5ECMB

Crystal structure of fin219-fip1 complex with ja and leu
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Jasmonic acid-amido synthetase JAR1
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/transferase
total genus 61
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecmB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecmB01
6GSYA 5CNWA 2PU9C 1A8LA 3Q74A 4I5QA 3I69A 5ENUA 1K0MA 5G2ZA 3UAPA 2GSRA 3UVTA 4TR1B 3C8EA 1PX7A 3M0FA 1PMTA 4KDYA 3L0HA 1ERTA 1G7OA 2REMA 4I97A 1TRUA 5IO0A 3U6VA 2IL3A 3BD2A 2B1KA 1SK1A 2VD1A 2CX4A 3EYTA 2N5BA 2OBIA 3GL3A 4YQVA 1SL0B 4TR0A 2H74A 2LJAA 5IIZA 1I5GA 4JE1A 2MZCA 2I1UA 4HDEA 1GWCA 4JU5A 4MF6A 1FB6A 3NIVA 3J7Yb 1K0NA 3F4SA 3PR8A 3ZRDA 2LNTA 1Q4JA 2CVKA 2JSYA 4JR6A 2GSTA 1BYEA 2V1MA 3W8JA 4HU9A 5CYYA 1M7TA 5EY6A 2GDRA 2C80A 3TRPA 3IE3A 1SL2B 3FZ9A 1XWBA 2HZEB 4XS6A 1AQXA 10GSA 1Z6NA 2BTOT 3PINA 5ID2A 2YV9A 1X9WB 1V57A 2VCZA 3WD6A 2GQMA 3D22A 5ECHB 3E9JB 4BWSA 3IXRA 2CZ2A 2H6XA 3ERGA 5DCHA 2K18A 2AUVA 4GRFA 1SKSB 2DMLA 2B7JA 2ON7A 3IC8A 4BVYA 1ZCPA 5ECIB 1F3BA 1A2JA 2C4JA 3HYPA 1BX9A 3APQA 2FWHA 1T4ZA 4PURA 2VD0A 4ECJA 1PX6A 4OO5A 1K3OA 4HOJA 2ON5A 3CBUA 5AN1A 1WRYA 3GKNA 4PTSA 2LJKA 4NPBA 1GSEA 4ISDA 1VF4A 1MDKA 5D96A 5IPGA 4LA1A 1J08A 1QMVA 3GSTA 4P3YB 3P8WA 2LNSA 1HNBA 3EINA 3KGKA 4L5LA 4ZB8A 4ECIA 3R2QA 2WRTA 1B9YC 4ZL7A 4OFMA 1THOA 4CHSA 4PNFA 1ZYQB 3IC4A 1T7PB 2IFQA 3F63A 5F05A 1XPVA 5DVBA 1WOUA 1B8XA 2IN3A 3TOUA 4I2TA 5DALB 1RK4A 4RUVA 2WJUA 3TUEA 1XWCA 4EKZA 2AYTA 1RW1A 4O5RA 1GTAA 4KSOA 5COHA 1PSQA 1PD21 2H01A 3ISOA 2FLSA 3VWXA 2NVLA 1GH2A 3JCML 4MA9A 2N5AA 2CZ3A 4NV2A 1YQ1A 1KNGA 2C3NA 4EXJA 4XS1A 4N30A 4G0LA 3TCOA 3EU4A 2OADA 3ZMLA 4PUAA 4MK3A 4LL4B 2OBKA 2RUEA 1R5PA 2FA8A 2GVPA 3H4KA 1M0UA 2MMNA 6GSXA 2YOIA 5CAXA 2EIOA 1SYRA 1PGTA 1WE0A 1AAZA 3G7IA 4JEDA 4BL7B 2GZZA 1TRVA 2LSTA 3UVHA 4IGJA 3SBCA 3APOA 3MSZA 1JFUA 4XS4B 4EDZA 1TRWA 1EV4A 4MH2A 1R4WA 5A5KA 4V1Ap 2C1YA 2KOKA 1A0FA 2FY6A 5ECKB 1SK2A 2IMDA 2I9HA 1BG5A 3C1SA 3LXTA 4KH7A 2LUSA 1N2AA 3ZIJA 4TN8A 5ECLB 4Q5FA 1AIUA 1SJZA 5B8BA 1GSYA 1K0DA 2CX3A 2NDOA 4NHZA 4YAVA 19GSA 3KXOA 5GZZB 2OA7A 2R3XA 2PMTA 3N9JA 3QAWA 4K7OA 1FW1A 3HY2A 2OE0A 1FO5A 4ECCA 1A8YA 4RI6A 20GSA 3EWLA 4MZBA 3L4NA 2EIRA 5E59A 2AV4A 3GURA 3O76A 3QOUA 2B6MA 3D4MA 5IMVA 2KHPA 3GV1A 1EWXA 3MAKA 2TRCP 1TP9A 1FOVA 1GTUA 4KX4A 3FEUA 2HSNB 3EU3A 1F37A 4MDCA 2LQOA 1PN9A 3CYNA 4OMVA 4OWYA 4E8HA 1M2AA 1V2AA 3IAS2 5IO2A 4K0GA 1N8JA 3AY8A 4JR4A 2FUG2 4CDOA 5HFKA 1X5EA 1UA5A 3L78A 1YDKA 1DUGA 1JLWA 4MJCA 2C8UA 5J9CA 3FK8A 3I43A 2RIIA 1NSWA 3DXBA 1OE7A 3KMNA 1EEMA 3IAM2 3IV4A 4POLA 3IK7A 3A2VA 4HZ2A 2DJ2A 6GSUA 3PGTA 5HFIA 3CSJA 5ID2B 2XBIA 2YNXA 3EMPA 4F9ZA 5J41A 1G7EA 4IP6A 3FR3A 4IELA 3P2AA 4Z7XA 2ZNMA 2N5FA 2JZSA 1PRXA 2MMAA 4N10A 1SENA 4MPGA 2AJQB 4BVYB 2G2QA 4TOPA 1GNEA 2MYGA 1HD2A 1QQ2A 2DBCA 1GUMA 2K8VA 2LTKA 5J4UA 2GGTA 4DVCA 1TK5B 3D5JA 3ME8A 1T8EB 2ES7A 5FWGA 1ERWA 4HJ2A 1O81A 2HI7A 1YF0A 4N0VA 2JZRA 3TJGA 1X0RA 3DVWA 2K8SA 3TKRA 4IW9A 2B7KA 1TI3A 1O85A 2IFQB 5IPHA 1T00A 1R26A 4FIWA 2HXKA 3HXSA 1VRSD 3KTBA 3ZREA 4USSA 2O89A 4NXIA 4OCEA 4TRXA 4HU7A 1AQWA 1I9DA 1ZYEA 2FGXA 2YWNA 3QFBC 4MABA 4OCFA 3GNJA 1S3CA 3H1NA 1QUWA 4YAPA 5ABRA 2KP1A 3DVXA 2YWMA 4IQAA 3HZ8A 4WR5A 3KD0A 2PGTA 3EURA 1USBA 4G9HA 1TI1A 4KCEA 3IBHA 2RM5A 4ZBBA 1OAZA 2HRFA 3VK9A 2KUCA 1XVQA 1XXUA 1Y25A 5D9TA 1SL1B 1GUKA 3DGQA 4ECBA 3CSIA 2H1AA 1MEKA 3FZ4A 1YF1A 2L59A 3C71A 2HT9A 1M9BA 4EC0A 4QQ7A 5ECMB 2HYXA 1F6MC 1XWAA 4YQMA 1AUCA 2OE3A 4G2EA 13GSA 2LS5A 4XTSA 5DAKB 2VCQA 3NOFA 1GLQA 3TRXA 4MZWA 1V98A 3N5OA 3KH7A 3ZL5A 2EC4A 1J9BA 4NAXA 5D9XA 2BMXA 3RPNA 4HI7A 4BVXA 3BOAA 2C0GA 1K3LA 2FWFA 1R5AA 4X43A 5J5NA 1S3AA 4L5OA 2PVQA 3IPZA 1EZKA 3ZITA 3QMXA 2YZHA 4F0CA 5HR2A 1GL8A 4MMMA 2B5EA 2X8CA 2O85A 2O7KA 2FD3A 3GN3A 4EDYA 2XHFA 4KGIA 3F8UA 4IJ3A 2GZPA 3UL3A 2CVDA 4EO3A 5ECRB 3LGCA 3RAZA 5ELGA 5E4WA 1ABAA 4MF5A 3TKSC 2GLRA 5IMAA 3K8NA 4MF7A 3DYRA 4JBBA 4KB3A 5CP1A 3Q18A 1XBSA 2TIRA 3QAVA 4MLYA 4WBRD 1PKZA 3RPPA 3KJYA 4J57E 2K6VA 1A0RP 4PQ1A 2HRKA 2D2ZA 3GH9A 1OVNA 3HDCA 2H1DA 4MJAA 1WIKA 1XOAA 1NM3A 1IYIA 5JCGA 1ML6A 3V1WA 1SD8A 3DIEA 1SKRB 1EEJA 1IYHA 4N0ZA 2VCTA 1X9MB 3CTFA 5LCZA 1X5DA 1T1VA 1A23A 4N11A 4ZILA 3EC3A 2DJJA 3GUSA 3ZVJA 4I6XA 4ZL9A 1GSQA 2VAFA 3HD5A 2L4CA 2IMEA 5L71A 2R6KA 1SJIA 2L5LA 1XZOA 3KZQA 3GMFA 3J7Yk 2VUPA 1YZXA 3P7XA 3DEXA 3G9BA 3GA4A 3ZZXA 1JLVA 2R2JA 3H93A 3CTGA 2M80A 5KEJA 4ML1A 5B7CA 3DKSA 1DSBA 4KDUA 3WYWA 1U3AA 5KN0A 1V9WA 5J9BA 4MP4A 1KTEA 3ZFBA 2ZCTA 1G6WA 1O8XA 4PUFC 3KCMA 4H86A 4EUYA 2V6KA 5BMUA 1SD9A 4DEJA 4GQCA 6GSWA 1ERVA 4K8MA 3IRAA 4QL7A 3LORA 3C1RA 1MD3A 3D6IA 2BJXA 1XW5A 2WGRA 22GSA 3RBTA 2M46A 2MMZA 2XPEA 2PWJA 5IMFA 2M72A 3FHKA 1G0TA 2YCDA 1PL2A 3IR4A 3KMOA 4J56E 1DE1A 5G31A 1GULA 1JZRA 4ZIJA 4KW6A 4DSQA 2LKUA 3PPUA 1UN2A 4OO4A 3DD3A 4IQ1A 1K0OA 4YH2A 2IWTA 5CRGA 1U88A 1ZZYA 4ZXGA 3A3TA 2YWIA 1K0AA 2X64A 2RM6A 4YQUA 3GX0A 2PUKC 1Z3EA 3IDVA 2DJ1A 3C73A 1HQOA 1MD4A 4TW5A 5ELAA 5HR0A 4K7IA 3HJMA 3ERWA 3ZYWA 5IOWA 5DAKA 2PBJA 5A4UA 1XW6A 2HZFA 2VM2A 2VLVA 4AJ8A 1ZMAA 5AISA 4PQHA 1THXA 3A2XA 2JADA 1O8WA 4X1UA 3LFLA 3L9SA 2I4AA 5AIXA 5DJMA 1FB0A 2J9HA 1O6JA 1U87A 2DJ0A 4G0IA 4DSRA 1MTCA 2VL3A 2VM1A 3HZ4A 3E0UA 1UVZA 1SKWB 3EVIA 4GCIA 4BVXB 5ECQB 4MCUA 1GSSA 1LJRA 3RDWA 5DCGA 3ZFLA 3I9V2 4AGSA 3M8NA 3VPQA 5H5QA 4MPFA 2V41A 2H1BA 1TU7A 4PGTA 4GSTA 5DQYA 3LXZA 4HEA2 1MDJA 1ERUA 1O7UA 1OKDA 1SK0A 1TRSA 1Z5YE 1AC1A 3KTLA 3O6TA 2NTOA 3UOMA 1OC8A 2WDUA 3QR6A 2C0DA 4NMUA 2C0EA 5C04A 2H71A 2VL2A 5G5FA 5EL8A 4OD7A 3L9VA 1HNAA 2VCWA 3CXGA 3S9FA 3VLNA 3GSSA 3UARA 4EE0A 1NW2A 2YN1A 3TDGA 4GSNA 5FHIA 11GSA 4RQRA 4K1FA 3GIXA 1EGOA 2HRKB 5JWRB 4DSSB 4POKA 3MNGA 3CRUA 2QC7A 2X8HA 1TU8A 2WB9A 1URMA 2DIZA 2KLXA 1Z6MA 4BA7A 3UBKA 3TJBA 8GSSA 1A24A 5D73A 2CQ9A 1F3AA 2O8VB 3F0IA 5HFGA 5ECOB 3DMLA 2CAQA 1GNWA 3NZNA 1Z7RA 4ZB6A 2XC2A 3VPTA 4V1Ag 5H5RA 5JWQB 3D0ZA 2GT6A 1WP0A 2V2GA 1QFNA 1VF3A 4ULXA 2LEGA 2HSYA 4GXZA 1Y6EA 5GAND 2LJRA 1C72A 3FZ5A 5GSTA 2RLIA 2QGVA 1GSUA 1ILOA 1TTZA 3HJPA 5CRDA 4LMVA 1BEDA 1NHYA 4XIHA 3WT1A 2C3QA 1LU4A 9GSSA 1OC9A 5AIVA 1M2DA 5GAPD 1RQMA 3TJKA 5F0GA 4PXOA 1B48A 1WMJA 3G7YA 3HVVA 2AAWA 5IOXA 3W8SA 2UZ8A 4F03A 3GKKA 1YJ6A 1JHBA 5H5SA 4GF0A 3M3MA 2HSHA 5ECSA 2DLXA 4J2FA 4ZBAA 2R5GA 4FYCA 3GKXA 4WR4A 4I2UA 4LL1B 1Z9HA 1OE8A 3ZLPA 5A4VA 2HE3A 4TR3A 1Q98A 1PKWA 1H4OA 2B5XA 2FWEA 3LYKA 5A4WA 3A2WA 1BJXA 5EVOA 3CSHA 2XPDA 3US3A 1HYUA 5D93A 2C3TA 1EGRA 1M9AA 2I3YA 3F9UA 4TXOA 2C0FA 5EPFA 2DIYA 3IHQA 3GFKA 1T4YA 2IIYA 2H6ZA 1QGVA 2ALBA 1UC7A 4IVFA 1BQ7A 1W89A 1A2MA 1F9MA 5JWOB 5IMZA 3UBLA 3F6FA 3IOSA 3MDKA 1XOBA 3DRNA 1ZGNA 5D9WA 2MBTA 3E3EA 5G5EA 2IJYA 2XBQA 3TB2A 1TK8B 2E2MA 1CQGA 1AW9A 3GL5A 3ZIVA 5AGYA 1DBYA 4GTUA 4AF2A 1E2YA 2J23A 2QKEA 1TOFA 1FVJA 2H70A 1TKDB 4V2LA 2R37A 2HNLA 2OJLA 2WULA 3GTUA 3BBYA 3H79A 3H8QA 3BCKA 4KA0A 2K9FA 5JCUA 2FHEA 3PH9A 3ZVJD 4QL9A 3HVSA 4PX1A 2P31A 1WWJA 4K9ZA 2YV7A 1FG4A 3I6AA 4V2NA 2L6DA 5LNKe 1S3DA 3M9JA 1GTIA 3F3RA 4K2DA 1QK8A 3UEMA 4KF9A 1PQNA 4L0UA 3ERFA 2YP6A 2HSMA 2PPTA 2B3SA 2P0GA 2O87A 3APSA 16GSA 1M2BA 2CA8A 4DSSA 4FQUA 1WJKA 4K6XA 4WXTA 4Q5QA 3GX8A 2JU5A 1LBKA 1V40A 1TDIA 3WT2A 2DC5A 1TW9A 3GKMA 2R4VA 5JCWA 6GSVA 1GSFA 5D9VA 3HJOA 2EIQA 2V6OA 2DJ3A 6GSSA 2HRNA 3FY7A 4GQFA 4IBPA 2H0GA 4D73A 2FNOA 5ECNB 3FZAA 4F2IA 4POMA 1EOGA 3RHBA 3O3TA 2DMMA 1YY7A 4Q5NA 2VL9A 2YWOA 5G30A 1XFLA 4IN0A 4KAEA 2H73A 2B5YA 4CW9A 4GSSA 2VOCA 4O32A 1U6TA 2GQLA 1GUHA 2IMKA 4L0WA 2VCVA 1QXHA 5D8IA 3DWVA 3QPMA 2WS2A 1JZWA 4LMWA 4FYUA 4XCSA 4WKWA 1X9SB 3HHVA 1YEPA 3LYPA 5ECPB 1XCCA 1X5CA 4AJ6A 4FYBA 18GSA 3EE2A 1M99A 2P5RA 2IMFA 2F9SA 4F0BA 1OC9B 4EL1A 4HZ4A 3TOTA 2L6CA 2V32A 1ON4A 4G0KA 2H75A 2AHEA 4K7NA 4GWRA 2CT6A 5G1KA 5G1LA 2LV3A 1J0FA 1FAAA 2ZUPA 1O73A 5CREA 1TK0B 1EV9A 2H19A 4ZBDA 1G6YA 4IS0A 1GRXA 4ZB9A 1CQHA 3KH9A 4HQZA 5DDLA 5DJLA 5B6MA 1U3IA 3WGEA 3Q6OA 4WF5A 2YJ7A 2P5QA 1EP8A 3GRXA 4HQSA 3TJJA 2HRAA 14GSA 2GTUA 4ILFA 4XHMA 2X99A 3GYKA 4V2MA 2TRXA 3D4TA 5HR1A 3HKRA 2YZUA 5C00A 5IMDA 4E8EA 4HUAA 1XW9A 3LSZA 1XVWA 1B9XC 3QAGA 5DBQA 3OR5A 1KEBA 3IK9A 4TXOB 4JZQA 4TKYA 2H72A 3BCIA 6GSTA 2RUFA 5CRWA 2A2RA 1WPIA 1B4QA 4KE3A 2QSIA 2H0HA 1XIYA 3BJ5A 2YPMA 2YJHA 3IA1A 4POBA 2PN8A 4HJMA 4IJIA 4TXVA 3Q19A 5IQYA 5IM9A 1B4PA 1MDIA 3F6DA 3D21A 3TKPA 2LRCA 3ED3A 1VGLA 4PNGA 1PA3A 3HA9A 2L4QA 4I8BA 1EP7A 2MMOA 2E2GA 1FVKA 3TKQA 3VFIA 5B8AA 2AB6A 1JZDA 4WF4A 2CVBA 3UJ1A 2NBSA 5DQSA 2F8FA 4MH3A 5CO3A 5B6NA 4L8EA 3W6GA 1W4VA 1XWKA 3GTUB 1YKAA 4TR1A 3ZMKA 2I81A 2CAIA 1T3BA 3L9UA 3FKFA 2KP2A 4F82A 5F06A 4FO5A 3C7MA 3F4TA 3WGDA 4KCAA 2A2SA 3HCZA 5KN2A 1BAYA 5INYA 3F4RA 4AJ7A 4WETA 3ZTLA 2GS3A 4IP1A 4OFNA 2OKAA 4RI7A 2VIMA 2YANA 3EMXA 4Q5RA 2HSMB 2PERA 2F51A 4MZCA 3LQ7A 4G19A 1VF1A 1TJDA 1SJ6A 2GSSA 4O7HA 2E0QA 2JSZA 2JACA 3VWUA 3CMIA 2FCHA 2NPBA 4WBJA 2H1GA 5F8BA 2WFCA 4XRAA 3VURA 2HZEA 2GZYA 4ML6A 2DSAA 3KP8A 2A4VA 4HS1A 3M1GA 4K0NA 4D73B 2JZTA 1K0CA 2VO4A 2FA4A 3QCPA 4NWYA 3M9KA 4IHUA 2IMIA 2H30A 4TR4A 3VI5A 2PVOC 5F07A 2LQQA 1F2EA 5KN1A 4MJBA 1OC3A 2LRTA 1A2LA 2H66A 2OACA 3FRCA 1E6BA 1GSDA 4IKHA 1GLPA 3LJRA 4KUNA 1PL1A 3R3EA 2GSQA 3TRQA 3GHAA 1ZL9A 3LEFA 1K3YA 3U5RE 3VWWA 3FW2A 4XRDA 1JZOA 4G10A 4ACSA 12GSA 3LWAA 1YEXA 1HNCA 2F3MA 3KM6A 3RHCA 2VL2C 2DJKA 2WZ9A 1VF2A 3WGXA 4PQIA 4LLRA 4X0XA 3KEBA 4KNDA 2JL4A 2VLUA 3TJFA 4TVEA 4NHWA 3KIJA 4BPYA 2Z9SA 4ZL8A 1XWGA 2VCXA 1H75A 2L57A 1YKCA 1FHEA 4WEYA 3CRTA 5DALA 1AXDA 3F3QA 2B1LA 3MWHA 2H6YA 4OFTA 2HFDA 2OE1A 2X8GA 4NV5A 2L5OA 3QDNA 3SWLA 4RQXA 1TXXA 5FT3A 3FYGA 3P90A 2VLTA 3HVXA 3TKSA 1V58A 5IMCA 3TGZA 1SU9A 3KP9A 1SYXA 5CRHA 2F8AA 1Z7PA 1K0BA 2HLSA 1NHOA 3G7JA 3ME7A 3FR6A 5KN3A 4EVMA 1KBNA 1AQVA 1ACVA 2HQTA 1GP1A 3VI7A 4GLTA 4O92A 2MBSA 1OYJA 4BL7A 3UMAA 2E7PA 4ID0A 4MJEA 4XS4A 3UIWA 3GH6A 1GTBA 2WCIA 7GSSA 2CV4A 1ZOFA 5HQPA 2H0IA 2IPAA 4KDXA 5GSSA 17GSA 2FWGA 3TKSE 5J3RA 2LRNA 1ST9A 3VWVA 3QD9A 2H8LA 3LG6A 4KSMA 2G0FA 1R7HA 2GT5A 4FH8A 5HR3A 1EOHA 4EF0A 5LD0A 3FR9A 3QFAC 2H76A 1OKTA 1DE2A 2GQKA 3A5WA 4JRRA 4BWQA
