5ECKB

Crystal structure of fin219-fip1 complex with ja, ile and atp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 61
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5eckB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5eckB01
3RPNA 5DCGA 2DLXA 1TP9A 2KLXA 3G7JA 4V2MA 2YZUA 2R6KA 3Q6OA 3HXSA 4DEJA 3GX8A 1U87A 5E59A 3DIEA 1JZRA 2RM5A 2FWFA 2RUFA 1XZOA 1ZMAA 5HR0A 3D4MA 1TOFA 5LNKe 3F6DA 4JR4A 2FUG2 2HSHA 2H6XA 5DAKB 1ABAA 3ZZXA 4L5LA 5IO2A 12GSA 3GV1A 2LV3A 3ERWA 2FA8A 4ID0A 3ERGA 2GQMA 4LL1B 1NSWA 1KBNA 1G6YA 1SYXA 1GULA 1K0CA 2IN3A 4K7OA 2B7JA 4G0KA 3MNGA 1M2DA 2YV7A 3KGKA 1B9XC 3R2QA 1Q98A 4V1Ap 2DJKA 2KP1A 1SK2A 4IKHA 2HZFA 5IMZA 4K2DA 3QFBC 2C0FA 2VCTA 4OCEA 2C3TA 4V1Ag 5ECQB 2VL2C 3IE3A 1OYJA 4TXOB 5B6NA 1W4VA 2H70A 4OCFA 3KTBA 1V57A 1XWBA 3NOFA 1PA3A 2L6CA 1F37A 2G2QA 4RI6A 1XVQA 4IN0A 3DWVA 1EWXA 4RQRA 2LRTA 2VL3A 2TIRA 18GSA 2WCIA 3HA9A 4MABA 1WJKA 1UA5A 2B5XA 3ZL5A 1M0UA 1YEPA 1FW1A 3PINA 10GSA 2XC2A 4I8BA 1TK8B 4KUNA 2YZHA 2B6MA 2DIZA 1RQMA 3GYKA 2YWOA 4FYUA 5KN3A 3EYTA 4O32A 4MJCA 4WKWA 5IQYA 2ON5A 3MAKA 5D9TA 2A2RA 3I69A 4HDEA 3LSZA 3M3MA 3P90A 2I3YA 3HD5A 6GSXA 1GSYA 2YN1A 2DMLA 2AJQB 3KMNA 4ZXGA 4OD7A 3KH9A 4POMA 2M46A 4ZL7A 3GURA 3M9JA 4HJMA 4HS1A 3E9JB 2FHEA 2C4JA 1UN2A 1LBKA 1Z6MA 2DJ0A 2OACA 3EINA 3HJMA 5AGYA 1M7TA 2OA7A 3GUSA 5IMDA 5DBQA 3A2XA 3P8WA 3EC3A 3G9BA 3Q18A 3GH6A 2L4CA 2IMIA 4ZBBA 2E2MA 3SBCA 1OKTA 1EZKA 1PX7A 2OKAA 5A4VA 4PGTA 4J56E 3H4KA 3IXRA 5AIVA 2HNLA 1PKZA 3ISOA 4GCIA 2IMFA 5D9WA 4MF7A 1XIYA 1BEDA 4I5QA 1NM3A 1VF4A 3HJPA 4ECCA 4I6XA 1SJ6A 1SL1B 4IQAA 1GTBA 4X1UA 3DKSA 1JFUA 5ECSA 1SJIA 4F0CA 2B3SA 4F03A 1ZOFA 1ZZYA 2GZZA 3ZMKA 3IBHA 4XS4A 1CQHA 2CAQA 3APQA 5ID2A 2F8FA 2N5AA 2PWJA 2LQOA 3UIWA 3Q19A 5D93A 4OO4A 2MMZA 2GSRA 3LFLA 2KP2A 4IP1A 5F0GA 4QL7A 1LU4A 4PQIA 1B9YC 2PVQA 3P2AA 1V98A 3TOTA 16GSA 4Q5NA 2V2GA 5HFIA 3DVXA 1SD9A 4GWRA 3L0HA 2IMEA 2F3MA 1JZOA 4IELA 1TI3A 3KZQA 1ON4A 2GZYA 4I97A 1BAYA 1G7OA 5C04A 4HU7A 1TTZA 4K0GA 2PERA 1XFLA 1KTEA 1ML6A 3CSJA 2H66A 2PU9C 1XOAA 3D6IA 2H0HA 4KDYA 2QKEA 1TDIA 4EO3A 2GTUA 4GLTA 3ERFA 4N0VA 3IHQA 3EMPA 4FQUA 2YJ7A 2LEGA 3F4RA 1HD2A 4E8HA 1DE1A 2K9FA 1GSQA 1MD3A 2VL9A 3KMOA 4OWYA 5IMFA 3M0FA 3GSSA 1EEMA 4MZBA 4F82A 1F3AA 2MYGA 5DVBA 4JZQA 11GSA 3F4TA 1ZYQB 4JEDA 3IPZA 5H5QA 4P3YB 1V58A 3TKQA 3FEUA 5D73A 1FVKA 3RDWA 3F6FA 2L6DA 4TR3A 4X43A 4LLRA 1GSUA 1A8LA 1ERTA 4GRFA 2PUKC 4D73A 4HQSA 3OR5A 2RUEA 4ZB8A 5JCWA 1FO5A 1X9SB 3EVIA 1QQ2A 2O8VB 3EU4A 4O5RA 3IDVA 2VUPA 1YJ6A 3KP9A 2TRXA 2HZEA 4I2TA 4IQ1A 2IFQA 1MEKA 3M1GA 2TRCP 3IR4A 5DQSA 3CRTA 1ERUA 2C80A 4ECBA 4Q5FA 5ECNB 2DIYA 1TK0B 2OBIA 4AJ6A 5ID2B 2H73A 3TGZA 5CO3A 4WF5A 1R5PA 1PL1A 4PQHA 3HY2A 3VWVA 2M72A 1T8EB 2E2GA 4TR1A 4ZB9A 4EKZA 4GXZA 4KDUA 3QD9A 2RM6A 1VF3A 2CZ2A 3ED3A 4HI7A 3C1SA 1QMVA 2OBKA 5JWQB 2IWTA 2JZRA 2FY6A 3U5RE 2YANA 2R5GA 4XS1A 4V2LA 3R3EA 2RIIA 1T7PB 3ZIJA 2AV4A 3TKPA 2F51A 1J9BA 2BTOT 2PVOC 3A2WA 4KB3A 2H1GA 4BVXA 3SWLA 4RQXA 1EGOA 4LMWA 2H76A 3TB2A 2YWMA 4MF6A 1R5AA 4OMVA 3FR3A 4WR4A 5KN2A 2HLSA 2H1BA 4I2UA 2IIYA 3TRPA 4HEA2 2PMTA 1X9MB 3QAWA 1MD4A 1PKWA 2IL3A 3VURA 3D22A 1N2AA 1K0DA 1F2EA 5JWRB 2EC4A 3BCIA 3IK7A 1SK1A 3PGTA 1ZGNA 1MDIA 1T4YA 3W8SA 3QAGA 2CX4A 4K0NA 4POLA 2FWHA 4JU5A 1FVJA 4G10A 1AAZA 4K7IA 4NHZA 1FAAA 3BOAA 3D4TA 4EDZA 2LKUA 3GKNA 4N10A 5ECIB 2HZEB 3LQ7A 3CXGA 2PGTA 3KP8A 2H72A 4KCEA 3KTLA 1EV4A 2XHFA 4MA9A 4ULXA 2IFQB 4MH3A 2LJAA 5G1LA 1K0MA 5IPGA 3EURA 3NZNA 2VCZA 4J2FA 1ST9A 3IV4A 3WGEA 5J3RA 1QK8A 3F9UA 1O8WA 1TU7A 4HQZA 2HE3A 1THXA 3F8UA 3LXZA 4TR1B 3UVHA 3ZREA 5IIZA 4WBJA 1WWJA 2WJUA 4BVYA 4L0UA 1G7EA 1A0RP 1OE7A 2GSSA 2MMOA 3RHCA 3TJBA 3MDKA 2H01A 4YQVA 3GFKA 5KN0A 2FWEA 1VRSD 1DUGA 5F07A 1GSEA 3FKFA 1GTAA 2HFDA 3IA1A 1O73A 2L4QA 4PTSA 4G2EA 4AJ7A 4BVXB 2L5OA 3GKKA 4HU9A 3TJGA 3QFAC 1X9WB 2B7KA 3EMXA 1NW2A 4Z7XA 3GRXA 1BG5A 1FB0A 1SYRA 3ME8A 5IO0A 2GQLA 19GSA 3VK9A 3H79A 5AISA 4RUVA 2O89A 3C73A 2WFCA 4TKYA 3HVVA 2VCXA 14GSA 3O6TA 2NPBA 2P5RA 3C7MA 4KSOA 4EDYA 2AHEA 3DD3A 1EOGA 4TVEA 4IBPA 4HZ2A 3A5WA 4MZCA 3RAZA 3L9VA 2C3NA 1FB6A 3JCML 2OADA 3UL3A 2OE0A 4ZBDA 4IGJA 3VPTA 3ZFBA 1GSDA 3AY8A 3FHKA 1V40A 3CTGA 2C1YA 4BPYA 2B5YA 4NAXA 3FK8A 3HVSA 3TJFA 3FY7A 3ZFLA 5GAPD 3ZITA 1HNBA 3FZAA 4PNGA 5JWOB 1HQOA 3QAVA 2VLUA 3H93A 4L8EA 4EXJA 2EIQA 1K3YA 1GSSA 2LS5A 1YKAA 3GMFA 1TK5B 1GWCA 5BMUA 3F0IA 3DYRA 4NXIA 3F3RA 4ZB6A 2H74A 4BVYB 1TJDA 1XXUA 5J9CA 1K3OA 1XCCA 1O8XA 5ECRB 1DSBA 3HKRA 3UBKA 1NHYA 4KSMA 5ECPB 4N0ZA 5J5NA 4HUAA 4K8MA 3J7Yk 2LQQA 5G5FA 5ELGA 2R2JA 4Q5QA 1AIUA 2VD0A 3LXTA 2YP6A 2VAFA 5F8BA 2X8GA 1I5GA 4GQCA 1AXDA 4IP6A 4GSNA 4YAPA 1URMA 1O85A 2WZ9A 4QQ7A 4FYCA 2I4AA 1DE2A 1PX6A 3GNJA 4EUYA 1U6TA 4BL7A 6GSSA 2XPEA 2CVBA 1HNAA 4KDXA 3TKRA 2H0GA 1B4QA 1YEXA 5IMAA 4HJ2A 5CRHA 2GDRA 2MBSA 2X8HA 1JZDA 1Z7RA 4BWSA 4F0BA 3LGCA 1TI1A 2FCHA 3KIJA 3L4NA 3O76A 2HSYA 3UMAA 2XBQA 4EF0A 5D8IA 2H1DA 3VLNA 2C0GA 4GSSA 2YPMA 5FHIA 1SU9A 4AJ8A 4ML6A 5CP1A 4N30A 5CAXA 5IPHA 2OE1A 1XWCA 1ILOA 5CRDA 2OJLA 2H71A 3WD6A 2VCWA 1TRWA 3FR9A 2HSMA 3VWWA 3VWXA 4WF4A 2OE3A 5HQPA 2K6VA 3C8EA 1A24A 1O81A 6GSVA 1U88A 2HT9A 1RW1A 1WRYA 1GLQA 3Q74A 2VD1A 5EY6A 2VCVA 2DJJA 1ERWA 2YOIA 5LCZA 1XWAA 2DBCA 2C0EA 1OAZA 4EL1A 2JL4A 2WGRA 2NDOA 3LG6A 5F06A 1YY7A 4OFTA 3W6GA 5A4WA 1S3DA 22GSA 2YCDA 1A23A 1ZYEA 5GSSA 1F9MA 2JZSA 2YWNA 3GL3A 3KD0A 3HZ4A 5HR3A 2GQKA 2IJYA 1OC3A 2H6ZA 3HZ8A 1SL2B 2P31A 1YF1A 2IMKA 1YZXA 4JRRA 3BBYA 4BL7B 3PH9A 1AC1A 5CRGA 1M9AA 1EGRA 4AGSA 1FHEA 2WDUA 4XTSA 4FH8A 1SJZA 1Z3EA 2BMXA 5G31A 5GSTA 2I81A 1O7UA 1SKSB 2P0GA 3C71A 3GIXA 1RK4A 3ZMLA 4KAEA 5G5EA 1K0NA 1TKDB 2CAIA 1YQ1A 4QL9A 1XW9A 3TRXA 5CREA 4LA1A 1VF2A 1M2BA 2X64A 1TXXA 5HFGA 5D96A 2LNTA 3A3TA 5DCHA 5HFKA 2AUVA 5GZZB 3F3QA 4PXOA 4WETA 1PGTA 4IHUA 2XPDA 4ZBAA 2A4VA 1K0OA 4MDCA 2VO4A 2LNSA 5IMCA 4ZL8A 3RPPA 2MMNA 2V41A 1FG4A 1XWGA 4WXTA 2AB6A 2HSMB 1GUMA 4POBA 4MPGA 2H0IA 1OE8A 3CYNA 2GSQA 1JLVA 3DXBA 3D0ZA 2M80A 5HR1A 2CVKA 3S9FA 1PN9A 5E4WA 2DMMA 2MBTA 1TW9A 1AW9A 3US3A 3HDCA 4BWQA 3FRCA 4TOPA 5ELAA 1R7HA 5DQYA 3QOUA 2HSNB 2J9HA 1VF1A 3CTFA 1EV9A 2ON7A 2E7PA 2C8UA 1A2LA 4POKA 1H4OA 3M9KA 2YJHA 3L78A 2VLTA 4JR6A 3GTUA 1TU8A 1HYUA 1TRUA 1K0AA 1G6WA 4K7NA 4HOJA 2RLIA 4HZ4A 5DALA 2JU5A 1EP7A 5IOWA 4V2NA 1GNEA 1ERVA 3PPUA 1JZWA 2JADA 1JHBA 2FNOA 1A8YA 5JCGA 4KNDA 4IW9A 2L59A 1U3AA 4MJBA 3FZ9A 2CT6A 4DSSA 4XRAA 3IOSA 3UVTA 3QR6A 3EE2A 3I43A 3VFIA 2HRFA 3IK9A 1PSQA 2YNXA 2PBJA 4ZIJA 3VPQA 2X8CA 5CYYA 3IC4A 3GH9A 1F6MC 1AQXA 3GN3A 3MSZA 3HVXA 2CA8A 4G9HA 2B1LA 4MMMA 3E0UA 5KN1A 1S3AA 2LJKA 2NVLA 8GSSA 3G7IA 2IMDA 2LSTA 3TRQA 2PPTA 4G19A 2JZTA 2AAWA 1AQVA 4MCUA 2GZPA 5LD0A 4MP4A 3GL5A 7GSSA 4TW5A 1Y25A 1GRXA 4WBRD 1T00A 3ZYWA 3F63A 5C00A 1PMTA 5COHA 1FOVA 1I9DA 3VWUA 1PL2A 3KXOA 3A2VA 1Z7PA 4XIHA 3KJYA 1QGVA 4XRDA 1K3LA 4MPFA 3L9SA 2L5LA 3TKSC 1VGLA 1U3IA 4CDOA 4PNFA 4CHSA 4TRXA 4TN8A 2CX3A 2FD3A 2C0DA 4EC0A 2R4VA 4WR5A 4MZWA 3LJRA 4E8EA 2K18A 4FYBA 4BA7A 3TKSE 5ECKB 1XW6A 1GTUA 3G7YA 2HYXA 2IPAA 2B5EA 1X0RA 1T1VA 1AUCA 2H30A 3MWHA 3GTUB 1NHOA 1USBA 2QGVA 1F3BA 3LEFA 3I6AA 3TOUA 3M8NA 4PX1A 3DMLA 3HJOA 1E2YA 2HRNA 2LJRA 3QPMA 5DALB 3QCPA 3IC8A 6GSUA 4YQMA 4MK3A 4KE3A 1BJXA 1ACVA 3GHAA 4DSSB 1MDJA 1LJRA 2ZNMA 5ABRA 1DBYA 4EVMA 4L5OA 2I1UA 3L9UA 2AYTA 2FA4A 3RBTA 1OC9B 1GP1A 1THOA 3UOMA 1IYIA 2GLRA 3KH7A 3UBLA 5L71A 2DJ3A 3LYKA 1TRVA 1GUHA 3U6VA 5A4UA 3DRNA 3UAPA 3VI5A 4F2IA 2H1AA 2I9HA 2VLVA 2O7KA 1WOUA 2ZUPA 1SKWB 1KNGA 2X99A 3ZIVA 3EWLA 3W8JA 2DJ1A 3N5OA 3VI7A 2VOCA 4DSRA 5ECHB 1GH2A 1X5CA 2KOKA 5FT3A 1OVNA 2FWGA 5CRWA 2GT5A 4YAVA 4O7HA 2LRNA 4KCAA 2CVDA 4RI7A 3V1WA 3FZ5A 2QSIA 4MJEA 2H75A 4DVCA 1O6JA 4GF0A 3EU3A 2FLSA 2R37A 3PR8A 3ZRDA 5CNWA 2V1MA 5B6MA 1GL8A 3TJJA 3E3EA 1EOHA 2FGXA 2WRTA 1GUKA 4ECJA 2HRAA 13GSA 1PD21 3QMXA 1GNWA 2O85A 4OO5A 3GA4A 2MMAA 3ZTLA 2DJ2A 3UEMA 4PUFC 2CQ9A 1SL0B 4XCSA 2ZCTA 1A2MA 1PRXA 1M9BA 4NWYA 3J7Yb 2L57A 3F4SA 3LYPA 3CBUA 3HCZA 6GSYA 5J4UA 5IM9A 2H6YA 2LUSA 1V9WA 1R4WA 4FO5A 4ISDA 3I9V2 3LWAA 4J57E 1N8JA 3TKSA 2K8VA 2BJXA 2VCQA 4NV5A 3K8NA 4TR0A 3LORA 4KGIA 1GTIA 4Q5RA 3APOA 4K1FA 1OC8A 2ALBA 4PUAA 3C1RA 5INYA 3APSA 2GVPA 1SKRB 4KW6A 5D9XA 5AIXA 2K8SA 4NPBA 5G2ZA 3QDNA 3KM6A 5A5KA 1XBSA 4JBBA 3GKMA 3P7XA 1OKDA 1K0BA 1Y6EA 4NMUA 2WB9A 1X5EA 2JSYA 1GLPA 2REMA 2CZ3A 3DVWA 3DGQA 3WT1A 1V2AA 2NTOA 2HI7A 4IVFA 3WT2A 4MLYA 5EVOA 1XW5A 3UJ1A 3FYGA 2VL2A 1T4ZA 5DJLA 3FW2A 3ZLPA 2PN8A 3CRUA 1M99A 1ZCPA 2O87A 4GSTA 4G0LA 1MDKA 4MH2A 4EE0A 1UVZA 2V6KA 2R3XA 4PURA 1J0FA 3FZ4A 5ENUA 1WMJA 1PQNA 3ME7A 2N5BA 4YQUA 1HNCA 3GKXA 4N11A 5EL8A 1H75A 9GSSA 1GSFA 3N9JA 3BCKA 4ZILA 4AF2A 4KF9A 6GSWA 5HR2A 17GSA 3TUEA 6GSTA 1E6BA 1XOBA 5B7CA 1YF0A 5IOXA 1YDKA 1SENA 1WPIA 4LL4B 4ACSA 20GSA 1XWKA 1WIKA 2WULA 1Q4JA 3IAM2 2A2SA 2MZCA 1R26A 2JSZA 4TR4A 1ZL9A 2LTKA 2F9SA 1EEJA 3TJKA 1B48A 1Z9HA 3UARA 1T3BA 2C3QA 2QC7A 3GSTA 1A0FA 3ZVJD 2EIOA 1JLWA 2V6OA 3FR6A 2DC5A 4MF5A 4DSQA 2VM1A 5G30A 1KEBA 2P5QA 5IMVA 1W89A 1M2AA 4XS4B 3CMIA 1B8XA 4LMVA 1WP0A 4NHWA 2HRKA 5F05A 5JCUA 2G0FA 2XBIA 4USSA 1SK0A 2V32A 1QXHA 1XVWA 2EIRA 4GTUA 3TCOA 4MJAA 3DEXA 3GX0A 5AN1A 3TDGA 3RHBA 4CW9A 4F9ZA 2KHPA 5ECMB 4WEYA 5GAND 2GS3A 3BJ5A 3NIVA 5DDLA 2F8AA 2H19A 2VIMA 1IYHA 5ECOB 2GGTA 4XHMA 4ILFA 1S3CA 3WGXA 4K9ZA 2GSTA 4L0WA 2B1KA 2LRCA 5ECLB 2GT6A 2E0QA 5DAKA 2YV9A 2JACA 2NBSA 1MTCA 1YKCA 1J08A 2CV4A 4GQFA 4IJ3A 1BX9A 3IRAA 4OFMA 4JE1A 4NV2A 5B8AA 3BD2A 1QUWA 2HXKA 1B4PA 1SD8A 3H1NA 3D5JA 2N5FA 2H8LA 5FWGA 1UC7A 1QFNA 1Z5YE 1AQWA 2KUCA 4KX4A 2WS2A 2D2ZA 3WYWA 3KEBA 4TXOA 5B8BA 1BYEA 5KEJA 2YWIA 4IS0A 1XPVA 4YH2A 5DJMA 1BQ7A 1X5DA 3O3TA 4D73B 1OC9A 4H86A 1C72A 3ZVJA 4O92A 1WE0A 4ML1A 1EP8A 1TRSA 4X0XA 5D9VA 4IJIA 4ZL9A 3IAS2 2J23A 3WGDA 1G0TA 2DSAA 2UZ8A 5G1KA 3KCMA 5H5SA 4G0IA 5J41A 5J9BA 4FIWA 3HHVA 3CSIA 4OFNA 4TXVA 3D21A 4K6XA 1A2JA 2HRKB 2VM2A 3H8QA 5EPFA 5H5RA 2HQTA 4ECIA 4PQ1A 4XS6A 4KH7A 2ES7A 4KA0A 1CQGA 1Z6NA 3HYPA 3CSHA 2Z9SA
