELME 3LN5A 1F6LL 3TM6A 4WEMB 3QRGH 2IWGA 2FWOB 4FP8L 3VXPB 3QJHB 5B22A 1EX0A 2QQKL 4JB9L 3HE7D 3QEHA 4QRQA 4XBEH 1XZ0B 4I8DA 3N9GL 2D03H 1FFOA 3PE9A 1RUPH 1N5AB 5JW5A 3L3KA 1HYSC 4UIMA 5FHBL 1DUZA 4PJ5A 3FCTA 4QRQB 2ITDA 1R24A 2AQ3A 2MFNA 4ZXBD 1KB5H 1UM4H 1KG0B 1FHGA 4NN6C 3GBMH 4NYLB 3F12A 4TRPL 3S96B 4ZO7A 5KJRH 1PKOA 4YHZH 3TT3H 5J3HD 5KANG 2VXUH 3TZVC 4WUUB 5ITBL 3IAQA 5DEZA 1A7OL 2VSDA 4ZFZA 5HI5C 2BDNH 4ODXB 4QOKA 2HN7A 4QHNB 2V5SA 1QFWH 2ADGA 3U0TA 5LVEA 3IDMA 2D7QA 4Y16B 3VFPB 4PRHD 4WO4B 3WO3B 5EU3B 5F96L 4GAYB 4YX2L 2XWBB 2X4NB 4QHNA 5FYKH 1EJOL 1YC8A 1MAML 2R39A 1DBKH 3QO0A 3DURA 5E8PB 1JZ3A 3L5WB 3DRTA 1ULVA 4MJ5A 2X1OA 5IB1A 2AJSH 1EZVY 2ATKA 1FFNB 3ARDD 3AMKA 2R29L 3V6OE 1KELH 1UENA 3O4LD 2ILLA 4IJ3C 4YDKH 1DUYA 1MRFH 4G6AC 1KJMB 5FCSH 3V4VH 5HVWA 1RI8A 4QXTB 2Q7YA 4QCIB 4YK4C 1MUJB 3T0EA 4FQ2L 2RR3A 2VXUL 2CLRB 1O7VA 3QJHA 3HPLA 2E8ZA 4MGXA 4O2CA 1G7JB 5D9SA 1OB1A 4YHKL 4RX4A 1R3LB 1QBBA 4WENB 5D1ZC 4ZUSB 3RNQA 1S5IH 3IDGB 4G9FD 4K7FA 4R2GD 3S35X 2WNGA 1RZFH 1AY1L 4P5KA 4WCYL 1MRDL 3VFMA 5IB4A 4BK5A 1NAML 2BNRB 4RCAA 1H5BA 5D1QD 2YD4A 3OAUL 3VFOA 5EUOA 4IOFC 5ETUA 4X9FA 4I9WE 1VSCA 4XCYB 5CBAA 1DL7L 4KZDL 2GI7A 5EOQH 3TV3L 3PGFH 1CLYH 5SX4I 5C0AE 4X8JB 5L8KB 3WFDH 1M6OB 4R0LC 1ZVSB 2HVKA 4JFXB 5F9JA 5GSRB 4Q0XH 3V5KA 5I6XC 2ZSWA 5HGAB 4AY0A 5D1ZD 4AH2A 4POYA 1YPZF 1PYWB 1RZKL 1KIQB 4JM4H 2NZIA 1YECL 3DX9B 5E6IB 3HNVL 1C7SA 3BP4B 4LLQB 3FOLA 3CVIH 5IEHB 3STZA 1OLLA 4PB0H 3X14A 2V17H 5HYFA 4UOW1 1YEHL 2J88L 1BMGA 1NC4A 2J4WL 4XCCH 3D2UD 5E6ID 3V4PL 5T1LA 5MHSD 1W8OA 4LLUB 4GKZA 3U83A 5GS1B 3MGOB 1N2RA 3WFHB 4EZMA 2YWYA 1Z5LB 3F62A 1DQMH 4DFIA 4WGVB 4PJCA 3LEXB 2EIEA 2IG2L 4RIRB 1VFOA 2NLJA 3PWVA 3RY4A 1I8LA 4HUXB 4OM1H 4GG6B 3NMEA 4RMRA 4LRNH 3GMQB 3QWOB 3GSUB 4Z7UA 5I71C 2IAMD 4NDMB 4EI5B 1ZTXL 4NQEA 5DA0B 3EOTL 4FFZH 2IANA 2VR5A 3UC0H 2FATH 2JJSA 3WD5H 4AJ0A 3TBYB 1YECH 1NGWB 3EDKA 4EOWL 4FQCL 4FTVE 3X3GH 3OKOB 2HJLB 2Y06L 2LABA 1NGXB 3SE9L 1MLBA 4X4XB 5ACMA 3D25A 3QQ4A 1F3JB 5DC9B 5HI3D 1YY9D 1I1CA 4XP6H 4J8RB 4DQOL 1NLBH 2HVKB 4MMXC 3H3KA 4NWUL 4K3EL 2AK1L 5F9OL 4ORGB 5K9OB 1RU9H 5E00A 3D85B 4XTRD 4FNLH 4YO0A 4DN3H 4HK3J 2IG2H 3K1DA 3FOLB 4KUCD 3T2NH 4U0RB 2X4QB 2IANE 4JN2B 1GZPA 3O3DA 4A6YB 1U3HD 5E4EC 2HTLD 3E2HB 3EYOB 4IMKA 5E2TH 4QGYA 1WQVT 1QFOA 4JQIL 2EDTA 2FDBP 1GGBH 5T1MA 3U6RA 2PO6A 3OZ9L 1EHNA 1P7QB 1JPTL 3KPSB 3QXVA 1QKZH 1XGUB 3PIQA 3LEXA 1TZIA 5D1XD 1CZ8L 4XT1C 4EI5D 1OGAB 2XQYG 4Y16C 2JIXD 1JYVA 2FL5B 4GG6F 4OB5L 2OP4H 3LV3B 2BCKA 2BMKA 4GBXB 4OF3A 4PJBE 2Z35B 3VFWB 3GMQA 2CD0A 1JMZA 5EZOH 1SJXA 3BE1H 3I50H 3TA3D 2ZKHL 1CCZA 3GUTB 4TRPH 3ULUD 2BFVH 1HXYA 3QZWG 3D87B 3WSQH 1Q1JL 3MLUH 3U4AA 1H3PH 2OQJB 1H5BC 4NHCH 5JXAL 1KXQE 1OY3B 2CK0L 1BFTA 3TZVA 4OGAC 3GJEA 1IQWL 4JREC 3MRFA 1LP9A 2P44B 4AYFA 1NBVL 1MRDH 4KMLB 3BP7B 1D5BA 4X4ZA 2KQMA 2EDWA 4J12A 4JREB 2ZOLA 5H2BB 5JOEA 4OZFH 4FQLL 2C3VB 5BVJA 1TZHA 3C6SB 3EGSB 3D85A 2DICA 5KS9E 3O9WC 2GJZA 2DM4A 3HAEH 2ZOLB 5H2BA 5EU7E 5EU4B 5HHMD 1QVOB 3P4NA 1R3KB 4J4PA 2X7LA 2X4RA 5MENE 1I3GL 4LP5A 5I17A 3QUKB 1P6AB 3QNZB 4UT6H 5EZIH 4LKXA 4L4TA 1BJ1J 3ORJA 4OIBA 4OF7A 4Q0XL 5D1QA 3W0WD 2Y36L 2HJKA 4X6BA 2YPLB 3MZGB 1FNEB 4DOHB 2CIIB 1ITBB 5EC2A 5JHDB 1X5XA 2NXZB 2ZZUT 1MWAB 1AXTH 3MRGA 2ESVD 1FGVH 3CAFA 3I6GA 4NZDA 5DURB 3WIHL 1IM9B 5LG1A 2QSVA 5CLWA 2GT9A 2X10A 3LV3A 3GSRA 1I8KB 5E6ZA 3P9LA 3QA3B 4YH6A 1AXSA 2A6IA 1UA6H 1F4WL 3QO1B 3KR3L 3EJJX 3VXQA 4DGIL 5I1HH 5JIIA 1KJ2A 3QQ3A 4PJBA 3QZWA 5IMOA 4RFEA 4RDQG 1EHAA 3GMMB 3QPQC 3D0VB 