5ECNB

Crystal structure of fin219-fip1 complex with ja, leu and atp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
214
structure length
214
Chain Sequence
LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
molecule keywords Jasmonic acid-amido synthetase JAR1
molecule tags Ligase/transferase
source organism Arabidopsis thaliana
total genus 60
structure length 214
sequence length 214
chains with identical sequence C, E, F
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02798 GST_N Glutathione S-transferase, N-terminal domain
B PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecnB02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecnB01
3CSIA 1JHBA 1YKAA 3WGXA 3FK8A 5J41A 3QPMA 4YAPA 1WOUA 2MBSA 3RHCA 1GSDA 2VAFA 1B48A 1AC1A 4IP6A 2TIRA 3L9UA 2CV4A 1K0NA 1SJZA 4NV2A 4GF0A 2RUEA 1PRXA 3FRCA 3FR9A 1V58A 1EOHA 3MAKA 5D9XA 2DMMA 2HRFA 5DJLA 2B7KA 3IE3A 2HT9A 4Q5FA 3LWAA 2L6DA 1Z6MA 2EIOA 3WGEA 1FB6A 3F8UA 5JWOB 3ZFBA 2G2QA 3ZIVA 4MLYA 2H8LA 1XXUA 2F8FA 2P0GA 4IW9A 4L5LA 3HDCA 3TDGA 5HQPA 1AAZA 1R5PA 3IRAA 2R2JA 2B5YA 2PMTA 3ZVJA 3IC4A 2HRKB 3HJPA 3TJGA 2GZZA 2I81A 3HA9A 3LGCA 4ACSA 3F4TA 2LRTA 4MJAA 1SL0B 2GS3A 4POBA 4KA0A 3VWUA 4EDZA 4AJ8A 4OD7A 5G5EA 2JL4A 1K0OA 2HI7A 1GLPA 3ERFA 1AIUA 4XTSA 3J7Yk 3KTBA 2B7JA 3ED3A 1M99A 1TU8A 4GSNA 2PUKC 1AXDA 3HVVA 3TJKA 2MZCA 1WWJA 4WXTA 2JSYA 4OFMA 1PL1A 2OBIA 1CQGA 2DBCA 3H93A 1KBNA 3E9JB 5C04A 4CHSA 2R5GA 4TR0A 5HR1A 5A4WA 5ELGA 1TI3A 3M1GA 1GNWA 2HRKA 2H66A 3GH6A 3Q19A 5HFGA 4AJ6A 4V1Ap 1M0UA 4ZL7A 1U88A 3RAZA 3QFAC 4XHMA 3FHKA 4POKA 1OKTA 3FZ5A 1K0AA 2C3TA 3KEBA 4MH3A 4OCFA 2NBSA 3ERWA 3DVWA 4PURA 4EXJA 3V1WA 5B7CA 3O76A 2FWEA 4FO5A 1T8EB 3ZRDA 1KTEA 3QDNA 2V41A 4MABA 1B4QA 2EC4A 1RW1A 5IOWA 1FG4A 1DE2A 2I4AA 3HCZA 2N5AA 1EP8A 1O85A 1O6JA 2DJ0A 4MF6A 5J9BA 5JCWA 2KP1A 2EIRA 4BVYB 3IR4A 5ECLB 2CX3A 1LJRA 2GQLA 3TJJA 3KIJA 3CBUA 3TGZA 7GSSA 4GXZA 4KDYA 2IMFA 3ISOA 1MEKA 4MCUA 1BG5A 1OAZA 2DJ1A 1YZXA 4V1Ag 4RUVA 1UC7A 4MJEA 1MD4A 1BEDA 3QAGA 4OWYA 3ERGA 4GTUA 4O32A 2IIYA 1Y6EA 2XHFA 3QAWA 2DMLA 4TR3A 2B3SA 3KXOA 3PR8A 1NSWA 4AGSA 1RK4A 2IWTA 