chains in the Genus database with same CATH superfamily
3RPNA 5DCGA 2DLXA 1I1IP 1TP9A 2KLXA 3G7JA 4V2MA 2YZUA 2R6KA 3Q6OA 3HXSA 4DEJA 3GX8A 1U87A 5E59A 3DIEA 1JZRA 2RM5A 2FWFA 2RUFA 1XZOA 1ZMAA 5HR0A 3D4MA 1TOFA 4GDFA 5LNKe 3F6DA 4JR4A 2FUG2 2HSHA 2H6XA 5DAKB 1ABAA 3ZZXA 4L5LA 5IO2A 12GSA 3GV1A 2LV3A 3ERWA 2FA8A 4ID0A 3ERGA 2GQMA 4LL1B 1NSWA 1KBNA 1G6YA 1SYXA 2WZSA 1GULA 2DKIA 1K0CA 2IN3A 4K7OA 2B7JA 4G0KA 3MNGA 1M2DA 2YV7A 3KGKA 1B9XC 3EPTA 3R2QA 1Q98A 4V1Ap 2DJKA 1YEWC 2KP1A 1SK2A 4IKHA 2HZFA 5IMZA 4K2DA 3QFBC 2C0FA 2VCTA 4OCEA 2C3TA 4V1Ag 5ECQB 2VL2C 3IE3A 1OYJA 4TXOB 5B6NA 1W4VA 2H70A 4OCFA 2X4AA 3KTBA 1V57A 1XWBA 3NOFA 1PA3A 2L6CA 1F37A 2G2QA 4RI6A 1XVQA 4IN0A 3DWVA 2EFCA 1EWXA 4RQRA 2LRTA 2VL3A 4G01A 3A5IA 2TIRA 18GSA 1BG1A 2WCIA 3HA9A 4MABA 1WJKA 1UA5A 2B5XA 3ZL5A 1M0UA 4K5SA 1YEPA 3HVNA 1FW1A 3PINA 10GSA 2XC2A 4I8BA 1TK8B 4KUNA 2YZHA 4W66A 2B6MA 2DIZA 1RQMA 3GYKA 2YWOA 4FYUA 5KN3A 3EYTA 4O32A 4MJCA 4WKWA 5IQYA 2ON5A 1PFOA 3MAKA 5D9TA 2A2RA 3I69A 4HDEA 3LSZA 3M3MA 3P90A 2I3YA 3HD5A 6GSXA 1GSYA 2YN1A 2DMLA 4CY6A 2AJQB 3KMNA 4ZXGA 4OD7A 3KH9A 4POMA 2M46A 4ZL7A 4ICYA 3GURA 1SVLA 3M9JA 4HJMA 4HS1A 3E9JB 2FHEA 2C4JA 1UN2A 1LBKA 1Z6MA 2DJ0A 2WVXA 2OACA 3EINA 4ZB7A 3HJMA 5AGYA 1M7TA 2OA7A 3GUSA 4Z2UA 5KOXA 5IMDA 5DBQA 3A2XA 3P8WA 3EC3A 3G9BA 3Q18A 3GH6A 2L4CA 2IMIA 4ZBBA 2E2MA 3SBCA 1OKTA 1EZKA 1PX7A 2OKAA 4BIKA 5A4VA 4PGTA 4J56E 3H4KA 3IXRA 5AIVA 2HNLA 1PKZA 3ISOA 4GCIA 2IMFA 5D9WA 4MF7A 1XIYA 1BEDA 4I5QA 1NM3A 1VF4A 3HJPA 4ECCA 4I6XA 1SJ6A 1SL1B 4IQAA 1GTBA 4X1UA 3DKSA 1JFUA 5ECSA 1SJIA 4F0CA 2B3SA 4F03A 1ZOFA 1ZZYA 2GZZA 3ZMKA 3IBHA 4XS4A 1CQHA 2CAQA 3APQA 5ID2A 2F8FA 2N5AA 2PWJA 2LQOA 3UIWA 3Q19A 5D93A 4OO4A 2MMZA 2GSRA 3LFLA 2KP2A 4IP1A 5F0GA 4QL7A 1LU4A 3CWGA 4PQIA 1B9YC 2PVQA 3P2AA 1V98A 3TOTA 16GSA 4Q5NA 2V2GA 5HFIA 3DVXA 1SD9A 4GWRA 3L0HA 2IMEA 2F3MA 1JZOA 4IELA 1TI3A 3KZQA 1ON4A 2GZYA 4I97A 1BAYA 1G7OA 5C04A 4HU7A 1TTZA 4K0GA 2PERA 1XFLA 1KTEA 1ML6A 3CSJA 2H66A 2PU9C 1XOAA 3D6IA 2H0HA 4KDYA 5J4VA 2QKEA 1TDIA 4EO3A 2GTUA 4GLTA 3ERFA 4N0VA 2WVXB 3IHQA 3EMPA 4FQUA 2YJ7A 2LEGA 3F4RA 1HD2A 4E8HA 1DE1A 2K9FA 1GSQA 1MD3A 2VL9A 3KMOA 4OWYA 5IMFA 3M0FA 3GSSA 1EEMA 4MZBA 4F82A 1F3AA 2MYGA 5DVBA 4JZQA 11GSA 3F4TA 1ZYQB 4JEDA 1SVOA 3IPZA 5H5QA 4P3YB 1V58A 3TKQA 3FEUA 5D73A 1FVKA 3RDWA 5J47A 3F6FA 2L6DA 4TR3A 4X43A 4LLRA 1GSUA 1A8LA 1ERTA 4GRFA 2PUKC 4D73A 4HQSA 3OR5A 2RUEA 4ZB8A 5JCWA 1FO5A 1X9SB 3EVIA 1QQ2A 2O8VB 3EU4A 4O5RA 3IDVA 2EFEA 2VUPA 1YJ6A 3KP9A 2TRXA 2VKZG 2HZEA 4I2TA 4IQ1A 2IFQA 1MEKA 3M1GA 2TRCP 3IR4A 5DQSA 3CRTA 1ERUA 2C80A 4O5UA 4ECBA 4Q5FA 5ECNB 2DIYA 1TK0B 2OBIA 4AJ6A 5ID2B 4QMKA 2H73A 3TGZA 5CO3A 4WF5A 1R5PA 1PL1A 4PQHA 3HY2A 3VWVA 2M72A 1T8EB 2E2GA 4TR1A 4ZB9A 4EKZA 4GXZA 4KDUA 3QD9A 2RM6A 1VF3A 2CZ2A 3ED3A 4HI7A 4K2XA 3C1SA 1QMVA 2OBKA 5JWQB 2IWTA 2JZRA 2FY6A 3U5RE 2YANA 4YKGA 2R5GA 4XS1A 4V2LA 3R3EA 2RIIA 1T7PB 3ZIJA 2AV4A 3TKPA 2F51A 1J9BA 2BTOT 2PVOC 3A2WA 4KB3A 2H1GA 4BVXA 3SWLA 2R0CA 4RQXA 1EGOA 4LMWA 2H76A 3TB2A 2YWMA 4MF6A 1R5AA 4OMVA 3FR3A 4WR4A 5A1NA 5KN2A 2HLSA 2H1BA 4I2UA 2IIYA 3TRPA 4HEA2 2DKHA 2PMTA 4PI2C 1X9MB 3QAWA 1MD4A 1PKWA 4HSCX 2IL3A 3VURA 3D22A 1N2AA 1K0DA 1F2EA 5JWRB 2EC4A 3BCIA 3IK7A 1SK1A 3PGTA 3CHXC 1ZGNA 1MDIA 1T4YA 3W8SA 3QAGA 2CX4A 4K0NA 4POLA 2FWHA 4JU5A 1FVJA 4G10A 1AAZA 4K7IA 4NHZA 1FAAA 3BOAA 3D4TA 4EDZA 2LKUA 3GKNA 4N10A 5ECIB 2HZEB 3LQ7A 3CXGA 2PGTA 3KP8A 2H72A 4KCEA 3KTLA 1EV4A 2XHFA 4MA9A 4ULXA 2IFQB 4MH3A 2A2PA 2R0PA 2LJAA 5G1LA 1K0MA 5IPGA 3EURA 3NZNA 2VCZA 4J2FA 1ST9A 3IV4A 1SVMA 3WGEA 5J3RA 1QK8A 3F9UA 1O8WA 1TU7A 5A5HA 4HQZA 2HE3A 1THXA 3F8UA 1TXUA 3LXZA 4TR1B 3UVHA 3ZREA 5IIZA 4WBJA 1WWJA 2WJUA 4BVYA 4L0UA 1G7EA 1A0RP 1OE7A 2GSSA 2MMOA 1YVLA 3RHCA 3TJBA 3MDKA 3IHGA 2H01A 4YQVA 3GFKA 5KN0A 2FWEA 1VRSD 1DUGA 1M3IA 5F07A 1GSEA 3FKFA 1GTAA 2HFDA 3IA1A 3MIXA 1O73A 2L4QA 4PTSA 4G2EA 4AJ7A 4BVXB 2L5OA 3GKKA 4HU9A 3TJGA 3QFAC 1X9WB 2B7KA 3EMXA 2WVZA 1NW2A 4Z7XA 3MYDA 2QA2A 3GRXA 5A1NB 1BG5A 1FB0A 1SYRA 3ME8A 5IO0A 2GQLA 19GSA 3VK9A 4E68A 3H79A 5AISA 4RUVA 2O89A 3C73A 2WFCA 4TKYA 3HVVA 2VCXA 14GSA 3O6TA 2NPBA 2P5RA 3C7MA 4KSOA 4EDYA 2AHEA 3DD3A 1EOGA 4TVEA 4IBPA 4HZ2A 2WW1A 3A5WA 2QA1A 4MZCA 3RAZA 3L9VA 2C3NA 1FB6A 3JCML 2OADA 3UL3A 4PI0C 2OE0A 4ZBDA 4IGJA 3VPTA 3ZFBA 1GSDA 3AY8A 3FHKA 1V40A 3CTGA 2C1YA 4BPYA 2B5YA 4NAXA 3FK8A 3HVSA 3TJFA 3FY7A 3ZFLA 5GAPD 3ZITA 1HNBA 3FZAA 4PNGA 5JWOB 1HQOA 3QAVA 5A5HB 2VLUA 3H93A 4L8EA 4EXJA 2EIQA 1K3YA 1GSSA 2LS5A 1YKAA 3GMFA 1TK5B 1GWCA 5BMUA 3F0IA 3DYRA 4NXIA 3F3RA 4ZB6A 2H74A 4BVYB 1TJDA 1XXUA 5J9CA 1K3OA 1XCCA 1O8XA 5ECRB 1DSBA 3HKRA 3UBKA 1NHYA 4KSMA 5ECPB 4N0ZA 5J5NA 4MNNA 4HUAA 4K8MA 3J7Yk 2LQQA 5G5FA 5ELGA 2R2JA 4Q5QA 1AIUA 2VD0A 3LXTA 2YP6A 2VAFA 5F8BA 2X8GA 1I5GA 4GQCA 1AXDA 4IP6A 4GSNA 4YAPA 1URMA 1O85A 2WZ9A 4QQ7A 4FYCA 2I4AA 1DE2A 1PX6A 3GNJA 4EUYA 1U6TA 4BL7A 6GSSA 2XPEA 2CVBA 1HNAA 4KDXA 3TKRA 2H0GA 1B4QA 1YEXA 5IMAA 5A34A 4HJ2A 5CRHA 2GDRA 2MBSA 2X8HA 1JZDA 1Z7RA 4BWSA 4F0BA 3LGCA 1TI1A 4AI6A 2FCHA 3KIJA 3L4NA 4Z2RA 3O76A 2HSYA 3UMAA 2XBQA 4EF0A 5D8IA 2H1DA 3VLNA 2C0GA 4GSSA 2YPMA 5FHIA 1SU9A 2EFHA 4AJ8A 4ML6A 5CP1A 4N30A 5CAXA 5IPHA 2OE1A 1XWCA 1ILOA 5CRDA 2OJLA 2H71A 3WD6A 2VCWA 1TRWA 3FR9A 2HSMA 3VWWA 3VWXA 5BMUB 4WF4A 2OE3A 5HQPA 2K6VA 3C8EA 3CQFA 1A24A 1O81A 6GSVA 1U88A 1M3JA 2HT9A 1RW1A 1WRYA 1GLQA 3Q74A 2VD1A 5EY6A 4K5RA 2VCVA 2DJJA 1ERWA 2YOIA 5LCZA 1XWAA 2HSNA 2DBCA 2C0EA 1OAZA 4EL1A 2JL4A 2WGRA 2NDOA 3LG6A 5F06A 1YY7A 4OFTA 3W6GA 5A4WA 1S3DA 22GSA 2YCDA 1A23A 1ZYEA 5GSSA 2O5VA 1F9MA 2JZSA 2YWNA 3GL3A 3KD0A 3HZ4A 5HR3A 2GQKA 2IJYA 1OC3A 2H6ZA 3HZ8A 1SL2B 2P31A 1YF1A 2IMKA 1YZXA 4JRRA 3BBYA 4BL7B 3PH9A 1AC1A 5CRGA 1M9AA 4N3ZA 1EGRA 4AGSA 1FHEA 2WDUA 4XTSA 4EIPA 4FH8A 1SJZA 1Z3EA 2BMXA 5G31A 2R0GA 5GSTA 2I81A 5A34B 1O7UA 1SKSB 2EFDA 2P0GA 3C71A 3GIXA 1RK4A 3ZMLA 4KAEA 5G5EA 1K0NA 1TKDB 2CAIA 1YQ1A 4QL9A 1XW9A 3TRXA 5CREA 4LA1A 1VF2A 1M2BA 2X64A 1TXXA 3RFRC 5HFGA 5D96A 2LNTA 3A3TA 5DCHA 5HFKA 2AUVA 5GZZB 3F3QA 4PXOA 4WETA 1FOHA 1PGTA 4IHUA 2XPDA 4ZBAA 2A4VA 1K0OA 4MDCA 2VO4A 2LNSA 5IMCA 4ZL8A 3RPPA 2MMNA 2V41A 1FG4A 1XWGA 4WXTA 2AB6A 2HSMB 1GUMA 4POBA 4MPGA 2H0IA 1OE8A 3CYNA 2GSQA 1JLVA 3DXBA 3D0ZA 2M80A 5HR1A 2CVKA 3S9FA 1PN9A 5E4WA 4AKXB 2DMMA 2MBTA 1TW9A 1AW9A 3US3A 3HDCA 4BWQA 3TU3B 3FRCA 4TOPA 5ELAA 1R7HA 5DQYA 3QOUA 5J4YA 2HSNB 2J9HA 1VF1A 3CTFA 1EV9A 2ON7A 2E7PA 2C8UA 1A2LA 4POKA 1H4OA 3M9KA 2YJHA 3L78A 2VLTA 4JR6A 3GTUA 1TU8A 4X4JA 1HYUA 1TRUA 1K0AA 1ZYPA 1G6WA 4K7NA 4AKHA 4HOJA 2RLIA 4HZ4A 5DALA 2JU5A 1EP7A 5IOWA 4V2NA 1GNEA 1ERVA 3PPUA 1JZWA 2JADA 1JHBA 2FNOA 1A8YA 5JCGA 4KNDA 4IW9A 2L59A 1U3AA 4MJBA 3FZ9A 2CT6A 4DSSA 4XRAA 3IOSA 3UVTA 3QR6A 3EE2A 3I43A 3VFIA 2HRFA 3IK9A 1PSQA 2YNXA 2PBJA 4ZIJA 3VPQA 2X8CA 5CYYA 3IC4A 3GH9A 1F6MC 2WW2A 1AQXA 3GN3A 3MSZA 3HVXA 2CA8A 4G9HA 2B1LA 4MMMA 3E0UA 5KN1A 1S3AA 2LJKA 2NVLA 8GSSA 3G7IA 2IMDA 2LSTA 3TRQA 2PPTA 4G19A 2JZTA 2AAWA 1AQVA 4MCUA 2GZPA 5LD0A 4MP4A 3GL5A 7GSSA 4TW5A 1Y25A 1GRXA 4WBRD 1T00A 2WW3A 3ZYWA 3F63A 5C00A 1PMTA 5COHA 1FOVA 1I9DA 3VWUA 1PL2A 3KXOA 3A2VA 3RGBC 1Z7PA 4XIHA 2WW0A 3KJYA 1QGVA 4XRDA 1K3LA 4MPFA 3L9SA 2L5LA 3TKSC 1VGLA 1U3IA 4CDOA 4PNFA 4CHSA 4TRXA 4TN8A 2CX3A 2FD3A 2C0DA 4EC0A 2R4VA 4WR5A 4MZWA 3LJRA 4E8EA 2K18A 4FYBA 4BA7A 3TKSE 5ECKB 1XW6A 4AKGA 1GTUA 3G7YA 2HYXA 2IPAA 2B5EA 1X0RA 1T1VA 1AUCA 2H30A 3MWHA 3GTUB 1NHOA 1USBA 2QGVA 1F3BA 3LEFA 3I6AA 3TOUA 3M8NA 4PX1A 3DMLA 3HJOA 1E2YA 2HRNA 2LJRA 3QPMA 5DALB 3QCPA 3IC8A 6GSUA 4YQMA 4MK3A 4KE3A 4CY8A 1BJXA 1ACVA 3GHAA 4DSSB 1MDJA 1LJRA 2ZNMA 5ABRA 1DBYA 1N25A 4EVMA 4L5OA 2I1UA 3L9UA 2AYTA 2FA4A 3RBTA 1OC9B 1GP1A 1THOA 3UOMA 1IYIA 2GLRA 1Y1UA 3KH7A 3UBLA 5L71A 2DJ3A 3LYKA 1TRVA 1GUHA 3U6VA 5A4UA 3DRNA 4A5PA 3UAPA 3VI5A 4F2IA 2H1AA 4PHZC 2I9HA 2VLVA 2O7KA 1WOUA 2ZUPA 1SKWB 1KNGA 2X99A 3ZIVA 3EWLA 3W8JA 2DJ1A 3N5OA 3VI7A 2VOCA 4DSRA 5ECHB 1GH2A 1X5CA 2KOKA 5FT3A 1OVNA 2FWGA 5CRWA 2GT5A 4YAVA 4O7HA 2LRNA 4KCAA 2CVDA 4RI7A 3V1WA 3FZ5A 2QSIA 1ZYNA 4MJEA 2H75A 4DVCA 2H1LA 1O6JA 4GF0A 3EU3A 2FLSA 2R37A 3PR8A 3ZRDA 5CNWA 2V1MA 5B6MA 1GL8A 3TJJA 3E3EA 1EOHA 2FGXA 2WRTA 1GUKA 4ECJA 2HRAA 13GSA 1PD21 3QMXA 1GNWA 3FMWA 2O85A 4OO5A 3GA4A 2MMAA 4Z2TA 3ZTLA 2DJ2A 3UEMA 4PUFC 2CQ9A 1SL0B 4XCSA 2ZCTA 1A2MA 1PRXA 1M9BA 4NWYA 3J7Yb 2L57A 3F4SA 3LYPA 3CBUA 3HCZA 6GSYA 5J4UA 5IM9A 2H6YA 2LUSA 1V9WA 1R4WA 4FO5A 4ISDA 3I9V2 3LWAA 4J57E 1N8JA 3TKSA 2K8VA 2BJXA 2VCQA 4NV5A 3K8NA 4TR0A 3LORA 4KGIA 1GTIA 4Q5RA 3APOA 4K1FA 1OC8A 2ALBA 4PUAA 3C1RA 5INYA 3APSA 2GVPA 1SKRB 4KW6A 5D9XA 5AIXA 2K8SA 4NPBA 5G2ZA 3QDNA 3KM6A 5A5KA 5J40A 1XBSA 4JBBA 3GKMA 3P7XA 1OKDA 1K0BA 1Y6EA 4NMUA 2WB9A 1X5EA 2JSYA 1GLPA 4EIQA 2REMA 2CZ3A 3DVWA 3DGQA 3WT1A 1V2AA 2NTOA 2HI7A 4IVFA 3WT2A 4MLYA 5EVOA 1XW5A 3UJ1A 3FYGA 2VL2A 1T4ZA 5DJLA 3FW2A 3ZLPA 2PN8A 3CRUA 1M99A 1ZCPA 2O87A 4GSTA 2X49A 4G0LA 1MDKA 4MH2A 4EE0A 1UVZA 2V6KA 2R3XA 4PURA 1J0FA 3FZ4A 5ENUA 1WMJA 3LW9A 1PQNA 3ME7A 2N5BA 4YQUA 2UV8G 1HNCA 3GKXA 4N11A 5EL8A 1H75A 9GSSA 1GSFA 3N9JA 3BCKA 4ZILA 4AF2A 4KF9A 6GSWA 5HR2A 17GSA 3TUEA 6GSTA 1E6BA 1XOBA 5B7CA 1YF0A 5IOXA 1YDKA 2WVYA 1S4BP 3HMJG 1SENA 1WPIA 4LL4B 4ACSA 20GSA 1XWKA 1WIKA 2WULA 1Q4JA 3IAM2 2A2SA 2MZCA 1R26A 2JSZA 4TR4A 1ZL9A 2LTKA 2F9SA 1EEJA 3TJKA 1B48A 1Z9HA 3UARA 1T3BA 2C3QA 1S3RA 2QC7A 3GSTA 1A0FA 3ZVJD 2EIOA 1JLWA 2V6OA 3FR6A 2DC5A 4MF5A 4DSQA 2VM1A 5G30A 1KEBA 2P5QA 1XG8A 5IMVA 1W89A 1M2AA 4XS4B 3CMIA 4YKFA 1B8XA 4LMVA 1WP0A 4NHWA 2HRKA 5F05A 5JCUA 2G0FA 2XBIA 4USSA 1SK0A 2V32A 1QXHA 5BRTA 1XVWA 2EIRA 4GTUA 3TCOA 4MJAA 3DEXA 3GX0A 5AN1A 3TDGA 3RHBA 4CW9A 4F9ZA 2KHPA 5ECMB 4WEYA 5GAND 2GS3A 3BJ5A 3NIVA 5DDLA 2F8AA 2H19A 2VIMA 1IYHA 5ECOB 2GGTA 4XHMA 4ILFA 4FXYP 1S3CA 4O5QA 3WGXA 4K9ZA 2OT3A 2GSTA 4L0WA 2B1KA 2O36A 2LRCA 5ECLB 2GT6A 2E0QA 5DAKA 2YV9A 2JACA 2NBSA 5KOWA 1MTCA 1YKCA 1J08A 2CV4A 4GQFA 4IJ3A 1BX9A 3IRAA 4OFMA 4JE1A 2O3EA 4NV2A 5B8AA 3BD2A 1QUWA 2HXKA 1B4PA 1SD8A 3H1NA 1PN0A 3D5JA 2N5FA 2H8LA 5FWGA 1UC7A 1QFNA 1Z5YE 1AQWA 2KUCA 4KX4A 2WS2A 2D2ZA 3WYWA 2A4HA 3KEBA 4TXOA 5B8BA 1BYEA 5KEJA 2YWIA 4IS0A 1XPVA 4YH2A 1BF5A 5DJMA 1BQ7A 1X5DA 3O3TA 4D73B 4AKIA 1OC9A 4H86A 1C72A 3ZVJA 4O92A 1WE0A 4ML1A 1EP8A 1TRSA 4X0XA 5D9VA 4IJIA 4ZL9A 3IAS2 2J23A 3WGDA 1G0TA 2DSAA 2UZ8A 5G1KA 3KCMA 5H5SA 4G0IA 5J41A 5J9BA 4FIWA 3HHVA 3CSIA 4OFNA 4TXVA 3D21A 4K6XA 1A2JA 2HRKB 2VM2A 3H8QA 5EPFA 5H5RA 2HQTA 4ECIA 4PQ1A 4XS6A 4KH7A 2ES7A 4KA0A 1CQGA 1Z6NA 3HYPA 3CSHA 2Z9SA