4O00A 4G43A 3PGCB 1I7UA 2ARJA 2Q8AH 2IH3B 1TVDA 1VFBB 4LCWA 3ROOA 3W2DL 2FECI 4HUVB 3DV4B 1MCWW 3WNKA 5JLZB 4PJDA 4D9RE 3RVUC 3FO0L 2YA2A 4EUPB 1YEDA 4HS6B 2AXGA 3S3PA 5CIPB 2P5WD 2WWMC 2Z31C 3QDJE 2FCBA 3TBVA 4F7PB 2PR4L 3CVHB 4BH7B 4X98B 5E6YA 2KQNA 1XR8A 3MRNA 4GMTL 3RY6A 5TH2A 4NZTL 3THMH 4NQXA 2FLBT 2BVEA 2R1XA 3ULVL 4M4PA 5ABDE 1IMHC 4Z7WA 1JGEB 4PLOB 4N0RA 4PJ9C 4PJEB 3JV6B 4NQXB 4OTXL 3CX5K 3O4LE 5BW7C 5BZDB 4JHZA 3UPCA 1AY1H 1BEYL 3HUJB 4PJAA 1NAKL 3U46B 5I8CB 1ADQL 5FUZL 3FL7A 3GSOA 1HN1A 4MLSA 3MV01 5C2UB 3EYUH 5GGTA 4WHDA 1P69B 2AEWA 5GGVY 5EPMA 4FMFA 4NM8L 5D70H 2W59A 4NWTH 4APQD 4G6JL 1I3RB 5J9PA 1MHPL 3X3FL 4I5BA 4FABH 2IBGA 4OAWB 4HG4K 2VDLH 3LAFA 2XKNB 2B2XL 5DRXB 3X12A 3W5MA 3TO4A 1GIGH 4M7JL 5D2NB 1ZHNA 1YEFH 2CLZB 2ARJQ 1NKOA 1ZK9A 2IAND 1PZUB 4ZS7H 5F97E 1HHHA 5EBWB 1N5YL 4NN7B 3X3GL 3FAXA 1G7MA 3BPLB 4X7TB 3EFDL 4RFNC 3ULVH 4N0YL 3NVQA 4P4KC 5E8NA 4D94A 4LEOA 3LN9A 1TQCC 4PP2A 2OK0H 1YEHH 2J88H 5C0CD 1QYGH 4HQQL 2UWEF 1FGNH 4YHKH 3U9UA 1IT9L 3KPSD 2YUWA 4UAOB 3TGXA 4K94L 3LDBB 4X98A 4PG2A 4AMKH 3S34L 1I1YA 1NFDF 5D1XA 3KLDA 1S5IL 5HYQB 4IBLT 4IEFB 4UTBL 4NM8H 1MRCH 3MNZA 3P4MB 5E0QA 5EU5B 2WLZA 2Z91B 4F7EB 1T7ZA 3RWGB 3GSNA 1OTUC 3RIFF 5J12B 1T04A 1R0AL 2R2EA 5KSAA 1HI6B 4CVXA 2ICWB 2FHCA 1MVUB 3FHQA 3I75A 4W70A 5LXGL 4WGWB 1LQSR 3D85D 1IGML 4R4BB 4FFVD 2B5IB 5D8JL 3PGFL 5DQJA 3REVA 1S7QA 5LQBL 4GLRI 4PJ9B 3RTQA 4GKSB 2YRPA 2AJXH 4S0SD 4NSKA 4OJFL 3WUWB 4I5BB 3KYKH 5HHXL 1OVZA 3SE4C 3QI9B 2DM3A 3DTXB 5IJVB 2I25N 4WEBL 5DMGC 2WIIB 3IDXH 1LD9A 3T2PA 4EDWH 3VH8G 5BXFA 5DMKB 1H3PL 4PJ8D 5C0FB 4NWUH 3QI9C 3OPZL 3PWLA 5B39B 2PKDA 4PB0L 1F4WH 3IFPB 4Q74A 5I8KH 4X7TA 5F3HA 4M7KH 5C0FA 3DXAE 1OAYL 2Q20A 4PY7A 3PWPB 2C1PA 4HUWB 4JPIA 2OMBA 2FO1A 4N90E 3QCVL 5CD3A 4YHYC 2B1HL 1CTNA 3MUY1 1YEGL 1HQ4A 3W2DH 5D71L 3JTSB 1CFSA 1MFBL 3HI1A 2K9UA 2IAMC 5I8EB 1I1YB 3MRKA 2AI0L 1GC1H 1JWMA 3FQUA 3REWB 3VCLB 5F9DC 3MOBH 5DJCB 4LK4A 3F7YA 4U0QB 5EU5A 3CDFA 5HGHB 2W0FB 1IGTB 3QUZB 3DNKA 3BKJH 4B50A 1TZGH 3CUPB 5CMAB 3Q6FB 3ZSSA 3C5SA 3O6LH 5LGJB 3CFIC 4YC2B 2DLEA 3MOAL 3W0WA 3CPLA 3DVNB 1CDIA 4ELKA 3PJSA 5C0DB 2BXYA 4JKMA 5BZWA 1INEH 4P4KB 5AWNL 4JKPH 2Z31D 2OL3H 3ZTJG 5MI0B 4JGMA 2ID5A 3O4OB 4IOIA 4URTB 5L2JA 1HK6A 1GZQA 4PRPD 5F9WC 3MUJA 2AJVL 1SYSA 2YRLA 3BIAX 2AK1H 1BFVL 3NA9H 3BFOA 2P5EB 1FZOA 1CN4A 2R1YA 4GAGH 4NUGH 4GRLA 4KK9C 4YEFA 2RBLA 4HJJL 3VWJC 3NACL 1JHTB 5F1IB 1IRAY 5JIHA 1YEGH 3GIZH 3QG6B 2BNQB 1U3HC 1MFBH 5E95B 1FFOB 2BOBA 1F3DJ 1I3UA 4K3JL 5D70L 3OKYA 1Z9LA 5C8JA 2XFXA 4CADB 3L3IA 1G6VK 4S1SH 4YEEA 5CD3B 5FV2A 3PL6D 4P2OA 3TVMD 4KHXL 1DVFC 5CLTA 3HR5A 1N7MH 4JRYA 3OR7B 1P4BL 5DJDA 2GSGA 1MREH 2Z9TA 1OQOA 3GBML 4UQ3B 1XIWB 4TUOB 1PKQA 5K9KB 2EXWC 2EXYD 3HPJB 4E41A 5DHVH 1MFAL 2V5RA 2NXYB 3LPWA 1DSFL 1IC7L 4NP4H 3O6KH 5CEXA 4R3SB 3ZSTA 5DT1L 2Z31A 5JW3L 4ZNEA 4WVRA 5E8EB 4QNPE 4XCFL 1D9KC 1U9KA 4F58H 2HT2C 3H9SB 1ERNA 4R3SA 1NGQH 4K7PX 1W0VA 5F96H 4XNQA 1DQTA 4ELKB 5T3ZD 1BWWA 5GZOC 3ARDB 1L7IH 3LVEA 3TFKD 2XOTA 4W4OC 2YZ1A 3MBXL 4XNUH 5KAQF 1BD2A 5LWYL 1B3JA 1X5HA 2X1XR 1ZTXH 2XTJE 4MNQE 2ZG1A 1KELL 2NX5E 1UJ3A 2DBLH 4NWTL 4P9HH 4WV1A 2AJ3A 1J0KA 3H9SE 4PY8J 4UUJB 3SDXA 4Z9KB 1CDJA 1OTUD 2HG5A 5J1TC 3RDTA 3RBSA 1NKRA 3RKDD 4I2XA 4UBDD 1X5YA 3T1WA 4WV1B 2DM7A 4JY6A 2VDMH 5HDQL 4G8GE 2WUBL 1ONQB 5JORA 3WDIA 1YMME 4NUJA 5C8JB 2NX5B 3O11B 1AD9A 2HWZH 2P47B 2YK1L 4JKLA 4JQXA 5EU6E 5DVKA 4LLAA 1ACZA 3UP1A 2I9LB 1A6WH 4FOMA 4BJLA 1I9RH 1FQ9C 3MQIA 4QXWA 3UTTE 2BOCA 4B7LA 2IAMA 1FYTE 3TLRA 5IFAL 