chains in the Genus database with same CATH superfamily
6GSYA 5CNWA 2PU9C 1A8LA 3Q74A 4I5QA 3I69A 5ENUA 1K0MA 5A34B 5G2ZA 3UAPA 2GSRA 3UVTA 4TR1B 3C8EA 1PX7A 3M0FA 1PMTA 4KDYA 4EIPA 3L0HA 1ERTA 1G7OA 2REMA 4I97A 1TRUA 5IO0A 3U6VA 2HSNA 2IL3A 3BD2A 2B1KA 1SK1A 2VD1A 2CX4A 3EYTA 2N5BA 2OBIA 3GL3A 4YQVA 1SL0B 4TR0A 2H74A 2LJAA 5IIZA 1I5GA 4JE1A 2H1LA 2MZCA 2I1UA 4HDEA 1GWCA 4JU5A 4MF6A 1FB6A 3NIVA 3J7Yb 1K0NA 5BRTA 3F4SA 3PR8A 3ZRDA 2LNTA 1Q4JA 2CVKA 2JSYA 4JR6A 2GSTA 1BYEA 2V1MA 3W8JA 4HU9A 5CYYA 1M7TA 5EY6A 2GDRA 2C80A 3TRPA 3IE3A 1SL2B 3FZ9A 1XWBA 2HZEB 2R0CA 4XS6A 1AQXA 10GSA 1Z6NA 2O36A 2BTOT 3PINA 5ID2A 2YV9A 1X9WB 1V57A 5A1NA 1PFOA 2VCZA 3WD6A 2GQMA 3D22A 5ECHB 3E9JB 4BWSA 3IXRA 2CZ2A 2H6XA 3ERGA 5DCHA 2K18A 2AUVA 4GRFA 1SKSB 2DMLA 1XG8A 2B7JA 2ON7A 3IC8A 4BVYA 1ZCPA 5ECIB 1F3BA 1A2JA 2C4JA 3HYPA 1BX9A 3APQA 2FWHA 1T4ZA 4PURA 2VD0A 4ECJA 1PX6A 4OO5A 1K3OA 4HOJA 2ON5A 3CBUA 5AN1A 1WRYA 3GKNA 4PTSA 2LJKA 4NPBA 1GSEA 4ISDA 1VF4A 1MDKA 5D96A 5IPGA 4LA1A 1J08A 1QMVA 3GSTA 4P3YB 3P8WA 2LNSA 1HNBA 3EINA 3KGKA 4L5LA 4ZB8A 4ECIA 3R2QA 2WRTA 1B9YC 3LW9A 4ZL7A 4OFMA 1THOA 4CHSA 4PNFA 1ZYQB 3IC4A 1T7PB 2IFQA 3F63A 5F05A 1XPVA 5DVBA 2WW1A 1WOUA 1B8XA 2IN3A 3TOUA 4I2TA 3CWGA 5DALB 1RK4A 4RUVA 2WJUA 3TUEA 1XWCA 4EKZA 2AYTA 1RW1A 4O5RA 1GTAA 4KSOA 5COHA 1PSQA 1PD21 4AKXB 2H01A 3ISOA 2FLSA 3VWXA 2NVLA 1GH2A 3JCML 4MA9A 4K2XA 2N5AA 2CZ3A 4NV2A 1YQ1A 1KNGA 2C3NA 4EXJA 4XS1A 4N30A 4G0LA 3TCOA 3EU4A 2OADA 3ZMLA 4PUAA 4MK3A 4LL4B 2OBKA 2RUEA 1R5PA 2FA8A 2GVPA 3H4KA 1M0UA 2MMNA 6GSXA 2YOIA 5CAXA 2EIOA 1SYRA 1PGTA 2QA2A 4AKIA 1WE0A 1AAZA 3G7IA 4JEDA 4BL7B 2GZZA 1TRVA 2LSTA 3UVHA 4IGJA 4O5UA 3SBCA 3APOA 3MSZA 1JFUA 4XS4B 4EDZA 1TRWA 1EV4A 4MH2A 1R4WA 5A5KA 4V1Ap 2C1YA 2KOKA 1A0FA 2FY6A 5ECKB 1SK2A 2IMDA 2I9HA 2WVXA 1BG5A 3C1SA 3LXTA 4KH7A 2LUSA 1N2AA 3ZIJA 4TN8A 5ECLB 4Q5FA 1AIUA 4W66A 1SJZA 5B8BA 1GSYA 1K0DA 2CX3A 2NDOA 4NHZA 5A34A 4YAVA 19GSA 3KXOA 5GZZB 2OA7A 2R3XA 2PMTA 3N9JA 3QAWA 4K7OA 1FW1A 3HY2A 2OE0A 1FO5A 2QA1A 4ECCA 1A8YA 4RI6A 20GSA 3EWLA 4MZBA 3L4NA 2EIRA 5E59A 2AV4A 3GURA 3O76A 3QOUA 2B6MA 3D4MA 5IMVA 2KHPA 3GV1A 1EWXA 3MAKA 5KOWA 2TRCP 1TP9A 1FOVA 1GTUA 4KX4A 3FEUA 2R0GA 2HSNB 3EU3A 1F37A 4MDCA 2LQOA 1PN9A 3CYNA 4OMVA 4OWYA 4E8HA 1M2AA 1V2AA 3IAS2 5IO2A 4K0GA 1N8JA 4YKFA 3AY8A 4JR4A 2FUG2 4CDOA 5HFKA 1X5EA 1UA5A 3L78A 1YDKA 1DUGA 1JLWA 4MJCA 2C8UA 5J9CA 3FK8A 3I43A 2RIIA 1NSWA 3DXBA 1OE7A 3KMNA 1EEMA 3IAM2 3IV4A 4POLA 3IK7A 3A2VA 4HZ2A 4Z2TA 2DJ2A 6GSUA 3PGTA 5HFIA 3CSJA 5ID2B 2XBIA 2YNXA 3EMPA 4F9ZA 5J41A 5A1NB 1G7EA 4IP6A 5J4VA 3FR3A 4IELA 3P2AA 4Z7XA 2ZNMA 2N5FA 2JZSA 1TXUA 1PRXA 2MMAA 4N10A 1SENA 4MPGA 2AJQB 4BVYB 2G2QA 4TOPA 1GNEA 1M3IA 2MYGA 1HD2A 1QQ2A 2DBCA 1GUMA 2K8VA 2LTKA 5J4UA 2GGTA 4DVCA 1TK5B 3D5JA 3ME8A 1T8EB 2ES7A 5FWGA 5BMUB 1ERWA 4HJ2A 1O81A 2HI7A 3TU3B 1YF0A 4N0VA 2JZRA 3TJGA 1X0RA 3DVWA 2K8SA 3TKRA 4IW9A 2B7KA 1TI3A 1O85A 2IFQB 5IPHA 1T00A 1R26A 4FIWA 2HXKA 3HXSA 1VRSD 3KTBA 3ZREA 4USSA 2O89A 4NXIA 4OCEA 4TRXA 4HU7A 1AQWA 1I9DA 1ZYEA 2FGXA 2YWNA 3QFBC 4MABA 4OCFA 3GNJA 1S3CA 3H1NA 1QUWA 4YAPA 5ABRA 2KP1A 3DVXA 2YWMA 4IQAA 3HZ8A 4WR5A 3KD0A 2PGTA 3EURA 1USBA 4G9HA 1TI1A 4KCEA 3IBHA 1I1IP 2RM5A 4ZBBA 1OAZA 2HRFA 3VK9A 4BIKA 2KUCA 1XVQA 1XXUA 1Y25A 5D9TA 1SL1B 1GUKA 3DGQA 4ECBA 3CSIA 2H1AA 1MEKA 3FZ4A 1YF1A 2L59A 3C71A 2HT9A 1M9BA 4EC0A 4QQ7A 5ECMB 2HYXA 1F6MC 1XWAA 4YQMA 1AUCA 2OE3A 4G2EA 13GSA 2LS5A 4XTSA 5DAKB 2VCQA 3NOFA 1GLQA 3TRXA 4MZWA 1V98A 3N5OA 3KH7A 3ZL5A 2WVXB 2EC4A 1J9BA 4NAXA 5D9XA 2BMXA 3RPNA 4HI7A 4BVXA 3BOAA 2C0GA 1K3LA 2FWFA 1R5AA 4X43A 5J5NA 2WZSA 1S3AA 4L5OA 2PVQA 3IPZA 1EZKA 3ZITA 3QMXA 2YZHA 4F0CA 5HR2A 1GL8A 4MMMA 2B5EA 2X8CA 2O85A 2O7KA 2FD3A 3GN3A 4EDYA 2XHFA 4KGIA 3F8UA 4IJ3A 1Y1UA 2GZPA 3UL3A 2CVDA 4EO3A 5ECRB 3LGCA 3RAZA 5ELGA 5E4WA 1ABAA 4MF5A 3TKSC 2GLRA 5IMAA 3K8NA 4MF7A 3DYRA 4JBBA 4KB3A 3MIXA 5CP1A 3Q18A 2EFEA 1XBSA 2TIRA 3QAVA 4MLYA 4WBRD 1PKZA 3RPPA 3KJYA 4J57E 2K6VA 1A0RP 4PQ1A 2HRKA 2D2ZA 3GH9A 1OVNA 3HDCA 2H1DA 4MJAA 1WIKA 1XOAA 1NM3A 1IYIA 5JCGA 1ML6A 3V1WA 1SD8A 3DIEA 1SKRB 2R0PA 1EEJA 1IYHA 4N0ZA 2VCTA 1X9MB 3CTFA 5LCZA 1X5DA 1T1VA 1A23A 4N11A 4ZILA 3EC3A 2DJJA 3GUSA 3ZVJA 4I6XA 4ZL9A 1GSQA 2VAFA 3HD5A 2L4CA 2A2PA 2IMEA 1M3JA 5L71A 2R6KA 1SJIA 2L5LA 1XZOA 3KZQA 3GMFA 3J7Yk 2VUPA 4K5RA 1YZXA 3P7XA 3DEXA 3G9BA 3GA4A 3ZZXA 3FMWA 1JLVA 2R2JA 3H93A 2EFCA 3CTGA 2M80A 5KEJA 4ML1A 5B7CA 3DKSA 1DSBA 4KDUA 3WYWA 1U3AA 5KN0A 2X4AA 1V9WA 5J9BA 4MP4A 1KTEA 3ZFBA 2ZCTA 1G6WA 1O8XA 4PUFC 3KCMA 4H86A 4EUYA 2V6KA 5BMUA 1SD9A 4DEJA 4GQCA 6GSWA 1ERVA 4K8MA 3IRAA 4QL7A 3LORA 3C1RA 1MD3A 3D6IA 2BJXA 1XW5A 2WGRA 22GSA 3RBTA 2M46A 2MMZA 2XPEA 2PWJA 5IMFA 2M72A 3FHKA 1G0TA 2YCDA 1PL2A 3IR4A 3KMOA 4J56E 1DE1A 5G31A 1GULA 1JZRA 4ZIJA 5J40A 4KW6A 4DSQA 2LKUA 3PPUA 5J4YA 1UN2A 4OO4A 2EFDA 3DD3A 4IQ1A 1K0OA 4YH2A 2IWTA 5CRGA 1U88A 1ZZYA 4ZXGA 3A3TA 2YWIA 1K0AA 2X64A 2RM6A 4YQUA 3GX0A 2PUKC 1Z3EA 3IDVA 2DJ1A 3C73A 2O3EA 1HQOA 1MD4A 4TW5A 5ELAA 4A5PA 5HR0A 1ZYNA 4HSCX 4K7IA 3HJMA 3ERWA 3ZYWA 5IOWA 5DAKA 2PBJA 5A4UA 1XW6A 2HZFA 2VM2A 2VLVA 4AJ8A 1ZMAA 3MYDA 5AISA 2WW2A 4PQHA 1THXA 3A2XA 2JADA 1O8WA 4X1UA 3LFLA 3L9SA 2I4AA 5AIXA 5DJMA 1FB0A 2J9HA 1O6JA 1U87A 2DJ0A 4G0IA 4DSRA 1MTCA 2VL3A 2VM1A 3HZ4A 3E0UA 1UVZA 1SKWB 3EVIA 4GCIA 4BVXB 1S3RA 5ECQB 4MCUA 1GSSA 1LJRA 3RDWA 5DCGA 3ZFLA 3I9V2 4AGSA 3M8NA 3VPQA 5H5QA 4MPFA 2V41A 2H1BA 1TU7A 4PGTA 4GSTA 5DQYA 3LXZA 4HEA2 1MDJA 1ERUA 1O7UA 1OKDA 1SK0A 1TRSA 1Z5YE 1AC1A 3KTLA 3O6TA 2NTOA 3UOMA 1OC8A 2WDUA 3QR6A 2C0DA 4NMUA 2C0EA 5C04A 2H71A 2VL2A 1BG1A 5G5FA 5EL8A 4OD7A 3L9VA 1HNAA 2VCWA 3CXGA 5A5HB 3S9FA 3VLNA 3GSSA 3UARA 4EE0A 1NW2A 2YN1A 3TDGA 4GSNA 5FHIA 11GSA 4RQRA 4K1FA 3GIXA 3IHGA 1EGOA 4CY8A 2HRKB 5JWRB 4DSSB 4POKA 3MNGA 3CRUA 2QC7A 2X8HA 1TU8A 2WB9A 4Z2RA 1URMA 2DIZA 2KLXA 1Z6MA 4BA7A 3UBKA 3TJBA 8GSSA 1A24A 5D73A 2CQ9A 1F3AA 2O8VB 3F0IA 4E68A 5HFGA 5ECOB 3DMLA 2CAQA 1GNWA 3NZNA 1Z7RA 4ZB6A 2XC2A 3VPTA 4V1Ag 5H5RA 5JWQB 3D0ZA 2GT6A 1WP0A 2V2GA 1QFNA 1VF3A 4ULXA 2LEGA 2HSYA 4GXZA 1Y6EA 4X4JA 5GAND 2LJRA 1C72A 3FZ5A 5GSTA 2RLIA 2QGVA 1GSUA 1ILOA 1TTZA 3HJPA 5CRDA 4LMVA 1BEDA 1NHYA 4FXYP 4XIHA 3WT1A 2C3QA 1LU4A 9GSSA 1OC9A 5AIVA 1M2DA 5GAPD 1RQMA 3TJKA 5F0GA 4PXOA 1B48A 1WMJA 3G7YA 3HVVA 2AAWA 5IOXA 3W8SA 2UZ8A 4F03A 3GKKA 1YJ6A 1JHBA 3EPTA 5H5SA 4GF0A 3M3MA 2HSHA 5ECSA 2DLXA 4J2FA 4ZBAA 2R5GA 4FYCA 3GKXA 4WR4A 4I2UA 4LL1B 1Z9HA 1OE8A 3ZLPA 5A4VA 2HE3A 4TR3A 1Q98A 1PKWA 1H4OA 2B5XA 2FWEA 3LYKA 5A4WA 3A2WA 1YEWC 1BJXA 5EVOA 3CSHA 2X49A 2XPDA 3US3A 1HYUA 5D93A 2C3TA 1EGRA 1M9AA 2I3YA 3F9UA 4TXOA 2C0FA 4AKHA 5EPFA 2DIYA 3IHQA 3GFKA 4EIQA 1T4YA 2IIYA 2H6ZA 1QGVA 2ALBA 1UC7A 2WW3A 4IVFA 1BQ7A 1W89A 1A2MA 1F9MA 5JWOB 1S4BP 5IMZA 3UBLA 3F6FA 4Z2UA 3IOSA 3MDKA 1XOBA 3DRNA 1ZGNA 5J47A 5D9WA 2MBTA 3E3EA 5G5EA 2IJYA 2XBQA 3TB2A 1TK8B 2E2MA 1CQGA 1AW9A 3GL5A 3ZIVA 5AGYA 1DBYA 4GTUA 4AF2A 4MNNA 1E2YA 2J23A 2QKEA 1TOFA 1FVJA 2H70A 1TKDB 4V2LA 2R37A 2HNLA 2OJLA 2WULA 5KOXA 3GTUA 3BBYA 3H79A 3H8QA 3BCKA 4KA0A 2K9FA 5JCUA 2FHEA 3PH9A 3ZVJD 4QL9A 3HVSA 4PX1A 2P31A 1WWJA 4K9ZA 2YV7A 1FG4A 3I6AA 4V2NA 5A5HA 2L6DA 5LNKe 1S3DA 4PHZC 3M9JA 1GTIA 1BF5A 3HMJG 3F3RA 4K2DA 1QK8A 3UEMA 4KF9A 1PQNA 4L0UA 3ERFA 2YP6A 2HSMA 2PPTA 2B3SA 2P0GA 2O87A 3APSA 16GSA 1M2BA 2CA8A 4DSSA 4FQUA 1WJKA 4K6XA 4WXTA 4Q5QA 3GX8A 2JU5A 1N25A 1LBKA 1V40A 1TDIA 3WT2A 4GDFA 2DC5A 4ICYA 1TW9A 2O5VA 3GKMA 2R4VA 5JCWA 3A5IA 6GSVA 1GSFA 5D9VA 3HJOA 2EIQA 2V6OA 2DJ3A 6GSSA 2HRNA 3FY7A 4GQFA 4PI2C 4IBPA 2H0GA 4D73A 2FNOA 5ECNB 3FZAA 4F2IA 4POMA 1EOGA 3RHBA 3O3TA 2DMMA 1YY7A 4Q5NA 2VL9A 2YWOA 5G30A 1XFLA 4IN0A 4KAEA 2H73A 4PI0C 2B5YA 4CW9A 4GSSA 2VOCA 4O32A 1U6TA 2GQLA 1GUHA 2IMKA 4L0WA 2VCVA 1QXHA 5D8IA 3DWVA 1SVMA 3QPMA 2WS2A 1JZWA 4LMWA 4FYUA 4XCSA 4WKWA 1X9SB 3HHVA 1YEPA 3LYPA 5ECPB 1XCCA 1X5CA 4AJ6A 4FYBA 18GSA 3EE2A 1M99A 2P5RA 2IMFA 2F9SA 4F0BA 1OC9B 4EL1A 4HZ4A 3TOTA 2WVYA 2L6CA 2V32A 1ON4A 4G0KA 2H75A 2AHEA 4K7NA 4GWRA 4CY6A 2CT6A 5G1KA 4N3ZA 5G1LA 2LV3A 1J0FA 1FAAA 2ZUPA 1O73A 5CREA 1TK0B 1EV9A 2H19A 4ZBDA 1G6YA 4IS0A 1GRXA 4ZB9A 1CQHA 3KH9A 4HQZA 5DDLA 5DJLA 5B6MA 1U3IA 3WGEA 3Q6OA 4WF5A 2YJ7A 2P5QA 1EP8A 3GRXA 4HQSA 3TJJA 2HRAA 14GSA 2GTUA 4ILFA 4XHMA 2X99A 3GYKA 4V2MA 2TRXA 3D4TA 5HR1A 3HKRA 2YZUA 5C00A 4ZB7A 5IMDA 4E8EA 4QMKA 4HUAA 1XW9A 3LSZA 1XVWA 1B9XC 3QAGA 5DBQA 3OR5A 1KEBA 3IK9A 4TXOB 4JZQA 4TKYA 2H72A 3BCIA 6GSTA 1ZYPA 2RUFA 5CRWA 1FOHA 2A2RA 1WPIA 1B4QA 4KE3A 2QSIA 2H0HA 1XIYA 3BJ5A 2YPMA 2YJHA 3IA1A 4POBA 2PN8A 4HJMA 4IJIA 4TXVA 3Q19A 5IQYA 5IM9A 1B4PA 4K5SA 1MDIA 3CQFA 3F6DA 3D21A 3CHXC 3TKPA 2LRCA 3ED3A 1VGLA 4PNGA 1PA3A 3HA9A 1SVOA 2L4QA 4I8BA 2DKHA 1EP7A 2MMOA 2E2GA 1FVKA 3TKQA 3VFIA 5B8AA 2AB6A 1JZDA 4WF4A 2CVBA 3UJ1A 2NBSA 5DQSA 2F8FA 4MH3A 5CO3A 5B6NA 4L8EA 3W6GA 1W4VA 1XWKA 3GTUB 1YKAA 4TR1A 3ZMKA 2A4HA 4AKGA 2I81A 2CAIA 1T3BA 3L9UA 3FKFA 2KP2A 4F82A 5F06A 4FO5A 3C7MA 3F4TA 3WGDA 4KCAA 2A2SA 3HCZA 5KN2A 1BAYA 5INYA 3F4RA 4AJ7A 4WETA 3ZTLA 2GS3A 4IP1A 4OFNA 2OKAA 4RI7A 2VIMA 2YANA 3EMXA 4YKGA 4Q5RA 2HSMB 2PERA 2F51A 4MZCA 3LQ7A 4G19A 1VF1A 1TJDA 1SJ6A 2GSSA 4O7HA 2WW0A 2E0QA 2JSZA 2JACA 3VWUA 3CMIA 2FCHA 2NPBA 4WBJA 2H1GA 5F8BA 2WFCA 4XRAA 3VURA 2HZEA 2GZYA 4ML6A 2DSAA 3KP8A 2A4VA 4HS1A 3M1GA 4K0NA 4D73B 2JZTA 1K0CA 2VO4A 2FA4A 3QCPA 4NWYA 3M9KA 4IHUA 2IMIA 2H30A 4TR4A 3VI5A 2PVOC 5F07A 2LQQA 1F2EA 5KN1A 4MJBA 1OC3A 2LRTA 1A2LA 2H66A 2OACA 3FRCA 1E6BA 1PN0A 1GSDA 4IKHA 1GLPA 3LJRA 4KUNA 1PL1A 3R3EA 2GSQA 3TRQA 3GHAA 1ZL9A 3LEFA 1K3YA 1YVLA 3U5RE 3VWWA 3FW2A 4XRDA 1JZOA 4G10A 4ACSA 2WVZA 12GSA 3LWAA 1YEXA 1HNCA 2F3MA 3KM6A 3HVNA 3RHCA 2VL2C 2DJKA 2WZ9A 1VF2A 3WGXA 4PQIA 4LLRA 4G01A 4X0XA 3KEBA 4KNDA 2EFHA 2JL4A 2VLUA 3TJFA 1SVLA 4TVEA 4NHWA 3KIJA 4BPYA 4O5QA 2Z9SA 4ZL8A 1XWGA 2VCXA 1H75A 2L57A 1YKCA 1FHEA 4WEYA 3CRTA 5DALA 1AXDA 3F3QA 2B1LA 3MWHA 2H6YA 4OFTA 2HFDA 2OE1A 2X8GA 4NV5A 2L5OA 3QDNA 3SWLA 4RQXA 1TXXA 5FT3A 3FYGA 3P90A 2VLTA 3HVXA 3TKSA 1V58A 5IMCA 3TGZA 1SU9A 3KP9A 1SYXA 5CRHA 2F8AA 1Z7PA 1K0BA 2HLSA 1NHOA 3G7JA 3ME7A 3FR6A 5KN3A 4EVMA 1KBNA 1AQVA 1ACVA 2HQTA 1GP1A 3VI7A 4GLTA 4O92A 2MBSA 1OYJA 4BL7A 3UMAA 2E7PA 2DKIA 4ID0A 4MJEA 4XS4A 3UIWA 3GH6A 1GTBA 3RFRC 2WCIA 7GSSA 4AI6A 2CV4A 3RGBC 1ZOFA 5HQPA 2H0IA 2IPAA 4KDXA 5GSSA 17GSA 2FWGA 3TKSE 5J3RA 2LRNA 1ST9A 3VWVA 3QD9A 2OT3A 2H8LA 3LG6A 4KSMA 2G0FA 1R7HA 2GT5A 4FH8A 5HR3A 1EOHA 4EF0A 5LD0A 3FR9A 3QFAC 2H76A 2VKZG 1OKTA 1DE2A 2GQKA 3A5WA 4JRRA 4BWQA 2UV8G