chains in the Genus database with same CATH topology
3RPNA 5DCGA 2DLXA 1TP9A 2KLXA 3G7JA 4V2MA 2YZUA 2R6KA 3Q6OA 3HXSA 4DEJA 3GX8A 1U87A 5E59A 3DIEA 1JZRA 2RM5A 2FWFA 2RUFA 1XZOA 1ZMAA 5HR0A 3D4MA 1TOFA 4GDFA 5LNKe 3F6DA 4JR4A 2FUG2 2HSHA 2H6XA 5DAKB 1ABAA 3ZZXA 4L5LA 5IO2A 12GSA 3GV1A 2LV3A 3ERWA 2FA8A 4ID0A 3ERGA 2GQMA 4LL1B 1NSWA 1KBNA 1G6YA 1SYXA 1GULA 2DKIA 1K0CA 2IN3A 4K7OA 2B7JA 4G0KA 3MNGA 1M2DA 2YV7A 3KGKA 1B9XC 3EPTA 3R2QA 1Q98A 4V1Ap 2DJKA 2KP1A 1SK2A 4IKHA 2HZFA 5IMZA 4K2DA 3QFBC 2C0FA 2VCTA 4OCEA 2C3TA 4V1Ag 5ECQB 2VL2C 3IE3A 1OYJA 4TXOB 5B6NA 1W4VA 2H70A 4OCFA 2X4AA 3KTBA 1V57A 1XWBA 3NOFA 1PA3A 2L6CA 1F37A 2G2QA 4RI6A 1XVQA 4IN0A 3DWVA 2EFCA 1EWXA 4RQRA 2LRTA 2VL3A 4G01A 3A5IA 2TIRA 18GSA 1BG1A 2WCIA 3HA9A 4MABA 1WJKA 1UA5A 2B5XA 3ZL5A 1M0UA 4K5SA 1YEPA 1FW1A 3PINA 10GSA 2XC2A 4I8BA 1TK8B 4KUNA 2YZHA 4W66A 2B6MA 2DIZA 1RQMA 3GYKA 2YWOA 4FYUA 5KN3A 3EYTA 4O32A 4MJCA 4WKWA 5IQYA 2ON5A 3MAKA 5D9TA 2A2RA 3I69A 4HDEA 3LSZA 3M3MA 3P90A 2I3YA 3HD5A 6GSXA 1GSYA 2YN1A 2DMLA 4CY6A 2AJQB 3KMNA 4ZXGA 4OD7A 3KH9A 4POMA 2M46A 4ZL7A 4ICYA 3GURA 1SVLA 3M9JA 4HJMA 4HS1A 3E9JB 2FHEA 2C4JA 1UN2A 1LBKA 1Z6MA 2DJ0A 2OACA 3EINA 4ZB7A 3HJMA 5AGYA 1M7TA 2OA7A 3GUSA 4Z2UA 5KOXA 5IMDA 5DBQA 3A2XA 3P8WA 3EC3A 3G9BA 3Q18A 3GH6A 2L4CA 2IMIA 4ZBBA 2E2MA 3SBCA 1OKTA 1EZKA 1PX7A 2OKAA 5A4VA 4PGTA 4J56E 3H4KA 3IXRA 5AIVA 2HNLA 1PKZA 3ISOA 4GCIA 2IMFA 5D9WA 4MF7A 1XIYA 1BEDA 4I5QA 1NM3A 1VF4A 3HJPA 4ECCA 4I6XA 1SJ6A 1SL1B 4IQAA 1GTBA 4X1UA 3DKSA 1JFUA 5ECSA 1SJIA 4F0CA 2B3SA 4F03A 1ZOFA 1ZZYA 2GZZA 3ZMKA 3IBHA 4XS4A 1CQHA 2CAQA 3APQA 5ID2A 2F8FA 2N5AA 2PWJA 2LQOA 3UIWA 3Q19A 5D93A 4OO4A 2MMZA 2GSRA 3LFLA 2KP2A 4IP1A 5F0GA 4QL7A 1LU4A 3CWGA 4PQIA 1B9YC 2PVQA 3P2AA 1V98A 3TOTA 16GSA 4Q5NA 2V2GA 5HFIA 3DVXA 1SD9A 4GWRA 3L0HA 2IMEA 2F3MA 1JZOA 4IELA 1TI3A 3KZQA 1ON4A 2GZYA 4I97A 1BAYA 1G7OA 5C04A 4HU7A 1TTZA 4K0GA 2PERA 1XFLA 1KTEA 1ML6A 3CSJA 2H66A 2PU9C 1XOAA 3D6IA 2H0HA 4KDYA 5J4VA 2QKEA 1TDIA 4EO3A 2GTUA 4GLTA 3ERFA 4N0VA 3IHQA 3EMPA 4FQUA 2YJ7A 2LEGA 3F4RA 1HD2A 4E8HA 1DE1A 2K9FA 1GSQA 1MD3A 2VL9A 3KMOA 4OWYA 5IMFA 3M0FA 3GSSA 1EEMA 4MZBA 4F82A 1F3AA 2MYGA 5DVBA 4JZQA 11GSA 3F4TA 1ZYQB 4JEDA 1SVOA 3IPZA 5H5QA 4P3YB 1V58A 3TKQA 3FEUA 5D73A 1FVKA 3RDWA 5J47A 3F6FA 2L6DA 4TR3A 4X43A 4LLRA 1GSUA 1A8LA 1ERTA 4GRFA 2PUKC 4D73A 4HQSA 3OR5A 2RUEA 4ZB8A 5JCWA 1FO5A 1X9SB 3EVIA 1QQ2A 2O8VB 3EU4A 4O5RA 3IDVA 2EFEA 2VUPA 1YJ6A 3KP9A 2TRXA 2VKZG 2HZEA 4I2TA 4IQ1A 2IFQA 1MEKA 3M1GA 2TRCP 3IR4A 5DQSA 3CRTA 1ERUA 2C80A 4O5UA 4ECBA 4Q5FA 5ECNB 2DIYA 1TK0B 2OBIA 4AJ6A 5ID2B 4QMKA 2H73A 3TGZA 5CO3A 4WF5A 1R5PA 1PL1A 4PQHA 3HY2A 3VWVA 2M72A 1T8EB 2E2GA 4TR1A 4ZB9A 4EKZA 4GXZA 4KDUA 3QD9A 2RM6A 1VF3A 2CZ2A 3ED3A 4HI7A 4K2XA 3C1SA 1QMVA 2OBKA 5JWQB 2IWTA 2JZRA 2FY6A 3U5RE 2YANA 4YKGA 2R5GA 4XS1A 4V2LA 3R3EA 2RIIA 1T7PB 3ZIJA 2AV4A 3TKPA 2F51A 1J9BA 2BTOT 2PVOC 3A2WA 4KB3A 2H1GA 4BVXA 3SWLA 2R0CA 4RQXA 1EGOA 4LMWA 2H76A 3TB2A 2YWMA 4MF6A 1R5AA 4OMVA 3FR3A 4WR4A 5A1NA 5KN2A 2HLSA 2H1BA 4I2UA 2IIYA 3TRPA 4HEA2 2DKHA 2PMTA 1X9MB 3QAWA 1MD4A 1PKWA 2IL3A 3VURA 3D22A 1N2AA 1K0DA 1F2EA 5JWRB 2EC4A 3BCIA 3IK7A 1SK1A 3PGTA 1ZGNA 1MDIA 1T4YA 3W8SA 3QAGA 2CX4A 4K0NA 4POLA 2FWHA 4JU5A 1FVJA 4G10A 1AAZA 4K7IA 4NHZA 1FAAA 3BOAA 3D4TA 4EDZA 2LKUA 3GKNA 4N10A 5ECIB 2HZEB 3LQ7A 3CXGA 2PGTA 3KP8A 2H72A 4KCEA 3KTLA 1EV4A 2XHFA 4MA9A 4ULXA 2IFQB 4MH3A 2A2PA 2R0PA 2LJAA 5G1LA 1K0MA 5IPGA 3EURA 3NZNA 2VCZA 4J2FA 1ST9A 3IV4A 1SVMA 3WGEA 5J3RA 1QK8A 3F9UA 1O8WA 1TU7A 5A5HA 4HQZA 2HE3A 1THXA 3F8UA 1TXUA 3LXZA 4TR1B 3UVHA 3ZREA 5IIZA 4WBJA 1WWJA 2WJUA 4BVYA 4L0UA 1G7EA 1A0RP 1OE7A 2GSSA 2MMOA 1YVLA 3RHCA 3TJBA 3MDKA 3IHGA 2H01A 4YQVA 3GFKA 5KN0A 2FWEA 1VRSD 1DUGA 5F07A 1GSEA 3FKFA 1GTAA 2HFDA 3IA1A 3MIXA 1O73A 2L4QA 4PTSA 4G2EA 4AJ7A 4BVXB 2L5OA 3GKKA 4HU9A 3TJGA 3QFAC 1X9WB 2B7KA 3EMXA 1NW2A 4Z7XA 3MYDA 2QA2A 3GRXA 5A1NB 1BG5A 1FB0A 1SYRA 3ME8A 5IO0A 2GQLA 19GSA 3VK9A 4E68A 3H79A 5AISA 4RUVA 2O89A 3C73A 2WFCA 4TKYA 3HVVA 2VCXA 14GSA 3O6TA 2NPBA 2P5RA 3C7MA 4KSOA 4EDYA 2AHEA 3DD3A 1EOGA 4TVEA 4IBPA 4HZ2A 3A5WA 2QA1A 4MZCA 3RAZA 3L9VA 2C3NA 1FB6A 3JCML 2OADA 3UL3A 2OE0A 4ZBDA 4IGJA 3VPTA 3ZFBA 1GSDA 3AY8A 3FHKA 1V40A 3CTGA 2C1YA 4BPYA 2B5YA 4NAXA 3FK8A 3HVSA 3TJFA 3FY7A 3ZFLA 5GAPD 3ZITA 1HNBA 3FZAA 4PNGA 5JWOB 1HQOA 3QAVA 5A5HB 2VLUA 3H93A 4L8EA 4EXJA 2EIQA 1K3YA 1GSSA 2LS5A 1YKAA 3GMFA 1TK5B 1GWCA 5BMUA 3F0IA 3DYRA 4NXIA 3F3RA 4ZB6A 2H74A 4BVYB 1TJDA 1XXUA 5J9CA 1K3OA 1XCCA 1O8XA 5ECRB 1DSBA 3HKRA 3UBKA 1NHYA 4KSMA 5ECPB 4N0ZA 5J5NA 4MNNA 4HUAA 4K8MA 3J7Yk 2LQQA 5G5FA 5ELGA 2R2JA 4Q5QA 1AIUA 2VD0A 3LXTA 2YP6A 2VAFA 5F8BA 2X8GA 1I5GA 4GQCA 1AXDA 4IP6A 4GSNA 4YAPA 1URMA 1O85A 2WZ9A 4QQ7A 4FYCA 2I4AA 1DE2A 1PX6A 3GNJA 4EUYA 1U6TA 4BL7A 6GSSA 2XPEA 2CVBA 1HNAA 4KDXA 3TKRA 2H0GA 1B4QA 1YEXA 5IMAA 5A34A 4HJ2A 5CRHA 2GDRA 2MBSA 2X8HA 1JZDA 1Z7RA 4BWSA 4F0BA 3LGCA 1TI1A 4AI6A 2FCHA 3KIJA 3L4NA 4Z2RA 3O76A 2HSYA 3UMAA 2XBQA 4EF0A 5D8IA 2H1DA 3VLNA 2C0GA 4GSSA 2YPMA 5FHIA 1SU9A 2EFHA 4AJ8A 4ML6A 5CP1A 4N30A 5CAXA 5IPHA 2OE1A 1XWCA 1ILOA 5CRDA 2OJLA 2H71A 3WD6A 2VCWA 1TRWA 3FR9A 2HSMA 3VWWA 3VWXA 5BMUB 4WF4A 2OE3A 5HQPA 2K6VA 3C8EA 1A24A 1O81A 6GSVA 1U88A 2HT9A 1RW1A 1WRYA 1GLQA 3Q74A 2VD1A 5EY6A 4K5RA 2VCVA 2DJJA 1ERWA 2YOIA 5LCZA 1XWAA 2HSNA 2DBCA 2C0EA 1OAZA 4EL1A 2JL4A 2WGRA 2NDOA 3LG6A 5F06A 1YY7A 4OFTA 3W6GA 5A4WA 1S3DA 22GSA 2YCDA 1A23A 1ZYEA 5GSSA 2O5VA 1F9MA 2JZSA 2YWNA 3GL3A 3KD0A 3HZ4A 5HR3A 2GQKA 2IJYA 1OC3A 2H6ZA 3HZ8A 1SL2B 2P31A 1YF1A 2IMKA 1YZXA 4JRRA 3BBYA 4BL7B 3PH9A 1AC1A 5CRGA 1M9AA 4N3ZA 1EGRA 4AGSA 1FHEA 2WDUA 4XTSA 4EIPA 4FH8A 1SJZA 1Z3EA 2BMXA 5G31A 2R0GA 5GSTA 2I81A 5A34B 1O7UA 1SKSB 2EFDA 2P0GA 3C71A 3GIXA 1RK4A 3ZMLA 4KAEA 5G5EA 1K0NA 1TKDB 2CAIA 1YQ1A 4QL9A 1XW9A 3TRXA 5CREA 4LA1A 1VF2A 1M2BA 2X64A 1TXXA 5HFGA 5D96A 2LNTA 3A3TA 5DCHA 5HFKA 2AUVA 5GZZB 3F3QA 4PXOA 4WETA 1FOHA 1PGTA 4IHUA 2XPDA 4ZBAA 2A4VA 1K0OA 4MDCA 2VO4A 2LNSA 5IMCA 4ZL8A 3RPPA 2MMNA 2V41A 1FG4A 1XWGA 4WXTA 2AB6A 2HSMB 1GUMA 4POBA 4MPGA 2H0IA 1OE8A 3CYNA 2GSQA 1JLVA 3DXBA 3D0ZA 2M80A 5HR1A 2CVKA 3S9FA 1PN9A 5E4WA 4AKXB 2DMMA 2MBTA 1TW9A 1AW9A 3US3A 3HDCA 4BWQA 3TU3B 3FRCA 4TOPA 5ELAA 1R7HA 5DQYA 3QOUA 5J4YA 2HSNB 2J9HA 1VF1A 3CTFA 1EV9A 2ON7A 2E7PA 2C8UA 1A2LA 4POKA 1H4OA 3M9KA 2YJHA 3L78A 2VLTA 4JR6A 3GTUA 1TU8A 4X4JA 1HYUA 1TRUA 1K0AA 1ZYPA 1G6WA 4K7NA 4AKHA 4HOJA 2RLIA 4HZ4A 5DALA 2JU5A 1EP7A 5IOWA 4V2NA 1GNEA 1ERVA 3PPUA 1JZWA 2JADA 1JHBA 2FNOA 1A8YA 5JCGA 4KNDA 4IW9A 2L59A 1U3AA 4MJBA 3FZ9A 2CT6A 4DSSA 4XRAA 3IOSA 3UVTA 3QR6A 3EE2A 3I43A 3VFIA 2HRFA 3IK9A 1PSQA 2YNXA 2PBJA 4ZIJA 3VPQA 2X8CA 5CYYA 3IC4A 3GH9A 1F6MC 1AQXA 3GN3A 3MSZA 3HVXA 2CA8A 4G9HA 2B1LA 4MMMA 3E0UA 5KN1A 1S3AA 2LJKA 2NVLA 8GSSA 3G7IA 2IMDA 2LSTA 3TRQA 2PPTA 4G19A 2JZTA 2AAWA 1AQVA 4MCUA 2GZPA 5LD0A 4MP4A 3GL5A 7GSSA 4TW5A 1Y25A 1GRXA 4WBRD 1T00A 3ZYWA 3F63A 5C00A 1PMTA 5COHA 1FOVA 1I9DA 3VWUA 1PL2A 3KXOA 3A2VA 1Z7PA 4XIHA 3KJYA 1QGVA 4XRDA 1K3LA 4MPFA 3L9SA 2L5LA 3TKSC 1VGLA 1U3IA 4CDOA 4PNFA 4CHSA 4TRXA 4TN8A 2CX3A 2FD3A 2C0DA 4EC0A 2R4VA 4WR5A 4MZWA 3LJRA 4E8EA 2K18A 4FYBA 4BA7A 3TKSE 5ECKB 1XW6A 4AKGA 1GTUA 3G7YA 2HYXA 2IPAA 2B5EA 1X0RA 1T1VA 1AUCA 2H30A 3MWHA 3GTUB 1NHOA 1USBA 2QGVA 1F3BA 3LEFA 3I6AA 3TOUA 3M8NA 4PX1A 3DMLA 3HJOA 1E2YA 2HRNA 2LJRA 3QPMA 5DALB 3QCPA 3IC8A 6GSUA 4YQMA 4MK3A 4KE3A 4CY8A 1BJXA 1ACVA 3GHAA 4DSSB 1MDJA 1LJRA 2ZNMA 5ABRA 1DBYA 1N25A 4EVMA 4L5OA 2I1UA 3L9UA 2AYTA 2FA4A 3RBTA 1OC9B 1GP1A 1THOA 3UOMA 1IYIA 2GLRA 1Y1UA 3KH7A 3UBLA 5L71A 2DJ3A 3LYKA 1TRVA 1GUHA 3U6VA 5A4UA 3DRNA 4A5PA 3UAPA 3VI5A 4F2IA 2H1AA 2I9HA 2VLVA 2O7KA 1WOUA 2ZUPA 1SKWB 1KNGA 2X99A 3ZIVA 3EWLA 3W8JA 2DJ1A 3N5OA 3VI7A 2VOCA 4DSRA 5ECHB 1GH2A 1X5CA 2KOKA 5FT3A 1OVNA 2FWGA 5CRWA 2GT5A 4YAVA 4O7HA 2LRNA 4KCAA 2CVDA 4RI7A 3V1WA 3FZ5A 2QSIA 1ZYNA 4MJEA 2H75A 4DVCA 2H1LA 1O6JA 4GF0A 3EU3A 2FLSA 2R37A 3PR8A 3ZRDA 5CNWA 2V1MA 5B6MA 1GL8A 3TJJA 3E3EA 1EOHA 2FGXA 2WRTA 1GUKA 4ECJA 2HRAA 13GSA 1PD21 3QMXA 1GNWA 3FMWA 2O85A 4OO5A 3GA4A 2MMAA 4Z2TA 3ZTLA 2DJ2A 3UEMA 4PUFC 2CQ9A 1SL0B 4XCSA 2ZCTA 1A2MA 1PRXA 1M9BA 4NWYA 3J7Yb 2L57A 3F4SA 3LYPA 3CBUA 3HCZA 6GSYA 5J4UA 5IM9A 2H6YA 2LUSA 1V9WA 