1CDCA 3WIIH 3WXVL 2GEEA 2KDGA 1AGBA 4JCMA 5E5MB 1E0OB 3BGAA 2VLLB 3FFDA 3EZJB 2GW5A 4GAFB 1J87A 4Y4FB 3GKZA 4PJ8C 2A6KA 4WI6A 2BC4A 3MODL 4L5FL 5J8OA 2XN9D 4X6DA 5LWYH 5MERA 4JM2A 4R96A 2BHUA 1CLCA 5BMFH 1H9VA 3KLHC 3B5TA 5L9DH 5I30L 2V7HA 5FUZH 5FHAL 3V8OA 1B6DA 1JPTH 4YWGH 2DDQL 2ZSWB 3RWHA 5EOQL 2BY3A 4GW1A 1ZLVK 2O5XH 1AXIB 4RMUA 1N4XL 3LY6A 4PGCB 4N9GA 3WFDL 4L3EB 2EDNA 4NGHH 3GO1L 1BJ8A 4Y4HD 1NMBL 4DZ8A 4F9LC 4PRBB 1F58H 2W9LA 1JTTA 4ZNEE 1YQVL 3BKJL 3KPPA 2VH5H 5HI4D 3WNNA 1E4XH 3O4LB 4DUXA 2VR9A 3KNBB 3VI3F 4M3KB 3G6JF 3OKMB 4R4NC 4X5WB 3RPKA 3VGGA 2PCPA 2AJXL 1A7RH 1OAUH 2VLJA 2HG5B 3RQ3A 3T4YB 5FB8A 3GIVA 1M7XA 1LP9F 4UOW0 5IW3A 4PREB 3VFRB 2BNQE 2IF7A 1J0ZA 1TLKA 4H0IA 2NY5C 2OI9B 1JGDA 3LKQB 1NJ9B 1ZHKA 4JFQA 5D7IB 3O6FD 4H1LA 3IB4A 2MCPL 3INUL 4LCCA 5L9DL 3FAWA 1UC6A 3LMJL 4WJ5A 1P9MC 5GGRY 3PG2A 1T1WA 4MZ3A 3T2QA 5BQ7B 3WO4C 2GQHA 2VLKD 2W92A 1KJVB 5E1HB 4P5MB 2NY6D 4X4XA 3UDWC 2VERN 2IMMA 2VZVA 5GSRA 3V5KB 3JWOL 5F21B 1G7PB 4OM0L 1HKFA 2C4FT 1MCEA 5E4EB 5I1KH 5DXWA 1YY9C 3FN9A 1MREL 4HDIA 5DDHA 4WNQB 4Q9QH 5C0CE 1C08B 3QP3A 3V5DB 3KYMA 2E7LC 4JDTL 1T2XA 1TZGL 1VPOL 3P0VL 4Y2DD 3QXTA 5SWZE 3WIHH 1CD8A 5KOVC 4KKBD 5FF6A 2A73B 3ULVD 3V5DA 3KYKL 4C59B 2EIZB 5AUMA 3B83A 1C5CH 1HOCB 2IBZY 1GOHA 4I0PA 3ALXA 1X6NA 3QUYB 1JF6A 5GS0L 4JGUA 3U4BH 3AGVA 3SDCD 4Y5VB 1FO0B 4BH8A 1T7YA 4K71C 3TT3L 1T7VA 2QL1A 4OUUA 5I66B 4Y1AE 1A7OH 1NCUA 3TPKA 2CDFB 4AL8H 5DTFA 1L7IL 3GIVB 1WZLA 4C4KO 1HCFX 4KAQH 5IUSA 1P7QD 4LLVB 4PREA 1QRND 2GK0A 5E2TL 1TJHH 2CDFA 1JF5A 4K94H 1A1NA 5EBLB 3SDXF 4LARL 2OCFD 3CFCL 2B39A 3VFUA 2XY1A 2N1KA 3AREB 1DBKL 4WFEE 2V5YA 4KKBC 4U05A 5E9DA 1TTUA 3FRPG 5GXBB 3OKEA 2CO6B 2GTZA 1WUNT 3TV3H 4PTTA 4IIQB 1Q9OA 1WZMA 4M6OL 1ODAA 1LO3H 3C60A 4ZQKB 3BPLC 3ARGB 4FFYL 4KHXH 4WI2A 4OZHE 3A6BL 5IFJA 4LPVA 1LEKA 3HI6H 3WFBH 1RHHB 5INDA 4GMTH 3I50L 3F7RA 3HC0A 5IROA 2OS7A 5HHNB 5ESQB 2YN5A 5C0NC 5KG9A 3GI8L 4FHBD 3ILPB 4PGBB 3WYRA 3KPNB 5HGAA 5HYJB 4AH2B 5KJRL 3FMGL 2H9GB 3ILQD 1J05B 3KPMA 3G6JA 5EO1B 4E9LA 5AAMA 5I75C 2I60L 4OBRA 4NNYA 2DN7A 1T22A 4PJHF 2WWMD 1R5VB 3X14B 5CZXC 5ANMB 3VJ6B 1IC5H 1CE6B 4LPXA 4M7KL 2BNQD 1A22B 5J13B 2H8PB 4PRHB 3S37X 2FH8A 5C6WH 4OSUL 4H8WC 3I6LE 4XNXH 5J56B 1CFQA 3HG1A 4L3CA 4QRPA 3RA7H 4G8IB 1OGAA 5MP6L 3W9EB 3SBWA 3FT2B 1GIGL 1UZ8B 5EO9A 3VFNA 2E9JA 5I1AB 3WS6A 1MWAA 4TULH 1T1YB 3D3VE 4XX1G 5DQDH 4OF0A 3UJTL 2X41A 2PETA 3ILQC 3BN9C 2IH1A 3GI8H 3VW3H 2V9TA 4JAMA 4M43L 4NFDA 1QO3B 1YEJL 5JXEC 4I18B 2A74B 1SHMA 4NDMA 1AXTL 3SJVE 4EI5A 2I27N 1UM6L 1HILB 1HZHH 3VRJA 3AC0A 1YN6A 3BP6B 4KQ4L 5C0IA 1IAOA 2J7LA 1BOGA 3DX6A 3NCCB 5DT1H 4XAWL 4U1IA 4GH7B 4H5SA 2K7QA 1A7BA 4XCFH 2MCPH 1KYOJ 2EO1A 5IHZB 1I4FB 2FIRT 1BOGB 3X11A 3IDJB 1PLGH 4DGIH 3SCMA 1U3ZA 1YEKL 3QBTB 5DFWH 2YWZA 1JF1A 4LHJB 4OSUH 4BUHA 5IBLC 5E4IA 1FJ1B 1U8PA 5A1AA 3CFBA 4TUJA 4JRWA 5CUSH 3B9KD 4XCEA 5BVPH 1QR1B 1C5BL 1OGTA 4X0KA 3LQZA 3WNLA 1NAMH 3T77A 3MX0A 4I48A 4IS6B 4Y1AD 4YR6A 2R4SH 5D1QB 4NQCA 3T09A 1OGTB 2AQ2A 4QRTB 4X0KB 1RVFH 5I1KL 5AEAA 3BEVB 1RZKC 2X4SA 1OP9A 1GYAA 1CD1B 2NY2D 3O45A 2J12B 5GS0D 1WFTA 5GGSA 4EIZC 1P53A 4P3CL 3T2OA 5IHLB 2VUYA 4PJDF 3RPIB 3NIFE 5T1KA 3OQ3B 5A2FA 1UM6H 4M8VA 5GGSB 3WO4B 1ZGLA 4QTHA 1RUKH 2AK4B 4Y16A 3VRIB 1C5CL 4PLJD 2CDGB 1TZIB 3DYPA 4D9LL 2P8MA 2IALB 1QBLL 3S7GA 2X4NA 1VFAA 3B9DA 5E8OB 1NMCB 4PRDA 1VFUA 3G5VB 4OD2A 5IFAH 4OZGE 4M61A 3OB8A 4RFEB 5JW3H 4OQTA 3HNTL 2P5WA 3RVXD 1QACA 4LASH 1KIPA 4P4RB 2WZPD 3NPSC 5BVPL 1NAKH 4M8QB 3E6FB 5TDPA 5GS0C 1ROWA 3OSKA 