chains in the Genus database with same CATH topology
6GSYA 5CNWA 2PU9C 1A8LA 3Q74A 4I5QA 3I69A 5ENUA 1K0MA 5A34B 5G2ZA 3UAPA 2GSRA 3UVTA 4TR1B 3C8EA 1PX7A 3M0FA 1PMTA 4KDYA 4EIPA 3L0HA 1ERTA 1G7OA 2REMA 4I97A 1TRUA 5IO0A 3U6VA 2HSNA 2IL3A 3BD2A 2B1KA 1SK1A 2VD1A 2CX4A 3EYTA 2N5BA 2OBIA 3GL3A 4YQVA 1SL0B 4TR0A 2H74A 2LJAA 5IIZA 1I5GA 4JE1A 2H1LA 2MZCA 2I1UA 4HDEA 1GWCA 4JU5A 4MF6A 1FB6A 3NIVA 3J7Yb 1K0NA 5BRTA 3F4SA 3PR8A 3ZRDA 2LNTA 1Q4JA 2CVKA 2JSYA 4JR6A 2GSTA 1BYEA 2V1MA 3W8JA 4HU9A 5CYYA 1M7TA 5EY6A 2GDRA 2C80A 3TRPA 3IE3A 1SL2B 3FZ9A 1XWBA 2HZEB 2R0CA 4XS6A 1AQXA 10GSA 1Z6NA 2BTOT 3PINA 5ID2A 2YV9A 1X9WB 1V57A 5A1NA 2VCZA 3WD6A 2GQMA 3D22A 5ECHB 3E9JB 4BWSA 3IXRA 2CZ2A 2H6XA 3ERGA 5DCHA 2K18A 2AUVA 4GRFA 1SKSB 2DMLA 2B7JA 2ON7A 3IC8A 4BVYA 1ZCPA 5ECIB 1F3BA 1A2JA 2C4JA 3HYPA 1BX9A 3APQA 2FWHA 1T4ZA 4PURA 2VD0A 4ECJA 1PX6A 4OO5A 1K3OA 4HOJA 2ON5A 3CBUA 5AN1A 1WRYA 3GKNA 4PTSA 2LJKA 4NPBA 1GSEA 4ISDA 1VF4A 1MDKA 5D96A 5IPGA 4LA1A 1J08A 1QMVA 3GSTA 4P3YB 3P8WA 2LNSA 1HNBA 3EINA 3KGKA 4L5LA 4ZB8A 4ECIA 3R2QA 2WRTA 1B9YC 3LW9A 4ZL7A 4OFMA 1THOA 4CHSA 4PNFA 1ZYQB 3IC4A 1T7PB 2IFQA 3F63A 5F05A 1XPVA 5DVBA 1WOUA 1B8XA 2IN3A 3TOUA 4I2TA 3CWGA 5DALB 1RK4A 4RUVA 2WJUA 3TUEA 1XWCA 4EKZA 2AYTA 1RW1A 4O5RA 1GTAA 4KSOA 5COHA 1PSQA 1PD21 4AKXB 2H01A 3ISOA 2FLSA 3VWXA 2NVLA 1GH2A 3JCML 4MA9A 4K2XA 2N5AA 2CZ3A 4NV2A 1YQ1A 1KNGA 2C3NA 4EXJA 4XS1A 4N30A 4G0LA 3TCOA 3EU4A 2OADA 3ZMLA 4PUAA 4MK3A 4LL4B 2OBKA 2RUEA 1R5PA 2FA8A 2GVPA 3H4KA 1M0UA 2MMNA 6GSXA 2YOIA 5CAXA 2EIOA 1SYRA 1PGTA 2QA2A 4AKIA 1WE0A 1AAZA 3G7IA 4JEDA 4BL7B 2GZZA 1TRVA 2LSTA 3UVHA 4IGJA 4O5UA 3SBCA 3APOA 3MSZA 1JFUA 4XS4B 4EDZA 1TRWA 1EV4A 4MH2A 1R4WA 5A5KA 4V1Ap 2C1YA 2KOKA 1A0FA 2FY6A 5ECKB 1SK2A 2IMDA 2I9HA 1BG5A 3C1SA 3LXTA 4KH7A 2LUSA 1N2AA 3ZIJA 4TN8A 5ECLB 4Q5FA 1AIUA 4W66A 1SJZA 5B8BA 1GSYA 1K0DA 2CX3A 2NDOA 4NHZA 5A34A 4YAVA 19GSA 3KXOA 5GZZB 2OA7A 2R3XA 2PMTA 3N9JA 3QAWA 4K7OA 1FW1A 3HY2A 2OE0A 1FO5A 2QA1A 4ECCA 1A8YA 4RI6A 20GSA 3EWLA 4MZBA 3L4NA 2EIRA 5E59A 2AV4A 3GURA 3O76A 3QOUA 2B6MA 3D4MA 5IMVA 2KHPA 3GV1A 1EWXA 3MAKA 5KOWA 2TRCP 1TP9A 1FOVA 1GTUA 4KX4A 3FEUA 2R0GA 2HSNB 3EU3A 1F37A 4MDCA 2LQOA 1PN9A 3CYNA 4OMVA 4OWYA 4E8HA 1M2AA 1V2AA 3IAS2 5IO2A 4K0GA 1N8JA 4YKFA 3AY8A 4JR4A 2FUG2 4CDOA 5HFKA 1X5EA 1UA5A 3L78A 1YDKA 1DUGA 1JLWA 4MJCA 2C8UA 5J9CA 3FK8A 3I43A 2RIIA 1NSWA 3DXBA 1OE7A 3KMNA 1EEMA 3IAM2 3IV4A 4POLA 3IK7A 3A2VA 4HZ2A 4Z2TA 2DJ2A 6GSUA 3PGTA 5HFIA 3CSJA 5ID2B 2XBIA 2YNXA 3EMPA 4F9ZA 5J41A 5A1NB 1G7EA 4IP6A 5J4VA 3FR3A 4IELA 3P2AA 4Z7XA 2ZNMA 2N5FA 2JZSA 1TXUA 1PRXA 2MMAA 4N10A 1SENA 4MPGA 2AJQB 4BVYB 2G2QA 4TOPA 1GNEA 2MYGA 1HD2A 1QQ2A 2DBCA 1GUMA 2K8VA 2LTKA 5J4UA 2GGTA 4DVCA 1TK5B 3D5JA 3ME8A 1T8EB 2ES7A 5FWGA 5BMUB 1ERWA 4HJ2A 1O81A 2HI7A 3TU3B 1YF0A 4N0VA 2JZRA 3TJGA 1X0RA 3DVWA 2K8SA 3TKRA 4IW9A 2B7KA 1TI3A 1O85A 2IFQB 5IPHA 1T00A 1R26A 4FIWA 2HXKA 3HXSA 1VRSD 3KTBA 3ZREA 4USSA 2O89A 4NXIA 4OCEA 4TRXA 4HU7A 1AQWA 1I9DA 1ZYEA 2FGXA 2YWNA 3QFBC 4MABA 4OCFA 3GNJA 1S3CA 3H1NA 1QUWA 4YAPA 5ABRA 2KP1A 3DVXA 2YWMA 4IQAA 3HZ8A 4WR5A 3KD0A 2PGTA 3EURA 1USBA 4G9HA 1TI1A 4KCEA 3IBHA 2RM5A 4ZBBA 1OAZA 2HRFA 3VK9A 2KUCA 1XVQA 1XXUA 1Y25A 5D9TA 1SL1B 1GUKA 3DGQA 4ECBA 3CSIA 2H1AA 1MEKA 3FZ4A 1YF1A 2L59A 3C71A 2HT9A 1M9BA 4EC0A 4QQ7A 5ECMB 2HYXA 1F6MC 1XWAA 4YQMA 1AUCA 2OE3A 4G2EA 13GSA 2LS5A 4XTSA 5DAKB 2VCQA 3NOFA 1GLQA 3TRXA 4MZWA 1V98A 3N5OA 3KH7A 3ZL5A 2EC4A 1J9BA 4NAXA 5D9XA 2BMXA 3RPNA 4HI7A 4BVXA 3BOAA 2C0GA 1K3LA 2FWFA 1R5AA 4X43A 5J5NA 1S3AA 4L5OA 2PVQA 3IPZA 1EZKA 3ZITA 3QMXA 2YZHA 4F0CA 5HR2A 1GL8A 4MMMA 2B5EA 2X8CA 2O85A 2O7KA 2FD3A 3GN3A 4EDYA 2XHFA 4KGIA 3F8UA 4IJ3A 1Y1UA 2GZPA 3UL3A 2CVDA 4EO3A 5ECRB 3LGCA 3RAZA 5ELGA 5E4WA 1ABAA 4MF5A 3TKSC 2GLRA 5IMAA 3K8NA 4MF7A 3DYRA 4JBBA 4KB3A 3MIXA 5CP1A 3Q18A 2EFEA 1XBSA 2TIRA 3QAVA 4MLYA 4WBRD 1PKZA 3RPPA 3KJYA 4J57E 2K6VA 1A0RP 4PQ1A 2HRKA 2D2ZA 3GH9A 1OVNA 3HDCA 2H1DA 4MJAA 1WIKA 1XOAA 1NM3A 1IYIA 5JCGA 1ML6A 3V1WA 1SD8A 3DIEA 1SKRB 2R0PA 1EEJA 1IYHA 4N0ZA 2VCTA 1X9MB 3CTFA 5LCZA 1X5DA 1T1VA 1A23A 4N11A 4ZILA 3EC3A 2DJJA 3GUSA 3ZVJA 4I6XA 4ZL9A 1GSQA 2VAFA 3HD5A 2L4CA 2A2PA 2IMEA 5L71A 2R6KA 1SJIA 2L5LA 1XZOA 3KZQA 3GMFA 3J7Yk 2VUPA 4K5RA 1YZXA 3P7XA 3DEXA 3G9BA 3GA4A 3ZZXA 3FMWA 1JLVA 2R2JA 3H93A 2EFCA 3CTGA 2M80A 5KEJA 4ML1A 5B7CA 3DKSA 1DSBA 4KDUA 3WYWA 1U3AA 5KN0A 2X4AA 1V9WA 5J9BA 4MP4A 1KTEA 3ZFBA 2ZCTA 1G6WA 1O8XA 4PUFC 3KCMA 4H86A 4EUYA 2V6KA 5BMUA 1SD9A 4DEJA 4GQCA 6GSWA 1ERVA 4K8MA 3IRAA 4QL7A 3LORA 3C1RA 1MD3A 3D6IA 2BJXA 1XW5A 2WGRA 22GSA 3RBTA 2M46A 2MMZA 2XPEA 2PWJA 5IMFA 2M72A 3FHKA 1G0TA 2YCDA 1PL2A 3IR4A 3KMOA 4J56E 1DE1A 5G31A 1GULA 1JZRA 4ZIJA 5J40A 4KW6A 4DSQA 2LKUA 3PPUA 5J4YA 1UN2A 4OO4A 2EFDA 3DD3A 4IQ1A 1K0OA 4YH2A 2IWTA 5CRGA 1U88A 1ZZYA 4ZXGA 3A3TA 2YWIA 1K0AA 2X64A 2RM6A 4YQUA 3GX0A 2PUKC 1Z3EA 3IDVA 2DJ1A 3C73A 1HQOA 1MD4A 4TW5A 5ELAA 4A5PA 5HR0A 1ZYNA 4K7IA 3HJMA 3ERWA 3ZYWA 5IOWA 5DAKA 2PBJA 5A4UA 1XW6A 2HZFA 2VM2A 2VLVA 4AJ8A 1ZMAA 3MYDA 5AISA 4PQHA 1THXA 3A2XA 2JADA 1O8WA 4X1UA 3LFLA 3L9SA 2I4AA 5AIXA 5DJMA 1FB0A 2J9HA 1O6JA 1U87A 2DJ0A 4G0IA 4DSRA 1MTCA 2VL3A 2VM1A 3HZ4A 3E0UA 1UVZA 1SKWB 3EVIA 4GCIA 4BVXB 5ECQB 4MCUA 1GSSA 1LJRA 3RDWA 5DCGA 3ZFLA 3I9V2 4AGSA 3M8NA 3VPQA 5H5QA 4MPFA 2V41A 2H1BA 1TU7A 4PGTA 4GSTA 5DQYA 3LXZA 4HEA2 1MDJA 1ERUA 1O7UA 1OKDA 1SK0A 1TRSA 1Z5YE 1AC1A 3KTLA 3O6TA 2NTOA 3UOMA 1OC8A 2WDUA 3QR6A 2C0DA 4NMUA 2C0EA 5C04A 2H71A 2VL2A 1BG1A 5G5FA 5EL8A 4OD7A 3L9VA 1HNAA 2VCWA 3CXGA 5A5HB 3S9FA 3VLNA 3GSSA 3UARA 4EE0A 1NW2A 2YN1A 3TDGA 4GSNA 5FHIA 11GSA 4RQRA 4K1FA 3GIXA 3IHGA 1EGOA 4CY8A 2HRKB 5JWRB 4DSSB 4POKA 3MNGA 3CRUA 2QC7A 2X8HA 1TU8A 2WB9A 4Z2RA 1URMA 2DIZA 2KLXA 1Z6MA 4BA7A 3UBKA 3TJBA 8GSSA 1A24A 5D73A 2CQ9A 1F3AA 2O8VB 3F0IA 4E68A 5HFGA 5ECOB 3DMLA 2CAQA 1GNWA 3NZNA 1Z7RA 4ZB6A 2XC2A 3VPTA 4V1Ag 5H5RA 5JWQB 3D0ZA 2GT6A 1WP0A 2V2GA 1QFNA 1VF3A 4ULXA 2LEGA 2HSYA 4GXZA 1Y6EA 4X4JA 5GAND 2LJRA 1C72A 3FZ5A 5GSTA 2RLIA 2QGVA 1GSUA 1ILOA 1TTZA 3HJPA 5CRDA 4LMVA 1BEDA 1NHYA 4XIHA 3WT1A 2C3QA 1LU4A 9GSSA 1OC9A 5AIVA 1M2DA 5GAPD 1RQMA 3TJKA 5F0GA 4PXOA 1B48A 1WMJA 3G7YA 3HVVA 2AAWA 5IOXA 3W8SA 2UZ8A 4F03A 3GKKA 1YJ6A 1JHBA 3EPTA 5H5SA 4GF0A 3M3MA 2HSHA 5ECSA 2DLXA 4J2FA 4ZBAA 2R5GA 4FYCA 3GKXA 4WR4A 4I2UA 4LL1B 1Z9HA 1OE8A 3ZLPA 5A4VA 2HE3A 4TR3A 1Q98A 1PKWA 1H4OA 2B5XA 2FWEA 3LYKA 5A4WA 3A2WA 1BJXA 5EVOA 3CSHA 2X49A 2XPDA 3US3A 1HYUA 5D93A 2C3TA 1EGRA 1M9AA 2I3YA 3F9UA 4TXOA 2C0FA 4AKHA 5EPFA 2DIYA 3IHQA 3GFKA 4EIQA 1T4YA 2IIYA 2H6ZA 1QGVA 2ALBA 1UC7A 4IVFA 1BQ7A 1W89A 1A2MA 1F9MA 5JWOB 5IMZA 3UBLA 3F6FA 4Z2UA 3IOSA 3MDKA 1XOBA 3DRNA 1ZGNA 5J47A 5D9WA 2MBTA 3E3EA 5G5EA 2IJYA 2XBQA 3TB2A 1TK8B 2E2MA 1CQGA 1AW9A 3GL5A 3ZIVA 5AGYA 1DBYA 4GTUA 4AF2A 4MNNA 1E2YA 2J23A 2QKEA 1TOFA 1FVJA 2H70A 1TKDB 4V2LA 2R37A 2HNLA 2OJLA 2WULA 5KOXA 3GTUA 3BBYA 3H79A 3H8QA 3BCKA 4KA0A 2K9FA 5JCUA 2FHEA 3PH9A 3ZVJD 4QL9A 3HVSA 4PX1A 2P31A 1WWJA 4K9ZA 2YV7A 1FG4A 3I6AA 4V2NA 5A5HA 2L6DA 5LNKe 1S3DA 3M9JA 1GTIA 1BF5A 3HMJG 3F3RA 4K2DA 1QK8A 3UEMA 4KF9A 1PQNA 4L0UA 3ERFA 2YP6A 2HSMA 2PPTA 2B3SA 2P0GA 2O87A 3APSA 16GSA 1M2BA 2CA8A 4DSSA 4FQUA 1WJKA 4K6XA 4WXTA 4Q5QA 3GX8A 2JU5A 1N25A 1LBKA 1V40A 1TDIA 3WT2A 4GDFA 2DC5A 4ICYA 1TW9A 2O5VA 3GKMA 2R4VA 5JCWA 3A5IA 6GSVA 1GSFA 5D9VA 3HJOA 2EIQA 2V6OA 2DJ3A 6GSSA 2HRNA 3FY7A 4GQFA 4IBPA 2H0GA 4D73A 2FNOA 5ECNB 3FZAA 4F2IA 4POMA 1EOGA 3RHBA 3O3TA 2DMMA 1YY7A 4Q5NA 2VL9A 2YWOA 5G30A 1XFLA 4IN0A 4KAEA 2H73A 2B5YA 4CW9A 4GSSA 2VOCA 4O32A 1U6TA 2GQLA 1GUHA 2IMKA 4L0WA 2VCVA 1QXHA 5D8IA 3DWVA 1SVMA 3QPMA 2WS2A 1JZWA 4LMWA 4FYUA 4XCSA 4WKWA 1X9SB 3HHVA 1YEPA 3LYPA 5ECPB 1XCCA 1X5CA 4AJ6A 4FYBA 18GSA 3EE2A 1M99A 2P5RA 2IMFA 2F9SA 4F0BA 1OC9B 4EL1A 4HZ4A 3TOTA 2L6CA 2V32A 1ON4A 4G0KA 2H75A 2AHEA 4K7NA 4GWRA 4CY6A 2CT6A 5G1KA 4N3ZA 5G1LA 2LV3A 1J0FA 1FAAA 2ZUPA 1O73A 5CREA 1TK0B 1EV9A 2H19A 4ZBDA 1G6YA 4IS0A 1GRXA 4ZB9A 1CQHA 3KH9A 4HQZA 5DDLA 5DJLA 5B6MA 1U3IA 3WGEA 3Q6OA 4WF5A 2YJ7A 2P5QA 1EP8A 3GRXA 4HQSA 3TJJA 2HRAA 14GSA 2GTUA 4ILFA 4XHMA 2X99A 3GYKA 4V2MA 2TRXA 3D4TA 5HR1A 3HKRA 2YZUA 5C00A 4ZB7A 5IMDA 4E8EA 4QMKA 