1R4WA 4FO5A 4ISDA 3LWAA 3I9V2 4J57E 1N8JA 3TKSA 2K8VA 2BJXA 2VCQA 4NV5A 3K8NA 4TR0A 3LORA 4KGIA 1GTIA 4Q5RA 3APOA 4K1FA 1OC8A 2ALBA 4PUAA 3C1RA 5INYA 3APSA 2GVPA 1SKRB 4KW6A 5D9XA 5AIXA 2K8SA 4NPBA 5G2ZA 3QDNA 3KM6A 5A5KA 5J40A 1XBSA 4JBBA 3GKMA 3P7XA 1OKDA 1K0BA 1Y6EA 4NMUA 2WB9A 1X5EA 2JSYA 1GLPA 4EIQA 2REMA 2CZ3A 3DVWA 3DGQA 3WT1A 1V2AA 2NTOA 2HI7A 4IVFA 3WT2A 4MLYA 5EVOA 1XW5A 3UJ1A 3FYGA 2VL2A 1T4ZA 5DJLA 3FW2A 3ZLPA 2PN8A 3CRUA 1M99A 1ZCPA 2O87A 4GSTA 2X49A 4G0LA 1MDKA 4MH2A 4EE0A 1UVZA 2V6KA 2R3XA 4PURA 1J0FA 3FZ4A 5ENUA 1WMJA 3LW9A 1PQNA 3ME7A 2N5BA 4YQUA 2UV8G 1HNCA 3GKXA 4N11A 5EL8A 1H75A 9GSSA 1GSFA 3N9JA 3BCKA 4ZILA 4AF2A 4KF9A 6GSWA 5HR2A 17GSA 3TUEA 6GSTA 1E6BA 1XOBA 5B7CA 1YF0A 5IOXA 1YDKA 3HMJG 1SENA 1WPIA 4LL4B 4ACSA 20GSA 1XWKA 1WIKA 2WULA 1Q4JA 3IAM2 2A2SA 2MZCA 1R26A 2JSZA 4TR4A 1ZL9A 2LTKA 2F9SA 1EEJA 3TJKA 1B48A 1Z9HA 3UARA 1T3BA 2C3QA 2QC7A 3GSTA 1A0FA 3ZVJD 2EIOA 1JLWA 2V6OA 3FR6A 2DC5A 4MF5A 4DSQA 2VM1A 5G30A 1KEBA 2P5QA 5IMVA 1W89A 1M2AA 4XS4B 3CMIA 4YKFA 1B8XA 4LMVA 1WP0A 4NHWA 2HRKA 5F05A 5JCUA 2G0FA 2XBIA 4USSA 1SK0A 2V32A 1QXHA 5BRTA 1XVWA 2EIRA 4GTUA 3TCOA 4MJAA 3DEXA 3GX0A 5AN1A 3TDGA 3RHBA 4CW9A 4F9ZA 2KHPA 5ECMB 4WEYA 5GAND 2GS3A 3BJ5A 3NIVA 5DDLA 2F8AA 2H19A 2VIMA 1IYHA 5ECOB 2GGTA 4XHMA 4ILFA 1S3CA 4O5QA 3WGXA 4K9ZA 2OT3A 2GSTA 4L0WA 2B1KA 2LRCA 5ECLB 2GT6A 2E0QA 5DAKA 2YV9A 2JACA 2NBSA 5KOWA 1MTCA 1YKCA 1J08A 2CV4A 4GQFA 4IJ3A 1BX9A 3IRAA 4OFMA 4JE1A 4NV2A 5B8AA 3BD2A 1QUWA 2HXKA 1B4PA 1SD8A 3H1NA 1PN0A 3D5JA 2N5FA 2H8LA 5FWGA 1UC7A 1QFNA 1Z5YE 1AQWA 2KUCA 4KX4A 2WS2A 2D2ZA 3WYWA 2A4HA 3KEBA 4TXOA 5B8BA 1BYEA 5KEJA 2YWIA 4IS0A 1XPVA 4YH2A 1BF5A 5DJMA 1BQ7A 1X5DA 3O3TA 4D73B 4AKIA 1OC9A 4H86A 1C72A 3ZVJA 4O92A 1WE0A 4ML1A 1EP8A 1TRSA 4X0XA 5D9VA 4IJIA 4ZL9A 3IAS2 2J23A 3WGDA 1G0TA 2DSAA 2UZ8A 5G1KA 3KCMA 5H5SA 4G0IA 5J41A 5J9BA 4FIWA 3HHVA 3CSIA 4OFNA 4TXVA 3D21A 4K6XA 1A2JA 2HRKB 2VM2A 3H8QA 5EPFA 5H5RA 2HQTA 4ECIA 4PQ1A 4XS6A 4KH7A 2ES7A 4KA0A 1CQGA 1Z6NA 3HYPA 3CSHA 2Z9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPN A;  5DCG A;  2DLX A;  1TP9 A;  2KLX A;  3G7J A;  4V2M A;  2YZU A;  2R6K A;  3Q6O A;  3HXS A;  4DEJ A;  3GX8 A;  1U87 A;  5E59 A;  3DIE A;  1JZR A;  2RM5 A;  2FWF A;  2RUF A;  1XZO A;  1ZMA A;  5HR0 A;  3D4M A;  1TOF A;  5LNK e;  3F6D A;  4JR4 A;  2FUG 2;  2HSH A;  2H6X A;  5DAK B;  1ABA A;  3ZZX A;  4L5L A;  5IO2 A;  12GS A;  3GV1 A;  2LV3 A;  3ERW A;  2FA8 A;  4ID0 A;  3ERG A;  2GQM A;  4LL1 B;  1NSW A;  1KBN A;  1G6Y A;  1SYX A;  1GUL A;  1K0C A;  2IN3 A;  4K7O A;  2B7J A;  4G0K A;  3MNG A;  1M2D A;  2YV7 A;  3KGK A;  1B9X C;  3R2Q A;  1Q98 A;  4V1A p;  2DJK A;  2KP1 A;  1SK2 A;  4IKH A;  2HZF A;  5IMZ A;  4K2D A;  3QFB C;  2C0F A;  2VCT A;  4OCE A;  2C3T A;  4V1A g;  5ECQ B;  2VL2 C;  3IE3 A;  1OYJ A;  4TXO B;  5B6N A;  1W4V A;  2H70 A;  4OCF A;  3KTB A;  1V57 A;  1XWB A;  3NOF A;  1PA3 A;  2L6C A;  1F37 A;  2G2Q A;  4RI6 A;  1XVQ A;  4IN0 A;  3DWV A;  1EWX A;  4RQR A;  2LRT A;  2VL3 A;  2TIR A;  18GS A;  2WCI A;  3HA9 A;  4MAB A;  1WJK A;  1UA5 A;  2B5X A;  3ZL5 A;  1M0U A;  1YEP A;  1FW1 A;  3PIN A;  10GS A;  2XC2 A;  4I8B A;  1TK8 B;  4KUN A;  2YZH A;  2B6M A;  2DIZ A;  1RQM A;  3GYK A;  2YWO A;  4FYU A;  5KN3 A;  3EYT A;  4O32 A;  4MJC A;  4WKW A;  5IQY A;  2ON5 A;  3MAK A;  5D9T A;  2A2R A;  3I69 A;  4HDE A;  3LSZ A;  3M3M A;  3P90 A;  2I3Y A;  3HD5 A;  6GSX A;  1GSY A;  2YN1 A;  2DML A;  2AJQ B;  3KMN A;  4ZXG A;  4OD7 A;  3KH9 A;  4POM A;  2M46 A;  4ZL7 A;  3GUR A;  3M9J A;  4HJM A;  4HS1 A;  3E9J B;  2FHE A;  2C4J A;  1UN2 A;  1LBK A;  1Z6M A;  2DJ0 A;  2OAC A;  3EIN A;  3HJM A;  5AGY A;  1M7T A;  2OA7 A;  3GUS A;  5IMD A;  5DBQ A;  3A2X A;  3P8W A;  3EC3 A;  3G9B A;  3Q18 A;  3GH6 A;  2L4C A;  2IMI A;  4ZBB A;  2E2M A;  3SBC A;  1OKT A;  1EZK A;  1PX7 A;  2OKA A;  5A4V A;  4PGT A;  4J56 E;  3H4K A;  3IXR A;  5AIV A;  2HNL A;  1PKZ A;  3ISO A;  4GCI A;  2IMF A;  5D9W A;  4MF7 A;  1XIY A;  1BED A;  4I5Q A;  1NM3 A;  1VF4 A;  3HJP A;  4ECC A;  4I6X A;  1SJ6 A;  1SL1 B;  4IQA A;  1GTB A;  4X1U A;  3DKS A;  1JFU A;  5ECS A;  1SJI A;  4F0C A;  2B3S A;  4F03 A;  1ZOF A;  1ZZY A;  2GZZ A;  3ZMK A;  3IBH A;  4XS4 A;  1CQH A;  2CAQ A;  3APQ A;  5ID2 A;  2F8F A;  2N5A A;  2PWJ A;  2LQO A;  3UIW A;  3Q19 A;  5D93 A;  4OO4 A;  2MMZ A;  2GSR A;  3LFL A;  2KP2 A;  4IP1 A;  5F0G A;  4QL7 A;  1LU4 A;  4PQI A;  1B9Y C;  2PVQ A;  3P2A A;  1V98 A;  3TOT A;  16GS A;  4Q5N A;  2V2G A;  5HFI A;  3DVX A;  1SD9 A;  4GWR A;  3L0H A;  2IME A;  2F3M A;  1JZO A;  4IEL A;  1TI3 A;  3KZQ A;  1ON4 A;  2GZY A;  4I97 A;  1BAY A;  1G7O A;  5C04 A;  4HU7 A;  1TTZ A;  4K0G A;  2PER A;  1XFL A;  1KTE A;  1ML6 A;  3CSJ A;  2H66 A;  2PU9 C;  1XOA A;  3D6I A;  2H0H A;  4KDY A;  2QKE A;  1TDI A;  4EO3 A;  2GTU A;  4GLT A;  3ERF A;  4N0V A;  3IHQ A;  3EMP A;  4FQU A;  2YJ7 A;  2LEG A;  3F4R A;  1HD2 A;  4E8H A;  1DE1 A;  2K9F A;  1GSQ A;  1MD3 A;  2VL9 A;  3KMO A;  4OWY A;  5IMF A;  3M0F A;  3GSS A;  1EEM A;  4MZB A;  4F82 A;  1F3A A;  2MYG A;  5DVB A;  4JZQ A;  11GS A;  3F4T A;  1ZYQ B;  4JED A;  3IPZ A;  5H5Q A;  4P3Y B;  1V58 A;  3TKQ A;  3FEU A;  5D73 A;  1FVK A;  3RDW A;  3F6F A;  2L6D A;  4TR3 A;  4X43 A;  4LLR A;  1GSU A;  1A8L A;  1ERT A;  4GRF A;  2PUK C;  4D73 A;  4HQS A;  3OR5 A;  2RUE A;  4ZB8 A;  5JCW A;  1FO5 A;  1X9S B;  3EVI A;  1QQ2 A;  2O8V B;  3EU4 A;  4O5R A;  3IDV A;  2VUP A;  1YJ6 A;  3KP9 A;  2TRX A;  2HZE A;  4I2T A;  4IQ1 A;  2IFQ A;  1MEK A;  3M1G A;  2TRC P;  3IR4 A;  5DQS A;  3CRT A;  1ERU A;  2C80 A;  4ECB A;  4Q5F A;  5ECN B;  2DIY A;  1TK0 B;  2OBI A;  4AJ6 A;  5ID2 B;  2H73 A;  3TGZ A;  5CO3 A;  4WF5 A;  1R5P A;  1PL1 A;  4PQH A;  3HY2 A;  3VWV A;  2M72 A;  1T8E B;  2E2G A;  4TR1 A;  4ZB9 A;  4EKZ A;  4GXZ A;  4KDU A;  3QD9 A;  2RM6 A;  1VF3 A;  2CZ2 A;  3ED3 A;  4HI7 A;  3C1S A;  1QMV A;  2OBK A;  5JWQ B;  2IWT A;  2JZR A;  2FY6 A;  3U5R E;  2YAN A;  2R5G A;  4XS1 A;  4V2L A;  3R3E A;  2RII A;  1T7P B;  3ZIJ A;  2AV4 A;  3TKP A;  2F51 A;  1J9B A;  2BTO T;  2PVO C;  3A2W A;  4KB3 A;  2H1G A;  4BVX A;  3SWL A;  4RQX A;  1EGO A;  4LMW A;  2H76 A;  3TB2 A;  2YWM A;  4MF6 A;  1R5A A;  4OMV A;  3FR3 A;  4WR4 A;  5KN2 A;  2HLS A;  2H1B A;  4I2U A;  2IIY A;  3TRP A;  4HEA 2;  2PMT A;  1X9M B;  3QAW A;  1MD4 A;  1PKW A;  2IL3 A;  3VUR A;  3D22 A;  1N2A A;  1K0D A;  1F2E A;  5JWR B;  2EC4 A;  3BCI A;  3IK7 A;  1SK1 A;  3PGT A;  1ZGN A;  1MDI A;  1T4Y A;  3W8S A;  3QAG A;  2CX4 A;  4K0N A;  4POL A;  2FWH A;  4JU5 A;  1FVJ A;  4G10 A;  1AAZ A;  4K7I A;  4NHZ A;  1FAA A;  3BOA A;  3D4T A;  4EDZ A;  2LKU A;  3GKN A;  4N10 A;  5ECI B;  2HZE B;  3LQ7 A;  3CXG A;  2PGT A;  3KP8 A;  2H72 A;  4KCE A;  3KTL A;  1EV4 A;  2XHF A;  4MA9 A;  4ULX A;  2IFQ B;  4MH3 A;  2LJA A;  5G1L A;  1K0M A;  5IPG A;  3EUR A;  3NZN A;  2VCZ A;  4J2F A;  1ST9 A;  3IV4 A;  3WGE A;  5J3R A;  1QK8 A;  3F9U A;  1O8W A;  1TU7 A;  4HQZ A;  2HE3 A;  1THX A;  3F8U A;  3LXZ A;  4TR1 B;  3UVH A;  3ZRE A;  5IIZ A;  4WBJ A;  1WWJ A;  2WJU A;  4BVY A;  4L0U A;  1G7E A;  1A0R P;  1OE7 A;  2GSS A;  2MMO A;  3RHC A;  3TJB A;  3MDK A;  2H01 A;  4YQV A;  3GFK A;  5KN0 A;  2FWE A;  1VRS D;  1DUG A;  5F07 A;  1GSE A;  3FKF A;  1GTA A;  2HFD A;  3IA1 A;  1O73 A;  2L4Q A;  4PTS A;  4G2E A;  4AJ7 A;  4BVX B;  2L5O A;  3GKK A;  4HU9 A;  3TJG A;  3QFA C;  1X9W B;  2B7K A;  3EMX A;  1NW2 A;  4Z7X A;  3GRX A;  1BG5 A;  1FB0 A;  1SYR A;  3ME8 A;  5IO0 A;  2GQL A;  19GS A;  3VK9 A;  3H79 A;  5AIS A;  4RUV A;  2O89 A;  3C73 A;  2WFC A;  4TKY A;  3HVV A;  2VCX A;  14GS A;  3O6T A;  2NPB A;  2P5R A;  3C7M A;  4KSO A;  4EDY A;  2AHE A;  3DD3 A;  1EOG A;  4TVE A;  4IBP A;  4HZ2 A;  3A5W A;  4MZC A;  3RAZ A;  3L9V A;  2C3N A;  1FB6 A;  3JCM L;  2OAD A;  3UL3 A;  2OE0 A;  4ZBD A;  4IGJ A;  3VPT A;  3ZFB A;  1GSD A;  3AY8 A;  3FHK A;  1V40 A;  3CTG A;  2C1Y A;  4BPY A;  2B5Y A;  4NAX A;  3FK8 A;  3HVS A;  3TJF A;  3FY7 A;  3ZFL A;  5GAP D;  3ZIT A;  1HNB A;  3FZA A;  4PNG A;  5JWO B;  1HQO A;  3QAV A;  2VLU A;  3H93 A;  4L8E A;  4EXJ A;  2EIQ A;  1K3Y A;  1GSS A;  2LS5 A;  1YKA A;  3GMF A;  1TK5 B;  1GWC A;  5BMU A;  3F0I A;  3DYR A;  4NXI A;  3F3R A;  4ZB6 A;  2H74 A;  4BVY B;  1TJD A;  1XXU A;  5J9C A;  1K3O A;  1XCC A;  1O8X A;  5ECR B;  1DSB A;  3HKR A;  3UBK A;  1NHY A;  4KSM A;  5ECP B;  4N0Z A;  5J5N A;  4HUA A;  4K8M A;  3J7Y k;  2LQQ A;  5G5F A;  5ELG A;  2R2J A;  4Q5Q A;  1AIU A;  2VD0 A;  3LXT A;  2YP6 A;  2VAF A;  5F8B A;  2X8G A;  1I5G A;  4GQC A;  1AXD A;  4IP6 A;  4GSN A;  4YAP A;  1URM A;  1O85 A;  2WZ9 A;  4QQ7 A;  4FYC A;  2I4A A;  1DE2 A;  1PX6 A;  3GNJ A;  4EUY A;  1U6T A;  4BL7 A;  6GSS A;  2XPE A;  2CVB A;  1HNA A;  4KDX A;  3TKR A;  2H0G A;  1B4Q A;  1YEX A;  5IMA A;  4HJ2 A;  5CRH A;  2GDR A;  2MBS A;  2X8H A;  1JZD A;  1Z7R A;  4BWS A;  4F0B A;  3LGC A;  1TI1 A;  2FCH A;  3KIJ A;  3L4N A;  3O76 A;  2HSY A;  3UMA A;  2XBQ A;  4EF0 A;  5D8I A;  2H1D A;  3VLN A;  2C0G A;  4GSS A;  2YPM A;  5FHI A;  1SU9 A;  4AJ8 A;  4ML6 A;  5CP1 A;  4N30 A;  5CAX A;  5IPH A;  2OE1 A;  1XWC A;  1ILO A;  5CRD A;  2OJL A;  2H71 A;  3WD6 A;  2VCW A;  1TRW A;  3FR9 A;  2HSM A;  3VWW A;  3VWX A;  4WF4 A;  2OE3 A;  5HQP A;  2K6V A;  3C8E A;  1A24 A;  1O81 A;  6GSV A;  1U88 A;  2HT9 A;  1RW1 A;  1WRY A;  1GLQ A;  3Q74 A;  2VD1 A;  5EY6 A;  2VCV A;  2DJJ A;  1ERW A;  2YOI A;  5LCZ A;  1XWA A;  2DBC A;  2C0E A;  