3O6FA 1XT5A 4CVZA 5DHYB 3QDJD 1A9BA 4LSRL 2ESVB 2R1WA 2DDQH 3JXAA 3VD3A 4HLZH 1Y6MR 1UADC 5HD8C 3VRLF 1F90H 5GISL 1IM3B 3RWEB 2AXGB 2BVPB 3CDGA 2ESVA 2YZ8A 1JN6B 3GO1H 2G2RA 3L5XH 4M7JH 3FO1A 5TE6H 2DBLL 5IWLC 3C6SA 4CMHC 3E1F1 2AV7B 5LJYH 2Y36H 3HLAA 5E9DD 1BQHA 2DKUA 1QUNA 4BSJA 1QBLH 1I3VA 1EV2E 1BX2B 1VPOH 3FTGB 3P0VH 4PYHA 3QUKA 4N0UE 5HHMB 4EOWH 2EDEA 3MFFA 1A6PA 3VFMB 4LIQE 2ICEB 3OF6D 5IB4B 1MFNA 3LKPB 4F3FA 1ETZA 3QHTC 4HQQH 5HDBE 3PV7A 4X7SH 3P9WB 2ICEA 1I9RL 2DYPB 4HXBL 5B4MD 1XCTB 1DQLL 5DI8B 1KC5L 5CBAB 1OSZA 3QXDB 4PIRF 4OLZH 4WRLA 2CK0H 3NFNA 1HDMB 2HLFD 2BSTB 3VXNA 4ZODA 4LSRH 2IPKA 2OTUA 3TNMA 3G5ZA 5H35A 3G5VA 1F4YL 1F90L 5GISH 3GSRB 4LCYA 1WBXB 7FABL 5FGBC 4LF3B 5BMFL 3RA7L 3REVB 2D7NA 5D7JC 4PJ9A 3BIBX 3QQ9D 4W4NA 1J10A 3B5HA 3FQTB 1N7ML 2N4IA 4X6DE 3DECA 3B2UD 1IGFL 3NA4A 4XHQA 1HHHB 3IDIB 4Y5XA 3C6LB 4HPOH 1HHJA 4YHYB 3MXWL 4PJHE 4M43H 4OI9A 1P4LB 1S7SB 1YEJH 3RL2A 2BSED 3NFSH 4ODTH 4LLDB 3CU1A 3HI6L 4LGPB 3WFBL 2CQVA 4LHUD 2VZSA 3WFHA 5IKCA 3PGDB 4MQXD 4V2BA 2VQTA 5J11B 1Z5LA 1UT9A 3QDGB 4H26B 3ECBB 5DD6B 5KS9B 5ACZA 2Y5TB 1A2YA 5FUCE 5I8KL 1HWGB 1FFPA 1T1ZB 5C86A 1YEKH 2VWEE 1LE5A 2DL2A 4BH7A 3B2UC 2Z91A 4NQEE 3VGAC 1EAJA 3TO2B 2NYYC 3WXWL 4YPGA 3C2SA 1CGUA 5C0CA 5JW4R 4U31A 4Z0BL 4WFFD 3LHPL 5L7XH 2Y4SA 1FSKB 1MPAL 4ODUB 5A16B 1MEXH 1ZT7B 1V7MH 4DJMA 1CF8H 3KJ6L 1WBZB 4XNZB 4F9LA 4I0KA 3OKOA 4OZ4B 5T5NG 1XF4A 1FPTL 5HY9A 1W72L 1Y0LB 2WV3A 5CMAA 1IBGL 1AIFB 4BFEA 1U6AH 4BFGA 3O2DH 2XACC 3RTQB 3G5ZB 7CGTA 4P2OC 1AGEA 3NFSL 2HFFA 4ODTL 5HHQA 3MRLB 4H0GA 2H1PL 3MRRB 2ADJA 4NCC2 5IMKB 4HH9A 3TN0C 5J9PB 2I07B 3TH3T 3TYFA 1UM4L 2DOCA 4KKLC 2GUOB 4K8RC 4HV8A 2ADJB 4P0DA 4JKPL 4YNYA 4E5XA 1MJ8H 2R9HC 2XRAL 2GJ6E 3L95A 3OGOE 4LCIL 3VA2C 3X12B 2LFGA 1D5XA 5TFSH 3T3PE 4Z95L 2P5ED 4PLJC 5DMYA 5EORH 4HV8B 3I6KA 2UYLB 2LU3A 4Z7UE 3WXWH 4NZTH 5ILTH 4WI7A 2NW3A 4DCQA 4L8CB 1ACYH 1DQML 2IFGA 5BRZA 2EZ0D 4YWGL 2E6JA 2XN9B 5ID0A 2H2SD 1K8DB 4CRPA 2O5XL 4LEOB 1MHCA 1FNAA 1KLGB 2DAVA 3TWCH 4JLRA 2GSGB 4APQB 5E08L 1JK8A 1C8PA 3MPCA 3MA7A 4S1SL 4MCYB 1R0AH 4FFZL 3M17B 4KV5F 1XGPB 1WAAA 5E6IC 3MNVB 3WEXA 3ZE2F 5IB2A 1IQDA 4JFPA 2X4UA 4MCZB 4UT9H 4EI6A 5B3JF 4MSWA 3C5SB 2WBKA 3Q3GB 4FABL 3MA7B 1EBAA 3GMPB 4X6CB 2Y06H 3SE9H 2WQRA 3O3EB 5F7YC 5EA0L 4NKIH 3RZCB 4ONOA 4PGEA 1T04B 4J7RA 2EDYA 4HJGA 2G9HA 3GSNL 4FFYH 1AQDB 1NFKA 4PP1D 4O9HL 2EZ0C 3ZO0A 1ED3B 3DPBA 3SQBA 2I9TB 3RGVD 5FM5M 3MRLA 2QSQA 3QIUA 5HHOD 1IGJA 1ACYL 4Y4HC 4C54A 3EFDH 2Q1EA 3IDXL 3UYPA 1B2WL 5GRVL 1NSNH 2EDKA 3THML 4JFYB 5C9JB 3FB6B 1B0WA 3HTLX 4ZUVB 5HDOA 4ZAKB 3QI9D 4A2MA 1NANI 1PBYA 1HSAB 1B90A 1RFDL 3QCVH 1LO5B 3BZ4A 3PWLB 4G6ML 4GJTB 1E27A 3DJ9A 2W0KA 2AEQL 1DUZB 4PJ5B 5IQ7H 1XMWA 4GKOA 1YMHA 3BP5A 1OARL 4F37K 4UT9L 2G5RA 4NKDA 1MFEL 1U8IB 4Q6YA 2GHWB 1QPXA 5A2KH 5HYSB 4EVNA 3BH8B 4TUOA 6CGTA 5J6GA 5EO0B 3K2MC 3KPQB 3UTSA 3X3FH 5HXMA 1U8IA 5D7IE 1S9YA 4DUVA 2JCCB 4TVSa 4OIIL 4LP4A 2HWZL 4YDJB 3VWJA 4KTDH 2XA3A 4NN5C 4UMGA 3FB5B 3DLQR 3M17A 4AM0B 3HE7C 1WV7T 3CZJA 4WWID 4Z0XA 2JLLA 1YNKH 1QQDA 4MQ7A 5HHXH 4ZYKA 5AWNH 4PJXB 2E7CA 1GGUA 3LCYA 4JKKA 1RK1B 4MNQD 4EN3A 3P4OA 3NZHL 3L5WA 4IMLA 3ULUF 4AEHH 1NBVH 3V4PH 1G7HB 3K7UA 3KJ4B 5C0BB 1I8LC 1TJHL 2BY1A 5JOPE 3S5LG 3BEWB 1IZJA 3LKNA 4NPYA 2OJZH 1T89C 4LSQL 5CSBA 4XNMA 1ZA6A 3GIZL 3QXAA 4FQQA 5IW1B 1EEZB 4WI8A 2N56A 1CQKA 3PQYD 3GHBL 5EC1A 1WZ1H 3SDCC 3L7EB 4GRWH 4JR9L 4FQQB 5F6IB 5IW1A 3CIQA 5MEPA 3A6BH 3BPOC 5GGQL 3W81A 5LKNA 2ITDB 2X09A 2UVEA 3VXRE 3WHE1 4NUJB 2DLIA 4MD5B 4FFWD 3BZ4B 