4HUAA 1XW9A 3LSZA 1XVWA 1B9XC 3QAGA 5DBQA 3OR5A 1KEBA 3IK9A 4TXOB 4JZQA 4TKYA 2H72A 3BCIA 6GSTA 1ZYPA 2RUFA 5CRWA 1FOHA 2A2RA 1WPIA 1B4QA 4KE3A 2QSIA 2H0HA 1XIYA 3BJ5A 2YPMA 2YJHA 3IA1A 4POBA 2PN8A 4HJMA 4IJIA 4TXVA 3Q19A 5IQYA 5IM9A 1B4PA 4K5SA 1MDIA 3F6DA 3D21A 3TKPA 2LRCA 3ED3A 1VGLA 4PNGA 1PA3A 3HA9A 1SVOA 2L4QA 4I8BA 2DKHA 1EP7A 2MMOA 2E2GA 1FVKA 3TKQA 3VFIA 5B8AA 2AB6A 1JZDA 4WF4A 2CVBA 3UJ1A 2NBSA 5DQSA 2F8FA 4MH3A 5CO3A 5B6NA 4L8EA 3W6GA 1W4VA 1XWKA 3GTUB 1YKAA 4TR1A 3ZMKA 2A4HA 4AKGA 2I81A 2CAIA 1T3BA 3L9UA 3FKFA 2KP2A 4F82A 5F06A 4FO5A 3C7MA 3F4TA 3WGDA 4KCAA 2A2SA 3HCZA 5KN2A 1BAYA 5INYA 3F4RA 4AJ7A 4WETA 3ZTLA 2GS3A 4IP1A 4OFNA 2OKAA 4RI7A 2VIMA 2YANA 3EMXA 4YKGA 4Q5RA 2HSMB 2PERA 2F51A 4MZCA 3LQ7A 4G19A 1VF1A 1TJDA 1SJ6A 2GSSA 4O7HA 2E0QA 2JSZA 2JACA 3VWUA 3CMIA 2FCHA 2NPBA 4WBJA 2H1GA 5F8BA 2WFCA 4XRAA 3VURA 2HZEA 2GZYA 4ML6A 2DSAA 3KP8A 2A4VA 4HS1A 3M1GA 4K0NA 4D73B 2JZTA 1K0CA 2VO4A 2FA4A 3QCPA 4NWYA 3M9KA 4IHUA 2IMIA 2H30A 4TR4A 3VI5A 2PVOC 5F07A 2LQQA 1F2EA 5KN1A 4MJBA 1OC3A 2LRTA 1A2LA 2H66A 2OACA 3FRCA 1E6BA 1PN0A 1GSDA 4IKHA 1GLPA 3LJRA 4KUNA 1PL1A 3R3EA 2GSQA 3TRQA 3GHAA 1ZL9A 3LEFA 1K3YA 1YVLA 3U5RE 3VWWA 3FW2A 4XRDA 1JZOA 4G10A 4ACSA 12GSA 3LWAA 1YEXA 1HNCA 2F3MA 3KM6A 3RHCA 2VL2C 2DJKA 2WZ9A 1VF2A 3WGXA 4PQIA 4LLRA 4G01A 4X0XA 3KEBA 4KNDA 2EFHA 2JL4A 2VLUA 3TJFA 1SVLA 4TVEA 4NHWA 3KIJA 4BPYA 4O5QA 2Z9SA 4ZL8A 1XWGA 2VCXA 1H75A 2L57A 1YKCA 1FHEA 4WEYA 3CRTA 5DALA 1AXDA 3F3QA 2B1LA 3MWHA 2H6YA 4OFTA 2HFDA 2OE1A 2X8GA 4NV5A 2L5OA 3QDNA 3SWLA 4RQXA 1TXXA 5FT3A 3FYGA 3P90A 2VLTA 3HVXA 3TKSA 1V58A 5IMCA 3TGZA 1SU9A 3KP9A 1SYXA 5CRHA 2F8AA 1Z7PA 1K0BA 2HLSA 1NHOA 3G7JA 3ME7A 3FR6A 5KN3A 4EVMA 1KBNA 1AQVA 1ACVA 2HQTA 1GP1A 3VI7A 4GLTA 4O92A 2MBSA 1OYJA 4BL7A 3UMAA 2E7PA 2DKIA 4ID0A 4MJEA 4XS4A 3UIWA 3GH6A 1GTBA 2WCIA 7GSSA 4AI6A 2CV4A 1ZOFA 5HQPA 2H0IA 2IPAA 4KDXA 5GSSA 17GSA 2FWGA 3TKSE 5J3RA 2LRNA 1ST9A 3VWVA 3QD9A 2OT3A 2H8LA 3LG6A 4KSMA 2G0FA 1R7HA 2GT5A 4FH8A 5HR3A 1EOHA 4EF0A 5LD0A 3FR9A 3QFAC 2H76A 2VKZG 1OKTA 1DE2A 2GQKA 3A5WA 4JRRA 4BWQA 2UV8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 6GSY A;  5CNW A;  2PU9 C;  1A8L A;  3Q74 A;  4I5Q A;  3I69 A;  5ENU A;  1K0M A;  5G2Z A;  3UAP A;  2GSR A;  3UVT A;  4TR1 B;  3C8E A;  1PX7 A;  3M0F A;  1PMT A;  4KDY A;  3L0H A;  1ERT A;  1G7O A;  2REM A;  4I97 A;  1TRU A;  5IO0 A;  3U6V A;  2IL3 A;  3BD2 A;  2B1K A;  1SK1 A;  2VD1 A;  2CX4 A;  3EYT A;  2N5B A;  2OBI A;  3GL3 A;  4YQV A;  1SL0 B;  4TR0 A;  2H74 A;  2LJA A;  5IIZ A;  1I5G A;  4JE1 A;  2MZC A;  2I1U A;  4HDE A;  1GWC A;  4JU5 A;  4MF6 A;  1FB6 A;  3NIV A;  3J7Y b;  1K0N A;  3F4S A;  3PR8 A;  3ZRD A;  2LNT A;  1Q4J A;  2CVK A;  2JSY A;  4JR6 A;  2GST A;  1BYE A;  2V1M A;  3W8J A;  4HU9 A;  5CYY A;  1M7T A;  5EY6 A;  2GDR A;  2C80 A;  3TRP A;  3IE3 A;  1SL2 B;  3FZ9 A;  1XWB A;  2HZE B;  4XS6 A;  1AQX A;  10GS A;  1Z6N A;  2BTO T;  3PIN A;  5ID2 A;  2YV9 A;  1X9W B;  1V57 A;  2VCZ A;  3WD6 A;  2GQM A;  3D22 A;  5ECH B;  3E9J B;  4BWS A;  3IXR A;  2CZ2 A;  2H6X A;  3ERG A;  5DCH A;  2K18 A;  2AUV A;  4GRF A;  1SKS B;  2DML A;  2B7J A;  2ON7 A;  3IC8 A;  4BVY A;  1ZCP A;  5ECI B;  1F3B A;  1A2J A;  2C4J A;  3HYP A;  1BX9 A;  3APQ A;  2FWH A;  1T4Z A;  4PUR A;  2VD0 A;  4ECJ A;  1PX6 A;  4OO5 A;  1K3O A;  4HOJ A;  2ON5 A;  3CBU A;  5AN1 A;  1WRY A;  3GKN A;  4PTS A;  2LJK A;  4NPB A;  1GSE A;  4ISD A;  1VF4 A;  1MDK A;  5D96 A;  5IPG A;  4LA1 A;  1J08 A;  1QMV A;  3GST A;  4P3Y B;  3P8W A;  2LNS A;  1HNB A;  3EIN A;  3KGK A;  4L5L A;  4ZB8 A;  4ECI A;  3R2Q A;  2WRT A;  1B9Y C;  4ZL7 A;  4OFM A;  1THO A;  4CHS A;  4PNF A;  1ZYQ B;  3IC4 A;  1T7P B;  2IFQ A;  3F63 A;  5F05 A;  1XPV A;  5DVB A;  1WOU A;  1B8X A;  2IN3 A;  3TOU A;  4I2T A;  5DAL B;  1RK4 A;  4RUV A;  2WJU A;  3TUE A;  1XWC A;  4EKZ A;  2AYT A;  1RW1 A;  4O5R A;  1GTA A;  4KSO A;  5COH A;  1PSQ A;  1PD2 1;  2H01 A;  3ISO A;  2FLS A;  3VWX A;  2NVL A;  1GH2 A;  3JCM L;  4MA9 A;  2N5A A;  2CZ3 A;  4NV2 A;  1YQ1 A;  1KNG A;  2C3N A;  4EXJ A;  4XS1 A;  4N30 A;  4G0L A;  3TCO A;  3EU4 A;  2OAD A;  3ZML A;  4PUA A;  4MK3 A;  4LL4 B;  2OBK A;  2RUE A;  1R5P A;  2FA8 A;  2GVP A;  3H4K A;  1M0U A;  2MMN A;  6GSX A;  2YOI A;  5CAX A;  2EIO A;  1SYR A;  1PGT A;  1WE0 A;  1AAZ A;  3G7I A;  4JED A;  4BL7 B;  2GZZ A;  1TRV A;  2LST A;  3UVH A;  4IGJ A;  3SBC A;  3APO A;  3MSZ A;  1JFU A;  4XS4 B;  4EDZ A;  1TRW A;  1EV4 A;  4MH2 A;  1R4W A;  5A5K A;  4V1A p;  2C1Y A;  2KOK A;  1A0F A;  2FY6 A;  5ECK B;  1SK2 A;  2IMD A;  2I9H A;  1BG5 A;  3C1S A;  3LXT A;  4KH7 A;  2LUS A;  1N2A A;  3ZIJ A;  4TN8 A;  5ECL B;  4Q5F A;  1AIU A;  1SJZ A;  5B8B A;  1GSY A;  1K0D A;  2CX3 A;  2NDO A;  4NHZ A;  4YAV A;  19GS A;  3KXO A;  5GZZ B;  2OA7 A;  2R3X A;  2PMT A;  3N9J A;  3QAW A;  4K7O A;  1FW1 A;  3HY2 A;  2OE0 A;  1FO5 A;  4ECC A;  1A8Y A;  4RI6 A;  20GS A;  3EWL A;  4MZB A;  3L4N A;  2EIR A;  5E59 A;  2AV4 A;  3GUR A;  3O76 A;  3QOU A;  2B6M A;  3D4M A;  5IMV A;  2KHP A;  3GV1 A;  1EWX A;  3MAK A;  2TRC P;  1TP9 A;  1FOV A;  1GTU A;  4KX4 A;  3FEU A;  2HSN B;  3EU3 A;  1F37 A;  4MDC A;  2LQO A;  1PN9 A;  3CYN A;  4OMV A;  4OWY A;  4E8H A;  1M2A A;  1V2A A;  3IAS 2;  5IO2 A;  4K0G A;  1N8J A;  3AY8 A;  4JR4 A;  2FUG 2;  4CDO A;  5HFK A;  1X5E A;  1UA5 A;  3L78 A;  1YDK A;  1DUG A;  1JLW A;  4MJC A;  2C8U A;  5J9C A;  3FK8 A;  3I43 A;  2RII A;  1NSW A;  3DXB A;  1OE7 A;  3KMN A;  1EEM A;  3IAM 2;  3IV4 A;  4POL A;  3IK7 A;  3A2V A;  4HZ2 A;  2DJ2 A;  6GSU A;  3PGT A;  5HFI A;  3CSJ A;  5ID2 B;  2XBI A;  2YNX A;  3EMP A;  4F9Z A;  5J41 A;  1G7E A;  4IP6 A;  3FR3 A;  4IEL A;  3P2A A;  4Z7X A;  2ZNM A;  2N5F A;  2JZS A;  1PRX A;  2MMA A;  4N10 A;  1SEN A;  4MPG A;  2AJQ B;  4BVY B;  2G2Q A;  4TOP A;  1GNE A;  2MYG A;  1HD2 A;  1QQ2 A;  2DBC A;  1GUM A;  2K8V A;  2LTK A;  5J4U A;  2GGT A;  4DVC A;  1TK5 B;  3D5J A;  3ME8 A;  1T8E B;  2ES7 A;  5FWG A;  1ERW A;  4HJ2 A;  1O81 A;  2HI7 A;  1YF0 A;  4N0V A;  2JZR A;  3TJG A;  1X0R A;  3DVW A;  2K8S A;  3TKR A;  4IW9 A;  2B7K A;  1TI3 A;  1O85 A;  2IFQ B;  5IPH A;  1T00 A;  1R26 A;  4FIW A;  2HXK A;  3HXS A;  1VRS D;  3KTB A;  3ZRE A;  4USS A;  2O89 A;  4NXI A;  4OCE A;  4TRX A;  4HU7 A;  1AQW A;  1I9D A;  1ZYE A;  2FGX A;  2YWN A;  3QFB C;  4MAB A;  4OCF A;  3GNJ A;  1S3C A;  3H1N A;  1QUW A;  4YAP A;  5ABR A;  2KP1 A;  3DVX A;  2YWM A;  4IQA A;  3HZ8 A;  4WR5 A;  3KD0 A;  2PGT A;  3EUR A;  1USB A;  4G9H A;  1TI1 A;  4KCE A;  3IBH A;  2RM5 A;  4ZBB A;  1OAZ A;  2HRF A;  3VK9 A;  2KUC A;  1XVQ A;  1XXU A;  1Y25 A;  5D9T A;  1SL1 B;  1GUK A;  3DGQ A;  4ECB A;  3CSI A;  2H1A A;  1MEK A;  3FZ4 A;  1YF1 A;  2L59 A;  3C71 A;  2HT9 A;  1M9B A;  4EC0 A;  4QQ7 A;  5ECM B;  2HYX A;  1F6M C;  1XWA A;  4YQM A;  1AUC A;  2OE3 A;  4G2E A;  13GS A;  2LS5 A;  4XTS A;  5DAK B;  2VCQ A;  3NOF A;  1GLQ A;  3TRX A;  4MZW A;  1V98 A;  3N5O A;  3KH7 A;  3ZL5 A;  2EC4 A;  1J9B A;  4NAX A;  5D9X A;  2BMX A;  3RPN A;  4HI7 A;  4BVX A;  3BOA A;  2C0G A;  1K3L A;  2FWF A;  1R5A A;  4X43 A;  5J5N A;  1S3A A;  4L5O A;  2PVQ A;  3IPZ A;  1EZK A;  3ZIT A;  3QMX A;  2YZH A;  4F0C A;  5HR2 A;  1GL8 A;  4MMM A;  2B5E A;  2X8C A;  2O85 A;  2O7K A;  2FD3 A;  3GN3 A;  4EDY A;  2XHF A;  4KGI A;  3F8U A;  4IJ3 A;  2GZP A;  3UL3 A;  2CVD A;  4EO3 A;  5ECR B;  3LGC A;  3RAZ A;  5ELG A;  5E4W A;  1ABA A;  4MF5 A;  3TKS C;  2GLR A;  5IMA A;  3K8N A;  4MF7 A;  3DYR A;  4JBB A;  4KB3 A;  5CP1 A;  3Q18 A;  1XBS A;  2TIR A;  3QAV A;  4MLY A;  4WBR D;  1PKZ A;  3RPP A;  3KJY A;  4J57 E;  2K6V A;  1A0R P;  4PQ1 A;  2HRK A;  2D2Z A;  3GH9 A;  1OVN A;  3HDC A;  2H1D A;  4MJA A;  1WIK A;  1XOA A;  1NM3 A;  1IYI A;  5JCG A;  1ML6 A;  3V1W A;  1SD8 A;  3DIE A;  1SKR B;  1EEJ A;  1IYH A;  4N0Z A;  2VCT A;  1X9M B;  3CTF A;  5LCZ A;  1X5D A;  1T1V A;  1A23 A;  4N11 A;  4ZIL A;  3EC3 A;  2DJJ A;  3GUS A;  3ZVJ A;  4I6X A;  4ZL9 A;  1GSQ A;  2VAF A;  3HD5 A;  2L4C A;  2IME A;  5L71 A;  2R6K A;  1SJI A;  2L5L A;  1XZO A;  3KZQ A;  3GMF A;  3J7Y k;  2VUP A;  1YZX A;  3P7X A;  3DEX A;  3G9B A;  3GA4 A;  3ZZX A;  1JLV A;  2R2J A;  3H93 A;  3CTG A;  2M80 A;  5KEJ A;  4ML1 A;  5B7C A;  3DKS A;  1DSB A;  4KDU A;  3WYW A;  1U3A A;  5KN0 A;  1V9W A;  5J9B A;  4MP4 A;  1KTE A;  3ZFB A;  2ZCT A;  1G6W A;  1O8X A;  4PUF C;  3KCM A;  4H86 A;  4EUY A;  2V6K A;  5BMU A;  1SD9 A;  4DEJ A;  4GQC A;  6GSW A;  1ERV A;  4K8M A;  3IRA A;  4QL7 A;  3LOR A;  3C1R A;  1MD3 A;  3D6I A;  2BJX A;  1XW5 A;  2WGR A;  22GS A;  3RBT A;  2M46 A;  2MMZ A;  2XPE A;  2PWJ A;  5IMF A;  2M72 A;  3FHK A;  1G0T A;  2YCD A;  1PL2 A;  3IR4 A;  3KMO A;  4J56 E;  1DE1 A;  5G31 A;  1GUL A;  1JZR A;  4ZIJ A;  4KW6 A;  4DSQ A;  2LKU A;  3PPU A;  1UN2 A;  4OO4 A;  3DD3 A;  4IQ1 A;  1K0O A;  4YH2 A;  2IWT A;  5CRG A;  1U88 A;  1ZZY A;  4ZXG A;  3A3T A;  2YWI A;  1K0A A;  2X64 A;  2RM6 A;  4YQU A;  3GX0 A;  2PUK C;  1Z3E A;  3IDV A;  2DJ1 A;  3C73 A;  1HQO A;  1MD4 A;  4TW5 A;  5ELA A;  5HR0 A;  4K7I A;  3HJM A;  3ERW A;  3ZYW A;  5IOW A;  5DAK A;  2PBJ A;  5A4U A;  1XW6 A;  2HZF A;  2VM2 A;  2VLV A;  4AJ8 A;  1ZMA A;  5AIS A;  4PQH A;  1THX A;  3A2X A;  2JAD A;  1O8W A;  4X1U A;  3LFL A;  3L9S A;  2I4A A;  5AIX A;  5DJM A;  1FB0 A;  2J9H A;  1O6J A;  1U87 A;  2DJ0 A;  4G0I A;  4DSR A;  1MTC A;  2VL3 A;  2VM1 A;  3HZ4 A;  3E0U A;  1UVZ A;  1SKW B;  3EVI A;  4GCI A;  4BVX B;  5ECQ B;  4MCU A;  1GSS A;  