1OAZ A;  4EL1 A;  2JL4 A;  2WGR A;  2NDO A;  3LG6 A;  5F06 A;  1YY7 A;  4OFT A;  3W6G A;  5A4W A;  1S3D A;  22GS A;  2YCD A;  1A23 A;  1ZYE A;  5GSS A;  1F9M A;  2JZS A;  2YWN A;  3GL3 A;  3KD0 A;  3HZ4 A;  5HR3 A;  2GQK A;  2IJY A;  1OC3 A;  2H6Z A;  3HZ8 A;  1SL2 B;  2P31 A;  1YF1 A;  2IMK A;  1YZX A;  4JRR A;  3BBY A;  4BL7 B;  3PH9 A;  1AC1 A;  5CRG A;  1M9A A;  1EGR A;  4AGS A;  1FHE A;  2WDU A;  4XTS A;  4FH8 A;  1SJZ A;  1Z3E A;  2BMX A;  5G31 A;  5GST A;  2I81 A;  1O7U A;  1SKS B;  2P0G A;  3C71 A;  3GIX A;  1RK4 A;  3ZML A;  4KAE A;  5G5E A;  1K0N A;  1TKD B;  2CAI A;  1YQ1 A;  4QL9 A;  1XW9 A;  3TRX A;  5CRE A;  4LA1 A;  1VF2 A;  1M2B A;  2X64 A;  1TXX A;  5HFG A;  5D96 A;  2LNT A;  3A3T A;  5DCH A;  5HFK A;  2AUV A;  5GZZ B;  3F3Q A;  4PXO A;  4WET A;  1PGT A;  4IHU A;  2XPD A;  4ZBA A;  2A4V A;  1K0O A;  4MDC A;  2VO4 A;  2LNS A;  5IMC A;  4ZL8 A;  3RPP A;  2MMN A;  2V41 A;  1FG4 A;  1XWG A;  4WXT A;  2AB6 A;  2HSM B;  1GUM A;  4POB A;  4MPG A;  2H0I A;  1OE8 A;  3CYN A;  2GSQ A;  1JLV A;  3DXB A;  3D0Z A;  2M80 A;  5HR1 A;  2CVK A;  3S9F A;  1PN9 A;  5E4W A;  2DMM A;  2MBT A;  1TW9 A;  1AW9 A;  3US3 A;  3HDC A;  4BWQ A;  3FRC A;  4TOP A;  5ELA A;  1R7H A;  5DQY A;  3QOU A;  2HSN B;  2J9H A;  1VF1 A;  3CTF A;  1EV9 A;  2ON7 A;  2E7P A;  2C8U A;  1A2L A;  4POK A;  1H4O A;  3M9K A;  2YJH A;  3L78 A;  2VLT A;  4JR6 A;  3GTU A;  1TU8 A;  1HYU A;  1TRU A;  1K0A A;  1G6W A;  4K7N A;  4HOJ A;  2RLI A;  4HZ4 A;  5DAL A;  2JU5 A;  1EP7 A;  5IOW A;  4V2N A;  1GNE A;  1ERV A;  3PPU A;  1JZW A;  2JAD A;  1JHB A;  2FNO A;  1A8Y A;  5JCG A;  4KND A;  4IW9 A;  2L59 A;  1U3A A;  4MJB A;  3FZ9 A;  2CT6 A;  4DSS A;  4XRA A;  3IOS A;  3UVT A;  3QR6 A;  3EE2 A;  3I43 A;  3VFI A;  2HRF A;  3IK9 A;  1PSQ A;  2YNX A;  2PBJ A;  4ZIJ A;  3VPQ A;  2X8C A;  5CYY A;  3IC4 A;  3GH9 A;  1F6M C;  1AQX A;  3GN3 A;  3MSZ A;  3HVX A;  2CA8 A;  4G9H A;  2B1L A;  4MMM A;  3E0U A;  5KN1 A;  1S3A A;  2LJK A;  2NVL A;  8GSS A;  3G7I A;  2IMD A;  2LST A;  3TRQ A;  2PPT A;  4G19 A;  2JZT A;  2AAW A;  1AQV A;  4MCU A;  2GZP A;  5LD0 A;  4MP4 A;  3GL5 A;  7GSS A;  4TW5 A;  1Y25 A;  1GRX A;  4WBR D;  1T00 A;  3ZYW A;  3F63 A;  5C00 A;  1PMT A;  5COH A;  1FOV A;  1I9D A;  3VWU A;  1PL2 A;  3KXO A;  3A2V A;  1Z7P A;  4XIH A;  3KJY A;  1QGV A;  4XRD A;  1K3L A;  4MPF A;  3L9S A;  2L5L A;  3TKS C;  1VGL A;  1U3I A;  4CDO A;  4PNF A;  4CHS A;  4TRX A;  4TN8 A;  2CX3 A;  2FD3 A;  2C0D A;  4EC0 A;  2R4V A;  4WR5 A;  4MZW A;  3LJR A;  4E8E A;  2K18 A;  4FYB A;  4BA7 A;  3TKS E;  5ECK B;  1XW6 A;  1GTU A;  3G7Y A;  2HYX A;  2IPA A;  2B5E A;  1X0R A;  1T1V A;  1AUC A;  2H30 A;  3MWH A;  3GTU B;  1NHO A;  1USB A;  2QGV A;  1F3B A;  3LEF A;  3I6A A;  3TOU A;  3M8N A;  4PX1 A;  3DML A;  3HJO A;  1E2Y A;  2HRN A;  2LJR A;  3QPM A;  5DAL B;  3QCP A;  3IC8 A;  6GSU A;  4YQM A;  4MK3 A;  4KE3 A;  1BJX A;  1ACV A;  3GHA A;  4DSS B;  1MDJ A;  1LJR A;  2ZNM A;  5ABR A;  1DBY A;  4EVM A;  4L5O A;  2I1U A;  3L9U A;  2AYT A;  2FA4 A;  3RBT A;  1OC9 B;  1GP1 A;  1THO A;  3UOM A;  1IYI A;  2GLR A;  3KH7 A;  3UBL A;  5L71 A;  2DJ3 A;  3LYK A;  1TRV A;  1GUH A;  3U6V A;  5A4U A;  3DRN A;  3UAP A;  3VI5 A;  4F2I A;  2H1A A;  2I9H A;  2VLV A;  2O7K A;  1WOU A;  2ZUP A;  1SKW B;  1KNG A;  2X99 A;  3ZIV A;  3EWL A;  3W8J A;  2DJ1 A;  3N5O A;  3VI7 A;  2VOC A;  4DSR A;  5ECH B;  1GH2 A;  1X5C A;  2KOK A;  5FT3 A;  1OVN A;  2FWG A;  5CRW A;  2GT5 A;  4YAV A;  4O7H A;  2LRN A;  4KCA A;  2CVD A;  4RI7 A;  3V1W A;  3FZ5 A;  2QSI A;  4MJE A;  2H75 A;  4DVC A;  1O6J A;  4GF0 A;  3EU3 A;  2FLS A;  2R37 A;  3PR8 A;  3ZRD A;  5CNW A;  2V1M A;  5B6M A;  1GL8 A;  3TJJ A;  3E3E A;  1EOH A;  2FGX A;  2WRT A;  1GUK A;  4ECJ A;  2HRA A;  13GS A;  1PD2 1;  3QMX A;  1GNW A;  2O85 A;  4OO5 A;  3GA4 A;  2MMA A;  3ZTL A;  2DJ2 A;  3UEM A;  4PUF C;  2CQ9 A;  1SL0 B;  4XCS A;  2ZCT A;  1A2M A;  1PRX A;  1M9B A;  4NWY A;  3J7Y b;  2L57 A;  3F4S A;  3LYP A;  3CBU A;  3HCZ A;  6GSY A;  5J4U A;  5IM9 A;  2H6Y A;  2LUS A;  1V9W A;  1R4W A;  4FO5 A;  4ISD A;  3I9V 2;  3LWA A;  4J57 E;  1N8J A;  3TKS A;  2K8V A;  2BJX A;  2VCQ A;  4NV5 A;  3K8N A;  4TR0 A;  3LOR A;  4KGI A;  1GTI A;  4Q5R A;  3APO A;  4K1F A;  1OC8 A;  2ALB A;  4PUA A;  3C1R A;  5INY A;  3APS A;  2GVP A;  1SKR B;  4KW6 A;  5D9X A;  5AIX A;  2K8S A;  4NPB A;  5G2Z A;  3QDN A;  3KM6 A;  5A5K A;  1XBS A;  4JBB A;  3GKM A;  3P7X A;  1OKD A;  1K0B A;  1Y6E A;  4NMU A;  2WB9 A;  1X5E A;  2JSY A;  1GLP A;  2REM A;  2CZ3 A;  3DVW A;  3DGQ A;  3WT1 A;  1V2A A;  2NTO A;  2HI7 A;  4IVF A;  3WT2 A;  4MLY A;  5EVO A;  1XW5 A;  3UJ1 A;  3FYG A;  2VL2 A;  1T4Z A;  5DJL A;  3FW2 A;  3ZLP A;  2PN8 A;  3CRU A;  1M99 A;  1ZCP A;  2O87 A;  4GST A;  4G0L A;  1MDK A;  4MH2 A;  4EE0 A;  1UVZ A;  2V6K A;  2R3X A;  4PUR A;  1J0F A;  3FZ4 A;  5ENU A;  1WMJ A;  1PQN A;  3ME7 A;  2N5B A;  4YQU A;  1HNC A;  3GKX A;  4N11 A;  5EL8 A;  1H75 A;  9GSS A;  1GSF A;  3N9J A;  3BCK A;  4ZIL A;  4AF2 A;  4KF9 A;  6GSW A;  5HR2 A;  17GS A;  3TUE A;  6GST A;  1E6B A;  1XOB A;  5B7C A;  1YF0 A;  5IOX A;  1YDK A;  1SEN A;  1WPI A;  4LL4 B;  4ACS A;  20GS A;  1XWK A;  1WIK A;  2WUL A;  1Q4J A;  3IAM 2;  2A2S A;  2MZC A;  1R26 A;  2JSZ A;  4TR4 A;  1ZL9 A;  2LTK A;  2F9S A;  1EEJ A;  3TJK A;  1B48 A;  1Z9H A;  3UAR A;  1T3B A;  2C3Q A;  2QC7 A;  3GST A;  1A0F A;  3ZVJ D;  2EIO A;  1JLW A;  2V6O A;  3FR6 A;  2DC5 A;  4MF5 A;  4DSQ A;  2VM1 A;  5G30 A;  1KEB A;  2P5Q A;  5IMV A;  1W89 A;  1M2A A;  4XS4 B;  3CMI A;  1B8X A;  4LMV A;  1WP0 A;  4NHW A;  2HRK A;  5F05 A;  5JCU A;  2G0F A;  2XBI A;  4USS A;  1SK0 A;  2V32 A;  1QXH A;  1XVW A;  2EIR A;  4GTU A;  3TCO A;  4MJA A;  3DEX A;  3GX0 A;  5AN1 A;  3TDG A;  3RHB A;  4CW9 A;  4F9Z A;  2KHP A;  5ECM B;  4WEY A;  5GAN D;  2GS3 A;  3BJ5 A;  3NIV A;  5DDL A;  2F8A A;  2H19 A;  2VIM A;  1IYH A;  5ECO B;  2GGT A;  4XHM A;  4ILF A;  1S3C A;  3WGX A;  4K9Z A;  2GST A;  4L0W A;  2B1K A;  2LRC A;  5ECL B;  2GT6 A;  2E0Q A;  5DAK A;  2YV9 A;  2JAC A;  2NBS A;  1MTC A;  1YKC A;  1J08 A;  2CV4 A;  4GQF A;  4IJ3 A;  1BX9 A;  3IRA A;  4OFM A;  4JE1 A;  4NV2 A;  5B8A A;  3BD2 A;  1QUW A;  2HXK A;  1B4P A;  1SD8 A;  3H1N A;  3D5J A;  2N5F A;  2H8L A;  5FWG A;  1UC7 A;  1QFN A;  1Z5Y E;  1AQW A;  2KUC A;  4KX4 A;  2WS2 A;  2D2Z A;  3WYW A;  3KEB A;  4TXO A;  5B8B A;  1BYE A;  5KEJ A;  2YWI A;  4IS0 A;  1XPV A;  4YH2 A;  5DJM A;  1BQ7 A;  1X5D A;  3O3T A;  4D73 B;  1OC9 A;  4H86 A;  1C72 A;  3ZVJ A;  4O92 A;  1WE0 A;  4ML1 A;  1EP8 A;  1TRS A;  4X0X A;  5D9V A;  4IJI A;  4ZL9 A;  3IAS 2;  2J23 A;  3WGD A;  1G0T A;  2DSA A;  2UZ8 A;  5G1K A;  3KCM A;  5H5S A;  4G0I A;  5J41 A;  5J9B A;  4FIW A;  3HHV A;  3CSI A;  4OFN A;  4TXV A;  3D21 A;  4K6X A;  1A2J A;  2HRK B;  2VM2 A;  3H8Q A;  5EPF A;  5H5R A;  2HQT A;  4ECI A;  4PQ1 A;  4XS6 A;  4KH7 A;  2ES7 A;  4KA0 A;  1CQG A;  1Z6N A;  3HYP A;  3CSH A;  2Z9S A; 
#chains in the Genus database with same CATH topology
 3RPN A;  5DCG A;  2DLX A;  1I1I P;  1TP9 A;  2KLX A;  3G7J A;  4V2M A;  2YZU A;  2R6K A;  3Q6O A;  3HXS A;  4DEJ A;  3GX8 A;  1U87 A;  5E59 A;  3DIE A;  1JZR A;  2RM5 A;  2FWF A;  2RUF A;  1XZO A;  1ZMA A;  5HR0 A;  3D4M A;  1TOF A;  4GDF A;  5LNK e;  3F6D A;  4JR4 A;  2FUG 2;  2HSH A;  2H6X A;  5DAK B;  1ABA A;  3ZZX A;  4L5L A;  5IO2 A;  12GS A;  3GV1 A;  2LV3 A;  3ERW A;  2FA8 A;  4ID0 A;  3ERG A;  2GQM A;  4LL1 B;  1NSW A;  1KBN A;  1G6Y A;  1SYX A;  2WZS A;  1GUL A;  2DKI A;  1K0C A;  2IN3 A;  4K7O A;  2B7J A;  4G0K A;  3MNG A;  1M2D A;  2YV7 A;  3KGK A;  1B9X C;  3EPT A;  3R2Q A;  1Q98 A;  4V1A p;  2DJK A;  1YEW C;  2KP1 A;  1SK2 A;  4IKH A;  2HZF A;  5IMZ A;  4K2D A;  3QFB C;  2C0F A;  2VCT A;  4OCE A;  2C3T A;  4V1A g;  5ECQ B;  2VL2 C;  3IE3 A;  1OYJ A;  4TXO B;  5B6N A;  1W4V A;  2H70 A;  4OCF A;  2X4A A;  3KTB A;  1V57 A;  1XWB A;  3NOF A;  1PA3 A;  2L6C A;  1F37 A;  2G2Q A;  4RI6 A;  1XVQ A;  4IN0 A;  3DWV A;  2EFC A;  1EWX A;  4RQR A;  2LRT A;  2VL3 A;  4G01 A;  3A5I A;  2TIR A;  18GS A;  1BG1 A;  2WCI A;  3HA9 A;  4MAB A;  1WJK A;  1UA5 A;  2B5X A;  3ZL5 A;  1M0U A;  4K5S A;  1YEP A;  3HVN A;  1FW1 A;  3PIN A;  10GS A;  2XC2 A;  4I8B A;  1TK8 B;  4KUN A;  2YZH A;  4W66 A;  2B6M A;  2DIZ A;  1RQM A;  3GYK A;  2YWO A;  4FYU A;  5KN3 A;  3EYT A;  4O32 A;  4MJC A;  4WKW A;  5IQY A;  2ON5 A;  1PFO A;  3MAK A;  5D9T A;  2A2R A;  3I69 A;  4HDE A;  3LSZ A;  3M3M A;  3P90 A;  2I3Y A;  3HD5 A;  6GSX A;  1GSY A;  2YN1 A;  2DML A;  4CY6 A;  2AJQ B;  3KMN A;  4ZXG A;  4OD7 A;  3KH9 A;  4POM A;  2M46 A;  4ZL7 A;  4ICY A;  3GUR A;  1SVL A;  3M9J A;  4HJM A;  4HS1 A;  3E9J B;  2FHE A;  2C4J A;  1UN2 A;  1LBK A;  1Z6M A;  2DJ0 A;  2WVX A;  2OAC A;  3EIN A;  4ZB7 A;  3HJM A;  5AGY A;  1M7T A;  2OA7 A;  3GUS A;  4Z2U A;  5KOX A;  5IMD A;  5DBQ A;  3A2X A;  3P8W A;  3EC3 A;  3G9B A;  3Q18 A;  3GH6 A;  2L4C A;  2IMI A;  4ZBB A;  2E2M A;  3SBC A;  1OKT A;  1EZK A;  1PX7 A;  2OKA A;  4BIK A;  5A4V A;  4PGT A;  4J56 E;  3H4K A;  3IXR A;  5AIV A;  2HNL A;  1PKZ A;  3ISO A;  4GCI A;  2IMF A;  5D9W A;  4MF7 A;  1XIY A;  1BED A;  4I5Q A;  1NM3 A;  1VF4 A;  3HJP A;  4ECC A;  4I6X A;  1SJ6 A;  1SL1 B;  4IQA A;  1GTB A;  4X1U A;  3DKS A;  1JFU A;  5ECS A;  1SJI A;  4F0C A;  2B3S A;  4F03 A;  1ZOF A;  1ZZY A;  2GZZ A;  3ZMK A;  3IBH A;  4XS4 A;  1CQH A;  2CAQ A;  3APQ A;  5ID2 A;  2F8F A;  