2IPTL 3ZE0E 4U1MB 2R29H 4NYLA 1Q94A 1RVFL 5TE6L 5DF0A 3VI4E 5IJKC 2XV6B 4ZUTA 5ICXA 4KRPC 2NTFA 3WS3A 3CMGA 2XFXB 4JDZB 4PRHE 4LCCB 5JMOC 1BJ1H 1AKJD 3H7LA 5ANME 4DUWA 4KJQC 1U58B 5KSBB 3HR5B 1G0DA 1AH1A 3UTPE 5A3ID 2R2BB 5BQ7A 2M2DA 3MV9D 1MCBA 3LN4B 4ZSOB 1BIIA 3AB0B 2P48B 4X7SL 3VGBA 3LMJH 4GKNA 4Y19D 4XCYA 5E8PA 1KC5H 3W11C 2JIXB 3NN8B 5ECJE 3LKSB 1QLRA 4HUMB 4KJPD 1M6OA 3IF1A 2R69L 2EE3A 4HDIB 4HJJH 1R3HA 3GHEH 5I1JH 1ZHNB 2IJ0C 2XTLA 3TJHC 1MPAH 1KJMA 5BJTA 5DSCB 2NNAB 1OM3H 3BWUC 4YUEH 1KFAH 1R3HB 3DX9A 4Y2DC 2A9NH 3FJTA 3T0XA 4HZLA 4BQBA 2GY5A 1RV6X 4LVHB 2QSCL 3H0TB 3U30C 4PD4K 3VW3L 4Z76A 5C0BE 3T04D 3SKMB 2CRMA 1HQRB 5C0RH 2VLKB 2C4XA 4OCRH 1IL1B 5FCUL 4YLQT 1SJHA 2PR4H 2F53A 3IDYB 3JTTB 5D7SH 4F9PA 3SDXB 4HCRL 2UZIH 3IU4H 5DR5H 1V05A 1PGRB 5F7MC 2CIKB 1CXFA 2XRAH 4MDIA 3UJJH 4PJCB 4K3HA 3MUGB 2GK0B 4YE4H 4L3EE 3TEUA 4P5KB 1NDGB 1PZ5A 2NLJB 2HLAA 3MBED 5C08D 4BYHA 5DD3L 3EYQC 4HUXA 1PJ9A 3ZDYE 2VLRA 3T0EE 2DWDB 3BPOB 4GSDH 4NQVA 1CTOA 2XZAL 4X8XA 4LCWE 1NGQL 3BHBA 2BOCB 4QHLB 1FLRL 3OKKA 5C70A 4JJ5B 4NHUB 1J0IA 3VXMD 2OJEB 3MV7E 4V2CB 4G6JH 1MHPH 4ERSL 3SPVB 1NANH 4XNUL 1RHHA 3VFSA 3A6OA 3NN8A 4JFXA 1BHGA 5F9JB 3D25B 4ZSOE 4P5TA 4ODSH 2FX9H 1SBBA 2X1PA 3ARVA 3V5HA 1IBGH 4KRNA 3RBGA 3PF2A 3MV9B 3KJ4C 3EO9H 4GXUM 3BKCL 4KROD 3FFCB 5CBEA 4OLUH 2W38A 1E4XL 4NRZA 5CWSA 2NNAA 2EYSB 3MBEC 2DQUH 5DJXB 5DFVC 2VXTL 4WDIA 4MQXC 4N0YH 2ZCKL 4LPCA 4FQ1H 4Y1AA 4QRRB 5HI4C 1YNKL 4TSCL 1I9EA 3CCHB 1DE4A 2NCMA 1MJ8L 4LCIH 1MFAH 2Y7QB 1OTSC 1F4AA 3O0RL 1CE6A 3MO1B 1WAAE 3QUXC 4LCUA 2ZSVA 1PX3A 1UQSB 4HIJB 2G75B 1NLBL 5BS0D 3SDCA 4XBPB 2XTJB 2I60H 4N0UB 4Z6AT 3RGVB 3T4YA 5FB8B 2OJZL 5EBLA 4XHJD 4Z7OE 3SDCB 3BISA 3UTPD 1TETL 1DANT 3GNML 2W9EH 1JGDB 4AENB 4ZOAA 3VRLE 1HIMH 4ORZC 1KCSL 4CU8A 4HG4J 3VE0A 3MRDA 4Z7UF 2BCKB 4HCRA 1XIWD 1UXSA 5DJYB 4JAMB 2DQFB 4U6HB 1DANU 2ZUQC 4LPTA 1KENH 3F65A 2WK2A 3DXAB 5IFJB 4JJ5A 4NHUA 3PJSB 1X3DA 5D5MF 4KJWC 1UXSB 5FKPB 5KW9L 1LK2A 2E9BA 3HC0B 1SQ2N 1F3JA 2DQGH 1QRNE 4S1QH 3GSXA 1K3IA 3EZ8A 2NPLX 2AW2A 4RRPA 3WHXB 2CUHA 1XCQB 3MJ6A 3ARQA 3KLAA 4D2NA 1G6RB 3MV7D 4PJBF 2ENYA 3VMNA 4DKFL 4ZD3H 2OTPA 3MV9A 3ZZ1A 1I8IA 4NQSB 3VU2A 3PDGA 5DO2D 5JQ6L 1HHGA 5EZOL 2BNQA 1Q0XH 4NQED 3OKDA 4MD4B 4ZFGL 1QSFA 1NH6A 8FABB 2BFVL 1QR1A 4NRXB 4DKAA 5F93C 2VLJE 3FQRB 1H3UA 2VDOH 1J88A 4M5ZL 2W9EL 3CCHA 2ADIA 3K4ZA 4X6CE 2OL3A 1I9JL 4OGYH 5AZEL 4HAFA 1QNZL 1TQBB 4LQ1A 4Y5YA 4LIQL 3BDYL 2BSSB 2VITB 2R2CA 2ZSVB 3RNKB 5I1JL 5MEQA 3LPGA 4HKXB 4GG8A 5FV1L 1JNHB 1RZIB 4NM4H 3R1GL 4FQXC 4RGMC 1XIWA 2ZNXA 1XGRA 3AU1A 3PQYA 2IBBA 3ZYIA 1FVCB 2X9XA 5I76A 2DLTA 4IOSD 1F3RB 3S3JA 4G5ZH 3SHSA 5GIRA 5E08H 5E2JA 3D9AH 1NGYB 3FQWA 3HE6A 4GBXA 5FECA 3QIBC 5E1AB 4Y5XC 4NO0D 4OCRL 5EUOF 4YZFF 1FVCA 5I76B 4NGHL 3QIWB 3VFUB 1SBSL 5GIRB 5KSAD 2EO9A 4N0CC 1U3HA 2VNCA 5FECB 4EJ1C 2APXA 2VL5A 1L4IA 4HCRH 4D9LH 4YBHA 3BIKA 2GK2A 4U1KA 4L4VB 4UU9B 5FGBA 3GJEB 5FXCH 2VLME 3O3AB 5GS1C 4WUUD 2ZUXA 5ITBH 1NC2B 4D3CL 5JZ7D 3AS3A 5BS0B 2X89D 4RQQB 1KJ2H 1ZLSH 3FMGH 3OB0H 3GSQA 3U36A 4LPYA 1CDGA 1MCWM 1FAIH 2XZAH 1D6EA 4DZBA 5L7XL 3IFOA 4X7DC 2YC1A 2JJTC 2R0KL 1FLRH 3LH2L 4Y2OA 5DFTA 5HD8D 1KPVB 3FOMA 1CF8L 4A6YH 5KSUA 1RSFA 2NY6B 4I2XE 5AAWA 4UTBH 1MRCL 1BFOA 3L3KB 3MJ7B 1MCCA 5DRWA 3O2DL 4N0CD 5M7QA 5MENA 4S0TD 4L4TB 2W9DL 3B9KB 4R4FL 2GCYB 1I1AC 3FTGA 4HWUA 1SBSH 3CFCH 4KI5C 4KU1A 5IVZA 3TBVB 3EHBD 4CN6A 4F7PA 2B20A 4S11A 4OLUL 3T65A 2B4CC 3UEZA 1C16B 1T21A 2JE8A 1OAKL 4C83B 3ARZA 3S36H 3PABA 4X7CC 3GFUA 3LRGA 4WU5B 4MJID 4OIIH 