1LJR A;  3RDW A;  5DCG A;  3ZFL A;  3I9V 2;  4AGS A;  3M8N A;  3VPQ A;  5H5Q A;  4MPF A;  2V41 A;  2H1B A;  1TU7 A;  4PGT A;  4GST A;  5DQY A;  3LXZ A;  4HEA 2;  1MDJ A;  1ERU A;  1O7U A;  1OKD A;  1SK0 A;  1TRS A;  1Z5Y E;  1AC1 A;  3KTL A;  3O6T A;  2NTO A;  3UOM A;  1OC8 A;  2WDU A;  3QR6 A;  2C0D A;  4NMU A;  2C0E A;  5C04 A;  2H71 A;  2VL2 A;  5G5F A;  5EL8 A;  4OD7 A;  3L9V A;  1HNA A;  2VCW A;  3CXG A;  3S9F A;  3VLN A;  3GSS A;  3UAR A;  4EE0 A;  1NW2 A;  2YN1 A;  3TDG A;  4GSN A;  5FHI A;  11GS A;  4RQR A;  4K1F A;  3GIX A;  1EGO A;  2HRK B;  5JWR B;  4DSS B;  4POK A;  3MNG A;  3CRU A;  2QC7 A;  2X8H A;  1TU8 A;  2WB9 A;  1URM A;  2DIZ A;  2KLX A;  1Z6M A;  4BA7 A;  3UBK A;  3TJB A;  8GSS A;  1A24 A;  5D73 A;  2CQ9 A;  1F3A A;  2O8V B;  3F0I A;  5HFG A;  5ECO B;  3DML A;  2CAQ A;  1GNW A;  3NZN A;  1Z7R A;  4ZB6 A;  2XC2 A;  3VPT A;  4V1A g;  5H5R A;  5JWQ B;  3D0Z A;  2GT6 A;  1WP0 A;  2V2G A;  1QFN A;  1VF3 A;  4ULX A;  2LEG A;  2HSY A;  4GXZ A;  1Y6E A;  5GAN D;  2LJR A;  1C72 A;  3FZ5 A;  5GST A;  2RLI A;  2QGV A;  1GSU A;  1ILO A;  1TTZ A;  3HJP A;  5CRD A;  4LMV A;  1BED A;  1NHY A;  4XIH A;  3WT1 A;  2C3Q A;  1LU4 A;  9GSS A;  1OC9 A;  5AIV A;  1M2D A;  5GAP D;  1RQM A;  3TJK A;  5F0G A;  4PXO A;  1B48 A;  1WMJ A;  3G7Y A;  3HVV A;  2AAW A;  5IOX A;  3W8S A;  2UZ8 A;  4F03 A;  3GKK A;  1YJ6 A;  1JHB A;  5H5S A;  4GF0 A;  3M3M A;  2HSH A;  5ECS A;  2DLX A;  4J2F A;  4ZBA A;  2R5G A;  4FYC A;  3GKX A;  4WR4 A;  4I2U A;  4LL1 B;  1Z9H A;  1OE8 A;  3ZLP A;  5A4V A;  2HE3 A;  4TR3 A;  1Q98 A;  1PKW A;  1H4O A;  2B5X A;  2FWE A;  3LYK A;  5A4W A;  3A2W A;  1BJX A;  5EVO A;  3CSH A;  2XPD A;  3US3 A;  1HYU A;  5D93 A;  2C3T A;  1EGR A;  1M9A A;  2I3Y A;  3F9U A;  4TXO A;  2C0F A;  5EPF A;  2DIY A;  3IHQ A;  3GFK A;  1T4Y A;  2IIY A;  2H6Z A;  1QGV A;  2ALB A;  1UC7 A;  4IVF A;  1BQ7 A;  1W89 A;  1A2M A;  1F9M A;  5JWO B;  5IMZ A;  3UBL A;  3F6F A;  3IOS A;  3MDK A;  1XOB A;  3DRN A;  1ZGN A;  5D9W A;  2MBT A;  3E3E A;  5G5E A;  2IJY A;  2XBQ A;  3TB2 A;  1TK8 B;  2E2M A;  1CQG A;  1AW9 A;  3GL5 A;  3ZIV A;  5AGY A;  1DBY A;  4GTU A;  4AF2 A;  1E2Y A;  2J23 A;  2QKE A;  1TOF A;  1FVJ A;  2H70 A;  1TKD B;  4V2L A;  2R37 A;  2HNL A;  2OJL A;  2WUL A;  3GTU A;  3BBY A;  3H79 A;  3H8Q A;  3BCK A;  4KA0 A;  2K9F A;  5JCU A;  2FHE A;  3PH9 A;  3ZVJ D;  4QL9 A;  3HVS A;  4PX1 A;  2P31 A;  1WWJ A;  4K9Z A;  2YV7 A;  1FG4 A;  3I6A A;  4V2N A;  2L6D A;  5LNK e;  1S3D A;  3M9J A;  1GTI A;  3F3R A;  4K2D A;  1QK8 A;  3UEM A;  4KF9 A;  1PQN A;  4L0U A;  3ERF A;  2YP6 A;  2HSM A;  2PPT A;  2B3S A;  2P0G A;  2O87 A;  3APS A;  16GS A;  1M2B A;  2CA8 A;  4DSS A;  4FQU A;  1WJK A;  4K6X A;  4WXT A;  4Q5Q A;  3GX8 A;  2JU5 A;  1LBK A;  1V40 A;  1TDI A;  3WT2 A;  2DC5 A;  1TW9 A;  3GKM A;  2R4V A;  5JCW A;  6GSV A;  1GSF A;  5D9V A;  3HJO A;  2EIQ A;  2V6O A;  2DJ3 A;  6GSS A;  2HRN A;  3FY7 A;  4GQF A;  4IBP A;  2H0G A;  4D73 A;  2FNO A;  5ECN B;  3FZA A;  4F2I A;  4POM A;  1EOG A;  3RHB A;  3O3T A;  2DMM A;  1YY7 A;  4Q5N A;  2VL9 A;  2YWO A;  5G30 A;  1XFL A;  4IN0 A;  4KAE A;  2H73 A;  2B5Y A;  4CW9 A;  4GSS A;  2VOC A;  4O32 A;  1U6T A;  2GQL A;  1GUH A;  2IMK A;  4L0W A;  2VCV A;  1QXH A;  5D8I A;  3DWV A;  3QPM A;  2WS2 A;  1JZW A;  4LMW A;  4FYU A;  4XCS A;  4WKW A;  1X9S B;  3HHV A;  1YEP A;  3LYP A;  5ECP B;  1XCC A;  1X5C A;  4AJ6 A;  4FYB A;  18GS A;  3EE2 A;  1M99 A;  2P5R A;  2IMF A;  2F9S A;  4F0B A;  1OC9 B;  4EL1 A;  4HZ4 A;  3TOT A;  2L6C A;  2V32 A;  1ON4 A;  4G0K A;  2H75 A;  2AHE A;  4K7N A;  4GWR A;  2CT6 A;  5G1K A;  5G1L A;  2LV3 A;  1J0F A;  1FAA A;  2ZUP A;  1O73 A;  5CRE A;  1TK0 B;  1EV9 A;  2H19 A;  4ZBD A;  1G6Y A;  4IS0 A;  1GRX A;  4ZB9 A;  1CQH A;  3KH9 A;  4HQZ A;  5DDL A;  5DJL A;  5B6M A;  1U3I A;  3WGE A;  3Q6O A;  4WF5 A;  2YJ7 A;  2P5Q A;  1EP8 A;  3GRX A;  4HQS A;  3TJJ A;  2HRA A;  14GS A;  2GTU A;  4ILF A;  4XHM A;  2X99 A;  3GYK A;  4V2M A;  2TRX A;  3D4T A;  5HR1 A;  3HKR A;  2YZU A;  5C00 A;  5IMD A;  4E8E A;  4HUA A;  1XW9 A;  3LSZ A;  1XVW A;  1B9X C;  3QAG A;  5DBQ A;  3OR5 A;  1KEB A;  3IK9 A;  4TXO B;  4JZQ A;  4TKY A;  2H72 A;  3BCI A;  6GST A;  2RUF A;  5CRW A;  2A2R A;  1WPI A;  1B4Q A;  4KE3 A;  2QSI A;  2H0H A;  1XIY A;  3BJ5 A;  2YPM A;  2YJH A;  3IA1 A;  4POB A;  2PN8 A;  4HJM A;  4IJI A;  4TXV A;  3Q19 A;  5IQY A;  5IM9 A;  1B4P A;  1MDI A;  3F6D A;  3D21 A;  3TKP A;  2LRC A;  3ED3 A;  1VGL A;  4PNG A;  1PA3 A;  3HA9 A;  2L4Q A;  4I8B A;  1EP7 A;  2MMO A;  2E2G A;  1FVK A;  3TKQ A;  3VFI A;  5B8A A;  2AB6 A;  1JZD A;  4WF4 A;  2CVB A;  3UJ1 A;  2NBS A;  5DQS A;  2F8F A;  4MH3 A;  5CO3 A;  5B6N A;  4L8E A;  3W6G A;  1W4V A;  1XWK A;  3GTU B;  1YKA A;  4TR1 A;  3ZMK A;  2I81 A;  2CAI A;  1T3B A;  3L9U A;  3FKF A;  2KP2 A;  4F82 A;  5F06 A;  4FO5 A;  3C7M A;  3F4T A;  3WGD A;  4KCA A;  2A2S A;  3HCZ A;  5KN2 A;  1BAY A;  5INY A;  3F4R A;  4AJ7 A;  4WET A;  3ZTL A;  2GS3 A;  4IP1 A;  4OFN A;  2OKA A;  4RI7 A;  2VIM A;  2YAN A;  3EMX A;  4Q5R A;  2HSM B;  2PER A;  2F51 A;  4MZC A;  3LQ7 A;  4G19 A;  1VF1 A;  1TJD A;  1SJ6 A;  2GSS A;  4O7H A;  2E0Q A;  2JSZ A;  2JAC A;  3VWU A;  3CMI A;  2FCH A;  2NPB A;  4WBJ A;  2H1G A;  5F8B A;  2WFC A;  4XRA A;  3VUR A;  2HZE A;  2GZY A;  4ML6 A;  2DSA A;  3KP8 A;  2A4V A;  4HS1 A;  3M1G A;  4K0N A;  4D73 B;  2JZT A;  1K0C A;  2VO4 A;  2FA4 A;  3QCP A;  4NWY A;  3M9K A;  4IHU A;  2IMI A;  2H30 A;  4TR4 A;  3VI5 A;  2PVO C;  5F07 A;  2LQQ A;  1F2E A;  5KN1 A;  4MJB A;  1OC3 A;  2LRT A;  1A2L A;  2H66 A;  2OAC A;  3FRC A;  1E6B A;  1GSD A;  4IKH A;  1GLP A;  3LJR A;  4KUN A;  1PL1 A;  3R3E A;  2GSQ A;  3TRQ A;  3GHA A;  1ZL9 A;  3LEF A;  1K3Y A;  3U5R E;  3VWW A;  3FW2 A;  4XRD A;  1JZO A;  4G10 A;  4ACS A;  12GS A;  3LWA A;  1YEX A;  1HNC A;  2F3M A;  3KM6 A;  3RHC A;  2VL2 C;  2DJK A;  2WZ9 A;  1VF2 A;  3WGX A;  4PQI A;  4LLR A;  4X0X A;  3KEB A;  4KND A;  2JL4 A;  2VLU A;  3TJF A;  4TVE A;  4NHW A;  3KIJ A;  4BPY A;  2Z9S A;  4ZL8 A;  1XWG A;  2VCX A;  1H75 A;  2L57 A;  1YKC A;  1FHE A;  4WEY A;  3CRT A;  5DAL A;  1AXD A;  3F3Q A;  2B1L A;  3MWH A;  2H6Y A;  4OFT A;  2HFD A;  2OE1 A;  2X8G A;  4NV5 A;  2L5O A;  3QDN A;  3SWL A;  4RQX A;  1TXX A;  5FT3 A;  3FYG A;  3P90 A;  2VLT A;  3HVX A;  3TKS A;  1V58 A;  5IMC A;  3TGZ A;  1SU9 A;  3KP9 A;  1SYX A;  5CRH A;  2F8A A;  1Z7P A;  1K0B A;  2HLS A;  1NHO A;  3G7J A;  3ME7 A;  3FR6 A;  5KN3 A;  4EVM A;  1KBN A;  1AQV A;  1ACV A;  2HQT A;  1GP1 A;  3VI7 A;  4GLT A;  4O92 A;  2MBS A;  1OYJ A;  4BL7 A;  3UMA A;  2E7P A;  4ID0 A;  4MJE A;  4XS4 A;  3UIW A;  3GH6 A;  1GTB A;  2WCI A;  7GSS A;  2CV4 A;  1ZOF A;  5HQP A;  2H0I A;  2IPA A;  4KDX A;  5GSS A;  17GS A;  2FWG A;  3TKS E;  5J3R A;  2LRN A;  1ST9 A;  3VWV A;  3QD9 A;  2H8L A;  3LG6 A;  4KSM A;  2G0F A;  1R7H A;  2GT5 A;  4FH8 A;  5HR3 A;  1EOH A;  4EF0 A;  5LD0 A;  3FR9 A;  3QFA C;  2H76 A;  1OKT A;  1DE2 A;  2GQK A;  3A5W A;  4JRR A;  4BWQ A; 
#chains in the Genus database with same CATH topology
 6GSY A;  5CNW A;  2PU9 C;  1A8L A;  3Q74 A;  4I5Q A;  3I69 A;  5ENU A;  1K0M A;  5A34 B;  5G2Z A;  3UAP A;  2GSR A;  3UVT A;  4TR1 B;  3C8E A;  1PX7 A;  3M0F A;  1PMT A;  4KDY A;  4EIP A;  3L0H A;  1ERT A;  1G7O A;  2REM A;  4I97 A;  1TRU A;  5IO0 A;  3U6V A;  2HSN A;  2IL3 A;  3BD2 A;  2B1K A;  1SK1 A;  2VD1 A;  2CX4 A;  3EYT A;  2N5B A;  2OBI A;  3GL3 A;  4YQV A;  1SL0 B;  4TR0 A;  2H74 A;  2LJA A;  5IIZ A;  1I5G A;  4JE1 A;  2H1L A;  2MZC A;  2I1U A;  4HDE A;  1GWC A;  4JU5 A;  4MF6 A;  1FB6 A;  3NIV A;  3J7Y b;  1K0N A;  5BRT A;  3F4S A;  3PR8 A;  3ZRD A;  2LNT A;  1Q4J A;  2CVK A;  2JSY A;  4JR6 A;  2GST A;  1BYE A;  2V1M A;  3W8J A;  4HU9 A;  5CYY A;  1M7T A;  5EY6 A;  2GDR A;  2C80 A;  3TRP A;  3IE3 A;  1SL2 B;  3FZ9 A;  1XWB A;  2HZE B;  2R0C A;  4XS6 A;  1AQX A;  10GS A;  1Z6N A;  2O36 A;  2BTO T;  3PIN A;  5ID2 A;  2YV9 A;  1X9W B;  1V57 A;  5A1N A;  1PFO A;  2VCZ A;  3WD6 A;  2GQM A;  3D22 A;  5ECH B;  3E9J B;  4BWS A;  3IXR A;  2CZ2 A;  2H6X A;  3ERG A;  5DCH A;  2K18 A;  2AUV A;  4GRF A;  1SKS B;  2DML A;  1XG8 A;  2B7J A;  2ON7 A;  3IC8 A;  4BVY A;  1ZCP A;  5ECI B;  1F3B A;  1A2J A;  2C4J A;  3HYP A;  1BX9 A;  3APQ A;  2FWH A;  1T4Z A;  4PUR A;  2VD0 A;  4ECJ A;  1PX6 A;  4OO5 A;  1K3O A;  4HOJ A;  2ON5 A;  3CBU A;  5AN1 A;  1WRY A;  3GKN A;  4PTS A;  2LJK A;  4NPB A;  1GSE A;  4ISD A;  1VF4 A;  1MDK A;  5D96 A;  5IPG A;  4LA1 A;  1J08 A;  1QMV A;  3GST A;  4P3Y B;  3P8W A;  2LNS A;  1HNB A;  3EIN A;  3KGK A;  4L5L A;  4ZB8 A;  4ECI A;  3R2Q A;  2WRT A;  1B9Y C;  3LW9 A;  4ZL7 A;  4OFM A;  1THO A;  4CHS A;  4PNF A;  1ZYQ B;  3IC4 A;  1T7P B;  2IFQ A;  3F63 A;  5F05 A;  1XPV A;  5DVB A;  2WW1 A;  1WOU A;  1B8X A;  2IN3 A;  3TOU A;  4I2T A;  3CWG A;  5DAL B;  1RK4 A;  4RUV A;  2WJU A;  3TUE A;  1XWC A;  4EKZ A;  2AYT A;  1RW1 A;  4O5R A;  1GTA A;  4KSO A;  5COH A;  1PSQ A;  1PD2 1;  4AKX B;  2H01 A;  3ISO A;  2FLS A;  3VWX A;  2NVL A;  1GH2 A;  3JCM L;  4MA9 A;  4K2X A;  2N5A A;  2CZ3 A;  4NV2 A;  1YQ1 A;  1KNG A;  2C3N A;  4EXJ A;  4XS1 A;  4N30 A;  4G0L A;  3TCO A;  3EU4 A;  2OAD A;  3ZML A;  4PUA A;  4MK3 A;  4LL4 B;  2OBK A;  2RUE A;  1R5P A;  2FA8 A;  2GVP A;  3H4K A;  1M0U A;  2MMN A;  6GSX A;  2YOI A;  5CAX A;  2EIO A;  1SYR A;  1PGT A;  2QA2 A;  4AKI A;  1WE0 A;  1AAZ A;  3G7I A;  4JED A;  4BL7 B;  2GZZ A;  