2N5A A;  2PWJ A;  2LQO A;  3UIW A;  3Q19 A;  5D93 A;  4OO4 A;  2MMZ A;  2GSR A;  3LFL A;  2KP2 A;  4IP1 A;  5F0G A;  4QL7 A;  1LU4 A;  3CWG A;  4PQI A;  1B9Y C;  2PVQ A;  3P2A A;  1V98 A;  3TOT A;  16GS A;  4Q5N A;  2V2G A;  5HFI A;  3DVX A;  1SD9 A;  4GWR A;  3L0H A;  2IME A;  2F3M A;  1JZO A;  4IEL A;  1TI3 A;  3KZQ A;  1ON4 A;  2GZY A;  4I97 A;  1BAY A;  1G7O A;  5C04 A;  4HU7 A;  1TTZ A;  4K0G A;  2PER A;  1XFL A;  1KTE A;  1ML6 A;  3CSJ A;  2H66 A;  2PU9 C;  1XOA A;  3D6I A;  2H0H A;  4KDY A;  5J4V A;  2QKE A;  1TDI A;  4EO3 A;  2GTU A;  4GLT A;  3ERF A;  4N0V A;  2WVX B;  3IHQ A;  3EMP A;  4FQU A;  2YJ7 A;  2LEG A;  3F4R A;  1HD2 A;  4E8H A;  1DE1 A;  2K9F A;  1GSQ A;  1MD3 A;  2VL9 A;  3KMO A;  4OWY A;  5IMF A;  3M0F A;  3GSS A;  1EEM A;  4MZB A;  4F82 A;  1F3A A;  2MYG A;  5DVB A;  4JZQ A;  11GS A;  3F4T A;  1ZYQ B;  4JED A;  1SVO A;  3IPZ A;  5H5Q A;  4P3Y B;  1V58 A;  3TKQ A;  3FEU A;  5D73 A;  1FVK A;  3RDW A;  5J47 A;  3F6F A;  2L6D A;  4TR3 A;  4X43 A;  4LLR A;  1GSU A;  1A8L A;  1ERT A;  4GRF A;  2PUK C;  4D73 A;  4HQS A;  3OR5 A;  2RUE A;  4ZB8 A;  5JCW A;  1FO5 A;  1X9S B;  3EVI A;  1QQ2 A;  2O8V B;  3EU4 A;  4O5R A;  3IDV A;  2EFE A;  2VUP A;  1YJ6 A;  3KP9 A;  2TRX A;  2VKZ G;  2HZE A;  4I2T A;  4IQ1 A;  2IFQ A;  1MEK A;  3M1G A;  2TRC P;  3IR4 A;  5DQS A;  3CRT A;  1ERU A;  2C80 A;  4O5U A;  4ECB A;  4Q5F A;  5ECN B;  2DIY A;  1TK0 B;  2OBI A;  4AJ6 A;  5ID2 B;  4QMK A;  2H73 A;  3TGZ A;  5CO3 A;  4WF5 A;  1R5P A;  1PL1 A;  4PQH A;  3HY2 A;  3VWV A;  2M72 A;  1T8E B;  2E2G A;  4TR1 A;  4ZB9 A;  4EKZ A;  4GXZ A;  4KDU A;  3QD9 A;  2RM6 A;  1VF3 A;  2CZ2 A;  3ED3 A;  4HI7 A;  4K2X A;  3C1S A;  1QMV A;  2OBK A;  5JWQ B;  2IWT A;  2JZR A;  2FY6 A;  3U5R E;  2YAN A;  4YKG A;  2R5G A;  4XS1 A;  4V2L A;  3R3E A;  2RII A;  1T7P B;  3ZIJ A;  2AV4 A;  3TKP A;  2F51 A;  1J9B A;  2BTO T;  2PVO C;  3A2W A;  4KB3 A;  2H1G A;  4BVX A;  3SWL A;  2R0C A;  4RQX A;  1EGO A;  4LMW A;  2H76 A;  3TB2 A;  2YWM A;  4MF6 A;  1R5A A;  4OMV A;  3FR3 A;  4WR4 A;  5A1N A;  5KN2 A;  2HLS A;  2H1B A;  4I2U A;  2IIY A;  3TRP A;  4HEA 2;  2DKH A;  2PMT A;  4PI2 C;  1X9M B;  3QAW A;  1MD4 A;  1PKW A;  4HSC X;  2IL3 A;  3VUR A;  3D22 A;  1N2A A;  1K0D A;  1F2E A;  5JWR B;  2EC4 A;  3BCI A;  3IK7 A;  1SK1 A;  3PGT A;  3CHX C;  1ZGN A;  1MDI A;  1T4Y A;  3W8S A;  3QAG A;  2CX4 A;  4K0N A;  4POL A;  2FWH A;  4JU5 A;  1FVJ A;  4G10 A;  1AAZ A;  4K7I A;  4NHZ A;  1FAA A;  3BOA A;  3D4T A;  4EDZ A;  2LKU A;  3GKN A;  4N10 A;  5ECI B;  2HZE B;  3LQ7 A;  3CXG A;  2PGT A;  3KP8 A;  2H72 A;  4KCE A;  3KTL A;  1EV4 A;  2XHF A;  4MA9 A;  4ULX A;  2IFQ B;  4MH3 A;  2A2P A;  2R0P A;  2LJA A;  5G1L A;  1K0M A;  5IPG A;  3EUR A;  3NZN A;  2VCZ A;  4J2F A;  1ST9 A;  3IV4 A;  1SVM A;  3WGE A;  5J3R A;  1QK8 A;  3F9U A;  1O8W A;  1TU7 A;  5A5H A;  4HQZ A;  2HE3 A;  1THX A;  3F8U A;  1TXU A;  3LXZ A;  4TR1 B;  3UVH A;  3ZRE A;  5IIZ A;  4WBJ A;  1WWJ A;  2WJU A;  4BVY A;  4L0U A;  1G7E A;  1A0R P;  1OE7 A;  2GSS A;  2MMO A;  1YVL A;  3RHC A;  3TJB A;  3MDK A;  3IHG A;  2H01 A;  4YQV A;  3GFK A;  5KN0 A;  2FWE A;  1VRS D;  1DUG A;  1M3I A;  5F07 A;  1GSE A;  3FKF A;  1GTA A;  2HFD A;  3IA1 A;  3MIX A;  1O73 A;  2L4Q A;  4PTS A;  4G2E A;  4AJ7 A;  4BVX B;  2L5O A;  3GKK A;  4HU9 A;  3TJG A;  3QFA C;  1X9W B;  2B7K A;  3EMX A;  2WVZ A;  1NW2 A;  4Z7X A;  3MYD A;  2QA2 A;  3GRX A;  5A1N B;  1BG5 A;  1FB0 A;  1SYR A;  3ME8 A;  5IO0 A;  2GQL A;  19GS A;  3VK9 A;  4E68 A;  3H79 A;  5AIS A;  4RUV A;  2O89 A;  3C73 A;  2WFC A;  4TKY A;  3HVV A;  2VCX A;  14GS A;  3O6T A;  2NPB A;  2P5R A;  3C7M A;  4KSO A;  4EDY A;  2AHE A;  3DD3 A;  1EOG A;  4TVE A;  4IBP A;  4HZ2 A;  2WW1 A;  3A5W A;  2QA1 A;  4MZC A;  3RAZ A;  3L9V A;  2C3N A;  1FB6 A;  3JCM L;  2OAD A;  3UL3 A;  4PI0 C;  2OE0 A;  4ZBD A;  4IGJ A;  3VPT A;  3ZFB A;  1GSD A;  3AY8 A;  3FHK A;  1V40 A;  3CTG A;  2C1Y A;  4BPY A;  2B5Y A;  4NAX A;  3FK8 A;  3HVS A;  3TJF A;  3FY7 A;  3ZFL A;  5GAP D;  3ZIT A;  1HNB A;  3FZA A;  4PNG A;  5JWO B;  1HQO A;  3QAV A;  5A5H B;  2VLU A;  3H93 A;  4L8E A;  4EXJ A;  2EIQ A;  1K3Y A;  1GSS A;  2LS5 A;  1YKA A;  3GMF A;  1TK5 B;  1GWC A;  5BMU A;  3F0I A;  3DYR A;  4NXI A;  3F3R A;  4ZB6 A;  2H74 A;  4BVY B;  1TJD A;  1XXU A;  5J9C A;  1K3O A;  1XCC A;  1O8X A;  5ECR B;  1DSB A;  3HKR A;  3UBK A;  1NHY A;  4KSM A;  5ECP B;  4N0Z A;  5J5N A;  4MNN A;  4HUA A;  4K8M A;  3J7Y k;  2LQQ A;  5G5F A;  5ELG A;  2R2J A;  4Q5Q A;  1AIU A;  2VD0 A;  3LXT A;  2YP6 A;  2VAF A;  5F8B A;  2X8G A;  1I5G A;  4GQC A;  1AXD A;  4IP6 A;  4GSN A;  4YAP A;  1URM A;  1O85 A;  2WZ9 A;  4QQ7 A;  4FYC A;  2I4A A;  1DE2 A;  1PX6 A;  3GNJ A;  4EUY A;  1U6T A;  4BL7 A;  6GSS A;  2XPE A;  2CVB A;  1HNA A;  4KDX A;  3TKR A;  2H0G A;  1B4Q A;  1YEX A;  5IMA A;  5A34 A;  4HJ2 A;  5CRH A;  2GDR A;  2MBS A;  2X8H A;  1JZD A;  1Z7R A;  4BWS A;  4F0B A;  3LGC A;  1TI1 A;  4AI6 A;  2FCH A;  3KIJ A;  3L4N A;  4Z2R A;  3O76 A;  2HSY A;  3UMA A;  2XBQ A;  4EF0 A;  5D8I A;  2H1D A;  3VLN A;  2C0G A;  4GSS A;  2YPM A;  5FHI A;  1SU9 A;  2EFH A;  4AJ8 A;  4ML6 A;  5CP1 A;  4N30 A;  5CAX A;  5IPH A;  2OE1 A;  1XWC A;  1ILO A;  5CRD A;  2OJL A;  2H71 A;  3WD6 A;  2VCW A;  1TRW A;  3FR9 A;  2HSM A;  3VWW A;  3VWX A;  5BMU B;  4WF4 A;  2OE3 A;  5HQP A;  2K6V A;  3C8E A;  3CQF A;  1A24 A;  1O81 A;  6GSV A;  1U88 A;  1M3J A;  2HT9 A;  1RW1 A;  1WRY A;  1GLQ A;  3Q74 A;  2VD1 A;  5EY6 A;  4K5R A;  2VCV A;  2DJJ A;  1ERW A;  2YOI A;  5LCZ A;  1XWA A;  2HSN A;  2DBC A;  2C0E A;  1OAZ A;  4EL1 A;  2JL4 A;  2WGR A;  2NDO A;  3LG6 A;  5F06 A;  1YY7 A;  4OFT A;  3W6G A;  5A4W A;  1S3D A;  22GS A;  2YCD A;  1A23 A;  1ZYE A;  5GSS A;  2O5V A;  1F9M A;  2JZS A;  2YWN A;  3GL3 A;  3KD0 A;  3HZ4 A;  5HR3 A;  2GQK A;  2IJY A;  1OC3 A;  2H6Z A;  3HZ8 A;  1SL2 B;  2P31 A;  1YF1 A;  2IMK A;  1YZX A;  4JRR A;  3BBY A;  4BL7 B;  3PH9 A;  1AC1 A;  5CRG A;  1M9A A;  4N3Z A;  1EGR A;  4AGS A;  1FHE A;  2WDU A;  4XTS A;  4EIP A;  4FH8 A;  1SJZ A;  1Z3E A;  2BMX A;  5G31 A;  2R0G A;  5GST A;  2I81 A;  5A34 B;  1O7U A;  1SKS B;  2EFD A;  2P0G A;  3C71 A;  3GIX A;  1RK4 A;  3ZML A;  4KAE A;  5G5E A;  1K0N A;  1TKD B;  2CAI A;  1YQ1 A;  4QL9 A;  1XW9 A;  3TRX A;  5CRE A;  4LA1 A;  1VF2 A;  1M2B A;  2X64 A;  1TXX A;  3RFR C;  5HFG A;  5D96 A;  2LNT A;  3A3T A;  5DCH A;  5HFK A;  2AUV A;  5GZZ B;  3F3Q A;  4PXO A;  4WET A;  1FOH A;  1PGT A;  4IHU A;  2XPD A;  4ZBA A;  2A4V A;  1K0O A;  4MDC A;  2VO4 A;  2LNS A;  5IMC A;  4ZL8 A;  3RPP A;  2MMN A;  2V41 A;  1FG4 A;  1XWG A;  4WXT A;  2AB6 A;  2HSM B;  1GUM A;  4POB A;  4MPG A;  2H0I A;  1OE8 A;  3CYN A;  2GSQ A;  1JLV A;  3DXB A;  3D0Z A;  2M80 A;  5HR1 A;  2CVK A;  3S9F A;  1PN9 A;  5E4W A;  4AKX B;  2DMM A;  2MBT A;  1TW9 A;  1AW9 A;  3US3 A;  3HDC A;  4BWQ A;  3TU3 B;  3FRC A;  4TOP A;  5ELA A;  1R7H A;  5DQY A;  3QOU A;  5J4Y A;  2HSN B;  2J9H A;  1VF1 A;  3CTF A;  1EV9 A;  2ON7 A;  2E7P A;  2C8U A;  1A2L A;  4POK A;  1H4O A;  3M9K A;  2YJH A;  3L78 A;  2VLT A;  4JR6 A;  3GTU A;  1TU8 A;  4X4J A;  1HYU A;  1TRU A;  1K0A A;  1ZYP A;  1G6W A;  4K7N A;  4AKH A;  4HOJ A;  2RLI A;  4HZ4 A;  5DAL A;  2JU5 A;  1EP7 A;  5IOW A;  4V2N A;  1GNE A;  1ERV A;  3PPU A;  1JZW A;  2JAD A;  1JHB A;  2FNO A;  1A8Y A;  5JCG A;  4KND A;  4IW9 A;  2L59 A;  1U3A A;  4MJB A;  3FZ9 A;  2CT6 A;  4DSS A;  4XRA A;  3IOS A;  3UVT A;  3QR6 A;  3EE2 A;  3I43 A;  3VFI A;  2HRF A;  3IK9 A;  1PSQ A;  2YNX A;  2PBJ A;  4ZIJ A;  3VPQ A;  2X8C A;  5CYY A;  3IC4 A;  3GH9 A;  1F6M C;  2WW2 A;  1AQX A;  3GN3 A;  3MSZ A;  3HVX A;  2CA8 A;  4G9H A;  2B1L A;  4MMM A;  3E0U A;  5KN1 A;  1S3A A;  2LJK A;  2NVL A;  8GSS A;  3G7I A;  2IMD A;  2LST A;  3TRQ A;  2PPT A;  4G19 A;  2JZT A;  2AAW A;  1AQV A;  4MCU A;  2GZP A;  5LD0 A;  4MP4 A;  3GL5 A;  7GSS A;  4TW5 A;  1Y25 A;  1GRX A;  4WBR D;  1T00 A;  2WW3 A;  3ZYW A;  3F63 A;  5C00 A;  1PMT A;  5COH A;  1FOV A;  1I9D A;  3VWU A;  1PL2 A;  3KXO A;  3A2V A;  3RGB C;  1Z7P A;  4XIH A;  2WW0 A;  3KJY A;  1QGV A;  4XRD A;  1K3L A;  4MPF A;  3L9S A;  2L5L A;  3TKS C;  1VGL A;  1U3I A;  4CDO A;  4PNF A;  4CHS A;  4TRX A;  4TN8 A;  2CX3 A;  2FD3 A;  2C0D A;  4EC0 A;  2R4V A;  4WR5 A;  4MZW A;  3LJR A;  4E8E A;  2K18 A;  4FYB A;  4BA7 A;  3TKS E;  5ECK B;  1XW6 A;  4AKG A;  1GTU A;  3G7Y A;  2HYX A;  2IPA A;  2B5E A;  1X0R A;  1T1V A;  1AUC A;  2H30 A;  3MWH A;  3GTU B;  1NHO A;  1USB A;  2QGV A;  1F3B A;  3LEF A;  3I6A A;  3TOU A;  3M8N A;  4PX1 A;  3DML A;  3HJO A;  1E2Y A;  2HRN A;  2LJR A;  3QPM A;  5DAL B;  3QCP A;  3IC8 A;  6GSU A;  4YQM A;  4MK3 A;  4KE3 A;  4CY8 A;  1BJX A;  1ACV A;  3GHA A;  4DSS B;  1MDJ A;  1LJR A;  2ZNM A;  5ABR A;  1DBY A;  1N25 A;  4EVM A;  4L5O A;  2I1U A;  3L9U A;  2AYT A;  2FA4 A;  3RBT A;  1OC9 B;  1GP1 A;  1THO A;  3UOM A;  1IYI A;  2GLR A;  1Y1U A;  3KH7 A;  3UBL A;  5L71 A;  2DJ3 A;  3LYK A;  1TRV A;  1GUH A;  3U6V A;  5A4U A;  3DRN A;  4A5P A;  3UAP A;  3VI5 A;  4F2I A;  2H1A A;  4PHZ C;  2I9H A;  2VLV A;  2O7K A;  1WOU A;  2ZUP A;  1SKW B;  1KNG A;  2X99 A;  3ZIV A;  3EWL A;  3W8J A;  2DJ1 A;  3N5O A;  3VI7 A;  2VOC A;  4DSR A;  5ECH B;  1GH2 A;  1X5C A;  2KOK A;  5FT3 A;  1OVN A;  2FWG A;  5CRW A;  2GT5 A;  4YAV A;  4O7H A;  2LRN A;  4KCA A;  2CVD A;  4RI7 A;  3V1W A;  3FZ5 A;  2QSI A;  1ZYN A;  4MJE A;  2H75 A;  4DVC A;  2H1L