3O6ML 4HS8L 3IXAB 4KTDL 2Y5EA 4PJ7B 4V1DB 3S9DB 4F58L 4LCYB 4XAWH 3VXQB 2IMNA 4HK3N 1QFHA 5IB1B 1CVSC 4A6YL 3WDHA 1RJZA 1LGVA 4ISVB 1PAMA 2UVFA 3U4BL 2OLDA 5ISZD 3FRUA 3TA3A 3TN0D 3D18B 5HYEA 4G9FA 4PJIA 2NZ9C 5HGBB 1PG7H 1RUQH 4GW4A 1LMKA 5D2LB 5KZCB 3C6LA 4KK6C 1E28B 4KTEL 1OT2A 5E2UH 1R3JA 1BEYH 2BHYA 4ETYA 2FJHA 5TE7L 3SO3C 3EYUL 1DL7H 2RQ8A 4HMCA 3EFFA 3FO2A 4LARH 4WI4A 2GIYA 4AEFA 1V7NL 2VB5A 4KXZH 5E03A 5JOFB 3U30B 1T20B 3O41A 5IHUL 3ECBA 2VIRB 4R7NB 4J6RL 2ZPKH 3VG9C 2ZUQB 5EBGA 3U4EB 4R2GC 4F8QA 1KNOA 3GMLA 3HUJF 1NAMA 1P5VA 4HUUB 4PJ5E 1SYVB 4OV5A 3HNVH 3MGAA 5JOPD 1LWRA 1G84A 4H8WL 5J1AB 5IQ9B 4WO4D 1H15A 3VFPA 1L6XA 2NYYD 5BZDA 3ARBD 4PJAB 4TVPL 3LPFA 5J1AA 1T2JA 2AJVH 5DD3H 1U91A 1RFDH 5LGKA 2P8MB 3RX5A 4GAGL 4P2QE 3IXAA 3MCKA 5CZVH 3LHPH 4MA3B 4GRLD 4OD2B 1BZQK 4P4KD 2NTSP 4JG0H 5JUEH 3QEQA 5FYKL 1QEWB 4KRPB 1KN4H 4R97C 4XH2B 4G42A 1RULL 3WUWA 1F58L 1JGLL 1FE8L 3RI5K 1JPGA 3UMTA 1P7HL 3SCMC 4HWBA 3QXUA 4XPAL 1FCGA 4CVZB 1KFAL 1XF5A 4OZIF 3QG7L 5KVMC 2JJSC 2QBWA 2P24B 4GRMA 3O2WL 2CO7B 2WW8A 1IEBB 2VLRE 2FSEB 1S8DB 2BNRE 3T3PF 2H32H 4CDGC 3KAAA 5J6HA 1G9EA 1IM3A 1IGMH 1NUNB 4K3GA 1U3JA 3TBTB 1JN6A 4FQ2H 1J5OL 5DMJB 3L3JB 4AIOA 1LDSA 5LCVH 2C1PB 4HUWA 2Q3AA 4K55A 2XN9A 4LLVA 3SDDA 2NR6C 1CGYA 4RIRA 4X83A 1VKXA 1CQYA 2M8XA 5D1XB 1OGAE 4B0MM 1JK8B 1IGCH 3HCVA 3VMPA 3ZKND 4ZDHA 2JF1A 1C12A 4QRRE 2XG4A 1H15B 3L7FA 3V52H 1MELA 3HMWH 3QJFA 4OI8A 1RQ5A 3DUHA 1WISA 2NW2B 1TTGA 1JGLH 5E7BA 3RIAF 3STBA 3GMPA 7FABH 3SO3B 1FL5A 5CUSL 1MLBB 1F4XL 3D39E 1S7QB 3GMOA 4ALAL 4OFPA 4ERSH 3C60C 1FDLH 3C5ZD 5D6CB 1KIQA 1ZT4B 2FX9L 2DIJA 3EHBC 4XNYL 1NMCC 3GMOB 4G8EB 3ZL4L 4PV9B 4XP5H 1B4RA 3SGJA 1AQKL 2F74B 5JPMA 4YFEA 4GMSH 1I7ZA 3BOVA 3CXDL 3RX7A 3MRBA 4HS8H 1QR4A 4JFHD 5GS0H 4I77H 4BSWA 5IIEA 1KB5A 4P2YA 1N2RB 1OLZA 5ANMA 1GZPB 3K3QA 3O3DB 4XMLH 4RA3A 4HFUH 4FQ1L 1A7QL 4PRHA 3EYOA 4KK5C 2R23B 4XP4H 5IF0B 1T66C 3GMNB 1IGYB 3DYOA 3FN3A 2OR9L 2LQRA 3MLVL 4NOFA 1MJ7H 4BKLA 4JY5H 5FYKU 5K9JH 4HFWB 4LLYA 1OQXA 5ADOH 5IF0A 5KS9A 3BGMB 3KPLB 2Y5TA 1PG7W 1NCTA 5E2UL 4Z0BH 4JRYB 4NQCE 2XZCL 5ELIA 3NCBB 5FHAH 2OBGA 4HKBB 4OLYL 1CWVA 3DMMD 3LQAC 4OD3H 3OJMB 1X7QB 2K7PA 3L1OH 4X99A 4I18A 2YPVH 2AKRB 3ULUC 3MUHL 2NY0D 1PDKA 4G5ZL 4P2QB 2X40A 3O9WA 4G3YL 4MJIA 5F6HI 5C0IB 2L0DA 2AKRA 3KYOB 5E8EA 4KJPC 1CICA 3T0BA 1TTFA 3EOTH 5HY9B 4P2QA 3WD5L 1PY4A 4XMLL 4PV8A 3VXUA 3MXWH 1S7WA 1WBYA 5EN2B 5C07B 4QOKE 4DKDC 1DVFD 4EUPG 4JFYA 3UBXB 4E0RB 1A3RH 3N85L 4F2MA 3OBAA 4RNRB 4GSDL 4XCEB 4AEHL 5C6TH 5BVJB 2I07A 3JZ7A 2ZUSA 2YS4A 1M71A 1J0YA 1S3KH 1Q0XL 3AUVA 4F2MB 3S37L 1A6TA 4E5XB 5J57B 3MV8B 2XZQH 4WFGE 1H3VA 1DQLH 2GITA 3WMSA 3W9DA 1Z9SA 1I8MB 1F45A 1A6TB 2VUOA 1YMMB 4GUPA 3T2NL 2YPLA 2APWA 4JY6B 4FFWC 1INQA 3SE8H 3Q1SH 5F70A 4ODHL 3BDYH 4U1HB 1FZMA 5GGQH 3BUTA 2FL5A 4RBPK 3VRIA 4M03A 2IPTH 5JPNA 3NCFB 3FO0H 3OV6A 4B5EA 1E6OH 2D31B 4PBXA 1U8LA 4APQA 2V5MA 1ZA3A 4NQDA 1QLFA 3JV4B 3G6JE 5CZXD 4X99B 2ZPKL 3RHWF 1N3NA 3NAAL 4OB5H 4K9EC 4QHKJ 1IQDB 1JL8A 3MJ8A 3PNWA 2K1MA 5AG9A 3BQUB 3GMMA 5INCB 3O6FB 4Q97A 2LVCA 2F19H 3ARGC 5DHVA 1CDHA 2LV4A 3BQUA 3BYTA 5IOPB 4L8SB 1E4KC 4OTXH 5EN2A 2EE6A 3MC0A 5EUKA 2Y72A 3N1PC 1IGJB 1CG9B 4LOUD 1T0MB 4K2UL 1QRNB 4MJ2A 3GI9H 3ROLB 3DRQA 3RWCA 2UUDK 1OM3L 4KC3B 3CSBA 1YMMD 3BO8A 3EOBB 4OFYA 4L8BB 5GRWA 3LEVL 3RDTB 1MJUH 2HTKC 3VDAA 4S2SB 1VEMA 25C8H 1FNEA 3FCTB 4PRIB 4CNIA 2VDLL 3MLYL 5HVFB 4XP5L 2WBJC 5K93A 3B4NA 2A38A 2XTJC 4UT6L 1U58A 4J6RH 4GMSL 4KJYB 3V0VA 5JQ6H 3I02A 4MXQC 3QUXB 5HYSA 2GT9B 