1TRV A;  2LST A;  3UVH A;  4IGJ A;  4O5U A;  3SBC A;  3APO A;  3MSZ A;  1JFU A;  4XS4 B;  4EDZ A;  1TRW A;  1EV4 A;  4MH2 A;  1R4W A;  5A5K A;  4V1A p;  2C1Y A;  2KOK A;  1A0F A;  2FY6 A;  5ECK B;  1SK2 A;  2IMD A;  2I9H A;  2WVX A;  1BG5 A;  3C1S A;  3LXT A;  4KH7 A;  2LUS A;  1N2A A;  3ZIJ A;  4TN8 A;  5ECL B;  4Q5F A;  1AIU A;  4W66 A;  1SJZ A;  5B8B A;  1GSY A;  1K0D A;  2CX3 A;  2NDO A;  4NHZ A;  5A34 A;  4YAV A;  19GS A;  3KXO A;  5GZZ B;  2OA7 A;  2R3X A;  2PMT A;  3N9J A;  3QAW A;  4K7O A;  1FW1 A;  3HY2 A;  2OE0 A;  1FO5 A;  2QA1 A;  4ECC A;  1A8Y A;  4RI6 A;  20GS A;  3EWL A;  4MZB A;  3L4N A;  2EIR A;  5E59 A;  2AV4 A;  3GUR A;  3O76 A;  3QOU A;  2B6M A;  3D4M A;  5IMV A;  2KHP A;  3GV1 A;  1EWX A;  3MAK A;  5KOW A;  2TRC P;  1TP9 A;  1FOV A;  1GTU A;  4KX4 A;  3FEU A;  2R0G A;  2HSN B;  3EU3 A;  1F37 A;  4MDC A;  2LQO A;  1PN9 A;  3CYN A;  4OMV A;  4OWY A;  4E8H A;  1M2A A;  1V2A A;  3IAS 2;  5IO2 A;  4K0G A;  1N8J A;  4YKF A;  3AY8 A;  4JR4 A;  2FUG 2;  4CDO A;  5HFK A;  1X5E A;  1UA5 A;  3L78 A;  1YDK A;  1DUG A;  1JLW A;  4MJC A;  2C8U A;  5J9C A;  3FK8 A;  3I43 A;  2RII A;  1NSW A;  3DXB A;  1OE7 A;  3KMN A;  1EEM A;  3IAM 2;  3IV4 A;  4POL A;  3IK7 A;  3A2V A;  4HZ2 A;  4Z2T A;  2DJ2 A;  6GSU A;  3PGT A;  5HFI A;  3CSJ A;  5ID2 B;  2XBI A;  2YNX A;  3EMP A;  4F9Z A;  5J41 A;  5A1N B;  1G7E A;  4IP6 A;  5J4V A;  3FR3 A;  4IEL A;  3P2A A;  4Z7X A;  2ZNM A;  2N5F A;  2JZS A;  1TXU A;  1PRX A;  2MMA A;  4N10 A;  1SEN A;  4MPG A;  2AJQ B;  4BVY B;  2G2Q A;  4TOP A;  1GNE A;  1M3I A;  2MYG A;  1HD2 A;  1QQ2 A;  2DBC A;  1GUM A;  2K8V A;  2LTK A;  5J4U A;  2GGT A;  4DVC A;  1TK5 B;  3D5J A;  3ME8 A;  1T8E B;  2ES7 A;  5FWG A;  5BMU B;  1ERW A;  4HJ2 A;  1O81 A;  2HI7 A;  3TU3 B;  1YF0 A;  4N0V A;  2JZR A;  3TJG A;  1X0R A;  3DVW A;  2K8S A;  3TKR A;  4IW9 A;  2B7K A;  1TI3 A;  1O85 A;  2IFQ B;  5IPH A;  1T00 A;  1R26 A;  4FIW A;  2HXK A;  3HXS A;  1VRS D;  3KTB A;  3ZRE A;  4USS A;  2O89 A;  4NXI A;  4OCE A;  4TRX A;  4HU7 A;  1AQW A;  1I9D A;  1ZYE A;  2FGX A;  2YWN A;  3QFB C;  4MAB A;  4OCF A;  3GNJ A;  1S3C A;  3H1N A;  1QUW A;  4YAP A;  5ABR A;  2KP1 A;  3DVX A;  2YWM A;  4IQA A;  3HZ8 A;  4WR5 A;  3KD0 A;  2PGT A;  3EUR A;  1USB A;  4G9H A;  1TI1 A;  4KCE A;  3IBH A;  1I1I P;  2RM5 A;  4ZBB A;  1OAZ A;  2HRF A;  3VK9 A;  4BIK A;  2KUC A;  1XVQ A;  1XXU A;  1Y25 A;  5D9T A;  1SL1 B;  1GUK A;  3DGQ A;  4ECB A;  3CSI A;  2H1A A;  1MEK A;  3FZ4 A;  1YF1 A;  2L59 A;  3C71 A;  2HT9 A;  1M9B A;  4EC0 A;  4QQ7 A;  5ECM B;  2HYX A;  1F6M C;  1XWA A;  4YQM A;  1AUC A;  2OE3 A;  4G2E A;  13GS A;  2LS5 A;  4XTS A;  5DAK B;  2VCQ A;  3NOF A;  1GLQ A;  3TRX A;  4MZW A;  1V98 A;  3N5O A;  3KH7 A;  3ZL5 A;  2WVX B;  2EC4 A;  1J9B A;  4NAX A;  5D9X A;  2BMX A;  3RPN A;  4HI7 A;  4BVX A;  3BOA A;  2C0G A;  1K3L A;  2FWF A;  1R5A A;  4X43 A;  5J5N A;  2WZS A;  1S3A A;  4L5O A;  2PVQ A;  3IPZ A;  1EZK A;  3ZIT A;  3QMX A;  2YZH A;  4F0C A;  5HR2 A;  1GL8 A;  4MMM A;  2B5E A;  2X8C A;  2O85 A;  2O7K A;  2FD3 A;  3GN3 A;  4EDY A;  2XHF A;  4KGI A;  3F8U A;  4IJ3 A;  1Y1U A;  2GZP A;  3UL3 A;  2CVD A;  4EO3 A;  5ECR B;  3LGC A;  3RAZ A;  5ELG A;  5E4W A;  1ABA A;  4MF5 A;  3TKS C;  2GLR A;  5IMA A;  3K8N A;  4MF7 A;  3DYR A;  4JBB A;  4KB3 A;  3MIX A;  5CP1 A;  3Q18 A;  2EFE A;  1XBS A;  2TIR A;  3QAV A;  4MLY A;  4WBR D;  1PKZ A;  3RPP A;  3KJY A;  4J57 E;  2K6V A;  1A0R P;  4PQ1 A;  2HRK A;  2D2Z A;  3GH9 A;  1OVN A;  3HDC A;  2H1D A;  4MJA A;  1WIK A;  1XOA A;  1NM3 A;  1IYI A;  5JCG A;  1ML6 A;  3V1W A;  1SD8 A;  3DIE A;  1SKR B;  2R0P A;  1EEJ A;  1IYH A;  4N0Z A;  2VCT A;  1X9M B;  3CTF A;  5LCZ A;  1X5D A;  1T1V A;  1A23 A;  4N11 A;  4ZIL A;  3EC3 A;  2DJJ A;  3GUS A;  3ZVJ A;  4I6X A;  4ZL9 A;  1GSQ A;  2VAF A;  3HD5 A;  2L4C A;  2A2P A;  2IME A;  1M3J A;  5L71 A;  2R6K A;  1SJI A;  2L5L A;  1XZO A;  3KZQ A;  3GMF A;  3J7Y k;  2VUP A;  4K5R A;  1YZX A;  3P7X A;  3DEX A;  3G9B A;  3GA4 A;  3ZZX A;  3FMW A;  1JLV A;  2R2J A;  3H93 A;  2EFC A;  3CTG A;  2M80 A;  5KEJ A;  4ML1 A;  5B7C A;  3DKS A;  1DSB A;  4KDU A;  3WYW A;  1U3A A;  5KN0 A;  2X4A A;  1V9W A;  5J9B A;  4MP4 A;  1KTE A;  3ZFB A;  2ZCT A;  1G6W A;  1O8X A;  4PUF C;  3KCM A;  4H86 A;  4EUY A;  2V6K A;  5BMU A;  1SD9 A;  4DEJ A;  4GQC A;  6GSW A;  1ERV A;  4K8M A;  3IRA A;  4QL7 A;  3LOR A;  3C1R A;  1MD3 A;  3D6I A;  2BJX A;  1XW5 A;  2WGR A;  22GS A;  3RBT A;  2M46 A;  2MMZ A;  2XPE A;  2PWJ A;  5IMF A;  2M72 A;  3FHK A;  1G0T A;  2YCD A;  1PL2 A;  3IR4 A;  3KMO A;  4J56 E;  1DE1 A;  5G31 A;  1GUL A;  1JZR A;  4ZIJ A;  5J40 A;  4KW6 A;  4DSQ A;  2LKU A;  3PPU A;  5J4Y A;  1UN2 A;  4OO4 A;  2EFD A;  3DD3 A;  4IQ1 A;  1K0O A;  4YH2 A;  2IWT A;  5CRG A;  1U88 A;  1ZZY A;  4ZXG A;  3A3T A;  2YWI A;  1K0A A;  2X64 A;  2RM6 A;  4YQU A;  3GX0 A;  2PUK C;  1Z3E A;  3IDV A;  2DJ1 A;  3C73 A;  2O3E A;  1HQO A;  1MD4 A;  4TW5 A;  5ELA A;  4A5P A;  5HR0 A;  1ZYN A;  4HSC X;  4K7I A;  3HJM A;  3ERW A;  3ZYW A;  5IOW A;  5DAK A;  2PBJ A;  5A4U A;  1XW6 A;  2HZF A;  2VM2 A;  2VLV A;  4AJ8 A;  1ZMA A;  3MYD A;  5AIS A;  2WW2 A;  4PQH A;  1THX A;  3A2X A;  2JAD A;  1O8W A;  4X1U A;  3LFL A;  3L9S A;  2I4A A;  5AIX A;  5DJM A;  1FB0 A;  2J9H A;  1O6J A;  1U87 A;  2DJ0 A;  4G0I A;  4DSR A;  1MTC A;  2VL3 A;  2VM1 A;  3HZ4 A;  3E0U A;  1UVZ A;  1SKW B;  3EVI A;  4GCI A;  4BVX B;  1S3R A;  5ECQ B;  4MCU A;  1GSS A;  1LJR A;  3RDW A;  5DCG A;  3ZFL A;  3I9V 2;  4AGS A;  3M8N A;  3VPQ A;  5H5Q A;  4MPF A;  2V41 A;  2H1B A;  1TU7 A;  4PGT A;  4GST A;  5DQY A;  3LXZ A;  4HEA 2;  1MDJ A;  1ERU A;  1O7U A;  1OKD A;  1SK0 A;  1TRS A;  1Z5Y E;  1AC1 A;  3KTL A;  3O6T A;  2NTO A;  3UOM A;  1OC8 A;  2WDU A;  3QR6 A;  2C0D A;  4NMU A;  2C0E A;  5C04 A;  2H71 A;  2VL2 A;  1BG1 A;  5G5F A;  5EL8 A;  4OD7 A;  3L9V A;  1HNA A;  2VCW A;  3CXG A;  5A5H B;  3S9F A;  3VLN A;  3GSS A;  3UAR A;  4EE0 A;  1NW2 A;  2YN1 A;  3TDG A;  4GSN A;  5FHI A;  11GS A;  4RQR A;  4K1F A;  3GIX A;  3IHG A;  1EGO A;  4CY8 A;  2HRK B;  5JWR B;  4DSS B;  4POK A;  3MNG A;  3CRU A;  2QC7 A;  2X8H A;  1TU8 A;  2WB9 A;  4Z2R A;  1URM A;  2DIZ A;  2KLX A;  1Z6M A;  4BA7 A;  3UBK A;  3TJB A;  8GSS A;  1A24 A;  5D73 A;  2CQ9 A;  1F3A A;  2O8V B;  3F0I A;  4E68 A;  5HFG A;  5ECO B;  3DML A;  2CAQ A;  1GNW A;  3NZN A;  1Z7R A;  4ZB6 A;  2XC2 A;  3VPT A;  4V1A g;  5H5R A;  5JWQ B;  3D0Z A;  2GT6 A;  1WP0 A;  2V2G A;  1QFN A;  1VF3 A;  4ULX A;  2LEG A;  2HSY A;  4GXZ A;  1Y6E A;  4X4J A;  5GAN D;  2LJR A;  1C72 A;  3FZ5 A;  5GST A;  2RLI A;  2QGV A;  1GSU A;  1ILO A;  1TTZ A;  3HJP A;  5CRD A;  4LMV A;  1BED A;  1NHY A;  4FXY P;  4XIH A;  3WT1 A;  2C3Q A;  1LU4 A;  9GSS A;  1OC9 A;  5AIV A;  1M2D A;  5GAP D;  1RQM A;  3TJK A;  5F0G A;  4PXO A;  1B48 A;  1WMJ A;  3G7Y A;  3HVV A;  2AAW A;  5IOX A;  3W8S A;  2UZ8 A;  4F03 A;  3GKK A;  1YJ6 A;  1JHB A;  3EPT A;  5H5S A;  4GF0 A;  3M3M A;  2HSH A;  5ECS A;  2DLX A;  4J2F A;  4ZBA A;  2R5G A;  4FYC A;  3GKX A;  4WR4 A;  4I2U A;  4LL1 B;  1Z9H A;  1OE8 A;  3ZLP A;  5A4V A;  2HE3 A;  4TR3 A;  1Q98 A;  1PKW A;  1H4O A;  2B5X A;  2FWE A;  3LYK A;  5A4W A;  3A2W A;  1YEW C;  1BJX A;  5EVO A;  3CSH A;  2X49 A;  2XPD A;  3US3 A;  1HYU A;  5D93 A;  2C3T A;  1EGR A;  1M9A A;  2I3Y A;  3F9U A;  4TXO A;  2C0F A;  4AKH A;  5EPF A;  2DIY A;  3IHQ A;  3GFK A;  4EIQ A;  1T4Y A;  2IIY A;  2H6Z A;  1QGV A;  2ALB A;  1UC7 A;  2WW3 A;  4IVF A;  1BQ7 A;  1W89 A;  1A2M A;  1F9M A;  5JWO B;  1S4B P;  5IMZ A;  3UBL A;  3F6F A;  4Z2U A;  3IOS A;  3MDK A;  1XOB A;  3DRN A;  1ZGN A;  5J47 A;  5D9W A;  2MBT A;  3E3E A;  5G5E A;  2IJY A;  2XBQ A;  3TB2 A;  1TK8 B;  2E2M A;  1CQG A;  1AW9 A;  3GL5 A;  3ZIV A;  5AGY A;  1DBY A;  4GTU A;  4AF2 A;  4MNN A;  1E2Y A;  2J23 A;  2QKE A;  1TOF A;  1FVJ A;  2H70 A;  1TKD B;  4V2L A;  2R37 A;  2HNL A;  2OJL A;  2WUL A;  5KOX A;  3GTU A;  3BBY A;  3H79 A;  3H8Q A;  3BCK A;  4KA0 A;  2K9F A;  5JCU A;  2FHE A;  3PH9 A;  3ZVJ D;  4QL9 A;  3HVS A;  4PX1 A;  2P31 A;  1WWJ A;  4K9Z A;  2YV7 A;  1FG4 A;  3I6A A;  4V2N A;  5A5H A;  2L6D A;  5LNK e;  1S3D A;  4PHZ C;  3M9J A;  1GTI A;  1BF5 A;  3HMJ G;  3F3R A;  4K2D A;  1QK8 A;  3UEM A;  4KF9 A;  1PQN A;  4L0U A;  3ERF A;  2YP6 A;  2HSM A;  2PPT A;  2B3S A;  2P0G A;  2O87 A;  3APS A;  16GS A;  1M2B A;  2CA8 A;  4DSS A;  4FQU A;  1WJK A;  4K6X A;  4WXT A;  4Q5Q A;  3GX8 A;  2JU5 A;  1N25 A;  1LBK A;  1V40 A;  1TDI A;  3WT2 A;  4GDF A;  2DC5 A;  4ICY A;  1TW9 A;  2O5V A;  3GKM A;  2R4V A;  5JCW A;  3A5I A;  6GSV A;  1GSF A;  5D9V A;  3HJO A;  2EIQ A;  2V6O A;  2DJ3 A;  6GSS A;  2HRN A;  3FY7 A;  4GQF A;  4PI2 C;  4IBP A;  2H0G A;  4D73 A;  2FNO A;  5ECN B;  3FZA A;  4F2I A;  4POM A;  1EOG A;  3RHB A;  3O3T A;  2DMM A;  1YY7 A;  4Q5N A;  2VL9 A;  2YWO A;  5G30 A;  1XFL A;  4IN0 A;  4KAE A;  2H73 A;  4PI0 C;  2B5Y A;  4CW9 A;  4GSS A;  2VOC A;  4O32 A;  1U6T A;  2GQL A;  1GUH A;  2IMK A;  4L0W A;  2VCV A;  1QXH A;  5D8I A;  3DWV A;  1SVM A;  3QPM A;  2WS2 A;  1JZW A;  4LMW A;  4FYU A;  4XCS A;  4WKW A;  1X9S B;  3HHV A;  1YEP A;  3LYP A;  5ECP B;  1XCC A;  1X5C A;  4AJ6 A;  4FYB A;  18GS A;  3EE2 A;  1M99 A;  2P5R A;  2IMF A;  2F9S A;  4F0B A;  1OC9 B;  4EL1 A;  4HZ4 A;  3TOT A;  2WVY A;  2L6C A;  2V32 A;  1ON4 A;  4G0K A;  2H75 A;  2AHE A;  4K7N A;  4GWR A;  4CY6 A;  2CT6 A;  5G1K A;  4N3Z A;  5G1L A;  2LV3 A;  1J0F