A;  1O6J A;  4GF0 A;  3EU3 A;  2FLS A;  2R37 A;  3PR8 A;  3ZRD A;  5CNW A;  2V1M A;  5B6M A;  1GL8 A;  3TJJ A;  3E3E A;  1EOH A;  2FGX A;  2WRT A;  1GUK A;  4ECJ A;  2HRA A;  13GS A;  1PD2 1;  3QMX A;  1GNW A;  3FMW A;  2O85 A;  4OO5 A;  3GA4 A;  2MMA A;  4Z2T A;  3ZTL A;  2DJ2 A;  3UEM A;  4PUF C;  2CQ9 A;  1SL0 B;  4XCS A;  2ZCT A;  1A2M A;  1PRX A;  1M9B A;  4NWY A;  3J7Y b;  2L57 A;  3F4S A;  3LYP A;  3CBU A;  3HCZ A;  6GSY A;  5J4U A;  5IM9 A;  2H6Y A;  2LUS A;  1V9W A;  1R4W A;  4FO5 A;  4ISD A;  3I9V 2;  3LWA A;  4J57 E;  1N8J A;  3TKS A;  2K8V A;  2BJX A;  2VCQ A;  4NV5 A;  3K8N A;  4TR0 A;  3LOR A;  4KGI A;  1GTI A;  4Q5R A;  3APO A;  4K1F A;  1OC8 A;  2ALB A;  4PUA A;  3C1R A;  5INY A;  3APS A;  2GVP A;  1SKR B;  4KW6 A;  5D9X A;  5AIX A;  2K8S A;  4NPB A;  5G2Z A;  3QDN A;  3KM6 A;  5A5K A;  5J40 A;  1XBS A;  4JBB A;  3GKM A;  3P7X A;  1OKD A;  1K0B A;  1Y6E A;  4NMU A;  2WB9 A;  1X5E A;  2JSY A;  1GLP A;  4EIQ A;  2REM A;  2CZ3 A;  3DVW A;  3DGQ A;  3WT1 A;  1V2A A;  2NTO A;  2HI7 A;  4IVF A;  3WT2 A;  4MLY A;  5EVO A;  1XW5 A;  3UJ1 A;  3FYG A;  2VL2 A;  1T4Z A;  5DJL A;  3FW2 A;  3ZLP A;  2PN8 A;  3CRU A;  1M99 A;  1ZCP A;  2O87 A;  4GST A;  2X49 A;  4G0L A;  1MDK A;  4MH2 A;  4EE0 A;  1UVZ A;  2V6K A;  2R3X A;  4PUR A;  1J0F A;  3FZ4 A;  5ENU A;  1WMJ A;  3LW9 A;  1PQN A;  3ME7 A;  2N5B A;  4YQU A;  2UV8 G;  1HNC A;  3GKX A;  4N11 A;  5EL8 A;  1H75 A;  9GSS A;  1GSF A;  3N9J A;  3BCK A;  4ZIL A;  4AF2 A;  4KF9 A;  6GSW A;  5HR2 A;  17GS A;  3TUE A;  6GST A;  1E6B A;  1XOB A;  5B7C A;  1YF0 A;  5IOX A;  1YDK A;  2WVY A;  1S4B P;  3HMJ G;  1SEN A;  1WPI A;  4LL4 B;  4ACS A;  20GS A;  1XWK A;  1WIK A;  2WUL A;  1Q4J A;  3IAM 2;  2A2S A;  2MZC A;  1R26 A;  2JSZ A;  4TR4 A;  1ZL9 A;  2LTK A;  2F9S A;  1EEJ A;  3TJK A;  1B48 A;  1Z9H A;  3UAR A;  1T3B A;  2C3Q A;  1S3R A;  2QC7 A;  3GST A;  1A0F A;  3ZVJ D;  2EIO A;  1JLW A;  2V6O A;  3FR6 A;  2DC5 A;  4MF5 A;  4DSQ A;  2VM1 A;  5G30 A;  1KEB A;  2P5Q A;  1XG8 A;  5IMV A;  1W89 A;  1M2A A;  4XS4 B;  3CMI A;  4YKF A;  1B8X A;  4LMV A;  1WP0 A;  4NHW A;  2HRK A;  5F05 A;  5JCU A;  2G0F A;  2XBI A;  4USS A;  1SK0 A;  2V32 A;  1QXH A;  5BRT A;  1XVW A;  2EIR A;  4GTU A;  3TCO A;  4MJA A;  3DEX A;  3GX0 A;  5AN1 A;  3TDG A;  3RHB A;  4CW9 A;  4F9Z A;  2KHP A;  5ECM B;  4WEY A;  5GAN D;  2GS3 A;  3BJ5 A;  3NIV A;  5DDL A;  2F8A A;  2H19 A;  2VIM A;  1IYH A;  5ECO B;  2GGT A;  4XHM A;  4ILF A;  4FXY P;  1S3C A;  4O5Q A;  3WGX A;  4K9Z A;  2OT3 A;  2GST A;  4L0W A;  2B1K A;  2O36 A;  2LRC A;  5ECL B;  2GT6 A;  2E0Q A;  5DAK A;  2YV9 A;  2JAC A;  2NBS A;  5KOW A;  1MTC A;  1YKC A;  1J08 A;  2CV4 A;  4GQF A;  4IJ3 A;  1BX9 A;  3IRA A;  4OFM A;  4JE1 A;  2O3E A;  4NV2 A;  5B8A A;  3BD2 A;  1QUW A;  2HXK A;  1B4P A;  1SD8 A;  3H1N A;  1PN0 A;  3D5J A;  2N5F A;  2H8L A;  5FWG A;  1UC7 A;  1QFN A;  1Z5Y E;  1AQW A;  2KUC A;  4KX4 A;  2WS2 A;  2D2Z A;  3WYW A;  2A4H A;  3KEB A;  4TXO A;  5B8B A;  1BYE A;  5KEJ A;  2YWI A;  4IS0 A;  1XPV A;  4YH2 A;  1BF5 A;  5DJM A;  1BQ7 A;  1X5D A;  3O3T A;  4D73 B;  4AKI A;  1OC9 A;  4H86 A;  1C72 A;  3ZVJ A;  4O92 A;  1WE0 A;  4ML1 A;  1EP8 A;  1TRS A;  4X0X A;  5D9V A;  4IJI A;  4ZL9 A;  3IAS 2;  2J23 A;  3WGD A;  1G0T A;  2DSA A;  2UZ8 A;  5G1K A;  3KCM A;  5H5S A;  4G0I A;  5J41 A;  5J9B A;  4FIW A;  3HHV A;  3CSI A;  4OFN A;  4TXV A;  3D21 A;  4K6X A;  1A2J A;  2HRK B;  2VM2 A;  3H8Q A;  5EPF A;  5H5R A;  2HQT A;  4ECI A;  4PQ1 A;  4XS6 A;  4KH7 A;  2ES7 A;  4KA0 A;  1CQG A;  1Z6N A;  3HYP A;  3CSH A;  2Z9S A; 
#chains in the Genus database with same CATH homology
 3RPN A;  5DCG A;  2DLX A;  1TP9 A;  2KLX A;  3G7J A;  4V2M A;  2YZU A;  2R6K A;  3Q6O A;  3HXS A;  4DEJ A;  3GX8 A;  1U87 A;  5E59 A;  3DIE A;  1JZR A;  2RM5 A;  2FWF A;  2RUF A;  1XZO A;  1ZMA A;  5HR0 A;  3D4M A;  1TOF A;  4GDF A;  5LNK e;  3F6D A;  4JR4 A;  2FUG 2;  2HSH A;  2H6X A;  5DAK B;  1ABA A;  3ZZX A;  4L5L A;  5IO2 A;  12GS A;  3GV1 A;  2LV3 A;  3ERW A;  2FA8 A;  4ID0 A;  3ERG A;  2GQM A;  4LL1 B;  1NSW A;  1KBN A;  1G6Y A;  1SYX A;  1GUL A;  2DKI A;  1K0C A;  2IN3 A;  4K7O A;  2B7J A;  4G0K A;  3MNG A;  1M2D A;  2YV7 A;  3KGK A;  1B9X C;  3EPT A;  3R2Q A;  1Q98 A;  4V1A p;  2DJK A;  2KP1 A;  1SK2 A;  4IKH A;  2HZF A;  5IMZ A;  4K2D A;  3QFB C;  2C0F A;  2VCT A;  4OCE A;  2C3T A;  4V1A g;  5ECQ B;  2VL2 C;  3IE3 A;  1OYJ A;  4TXO B;  5B6N A;  1W4V A;  2H70 A;  4OCF A;  2X4A A;  3KTB A;  1V57 A;  1XWB A;  3NOF A;  1PA3 A;  2L6C A;  1F37 A;  2G2Q A;  4RI6 A;  1XVQ A;  4IN0 A;  3DWV A;  2EFC A;  1EWX A;  4RQR A;  2LRT A;  2VL3 A;  4G01 A;  3A5I A;  2TIR A;  18GS A;  1BG1 A;  2WCI A;  3HA9 A;  4MAB A;  1WJK A;  1UA5 A;  2B5X A;  3ZL5 A;  1M0U A;  4K5S A;  1YEP A;  1FW1 A;  3PIN A;  10GS A;  2XC2 A;  4I8B A;  1TK8 B;  4KUN A;  2YZH A;  4W66 A;  2B6M A;  2DIZ A;  1RQM A;  3GYK A;  2YWO A;  4FYU A;  5KN3 A;  3EYT A;  4O32 A;  4MJC A;  4WKW A;  5IQY A;  2ON5 A;  3MAK A;  5D9T A;  2A2R A;  3I69 A;  4HDE A;  3LSZ A;  3M3M A;  3P90 A;  2I3Y A;  3HD5 A;  6GSX A;  1GSY A;  2YN1 A;  2DML A;  4CY6 A;  2AJQ B;  3KMN A;  4ZXG A;  4OD7 A;  3KH9 A;  4POM A;  2M46 A;  4ZL7 A;  4ICY A;  3GUR A;  1SVL A;  3M9J A;  4HJM A;  4HS1 A;  3E9J B;  2FHE A;  2C4J A;  1UN2 A;  1LBK A;  1Z6M A;  2DJ0 A;  2OAC A;  3EIN A;  4ZB7 A;  3HJM A;  5AGY A;  1M7T A;  2OA7 A;  3GUS A;  4Z2U A;  5KOX A;  5IMD A;  5DBQ A;  3A2X A;  3P8W A;  3EC3 A;  3G9B A;  3Q18 A;  3GH6 A;  2L4C A;  2IMI A;  4ZBB A;  2E2M A;  3SBC A;  1OKT A;  1EZK A;  1PX7 A;  2OKA A;  5A4V A;  4PGT A;  4J56 E;  3H4K A;  3IXR A;  5AIV A;  2HNL A;  1PKZ A;  3ISO A;  4GCI A;  2IMF A;  5D9W A;  4MF7 A;  1XIY A;  1BED A;  4I5Q A;  1NM3 A;  1VF4 A;  3HJP A;  4ECC A;  4I6X A;  1SJ6 A;  1SL1 B;  4IQA A;  1GTB A;  4X1U A;  3DKS A;  1JFU A;  5ECS A;  1SJI A;  4F0C A;  2B3S A;  4F03 A;  1ZOF A;  1ZZY A;  2GZZ A;  3ZMK A;  3IBH A;  4XS4 A;  1CQH A;  2CAQ A;  3APQ A;  5ID2 A;  2F8F A;  2N5A A;  2PWJ A;  2LQO A;  3UIW A;  3Q19 A;  5D93 A;  4OO4 A;  2MMZ A;  2GSR A;  3LFL A;  2KP2 A;  4IP1 A;  5F0G A;  4QL7 A;  1LU4 A;  3CWG A;  4PQI A;  1B9Y C;  2PVQ A;  3P2A A;  1V98 A;  3TOT A;  16GS A;  4Q5N A;  2V2G A;  5HFI A;  3DVX A;  1SD9 A;  4GWR A;  3L0H A;  2IME A;  2F3M A;  1JZO A;  4IEL A;  1TI3 A;  3KZQ A;  1ON4 A;  2GZY A;  4I97 A;  1BAY A;  1G7O A;  5C04 A;  4HU7 A;  1TTZ A;  4K0G A;  2PER A;  1XFL A;  1KTE A;  1ML6 A;  3CSJ A;  2H66 A;  2PU9 C;  1XOA A;  3D6I A;  2H0H A;  4KDY A;  5J4V A;  2QKE A;  1TDI A;  4EO3 A;  2GTU A;  4GLT A;  3ERF A;  4N0V A;  3IHQ A;  3EMP A;  4FQU A;  2YJ7 A;  2LEG A;  3F4R A;  1HD2 A;  4E8H A;  1DE1 A;  2K9F A;  1GSQ A;  1MD3 A;  2VL9 A;  3KMO A;  4OWY A;  5IMF A;  3M0F A;  3GSS A;  1EEM A;  4MZB A;  4F82 A;  1F3A A;  2MYG A;  5DVB A;  4JZQ A;  11GS A;  3F4T A;  1ZYQ B;  4JED A;  1SVO A;  3IPZ A;  5H5Q A;  4P3Y B;  1V58 A;  3TKQ A;  3FEU A;  5D73 A;  1FVK A;  3RDW A;  5J47 A;  3F6F A;  2L6D A;  4TR3 A;  4X43 A;  4LLR A;  1GSU A;  1A8L A;  1ERT A;  4GRF A;  2PUK C;  4D73 A;  4HQS A;  3OR5 A;  2RUE A;  4ZB8 A;  5JCW A;  1FO5 A;  1X9S B;  3EVI A;  1QQ2 A;  2O8V B;  3EU4 A;  4O5R A;  3IDV A;  2EFE A;  2VUP A;  1YJ6 A;  3KP9 A;  2TRX A;  2VKZ G;  2HZE A;  4I2T A;  4IQ1 A;  2IFQ A;  1MEK A;  3M1G A;  2TRC P;  3IR4 A;  5DQS A;  3CRT A;  1ERU A;  2C80 A;  4O5U A;  4ECB A;  4Q5F A;  5ECN B;  2DIY A;  1TK0 B;  2OBI A;  4AJ6 A;  5ID2 B;  4QMK A;  2H73 A;  3TGZ A;  5CO3 A;  4WF5 A;  1R5P A;  1PL1 A;  4PQH A;  3HY2 A;  3VWV A;  2M72 A;  1T8E B;  2E2G A;  4TR1 A;  4ZB9 A;  4EKZ A;  4GXZ A;  4KDU A;  3QD9 A;  2RM6 A;  1VF3 A;  2CZ2 A;  3ED3 A;  4HI7 A;  4K2X A;  3C1S A;  1QMV A;  2OBK A;  5JWQ B;  2IWT A;  2JZR A;  2FY6 A;  3U5R E;  2YAN A;  4YKG A;  2R5G A;  4XS1 A;  4V2L A;  3R3E A;  2RII A;  1T7P B;  3ZIJ A;  2AV4 A;  3TKP A;  2F51 A;  1J9B A;  2BTO T;  2PVO C;  3A2W A;  4KB3 A;  2H1G A;  4BVX A;  3SWL A;  2R0C A;  4RQX A;  1EGO A;  4LMW A;  2H76 A;  3TB2 A;  2YWM A;  4MF6 A;  1R5A A;  4OMV A;  3FR3 A;  4WR4 A;  5A1N A;  5KN2 A;  2HLS A;  2H1B A;  4I2U A;  2IIY A;  3TRP A;  4HEA 2;  2DKH A;  2PMT A;  1X9M B;  3QAW A;  1MD4 A;  1PKW A;  2IL3 A;  3VUR A;  3D22 A;  1N2A A;  1K0D A;  1F2E A;  5JWR B;  2EC4 A;  3BCI A;  3IK7 A;  1SK1 A;  3PGT A;  1ZGN A;  1MDI A;  1T4Y A;  3W8S A;  3QAG A;  2CX4 A;  4K0N A;  4POL A;  2FWH A;  4JU5 A;  1FVJ A;  4G10 A;  1AAZ A;  4K7I A;  4NHZ A;  1FAA A;  3BOA A;  3D4T A;  4EDZ A;  2LKU A;  3GKN A;  4N10 A;  5ECI B;  2HZE B;  3LQ7 A;  3CXG A;  2PGT A;  3KP8 A;  2H72 A;  4KCE A;  3KTL A;  1EV4 A;  2XHF A;  4MA9 A;  4ULX A;  2IFQ B;  4MH3 A;  2A2P A;  2R0P A;  2LJA A;  5G1L A;  1K0M A;  5IPG A;  3EUR A;  3NZN A;  2VCZ A;  4J2F A;  1ST9 A;  3IV4 A;  1SVM A;  3WGE A;  5J3R A;  1QK8 A;  3F9U A;  1O8W A;  1TU7 A;  5A5H A;  4HQZ A;  2HE3 A;  1THX A;  3F8U A;  1TXU A;  3LXZ A;  4TR1 B;  3UVH A;  3ZRE A;  5IIZ A;  4WBJ A;  1WWJ A;  2WJU A;  4BVY A;  4L0U A;  1G7E A;  1A0R P;  1OE7 A;  2GSS A;  2MMO A;  1YVL A;  3RHC A;  3TJB A;  3MDK A;  3IHG A;  2H01 A;  4YQV A;  3GFK A;  5KN0 A;  2FWE A;  1VRS D;  1DUG A;  5F07 A;  1GSE A;  3FKF A;  1GTA A;  2HFD A;  3IA1 A;  3MIX A;  1O73 A;  2L4Q A;  4PTS A;  4G2E A;  4AJ7 A;  4BVX B;  2L5O A;  3GKK A;  4HU9 A;  3TJG A;  3QFA C;  1X9W B;  2B7K A;  3EMX A;  1NW2 A;  4Z7X A;  3MYD A;  2QA2 A;  3GRX A;  5A1N B;  1BG5 A;  1FB0 A;  1SYR A;  3ME8 A;  5IO0 