2RFXA 3AS0A 1YEIL 3C8HA 1DJSA 1HDMA 5HHVL 2MOVA 1I7TB 3QWRA 3U0TB 4YE4L 4LOUC 5DC0A 3QH3A 1A7RL 5H35B 5FM5O 2HFGL 5KVFL 1OF2B 3QUML 3DX8B 3HNTH 2XYCA 1QLRB 3N1MC 2YUZA 5TFSL 5D2LE 4Z95H 5FM4A 4QXUL 4UNUA 1U8QA 4JY5L 1IARB 1B2WH 5BOPA 3ZT6A 1A9EA 1U8QB 4XBGB 3V52L 4KK6D 3VXOB 4PRAB 5C1MB 5KVGH 1PG7L 1DUYB 1RUQL 3NCYS 3EYFB 4AT6A 2ZNWA 1X5AA 1SM3H 2XICA 3BGFB 4FA8A 3HC3L 1ZVYA 2RGSA 3EOAB 2EIBA 1FG2B 5C6PB 4RDQF 3WNOA 5CGTA 1B4JH 1FORL 2AXJA 1MFEH 1EO5A 2W1NA 2CMRH 1CT8A 1JPSL 2VLJB 1S7XA 3EJYD 4NJAL 3KPOB 5EZLA 3RTQC 5L2KE 3MRCA 2VXTH 3PWJA 3DV6A 4Y7MA 12E8H 1A7PH 4V1DD 1J9CT 1QTYT 5KN5B 1U8KA 2H6PB 4KDTC 4MDIB 2L7JA 3V79C 4QEGA 1CT8B 4ZOBA 5CHNA 1T5WA 4NC0B 4Z7WB 3O0RH 5I2IA 3V6FB 4JZOA 1SJVA 3V9FA 5C0CB 5C6TL 4QXUH 2F53D 3EO1A 4WJ5B 1NUDA 5FYKE 4RZCB 4IRSA 4Y16D 3LS4H 1ZT7A 1NCWL 4OLZL 4JZOB 1NUGA 1QFPA 4YBLC 5I8CA 2QKIA 1T03L 2XZQL 4FQPA 1X5FA 4M6MH 2GTWA 4P3DA 1PLGL 2GJ6B 2F54A 5ENWB 4HKZB 4F33B 3GNMH 1UH4A 3B9EA 5DRNB 1Q9OB 1BM3H 1D6VL 3ARTA 4LPUA 3RUGF 1L0QA 3BZDA 3DX8A 3H9ZA 1N64H 2WAHA 3RIAK 3ZKXC 5GSVB 1U42A 5DVOA 3QDGD 2NMSA 1IKNC 5D2NA 1FFQA 1C5DA 4CN1A 4U2YA 3L1OL 3X13A 1C08A 1JPSH 4OIAA 1ITCA 5DURD 4NRZB 5CWSB 4YNYB 5GS3A 3P77B 3DMMA 3T08A 4NNXA 1FE8H 3DROB 3BP4A 1RUPL 1MY7A 4ZD3L 4DKFH 4I3RL 3O9WD 2H2PC 3WLWC 2ZJSL 3CFDA 1CLOL 1HQRA 4B41A 4O02L 2F19L 2NR6D 4HWEL 5GRXG 15C8H 2V9RA 4HZAA 2EEAA 4QRUB 4L4TD 1DQQB 2VDKH 1DVFB 4HGKC 5IMLA 1U93A 4XZUB 4MAYC 4FXGB 4JG1L 3PWVB 3ARFD 1QNZH 5FK9A 3KPTA 4WW1A 5F6HJ 3CX2A 3CZFA 3PDOB 4XZUA 1EO8L 1XFPA 1T5XA 4QRSA 2WWKO 3E8UH 3MLWL 3QIWA 5CP3A 4EIGB 1E4JA 1K4DA 1M7DA 1U3HB 4NQTA 3MRIA 2NY3D 5ADPH 1U6AL 4RMVA 4Q9RH 4ZXBC 3EDJA 3Q6FA 2R8SH 1AQDA 3GHEL 2SEBA 1T83C 3GHBH 2ZG3A 3LRSB 4EQ3A 5IV2B 5I71B 1KLUB 4HBQA 4P46D 1REIA 1KPUA 4JR9H 4FQXA 3BP6A 3QQ4B 1UB5B 1VGEL 4HMDA 1JPFB 3QI9A 3WLBA 3GM8A 1F5WA 2EC9T 5DJZB 3VFSB 3T4AB 3MSPA 5DQDL 4OZGA 4UV4L 3BRFA 2AJYL 3PXHA 1NFIA 1MOEA 5E2WL 5HHVH 5SWSE 1AP2A 4OZFA 4HUNB 5CSZB 1RIHL 2EECA 1JRHL 3ZTNH 5F1KC 4ZO9A 5EFIA 3BVNB 5B4MC 1OAQH 3HAEA 5CD5C 1CFTB 3CFBB 5FAAA 3R0MA 4YZFE 3C5JB 5ILTL 1T22B 3GSWB 4I77L 2HLFC 3BUYB 3ULVF 4HXBH 4EDXA 2X4PA 2VKXA 4JRXB 1KT2A 4MB4A 2OR8A 1P84J 4JO2H 4UDTA 3NTCL 5HPMA 4LCUB 4Q9RL 3N1GC 1J8HA 4NKOB 3ZDZE 3HS0A 2BVOB 1T21B 3GI9L 4NRYA 1SM3L 3REWA 4WO4A 1HIML 3E3QE 4RMTA 4TVPD 1P1ZA 1PKQB 3VWJB 5K9KA 4QHKI 3SE8L 4ETQA 3U7AA 3O2WH 4PG2C 1ZHBA 2CDGA 2CRYA 3O8XD 3C9NB 1TDQA 2R4SL 2XN9E 1QQDB 5CEZE 1D9KD 3ZHDA 2HT2D 5E8DH 3BIKB 2VC2H 4FZEH 1M7DB 4P4KA 2O5ZH 1UZ6E 4XVUC 2WUBH 3RL1A 4CBPA 4M7ZB 5EULV 5C71A 1RJZB 1W0VB 4HEME 4LHUB 2F8OA 4D0CA 5ICZB 2PW1B 4FQXB 1RZJC 1A47A 1YYLL 3E6FA 3LKNB 3QISA 4NPYB 3GSQB 4EN3C 3R4DA 1IGCL 3FZUC 3TH2T 4GXVH 4DWHA 5JHDD 4XP1H 5D2NE 3SDAD 3WHXA 4I0CC 5JMRA 2ZG2A 3IS0X 4DN4L 3MV8D 3QNYA 2VR4A 4LQFH 2C3VA 4H1LH 2VDOL 2BJMH 1MJJB 2J6EA 1I8IB 1UJ3B 3O8XC 1R3LA 3NA9L 4MD4A 2AK4E 4X6DF 3B9KA 1MJJA 3FO1B 5JOFA 5I30H 2BX5A 4P57B 3L5HA 1RJLB 1V7ML 3QFJB 5KVGL 5ICXB 5DD0L 4Z8FL 2BVYA 3N06B 3TJEL 1W72H 4U6YB 1P4IH 4UAOC 3B5GA 3ZL4H 2B4CL 5DJ2A 4HUUA 2WMPA 4ELMA 3Q1SL 3HPJA 4ODHH 1BBJB 3MROB 4XGZB 1YQVH 4KKLD 1JFQL 5BCAA 4RBPH 2J8UB 2R9HD 1YYLH 4MWFB 1B0GA 1OTTD 3QQNA 3IDUA 1FL6A 3WN5A 5JIPA 4BA8A 2HKHL 5MERB 2Z4QA 4L4VD 5DEFB 15C8L 5DEGA 1CXLA 5I73B 1T3FA 4YGAB 3SOBL 3VXTB 2V7HB 5CAYB 2X4TB 4MJ5B 3L5JA 4K3EH 4HIXL 2X9WA 5KSVA 1HH6B 3BW9A 3FB8A 3INUH 4XH2A 2AERT 3U2SB 3S5LB 1EJ6A 3UPRB 4MX7A 4OD3L 3BKML 1AC0A 1AHWA 2XWJA 3EO0A 5DUMH 3TWCL 3ULSB 4JZNB 1JHKL 2A9MH 4XP9H 4YHPA 