A;  1FAA A;  2ZUP A;  1O73 A;  5CRE A;  1TK0 B;  1EV9 A;  2H19 A;  4ZBD A;  1G6Y A;  4IS0 A;  1GRX A;  4ZB9 A;  1CQH A;  3KH9 A;  4HQZ A;  5DDL A;  5DJL A;  5B6M A;  1U3I A;  3WGE A;  3Q6O A;  4WF5 A;  2YJ7 A;  2P5Q A;  1EP8 A;  3GRX A;  4HQS A;  3TJJ A;  2HRA A;  14GS A;  2GTU A;  4ILF A;  4XHM A;  2X99 A;  3GYK A;  4V2M A;  2TRX A;  3D4T A;  5HR1 A;  3HKR A;  2YZU A;  5C00 A;  4ZB7 A;  5IMD A;  4E8E A;  4QMK A;  4HUA A;  1XW9 A;  3LSZ A;  1XVW A;  1B9X C;  3QAG A;  5DBQ A;  3OR5 A;  1KEB A;  3IK9 A;  4TXO B;  4JZQ A;  4TKY A;  2H72 A;  3BCI A;  6GST A;  1ZYP A;  2RUF A;  5CRW A;  1FOH A;  2A2R A;  1WPI A;  1B4Q A;  4KE3 A;  2QSI A;  2H0H A;  1XIY A;  3BJ5 A;  2YPM A;  2YJH A;  3IA1 A;  4POB A;  2PN8 A;  4HJM A;  4IJI A;  4TXV A;  3Q19 A;  5IQY A;  5IM9 A;  1B4P A;  4K5S A;  1MDI A;  3CQF A;  3F6D A;  3D21 A;  3CHX C;  3TKP A;  2LRC A;  3ED3 A;  1VGL A;  4PNG A;  1PA3 A;  3HA9 A;  1SVO A;  2L4Q A;  4I8B A;  2DKH A;  1EP7 A;  2MMO A;  2E2G A;  1FVK A;  3TKQ A;  3VFI A;  5B8A A;  2AB6 A;  1JZD A;  4WF4 A;  2CVB A;  3UJ1 A;  2NBS A;  5DQS A;  2F8F A;  4MH3 A;  5CO3 A;  5B6N A;  4L8E A;  3W6G A;  1W4V A;  1XWK A;  3GTU B;  1YKA A;  4TR1 A;  3ZMK A;  2A4H A;  4AKG A;  2I81 A;  2CAI A;  1T3B A;  3L9U A;  3FKF A;  2KP2 A;  4F82 A;  5F06 A;  4FO5 A;  3C7M A;  3F4T A;  3WGD A;  4KCA A;  2A2S A;  3HCZ A;  5KN2 A;  1BAY A;  5INY A;  3F4R A;  4AJ7 A;  4WET A;  3ZTL A;  2GS3 A;  4IP1 A;  4OFN A;  2OKA A;  4RI7 A;  2VIM A;  2YAN A;  3EMX A;  4YKG A;  4Q5R A;  2HSM B;  2PER A;  2F51 A;  4MZC A;  3LQ7 A;  4G19 A;  1VF1 A;  1TJD A;  1SJ6 A;  2GSS A;  4O7H A;  2WW0 A;  2E0Q A;  2JSZ A;  2JAC A;  3VWU A;  3CMI A;  2FCH A;  2NPB A;  4WBJ A;  2H1G A;  5F8B A;  2WFC A;  4XRA A;  3VUR A;  2HZE A;  2GZY A;  4ML6 A;  2DSA A;  3KP8 A;  2A4V A;  4HS1 A;  3M1G A;  4K0N A;  4D73 B;  2JZT A;  1K0C A;  2VO4 A;  2FA4 A;  3QCP A;  4NWY A;  3M9K A;  4IHU A;  2IMI A;  2H30 A;  4TR4 A;  3VI5 A;  2PVO C;  5F07 A;  2LQQ A;  1F2E A;  5KN1 A;  4MJB A;  1OC3 A;  2LRT A;  1A2L A;  2H66 A;  2OAC A;  3FRC A;  1E6B A;  1PN0 A;  1GSD A;  4IKH A;  1GLP A;  3LJR A;  4KUN A;  1PL1 A;  3R3E A;  2GSQ A;  3TRQ A;  3GHA A;  1ZL9 A;  3LEF A;  1K3Y A;  1YVL A;  3U5R E;  3VWW A;  3FW2 A;  4XRD A;  1JZO A;  4G10 A;  4ACS A;  2WVZ A;  12GS A;  3LWA A;  1YEX A;  1HNC A;  2F3M A;  3KM6 A;  3HVN A;  3RHC A;  2VL2 C;  2DJK A;  2WZ9 A;  1VF2 A;  3WGX A;  4PQI A;  4LLR A;  4G01 A;  4X0X A;  3KEB A;  4KND A;  2EFH A;  2JL4 A;  2VLU A;  3TJF A;  1SVL A;  4TVE A;  4NHW A;  3KIJ A;  4BPY A;  4O5Q A;  2Z9S A;  4ZL8 A;  1XWG A;  2VCX A;  1H75 A;  2L57 A;  1YKC A;  1FHE A;  4WEY A;  3CRT A;  5DAL A;  1AXD A;  3F3Q A;  2B1L A;  3MWH A;  2H6Y A;  4OFT A;  2HFD A;  2OE1 A;  2X8G A;  4NV5 A;  2L5O A;  3QDN A;  3SWL A;  4RQX A;  1TXX A;  5FT3 A;  3FYG A;  3P90 A;  2VLT A;  3HVX A;  3TKS A;  1V58 A;  5IMC A;  3TGZ A;  1SU9 A;  3KP9 A;  1SYX A;  5CRH A;  2F8A A;  1Z7P A;  1K0B A;  2HLS A;  1NHO A;  3G7J A;  3ME7 A;  3FR6 A;  5KN3 A;  4EVM A;  1KBN A;  1AQV A;  1ACV A;  2HQT A;  1GP1 A;  3VI7 A;  4GLT A;  4O92 A;  2MBS A;  1OYJ A;  4BL7 A;  3UMA A;  2E7P A;  2DKI A;  4ID0 A;  4MJE A;  4XS4 A;  3UIW A;  3GH6 A;  1GTB A;  3RFR C;  2WCI A;  7GSS A;  4AI6 A;  2CV4 A;  3RGB C;  1ZOF A;  5HQP A;  2H0I A;  2IPA A;  4KDX A;  5GSS A;  17GS A;  2FWG A;  3TKS E;  5J3R A;  2LRN A;  1ST9 A;  3VWV A;  3QD9 A;  2OT3 A;  2H8L A;  3LG6 A;  4KSM A;  2G0F A;  1R7H A;  2GT5 A;  4FH8 A;  5HR3 A;  1EOH A;  4EF0 A;  5LD0 A;  3FR9 A;  3QFA C;  2H76 A;  2VKZ G;  1OKT A;  1DE2 A;  2GQK A;  3A5W A;  4JRR A;  4BWQ A;  2UV8 G; 
#chains in the Genus database with same CATH homology
 6GSY A;  5CNW A;  2PU9 C;  1A8L A;  3Q74 A;  4I5Q A;  3I69 A;  5ENU A;  1K0M A;  5A34 B;  5G2Z A;  3UAP A;  2GSR A;  3UVT A;  4TR1 B;  3C8E A;  1PX7 A;  3M0F A;  1PMT A;  4KDY A;  4EIP A;  3L0H A;  1ERT A;  1G7O A;  2REM A;  4I97 A;  1TRU A;  5IO0 A;  3U6V A;  2HSN A;  2IL3 A;  3BD2 A;  2B1K A;  1SK1 A;  2VD1 A;  2CX4 A;  3EYT A;  2N5B A;  2OBI A;  3GL3 A;  4YQV A;  1SL0 B;  4TR0 A;  2H74 A;  2LJA A;  5IIZ A;  1I5G A;  4JE1 A;  2H1L A;  2MZC A;  2I1U A;  4HDE A;  1GWC A;  4JU5 A;  4MF6 A;  1FB6 A;  3NIV A;  3J7Y b;  1K0N A;  5BRT A;  3F4S A;  3PR8 A;  3ZRD A;  2LNT A;  1Q4J A;  2CVK A;  2JSY A;  4JR6 A;  2GST A;  1BYE A;  2V1M A;  3W8J A;  4HU9 A;  5CYY A;  1M7T A;  5EY6 A;  2GDR A;  2C80 A;  3TRP A;  3IE3 A;  1SL2 B;  3FZ9 A;  1XWB A;  2HZE B;  2R0C A;  4XS6 A;  1AQX A;  10GS A;  1Z6N A;  2BTO T;  3PIN A;  5ID2 A;  2YV9 A;  1X9W B;  1V57 A;  5A1N A;  2VCZ A;  3WD6 A;  2GQM A;  3D22 A;  5ECH B;  3E9J B;  4BWS A;  3IXR A;  2CZ2 A;  2H6X A;  3ERG A;  5DCH A;  2K18 A;  2AUV A;  4GRF A;  1SKS B;  2DML A;  2B7J A;  2ON7 A;  3IC8 A;  4BVY A;  1ZCP A;  5ECI B;  1F3B A;  1A2J A;  2C4J A;  3HYP A;  1BX9 A;  3APQ A;  2FWH A;  1T4Z A;  4PUR A;  2VD0 A;  4ECJ A;  1PX6 A;  4OO5 A;  1K3O A;  4HOJ A;  2ON5 A;  3CBU A;  5AN1 A;  1WRY A;  3GKN A;  4PTS A;  2LJK A;  4NPB A;  1GSE A;  4ISD A;  1VF4 A;  1MDK A;  5D96 A;  5IPG A;  4LA1 A;  1J08 A;  1QMV A;  3GST A;  4P3Y B;  3P8W A;  2LNS A;  1HNB A;  3EIN A;  3KGK A;  4L5L A;  4ZB8 A;  4ECI A;  3R2Q A;  2WRT A;  1B9Y C;  3LW9 A;  4ZL7 A;  4OFM A;  1THO A;  4CHS A;  4PNF A;  1ZYQ B;  3IC4 A;  1T7P B;  2IFQ A;  3F63 A;  5F05 A;  1XPV A;  5DVB A;  1WOU A;  1B8X A;  2IN3 A;  3TOU A;  4I2T A;  3CWG A;  5DAL B;  1RK4 A;  4RUV A;  2WJU A;  3TUE A;  1XWC A;  4EKZ A;  2AYT A;  1RW1 A;  4O5R A;  1GTA A;  4KSO A;  5COH A;  1PSQ A;  1PD2 1;  4AKX B;  2H01 A;  3ISO A;  2FLS A;  3VWX A;  2NVL A;  1GH2 A;  3JCM L;  4MA9 A;  4K2X A;  2N5A A;  2CZ3 A;  4NV2 A;  1YQ1 A;  1KNG A;  2C3N A;  4EXJ A;  4XS1 A;  4N30 A;  4G0L A;  3TCO A;  3EU4 A;  2OAD A;  3ZML A;  4PUA A;  4MK3 A;  4LL4 B;  2OBK A;  2RUE A;  1R5P A;  2FA8 A;  2GVP A;  3H4K A;  1M0U A;  2MMN A;  6GSX A;  2YOI A;  5CAX A;  2EIO A;  1SYR A;  1PGT A;  2QA2 A;  4AKI A;  1WE0 A;  1AAZ A;  3G7I A;  4JED A;  4BL7 B;  2GZZ A;  1TRV A;  2LST A;  3UVH A;  4IGJ A;  4O5U A;  3SBC A;  3APO A;  3MSZ A;  1JFU A;  4XS4 B;  4EDZ A;  1TRW A;  1EV4 A;  4MH2 A;  1R4W A;  5A5K A;  4V1A p;  2C1Y A;  2KOK A;  1A0F A;  2FY6 A;  5ECK B;  1SK2 A;  2IMD A;  2I9H A;  1BG5 A;  3C1S A;  3LXT A;  4KH7 A;  2LUS A;  1N2A A;  3ZIJ A;  4TN8 A;  5ECL B;  4Q5F A;  1AIU A;  4W66 A;  1SJZ A;  5B8B A;  1GSY A;  1K0D A;  2CX3 A;  2NDO A;  4NHZ A;  5A34 A;  4YAV A;  19GS A;  3KXO A;  5GZZ B;  2OA7 A;  2R3X A;  2PMT A;  3N9J A;  3QAW A;  4K7O A;  1FW1 A;  3HY2 A;  2OE0 A;  1FO5 A;  2QA1 A;  4ECC A;  1A8Y A;  4RI6 A;  20GS A;  3EWL A;  4MZB A;  3L4N A;  2EIR A;  5E59 A;  2AV4 A;  3GUR A;  3O76 A;  3QOU A;  2B6M A;  3D4M A;  5IMV A;  2KHP A;  3GV1 A;  1EWX A;  3MAK A;  5KOW A;  2TRC P;  1TP9 A;  1FOV A;  1GTU A;  4KX4 A;  3FEU A;  2R0G A;  2HSN B;  3EU3 A;  1F37 A;  4MDC A;  2LQO A;  1PN9 A;  3CYN A;  4OMV A;  4OWY A;  4E8H A;  1M2A A;  1V2A A;  3IAS 2;  5IO2 A;  4K0G A;  1N8J A;  4YKF A;  3AY8 A;  4JR4 A;  2FUG 2;  4CDO A;  5HFK A;  1X5E A;  1UA5 A;  3L78 A;  1YDK A;  1DUG A;  1JLW A;  4MJC A;  2C8U A;  5J9C A;  3FK8 A;  3I43 A;  2RII A;  1NSW A;  3DXB A;  1OE7 A;  3KMN A;  1EEM A;  3IAM 2;  3IV4 A;  4POL A;  3IK7 A;  3A2V A;  4HZ2 A;  4Z2T A;  2DJ2 A;  6GSU A;  3PGT A;  5HFI A;  3CSJ A;  5ID2 B;  2XBI A;  2YNX A;  3EMP A;  4F9Z A;  5J41 A;  5A1N B;  1G7E A;  4IP6 A;  5J4V A;  3FR3 A;  4IEL A;  3P2A A;  4Z7X A;  2ZNM A;  2N5F A;  2JZS A;  1TXU A;  1PRX A;  2MMA A;  4N10 A;  1SEN A;  4MPG A;  2AJQ B;  4BVY B;  2G2Q A;  4TOP A;  1GNE A;  2MYG A;  1HD2 A;  1QQ2 A;  2DBC A;  1GUM A;  2K8V A;  2LTK A;  5J4U A;  2GGT A;  4DVC A;  1TK5 B;  3D5J A;  3ME8 A;  1T8E B;  2ES7 A;  5FWG A;  5BMU B;  1ERW A;  4HJ2 A;  1O81 A;  2HI7 A;  3TU3 B;  1YF0 A;  4N0V A;  2JZR A;  3TJG A;  1X0R A;  3DVW A;  2K8S A;  3TKR A;  4IW9 A;  2B7K A;  1TI3 A;  1O85 A;  2IFQ B;  5IPH A;  1T00 A;  1R26 A;  4FIW A;  2HXK A;  3HXS A;  1VRS D;  3KTB A;  3ZRE A;  4USS A;  2O89 A;  4NXI A;  4OCE A;  4TRX A;  4HU7 A;  1AQW A;  1I9D A;  1ZYE A;  2FGX A;  2YWN A;  3QFB C;  4MAB A;  4OCF A;  3GNJ A;  1S3C A;  3H1N A;  1QUW A;  4YAP A;  5ABR A;  2KP1 A;  3DVX A;  2YWM A;  4IQA A;  3HZ8 A;  4WR5 A;  3KD0 A;  2PGT A;  3EUR A;  1USB A;  4G9H A;  1TI1 A;  4KCE A;  3IBH A;  2RM5 A;  4ZBB A;  1OAZ A;  2HRF A;  3VK9 A;  2KUC A;  1XVQ A;  1XXU A;  1Y25 A;  5D9T A;  1SL1 B;  1GUK A;  3DGQ A;  4ECB A;  3CSI A;  2H1A A;  1MEK A;  3FZ4 A;  1YF1 A;  2L59 A;  3C71 A;  2HT9 A;  1M9B A;  4EC0 A;  4QQ7 A;  5ECM B;  2HYX A;  1F6M C;  1XWA A;  4YQM A;  1AUC A;  2OE3 A;  4G2E A;  13GS A;  2LS5 A;  4XTS A;  5DAK B;  2VCQ A;  3NOF A;  1GLQ A;  3TRX A;  4MZW A;  1V98 A;  3N5O A;  3KH7 A;  3ZL5 A;  2EC4 A;  1J9B A;  4NAX A;  5D9X A;  2BMX A;  3RPN A;  4HI7 A;  4BVX A;  3BOA A;  2C0G A;  1K3L A;  2FWF A;  1R5A A;  4X43 A;  5J5N A;  1S3A A;  4L5O A;  2PVQ A;  3IPZ A;  1EZK A;  3ZIT A;  3QMX A;  2YZH A;  4F0C A;  5HR2 A;  1GL8 A;  4MMM A;  2B5E A;  2X8C A;  2O85 A;  2O7K A;  2FD3 A;  3GN3 A;  4EDY A;  2XHF A;  4KGI A;  3F8U A;  4IJ3 A;  1Y1U A;  2GZP A;  3UL3 A;  2CVD A;  4EO3 A;  5ECR B;  3LGC A;  3RAZ A;  5ELG A;  5E4W A;  1ABA A;  4MF5 A;  3TKS C;  2GLR A;  5IMA A;  3K8N A;  4MF7 A;  3DYR A;  4JBB A;  4KB3 A;  3MIX A;  5CP1 A;  3Q18 A;  2EFE A;  1XBS A;  2TIR A;  3QAV A;  4MLY A;  4WBR D;  1PKZ A;  3RPP A;  3KJY A;  4J57 E;  2K6V A;  1A0R P;  4PQ1 A;  2HRK A;  2D2Z A;  