A;  2GQL A;  19GS A;  3VK9 A;  4E68 A;  3H79 A;  5AIS A;  4RUV A;  2O89 A;  3C73 A;  2WFC A;  4TKY A;  3HVV A;  2VCX A;  14GS A;  3O6T A;  2NPB A;  2P5R A;  3C7M A;  4KSO A;  4EDY A;  2AHE A;  3DD3 A;  1EOG A;  4TVE A;  4IBP A;  4HZ2 A;  3A5W A;  2QA1 A;  4MZC A;  3RAZ A;  3L9V A;  2C3N A;  1FB6 A;  3JCM L;  2OAD A;  3UL3 A;  2OE0 A;  4ZBD A;  4IGJ A;  3VPT A;  3ZFB A;  1GSD A;  3AY8 A;  3FHK A;  1V40 A;  3CTG A;  2C1Y A;  4BPY A;  2B5Y A;  4NAX A;  3FK8 A;  3HVS A;  3TJF A;  3FY7 A;  3ZFL A;  5GAP D;  3ZIT A;  1HNB A;  3FZA A;  4PNG A;  5JWO B;  1HQO A;  3QAV A;  5A5H B;  2VLU A;  3H93 A;  4L8E A;  4EXJ A;  2EIQ A;  1K3Y A;  1GSS A;  2LS5 A;  1YKA A;  3GMF A;  1TK5 B;  1GWC A;  5BMU A;  3F0I A;  3DYR A;  4NXI A;  3F3R A;  4ZB6 A;  2H74 A;  4BVY B;  1TJD A;  1XXU A;  5J9C A;  1K3O A;  1XCC A;  1O8X A;  5ECR B;  1DSB A;  3HKR A;  3UBK A;  1NHY A;  4KSM A;  5ECP B;  4N0Z A;  5J5N A;  4MNN A;  4HUA A;  4K8M A;  3J7Y k;  2LQQ A;  5G5F A;  5ELG A;  2R2J A;  4Q5Q A;  1AIU A;  2VD0 A;  3LXT A;  2YP6 A;  2VAF A;  5F8B A;  2X8G A;  1I5G A;  4GQC A;  1AXD A;  4IP6 A;  4GSN A;  4YAP A;  1URM A;  1O85 A;  2WZ9 A;  4QQ7 A;  4FYC A;  2I4A A;  1DE2 A;  1PX6 A;  3GNJ A;  4EUY A;  1U6T A;  4BL7 A;  6GSS A;  2XPE A;  2CVB A;  1HNA A;  4KDX A;  3TKR A;  2H0G A;  1B4Q A;  1YEX A;  5IMA A;  5A34 A;  4HJ2 A;  5CRH A;  2GDR A;  2MBS A;  2X8H A;  1JZD A;  1Z7R A;  4BWS A;  4F0B A;  3LGC A;  1TI1 A;  4AI6 A;  2FCH A;  3KIJ A;  3L4N A;  4Z2R A;  3O76 A;  2HSY A;  3UMA A;  2XBQ A;  4EF0 A;  5D8I A;  2H1D A;  3VLN A;  2C0G A;  4GSS A;  2YPM A;  5FHI A;  1SU9 A;  2EFH A;  4AJ8 A;  4ML6 A;  5CP1 A;  4N30 A;  5CAX A;  5IPH A;  2OE1 A;  1XWC A;  1ILO A;  5CRD A;  2OJL A;  2H71 A;  3WD6 A;  2VCW A;  1TRW A;  3FR9 A;  2HSM A;  3VWW A;  3VWX A;  5BMU B;  4WF4 A;  2OE3 A;  5HQP A;  2K6V A;  3C8E A;  1A24 A;  1O81 A;  6GSV A;  1U88 A;  2HT9 A;  1RW1 A;  1WRY A;  1GLQ A;  3Q74 A;  2VD1 A;  5EY6 A;  4K5R A;  2VCV A;  2DJJ A;  1ERW A;  2YOI A;  5LCZ A;  1XWA A;  2HSN A;  2DBC A;  2C0E A;  1OAZ A;  4EL1 A;  2JL4 A;  2WGR A;  2NDO A;  3LG6 A;  5F06 A;  1YY7 A;  4OFT A;  3W6G A;  5A4W A;  1S3D A;  22GS A;  2YCD A;  1A23 A;  1ZYE A;  5GSS A;  2O5V A;  1F9M A;  2JZS A;  2YWN A;  3GL3 A;  3KD0 A;  3HZ4 A;  5HR3 A;  2GQK A;  2IJY A;  1OC3 A;  2H6Z A;  3HZ8 A;  1SL2 B;  2P31 A;  1YF1 A;  2IMK A;  1YZX A;  4JRR A;  3BBY A;  4BL7 B;  3PH9 A;  1AC1 A;  5CRG A;  1M9A A;  4N3Z A;  1EGR A;  4AGS A;  1FHE A;  2WDU A;  4XTS A;  4EIP A;  4FH8 A;  1SJZ A;  1Z3E A;  2BMX A;  5G31 A;  2R0G A;  5GST A;  2I81 A;  5A34 B;  1O7U A;  1SKS B;  2EFD A;  2P0G A;  3C71 A;  3GIX A;  1RK4 A;  3ZML A;  4KAE A;  5G5E A;  1K0N A;  1TKD B;  2CAI A;  1YQ1 A;  4QL9 A;  1XW9 A;  3TRX A;  5CRE A;  4LA1 A;  1VF2 A;  1M2B A;  2X64 A;  1TXX A;  5HFG A;  5D96 A;  2LNT A;  3A3T A;  5DCH A;  5HFK A;  2AUV A;  5GZZ B;  3F3Q A;  4PXO A;  4WET A;  1FOH A;  1PGT A;  4IHU A;  2XPD A;  4ZBA A;  2A4V A;  1K0O A;  4MDC A;  2VO4 A;  2LNS A;  5IMC A;  4ZL8 A;  3RPP A;  2MMN A;  2V41 A;  1FG4 A;  1XWG A;  4WXT A;  2AB6 A;  2HSM B;  1GUM A;  4POB A;  4MPG A;  2H0I A;  1OE8 A;  3CYN A;  2GSQ A;  1JLV A;  3DXB A;  3D0Z A;  2M80 A;  5HR1 A;  2CVK A;  3S9F A;  1PN9 A;  5E4W A;  4AKX B;  2DMM A;  2MBT A;  1TW9 A;  1AW9 A;  3US3 A;  3HDC A;  4BWQ A;  3TU3 B;  3FRC A;  4TOP A;  5ELA A;  1R7H A;  5DQY A;  3QOU A;  5J4Y A;  2HSN B;  2J9H A;  1VF1 A;  3CTF A;  1EV9 A;  2ON7 A;  2E7P A;  2C8U A;  1A2L A;  4POK A;  1H4O A;  3M9K A;  2YJH A;  3L78 A;  2VLT A;  4JR6 A;  3GTU A;  1TU8 A;  4X4J A;  1HYU A;  1TRU A;  1K0A A;  1ZYP A;  1G6W A;  4K7N A;  4AKH A;  4HOJ A;  2RLI A;  4HZ4 A;  5DAL A;  2JU5 A;  1EP7 A;  5IOW A;  4V2N A;  1GNE A;  1ERV A;  3PPU A;  1JZW A;  2JAD A;  1JHB A;  2FNO A;  1A8Y A;  5JCG A;  4KND A;  4IW9 A;  2L59 A;  1U3A A;  4MJB A;  3FZ9 A;  2CT6 A;  4DSS A;  4XRA A;  3IOS A;  3UVT A;  3QR6 A;  3EE2 A;  3I43 A;  3VFI A;  2HRF A;  3IK9 A;  1PSQ A;  2YNX A;  2PBJ A;  4ZIJ A;  3VPQ A;  2X8C A;  5CYY A;  3IC4 A;  3GH9 A;  1F6M C;  1AQX A;  3GN3 A;  3MSZ A;  3HVX A;  2CA8 A;  4G9H A;  2B1L A;  4MMM A;  3E0U A;  5KN1 A;  1S3A A;  2LJK A;  2NVL A;  8GSS A;  3G7I A;  2IMD A;  2LST A;  3TRQ A;  2PPT A;  4G19 A;  2JZT A;  2AAW A;  1AQV A;  4MCU A;  2GZP A;  5LD0 A;  4MP4 A;  3GL5 A;  7GSS A;  4TW5 A;  1Y25 A;  1GRX A;  4WBR D;  1T00 A;  3ZYW A;  3F63 A;  5C00 A;  1PMT A;  5COH A;  1FOV A;  1I9D A;  3VWU A;  1PL2 A;  3KXO A;  3A2V A;  1Z7P A;  4XIH A;  3KJY A;  1QGV A;  4XRD A;  1K3L A;  4MPF A;  3L9S A;  2L5L A;  3TKS C;  1VGL A;  1U3I A;  4CDO A;  4PNF A;  4CHS A;  4TRX A;  4TN8 A;  2CX3 A;  2FD3 A;  2C0D A;  4EC0 A;  2R4V A;  4WR5 A;  4MZW A;  3LJR A;  4E8E A;  2K18 A;  4FYB A;  4BA7 A;  3TKS E;  5ECK B;  1XW6 A;  4AKG A;  1GTU A;  3G7Y A;  2HYX A;  2IPA A;  2B5E A;  1X0R A;  1T1V A;  1AUC A;  2H30 A;  3MWH A;  3GTU B;  1NHO A;  1USB A;  2QGV A;  1F3B A;  3LEF A;  3I6A A;  3TOU A;  3M8N A;  4PX1 A;  3DML A;  3HJO A;  1E2Y A;  2HRN A;  2LJR A;  3QPM A;  5DAL B;  3QCP A;  3IC8 A;  6GSU A;  4YQM A;  4MK3 A;  4KE3 A;  4CY8 A;  1BJX A;  1ACV A;  3GHA A;  4DSS B;  1MDJ A;  1LJR A;  2ZNM A;  5ABR A;  1DBY A;  1N25 A;  4EVM A;  4L5O A;  2I1U A;  3L9U A;  2AYT A;  2FA4 A;  3RBT A;  1OC9 B;  1GP1 A;  1THO A;  3UOM A;  1IYI A;  2GLR A;  1Y1U A;  3KH7 A;  3UBL A;  5L71 A;  2DJ3 A;  3LYK A;  1TRV A;  1GUH A;  3U6V A;  5A4U A;  3DRN A;  4A5P A;  3UAP A;  3VI5 A;  4F2I A;  2H1A A;  2I9H A;  2VLV A;  2O7K A;  1WOU A;  2ZUP A;  1SKW B;  1KNG A;  2X99 A;  3ZIV A;  3EWL A;  3W8J A;  2DJ1 A;  3N5O A;  3VI7 A;  2VOC A;  4DSR A;  5ECH B;  1GH2 A;  1X5C A;  2KOK A;  5FT3 A;  1OVN A;  2FWG A;  5CRW A;  2GT5 A;  4YAV A;  4O7H A;  2LRN A;  4KCA A;  2CVD A;  4RI7 A;  3V1W A;  3FZ5 A;  2QSI A;  1ZYN A;  4MJE A;  2H75 A;  4DVC A;  2H1L A;  1O6J A;  4GF0 A;  3EU3 A;  2FLS A;  2R37 A;  3PR8 A;  3ZRD A;  5CNW A;  2V1M A;  5B6M A;  1GL8 A;  3TJJ A;  3E3E A;  1EOH A;  2FGX A;  2WRT A;  1GUK A;  4ECJ A;  2HRA A;  13GS A;  1PD2 1;  3QMX A;  1GNW A;  3FMW A;  2O85 A;  4OO5 A;  3GA4 A;  2MMA A;  4Z2T A;  3ZTL A;  2DJ2 A;  3UEM A;  4PUF C;  2CQ9 A;  1SL0 B;  4XCS A;  2ZCT A;  1A2M A;  1PRX A;  1M9B A;  4NWY A;  3J7Y b;  2L57 A;  3F4S A;  3LYP A;  3CBU A;  3HCZ A;  6GSY A;  5J4U A;  5IM9 A;  2H6Y A;  2LUS A;  1V9W A;  1R4W A;  4FO5 A;  4ISD A;  3LWA A;  3I9V 2;  4J57 E;  1N8J A;  3TKS A;  2K8V A;  2BJX A;  2VCQ A;  4NV5 A;  3K8N A;  4TR0 A;  3LOR A;  4KGI A;  1GTI A;  4Q5R A;  3APO A;  4K1F A;  1OC8 A;  2ALB A;  4PUA A;  3C1R A;  5INY A;  3APS A;  2GVP A;  1SKR B;  4KW6 A;  5D9X A;  5AIX A;  2K8S A;  4NPB A;  5G2Z A;  3QDN A;  3KM6 A;  5A5K A;  5J40 A;  1XBS A;  4JBB A;  3GKM A;  3P7X A;  1OKD A;  1K0B A;  1Y6E A;  4NMU A;  2WB9 A;  1X5E A;  2JSY A;  1GLP A;  4EIQ A;  2REM A;  2CZ3 A;  3DVW A;  3DGQ A;  3WT1 A;  1V2A A;  2NTO A;  2HI7 A;  4IVF A;  3WT2 A;  4MLY A;  5EVO A;  1XW5 A;  3UJ1 A;  3FYG A;  2VL2 A;  1T4Z A;  5DJL A;  3FW2 A;  3ZLP A;  2PN8 A;  3CRU A;  1M99 A;  1ZCP A;  2O87 A;  4GST A;  2X49 A;  4G0L A;  1MDK A;  4MH2 A;  4EE0 A;  1UVZ A;  2V6K A;  2R3X A;  4PUR A;  1J0F A;  3FZ4 A;  5ENU A;  1WMJ A;  3LW9 A;  1PQN A;  3ME7 A;  2N5B A;  4YQU A;  2UV8 G;  1HNC A;  3GKX A;  4N11 A;  5EL8 A;  1H75 A;  9GSS A;  1GSF A;  3N9J A;  3BCK A;  4ZIL A;  4AF2 A;  4KF9 A;  6GSW A;  5HR2 A;  17GS A;  3TUE A;  6GST A;  1E6B A;  1XOB A;  5B7C A;  1YF0 A;  5IOX A;  1YDK A;  3HMJ G;  1SEN A;  1WPI A;  4LL4 B;  4ACS A;  20GS A;  1XWK A;  1WIK A;  2WUL A;  1Q4J A;  3IAM 2;  2A2S A;  2MZC A;  1R26 A;  2JSZ A;  4TR4 A;  1ZL9 A;  2LTK A;  2F9S A;  1EEJ A;  3TJK A;  1B48 A;  1Z9H A;  3UAR A;  1T3B A;  2C3Q A;  2QC7 A;  3GST A;  1A0F A;  3ZVJ D;  2EIO A;  1JLW A;  2V6O A;  3FR6 A;  2DC5 A;  4MF5 A;  4DSQ A;  2VM1 A;  5G30 A;  1KEB A;  2P5Q A;  5IMV A;  1W89 A;  1M2A A;  4XS4 B;  3CMI A;  4YKF A;  1B8X A;  4LMV A;  1WP0 A;  4NHW A;  2HRK A;  5F05 A;  5JCU A;  2G0F A;  2XBI A;  4USS A;  1SK0 A;  2V32 A;  1QXH A;  5BRT A;  1XVW A;  2EIR A;  4GTU A;  3TCO A;  4MJA A;  3DEX A;  3GX0 A;  5AN1 A;  3TDG A;  3RHB A;  4CW9 A;  4F9Z A;  2KHP A;  5ECM B;  4WEY A;  5GAN D;  2GS3 A;  3BJ5 A;  3NIV A;  5DDL A;  2F8A A;  2H19 A;  2VIM A;  1IYH A;  5ECO B;  2GGT A;  4XHM A;  4ILF A;  1S3C A;  4O5Q A;  3WGX A;  4K9Z A;  2OT3 A;  2GST A;  4L0W A;  2B1K A;  2LRC A;  5ECL B;  2GT6 A;  2E0Q A;  5DAK A;  2YV9 A;  2JAC A;  2NBS A;  5KOW A;  1MTC A;  1YKC A;  1J08 A;  2CV4 A;  4GQF A;  4IJ3 A;  1BX9 A;  3IRA A;  4OFM A;  4JE1 A;  4NV2 A;  5B8A A;  3BD2 A;  1QUW A;  2HXK A;  1B4P A;  1SD8 A;  3H1N A;  1PN0 A;  3D5J A;  2N5F A;  2H8L A;  5FWG A;  1UC7 A;  1QFN A;  1Z5Y E;  1AQW A;  2KUC A;  4KX4 A;  2WS2 A;  2D2Z A;  3WYW A;  2A4H A;  3KEB A;  4TXO A;  5B8B A;  1BYE A;  5KEJ A;  2YWI A;  4IS0 A;  1XPV A;  4YH2 A;  1BF5 A;  5DJM A;  1BQ7 A;  1X5D A;  3O3T A;  4D73 B;  4AKI A;  1OC9 A;  4H86 A;  1C72 A;  3ZVJ A;  4O92 A;  1WE0 A;  4ML1 A;  1EP8 A;  1TRS A;  4X0X A;  5D9V A;  4IJI A;  4ZL9 A;  3IAS 2;  2J23 A;  3WGD A;  1G0T A;  2DSA A;  2UZ8 A;  5G1K A;  3KCM A;  5H5S A;  4G0I A;  5J41 A;  5J9B A;  4FIW A;  3HHV A;  3CSI A;  4OFN A;  4TXV A;  3D21 A;  4K6X A;  1A2J A;  2HRK B;  2VM2 A;  3H8Q A;  5EPF A;  5H5R A;  2HQT A;  4ECI A;  4PQ1 A;  4XS6 A;  4KH7 A;  2ES7 A;  4KA0 A;  1CQG A;  1Z6N A;  3HYP A;  3CSH A;  2Z9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...