5E56A 3QNYB 4KK8D 4G3YH 4KK5D 5B39G 1MCOH 4JHAL 4U7MA 3TBTA 3ULSA 3KWWB 3JWOC 1GGBL 5JDSA 1MNUL 1MIEL 5E94A 4L8DA 4BZ1L 5GZNC 4P9HL 1TNNA 4P57A 2P42B 3S98A 1DP0A 4Q9QL 4O58L 2KUTA 5BOZG 4K3DH 5KW9H 4NQEB 5ID1A 1A21A 1JRHH 1KBGH 3ZTNL 4S1QL 2IANB 4FMKA 3EAKA 3PWUA 4O9HH 1CGSL 4WFED 5DQ9A 1BZ9B 4HAGA 1PEWA 2H32A 4WTZG 4ZXBB 3P30H 1BP3B 4HLZG 4GAYA 3EYSL 1YPZE 2BSTA 4R7DA 2XI9A 2A6DB 2IPKB 3S4SB 4OQTL 2IPUK 1FL5B 3BKMH 4ZFGH 3HZKB 5DEFA 1P2CA 1U36A 3S4SA 1VERA 1U0QA 2D7PA 1T3FB 3AVEA 1A1OA 1G7LA 4RGNC 1EFXB 4IRJB 5CBEB 1FYHB 5FM8A 4L4VE 1CBVH 4QHUB 5TQ2L 1LVEA 2WANA 5CP7B 3OTTA 1RZ8B 4ALAH 4JN2A 1MEXL 4M5YL 2MCG1 5I16A 1P4LA 1S7SA 1FPTH 4KK9D 5C0BD 3B43A 4M6OH 5E8DL 3OMZA 1V7NH 3STLB 1OGAD 4OZGF 4BH8B 1EGJL 4XB8A 4O2EB 1UQSA 3P4LA 1B4JL 1CDUA 5EIIA 3EFFB 3FO2B 4I3SL 4GLRH 4UNVA 1OT1A 4UV4H 5FO8A 4U6XA 4I3RH 4HJ0D 2QQQA 3OF6A 1L9MA 1JZ4A 2AJZA 1X5GA 3VD4A 4LVEA 1RJCA 1WGOA 2N7AA 2AEIT 2VQUA 1QSFD 4ZDHB 1FH5H 1NBQA 4JCLA 4M02A 1K2DA 1FV1A 4E41D 3BXNA 2NY4C 3FFCD 4MAYA 4TVPH 3GM0A 2FZ3A 1SYVA 1JWSB 3UTOA 3MZTA 4MCYA 1KJ2L 1ZLSL 1A7NL 1K2DB 3OGCA 1XF3B 3TZVB 4M1DH 4WW2B 1MJUL 3C60B 1LK2B 4XVJL 4ZQKA 1HI6A 4CVXB 1TCRA 4YBLB 4W6XB 5JUEL 1MY5A 4MB5A 1BM3L 1D6VH 1XGQB 2VWEC 3GB7B 1CR9L 5E7FA 1S78D 3MRRA 5DQJB 5SWQA 1AKJA 5ESQA 1G6RA 2KL6A 4O5LH 3EO9L 2BXZA 1PYWA 4KI1A 3BSZH 3GBLA 4R4FH 4N68A 3UROR 5GZOD 4F7MA 1XEDA 2GKIA 4M7LT 5FF6B 3MRJA 3JWOH 1XF2B 3NPSB 5HYJA 4NCC1 5SWQB 1FLTX 1VGEH 1YEIH 2VC2L 1NUFA 4FZEL 4CJ0A 1HINH 3Q5OA 3SCMD 5A3IC 3JV5A 3JV0A 3T8XA 1FYTA 2X9YA 3TP4A 4GAJL 2AXHA 1XF5B 5I74B 3Q2CA 5LCVL 5F7NC 4KUZL 3NIDE 5EDXA 4LVOC 5GJSH 5BRZB 2FEDD 5DTFB 2H8PA 4LGSB 3RKDC 1T2QL 1S9VB 1WC7B 4H8WH 1JV5A 3QDMB 1K8DA 5I74C 5DD5H 2WBJD 4CMHB 1EPFA 1MQKL 5EOTB 5HPOA 1S7VB 2W65B 2D9QB 4W4OA 1S9VA 3GJFK 5J06A 3DVGB 3WJJA 4OF8A 2VDKL 4EVNB 3NIGE 3RVUD 1PSKL 3GSVA 1S7TB 2EE9A 1CR9H 1K8IA 2W65A 2JJUA 5CP3H 2JCCA 3VD7A 4OCXH 1YNLL 4D0BA 4MAYB 4ZO8A 2VZUA 2D4DA 3ARGA 4U0RC 4NC2B 1VB9A 2YEZB 5B8CC 3VXSE 3H9HB 5DRZB 5DWUH 3CUPA 3T0AA 4XC3H 1P4IL 1NGXA 3FB7A 5TE7H 4RAVB 3EDFA 4MB3A 2YEZA 5IMMA 1FNLA 3OKLB 1IZKA 5TDNB 1XR9B 1MAKA 4XHJC 4EKXA 8CGTA 1WSST 2H3NA 5A2LH 4POUB 1XH3B 2FJFA 4ONGL 5K59F 3X11B 2EDXA 4TSBL 4MZ2A 2DI8A 1IJ9A 2XKUA 2YC1B 5IBLD 1T2QH 3MGTB 2R0ZH 5GHWL 4NZRH 2NY4B 4RWHA 3MV11 4HLJA 1TNMA 3SOBH 4I18C 4XP1L 4N8VG 5EH1A 4TVPE 4X5XA 4XXDA 4JZJC 4KVCH 4K94C 1IAKB 4DN4H 4JRYE 1OAXL 3ZKMC 3NZHH 4X4ME 5FYJE 1X4ZA 4K2UH 1LEGB 4PJFB 3ZLQC 1AR1C 5EO9B 2J8UE 4J4PD 2BK8A 4ZO6A 1FIEA 4JEGB 2XZCH 1Q38A 2YPKA 5J6GB 1JHKH 5DO2C 4M5YH 3DOSA 1RZGA 4NQDD 4U1NA 1FNSH 3PABB 3BI9X 4JG0L 3O6FC 4N8CH 3ZKQD 2CLVB 4NO2A 2J5LB 3D9AL 5FKAB 4XNXL 5L6YL 2Z8WC 2MKLC 3NFPA 2IH1B 2BMKB 1I85A 1Y6KR 4J3UA 3S88H 4B53A 3BKCH 3BX7C 5ESVA 5LXGH 3N1FC 3IJYB 3IETB 5D8JH 4C56A 2JJWA 1CXHA 2JELH 2PYFA 4LRIC 4F7TB 4YHLH 3QUMB 4IMLB 3HRZB 3LB6C 3QZWB 3MLZL 4G9FB 4PJIB 2DQTL 4M62H 4Y4KC 3IT8D 2MHAA 5C0BA 3FZUD 5TDNA 3HB3C 2XY2A 2PYED 1CYGA 3N1QC 1R5IB 1FAIL 4G43B 4BUGA 2OMNA 1A6ZB 2V7NA 4EI5C 1T0MA 1EO8H 5F89B 5IB3A 1S9XB 5CJXC 4XWGL 5HJ3B 1Y18B 3OPZH 4Y2DA 3DRQB 4MJIE 3AY4C 4HSQA 5I1CL 1GRWA 3I85A 4IIQC 2FYYA 1EXUB 3NIGF 1W0WA 3MXVH 4NKQB 2W9DH 1BQHB 1KYOK 1DBJH 2C1OA 5C09E 1EXUA 5HBBA 1SVCP 2HMID 3BN3B 5JHLH 3W11D 5T1KB 3TBSB 2CIIA 2DTSA 1KENL 3RVVC 5DD0H 1BECA 4Z8FH 5ACLA 3O11A 1FIGL 4AQ1B 3G6DL 5GGSY 2AK4A 2ZUUA 5DVLA 3HB3D 1YJDC 1UCTA 1GC1L 3T3MF 4UQ2A 4BZ1H 4K7PL 1NBZA 5F7UA 2R2EB 5CGMA 5BS0E 4TQEL 4LSVH 3I3EA 4XC1L 5E8OA 5J1SC 3O6MH 5HGGS 1RUAH