3GH9 A;  1OVN A;  3HDC A;  2H1D A;  4MJA A;  1WIK A;  1XOA A;  1NM3 A;  1IYI A;  5JCG A;  1ML6 A;  3V1W A;  1SD8 A;  3DIE A;  1SKR B;  2R0P A;  1EEJ A;  1IYH A;  4N0Z A;  2VCT A;  1X9M B;  3CTF A;  5LCZ A;  1X5D A;  1T1V A;  1A23 A;  4N11 A;  4ZIL A;  3EC3 A;  2DJJ A;  3GUS A;  3ZVJ A;  4I6X A;  4ZL9 A;  1GSQ A;  2VAF A;  3HD5 A;  2L4C A;  2A2P A;  2IME A;  5L71 A;  2R6K A;  1SJI A;  2L5L A;  1XZO A;  3KZQ A;  3GMF A;  3J7Y k;  2VUP A;  4K5R A;  1YZX A;  3P7X A;  3DEX A;  3G9B A;  3GA4 A;  3ZZX A;  3FMW A;  1JLV A;  2R2J A;  3H93 A;  2EFC A;  3CTG A;  2M80 A;  5KEJ A;  4ML1 A;  5B7C A;  3DKS A;  1DSB A;  4KDU A;  3WYW A;  1U3A A;  5KN0 A;  2X4A A;  1V9W A;  5J9B A;  4MP4 A;  1KTE A;  3ZFB A;  2ZCT A;  1G6W A;  1O8X A;  4PUF C;  3KCM A;  4H86 A;  4EUY A;  2V6K A;  5BMU A;  1SD9 A;  4DEJ A;  4GQC A;  6GSW A;  1ERV A;  4K8M A;  3IRA A;  4QL7 A;  3LOR A;  3C1R A;  1MD3 A;  3D6I A;  2BJX A;  1XW5 A;  2WGR A;  22GS A;  3RBT A;  2M46 A;  2MMZ A;  2XPE A;  2PWJ A;  5IMF A;  2M72 A;  3FHK A;  1G0T A;  2YCD A;  1PL2 A;  3IR4 A;  3KMO A;  4J56 E;  1DE1 A;  5G31 A;  1GUL A;  1JZR A;  4ZIJ A;  5J40 A;  4KW6 A;  4DSQ A;  2LKU A;  3PPU A;  5J4Y A;  1UN2 A;  4OO4 A;  2EFD A;  3DD3 A;  4IQ1 A;  1K0O A;  4YH2 A;  2IWT A;  5CRG A;  1U88 A;  1ZZY A;  4ZXG A;  3A3T A;  2YWI A;  1K0A A;  2X64 A;  2RM6 A;  4YQU A;  3GX0 A;  2PUK C;  1Z3E A;  3IDV A;  2DJ1 A;  3C73 A;  1HQO A;  1MD4 A;  4TW5 A;  5ELA A;  4A5P A;  5HR0 A;  1ZYN A;  4K7I A;  3HJM A;  3ERW A;  3ZYW A;  5IOW A;  5DAK A;  2PBJ A;  5A4U A;  1XW6 A;  2HZF A;  2VM2 A;  2VLV A;  4AJ8 A;  1ZMA A;  3MYD A;  5AIS A;  4PQH A;  1THX A;  3A2X A;  2JAD A;  1O8W A;  4X1U A;  3LFL A;  3L9S A;  2I4A A;  5AIX A;  5DJM A;  1FB0 A;  2J9H A;  1O6J A;  1U87 A;  2DJ0 A;  4G0I A;  4DSR A;  1MTC A;  2VL3 A;  2VM1 A;  3HZ4 A;  3E0U A;  1UVZ A;  1SKW B;  3EVI A;  4GCI A;  4BVX B;  5ECQ B;  4MCU A;  1GSS A;  1LJR A;  3RDW A;  5DCG A;  3ZFL A;  3I9V 2;  4AGS A;  3M8N A;  3VPQ A;  5H5Q A;  4MPF A;  2V41 A;  2H1B A;  1TU7 A;  4PGT A;  4GST A;  5DQY A;  3LXZ A;  4HEA 2;  1MDJ A;  1ERU A;  1O7U A;  1OKD A;  1SK0 A;  1TRS A;  1Z5Y E;  1AC1 A;  3KTL A;  3O6T A;  2NTO A;  3UOM A;  1OC8 A;  2WDU A;  3QR6 A;  2C0D A;  4NMU A;  2C0E A;  5C04 A;  2H71 A;  2VL2 A;  1BG1 A;  5G5F A;  5EL8 A;  4OD7 A;  3L9V A;  1HNA A;  2VCW A;  3CXG A;  5A5H B;  3S9F A;  3VLN A;  3GSS A;  3UAR A;  4EE0 A;  1NW2 A;  2YN1 A;  3TDG A;  4GSN A;  5FHI A;  11GS A;  4RQR A;  4K1F A;  3GIX A;  3IHG A;  1EGO A;  4CY8 A;  2HRK B;  5JWR B;  4DSS B;  4POK A;  3MNG A;  3CRU A;  2QC7 A;  2X8H A;  1TU8 A;  2WB9 A;  4Z2R A;  1URM A;  2DIZ A;  2KLX A;  1Z6M A;  4BA7 A;  3UBK A;  3TJB A;  8GSS A;  1A24 A;  5D73 A;  2CQ9 A;  1F3A A;  2O8V B;  3F0I A;  4E68 A;  5HFG A;  5ECO B;  3DML A;  2CAQ A;  1GNW A;  3NZN A;  1Z7R A;  4ZB6 A;  2XC2 A;  3VPT A;  4V1A g;  5H5R A;  5JWQ B;  3D0Z A;  2GT6 A;  1WP0 A;  2V2G A;  1QFN A;  1VF3 A;  4ULX A;  2LEG A;  2HSY A;  4GXZ A;  1Y6E A;  4X4J A;  5GAN D;  2LJR A;  1C72 A;  3FZ5 A;  5GST A;  2RLI A;  2QGV A;  1GSU A;  1ILO A;  1TTZ A;  3HJP A;  5CRD A;  4LMV A;  1BED A;  1NHY A;  4XIH A;  3WT1 A;  2C3Q A;  1LU4 A;  9GSS A;  1OC9 A;  5AIV A;  1M2D A;  5GAP D;  1RQM A;  3TJK A;  5F0G A;  4PXO A;  1B48 A;  1WMJ A;  3G7Y A;  3HVV A;  2AAW A;  5IOX A;  3W8S A;  2UZ8 A;  4F03 A;  3GKK A;  1YJ6 A;  1JHB A;  3EPT A;  5H5S A;  4GF0 A;  3M3M A;  2HSH A;  5ECS A;  2DLX A;  4J2F A;  4ZBA A;  2R5G A;  4FYC A;  3GKX A;  4WR4 A;  4I2U A;  4LL1 B;  1Z9H A;  1OE8 A;  3ZLP A;  5A4V A;  2HE3 A;  4TR3 A;  1Q98 A;  1PKW A;  1H4O A;  2B5X A;  2FWE A;  3LYK A;  5A4W A;  3A2W A;  1BJX A;  5EVO A;  3CSH A;  2X49 A;  2XPD A;  3US3 A;  1HYU A;  5D93 A;  2C3T A;  1EGR A;  1M9A A;  2I3Y A;  3F9U A;  4TXO A;  2C0F A;  4AKH A;  5EPF A;  2DIY A;  3IHQ A;  3GFK A;  4EIQ A;  1T4Y A;  2IIY A;  2H6Z A;  1QGV A;  2ALB A;  1UC7 A;  4IVF A;  1BQ7 A;  1W89 A;  1A2M A;  1F9M A;  5JWO B;  5IMZ A;  3UBL A;  3F6F A;  4Z2U A;  3IOS A;  3MDK A;  1XOB A;  3DRN A;  1ZGN A;  5J47 A;  5D9W A;  2MBT A;  3E3E A;  5G5E A;  2IJY A;  2XBQ A;  3TB2 A;  1TK8 B;  2E2M A;  1CQG A;  1AW9 A;  3GL5 A;  3ZIV A;  5AGY A;  1DBY A;  4GTU A;  4AF2 A;  4MNN A;  1E2Y A;  2J23 A;  2QKE A;  1TOF A;  1FVJ A;  2H70 A;  1TKD B;  4V2L A;  2R37 A;  2HNL A;  2OJL A;  2WUL A;  5KOX A;  3GTU A;  3BBY A;  3H79 A;  3H8Q A;  3BCK A;  4KA0 A;  2K9F A;  5JCU A;  2FHE A;  3PH9 A;  3ZVJ D;  4QL9 A;  3HVS A;  4PX1 A;  2P31 A;  1WWJ A;  4K9Z A;  2YV7 A;  1FG4 A;  3I6A A;  4V2N A;  5A5H A;  2L6D A;  5LNK e;  1S3D A;  3M9J A;  1GTI A;  1BF5 A;  3HMJ G;  3F3R A;  4K2D A;  1QK8 A;  3UEM A;  4KF9 A;  1PQN A;  4L0U A;  3ERF A;  2YP6 A;  2HSM A;  2PPT A;  2B3S A;  2P0G A;  2O87 A;  3APS A;  16GS A;  1M2B A;  2CA8 A;  4DSS A;  4FQU A;  1WJK A;  4K6X A;  4WXT A;  4Q5Q A;  3GX8 A;  2JU5 A;  1N25 A;  1LBK A;  1V40 A;  1TDI A;  3WT2 A;  4GDF A;  2DC5 A;  4ICY A;  1TW9 A;  2O5V A;  3GKM A;  2R4V A;  5JCW A;  3A5I A;  6GSV A;  1GSF A;  5D9V A;  3HJO A;  2EIQ A;  2V6O A;  2DJ3 A;  6GSS A;  2HRN A;  3FY7 A;  4GQF A;  4IBP A;  2H0G A;  4D73 A;  2FNO A;  5ECN B;  3FZA A;  4F2I A;  4POM A;  1EOG A;  3RHB A;  3O3T A;  2DMM A;  1YY7 A;  4Q5N A;  2VL9 A;  2YWO A;  5G30 A;  1XFL A;  4IN0 A;  4KAE A;  2H73 A;  2B5Y A;  4CW9 A;  4GSS A;  2VOC A;  4O32 A;  1U6T A;  2GQL A;  1GUH A;  2IMK A;  4L0W A;  2VCV A;  1QXH A;  5D8I A;  3DWV A;  1SVM A;  3QPM A;  2WS2 A;  1JZW A;  4LMW A;  4FYU A;  4XCS A;  4WKW A;  1X9S B;  3HHV A;  1YEP A;  3LYP A;  5ECP B;  1XCC A;  1X5C A;  4AJ6 A;  4FYB A;  18GS A;  3EE2 A;  1M99 A;  2P5R A;  2IMF A;  2F9S A;  4F0B A;  1OC9 B;  4EL1 A;  4HZ4 A;  3TOT A;  2L6C A;  2V32 A;  1ON4 A;  4G0K A;  2H75 A;  2AHE A;  4K7N A;  4GWR A;  4CY6 A;  2CT6 A;  5G1K A;  4N3Z A;  5G1L A;  2LV3 A;  1J0F A;  1FAA A;  2ZUP A;  1O73 A;  5CRE A;  1TK0 B;  1EV9 A;  2H19 A;  4ZBD A;  1G6Y A;  4IS0 A;  1GRX A;  4ZB9 A;  1CQH A;  3KH9 A;  4HQZ A;  5DDL A;  5DJL A;  5B6M A;  1U3I A;  3WGE A;  3Q6O A;  4WF5 A;  2YJ7 A;  2P5Q A;  1EP8 A;  3GRX A;  4HQS A;  3TJJ A;  2HRA A;  14GS A;  2GTU A;  4ILF A;  4XHM A;  2X99 A;  3GYK A;  4V2M A;  2TRX A;  3D4T A;  5HR1 A;  3HKR A;  2YZU A;  5C00 A;  4ZB7 A;  5IMD A;  4E8E A;  4QMK A;  4HUA A;  1XW9 A;  3LSZ A;  1XVW A;  1B9X C;  3QAG A;  5DBQ A;  3OR5 A;  1KEB A;  3IK9 A;  4TXO B;  4JZQ A;  4TKY A;  2H72 A;  3BCI A;  6GST A;  1ZYP A;  2RUF A;  5CRW A;  1FOH A;  2A2R A;  1WPI A;  1B4Q A;  4KE3 A;  2QSI A;  2H0H A;  1XIY A;  3BJ5 A;  2YPM A;  2YJH A;  3IA1 A;  4POB A;  2PN8 A;  4HJM A;  4IJI A;  4TXV A;  3Q19 A;  5IQY A;  5IM9 A;  1B4P A;  4K5S A;  1MDI A;  3F6D A;  3D21 A;  3TKP A;  2LRC A;  3ED3 A;  1VGL A;  4PNG A;  1PA3 A;  3HA9 A;  1SVO A;  2L4Q A;  4I8B A;  2DKH A;  1EP7 A;  2MMO A;  2E2G A;  1FVK A;  3TKQ A;  3VFI A;  5B8A A;  2AB6 A;  1JZD A;  4WF4 A;  2CVB A;  3UJ1 A;  2NBS A;  5DQS A;  2F8F A;  4MH3 A;  5CO3 A;  5B6N A;  4L8E A;  3W6G A;  1W4V A;  1XWK A;  3GTU B;  1YKA A;  4TR1 A;  3ZMK A;  2A4H A;  4AKG A;  2I81 A;  2CAI A;  1T3B A;  3L9U A;  3FKF A;  2KP2 A;  4F82 A;  5F06 A;  4FO5 A;  3C7M A;  3F4T A;  3WGD A;  4KCA A;  2A2S A;  3HCZ A;  5KN2 A;  1BAY A;  5INY A;  3F4R A;  4AJ7 A;  4WET A;  3ZTL A;  2GS3 A;  4IP1 A;  4OFN A;  2OKA A;  4RI7 A;  2VIM A;  2YAN A;  3EMX A;  4YKG A;  4Q5R A;  2HSM B;  2PER A;  2F51 A;  4MZC A;  3LQ7 A;  4G19 A;  1VF1 A;  1TJD A;  1SJ6 A;  2GSS A;  4O7H A;  2E0Q A;  2JSZ A;  2JAC A;  3VWU A;  3CMI A;  2FCH A;  2NPB A;  4WBJ A;  2H1G A;  5F8B A;  2WFC A;  4XRA A;  3VUR A;  2HZE A;  2GZY A;  4ML6 A;  2DSA A;  3KP8 A;  2A4V A;  4HS1 A;  3M1G A;  4K0N A;  4D73 B;  2JZT A;  1K0C A;  2VO4 A;  2FA4 A;  3QCP A;  4NWY A;  3M9K A;  4IHU A;  2IMI A;  2H30 A;  4TR4 A;  3VI5 A;  2PVO C;  5F07 A;  2LQQ A;  1F2E A;  5KN1 A;  4MJB A;  1OC3 A;  2LRT A;  1A2L A;  2H66 A;  2OAC A;  3FRC A;  1E6B A;  1PN0 A;  1GSD A;  4IKH A;  1GLP A;  3LJR A;  4KUN A;  1PL1 A;  3R3E A;  2GSQ A;  3TRQ A;  3GHA A;  1ZL9 A;  3LEF A;  1K3Y A;  1YVL A;  3U5R E;  3VWW A;  3FW2 A;  4XRD A;  1JZO A;  4G10 A;  4ACS A;  12GS A;  3LWA A;  1YEX A;  1HNC A;  2F3M A;  3KM6 A;  3RHC A;  2VL2 C;  2DJK A;  2WZ9 A;  1VF2 A;  3WGX A;  4PQI A;  4LLR A;  4G01 A;  4X0X A;  3KEB A;  4KND A;  2EFH A;  2JL4 A;  2VLU A;  3TJF A;  1SVL A;  4TVE A;  4NHW A;  3KIJ A;  4BPY A;  4O5Q A;  2Z9S A;  4ZL8 A;  1XWG A;  2VCX A;  1H75 A;  2L57 A;  1YKC A;  1FHE A;  4WEY A;  3CRT A;  5DAL A;  1AXD A;  3F3Q A;  2B1L A;  3MWH A;  2H6Y A;  4OFT A;  2HFD A;  2OE1 A;  2X8G A;  4NV5 A;  2L5O A;  3QDN A;  3SWL A;  4RQX A;  1TXX A;  5FT3 A;  3FYG A;  3P90 A;  2VLT A;  3HVX A;  3TKS A;  1V58 A;  5IMC A;  3TGZ A;  1SU9 A;  3KP9 A;  1SYX A;  5CRH A;  2F8A A;  1Z7P A;  1K0B A;  2HLS A;  1NHO A;  3G7J A;  3ME7 A;  3FR6 A;  5KN3 A;  4EVM A;  1KBN A;  1AQV A;  1ACV A;  2HQT A;  1GP1 A;  3VI7 A;  4GLT A;  4O92 A;  2MBS A;  1OYJ A;  4BL7 A;  3UMA A;  2E7P A;  2DKI A;  4ID0 A;  4MJE A;  4XS4 A;  3UIW A;  3GH6 A;  1GTB A;  2WCI A;  7GSS A;  4AI6 A;  2CV4 A;  1ZOF A;  5HQP A;  2H0I A;  2IPA A;  4KDX A;  5GSS A;  17GS A;  2FWG A;  3TKS E;  5J3R A;  2LRN A;  1ST9 A;  3VWV A;  3QD9 A;  2OT3 A;  2H8L A;  3LG6 A;  4KSM A;  2G0F A;  1R7H A;  2GT5 A;  4FH8 A;  5HR3 A;  1EOH A;  4EF0 A;  5LD0 A;  3FR9 A;  3QFA C;  2H76 A;  2VKZ G;  1OKT A;  1DE2 A;  2GQK A;  3A5W A;  4JRR A;  4BWQ A;  2UV8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...