2JU5A 3GSTA 4N10A 2VCWA 5D73A 5CRDA 4DEJA 5DAKB 2VL2A 4K8MA 4KCAA 3LQ7A 1KNGA 1TK5B 1EEMA 1R5AA 3IBHA 1E6BA 18GSA 2LJRA 2NPBA 1MDKA 2BJXA 2PWJA 3F6FA 3ZL5A 5GAPD 4LA1A 4HZ2A 5A4VA 2AYTA 1XOAA 2L59A 4NWYA 1SU9A 3DIEA 3APOA 3UJ1A 1ZOFA 1ERTA 2V2GA 3HZ8A 2H6ZA 1JFUA 20GSA 1XBSA 1MTCA 3TKRA 1FW1A 4HJ2A 4WEYA 2QC7A 4BA7A 1XWCA 4XS4B 2IMKA 1YKCA 3G7IA 5AN1A 4MA9A 2H74A 3MNGA 2IJYA 4GSTA 3WYWA 4EF0A 3HVSA 4NHZA 4PQHA 3C73A 1HNAA 3TKPA 5DAKA 3EWLA 5ECPB 5AIVA 1B4PA 1A2LA 2C80A 4ECJA 1B9XC 3KH7A 1YEPA 5IMDA 4IJIA 2HSYA 3ZITA 1YY7A 5DBQA 1SL1B 2IMDA 2YP6A 4J56E 2OBKA 4PNFA 2HFDA 4KGIA 4MPGA 5KN2A 4KNDA 4KDUA 2J23A 2CVKA 5CRHA 4Z7XA 5HFIA 1DSBA 2ON7A 1XOBA 2CT6A 1XFLA 2M80A 4MF5A 3GV1A 4ZB8A 3R2QA 2WFCA 4I2UA 5ECRB 2J9HA 2GVPA 3M3MA 4KE3A 2IPAA 4XS4A 5CNWA 10GSA 1PKWA 1AW9A 4GWRA 4AF2A 2KUCA 4K7OA 3EE2A 2VO4A 9GSSA 2FY6A 5ECOB 2H73A 4HDEA 6GSVA 5GZZB 3ZMKA 4KUNA 2HZFA 3FR3A 1F3AA 5EY6A 1WRYA 1SKWB 2IMIA 3BD2A 2WS2A 2OE3A 2KHPA 4DSQA 3ZLPA 2PGTA 4LLRA 2VLUA 3HVXA 3GKNA 5B8BA 4OFNA 3IV4A 2YN1A 2K18A 1TRVA 2L5OA 1EEJA 1C72A 3H4KA 1A8YA 5CYYA 4OO4A 4BVXA 1V98A 1Q98A 1BAYA 1OC8A 3TKSE 4LMWA 2L4CA 3U6VA 4WBRD 2C3NA 2BTOT 2ALBA 3I9V2 1G7OA 4TR1A 3NOFA 2VLVA 4NXIA 2WZ9A 2C0GA 1EV4A 4TOPA 3IOSA 4HQZA 1S3CA 5F06A 1GSEA 2OKAA 3C1SA 4X43A 4ULXA 1GLQA 2AV4A 4EVMA 5IOXA 3WT1A 2YZUA 1EWXA 5IPHA 4HZ4A 3IXRA 5HR2A 4MDCA 2LKUA 3GMFA 2B1LA 4ISDA 4ZIJA 5GAND 5F8BA 4I8BA 4MF7A 3VPTA 3KM6A 2H6XA 2VLTA 5B6MA 4N30A 4FYBA 3D21A 2MYGA 5J4UA 4G10A 1W89A 2PERA 1GNEA 3BOAA 2LJAA 3ZIJA 2L4QA 2RLIA 2M72A 2VL9A 1AQWA 1ST9A 2FA8A 4HU7A 1R4WA 4XCSA 4XRDA 1TXXA 2O87A 1OYJA 3DWVA 1T1VA 3SBCA 4KAEA 3L0HA 4NPBA 2QSIA 3SWLA 4BWSA 2IN3A 3MWHA 2IL3A 3TKQA 3GL3A 2GQMA 1A2MA 2OA7A 3F6DA 4EO3A 3LSZA 1S3DA 3L9SA 2FNOA 2I9HA 3W8JA 2FD3A 3DYRA 4ECCA 2HZEA 4V2LA 2AUVA 2YCDA 5ENUA 4G2EA 3O6TA 3KCMA 3GX8A 1FOVA 4EC0A 4WF5A 4DSSB 2GSRA 1XPVA 1QMVA 1SYXA 4E8EA 4JU5A 2VD1A 2GSQA 4HQSA 3HJOA 5FHIA 2C1YA 1BYEA 3ZVJD 4F82A 2GSTA 4HEA2 4Q5NA 1XZOA 2X8CA 4IHUA 4CW9A 1M9AA 4MJBA 2MMZA 2X8HA 5CAXA 2HQTA 2PVOC 2H76A 3TJFA 1J08A 4GCIA 3MSZA 4NAXA 1ZCPA 2RM5A 2VCTA 1SJ6A 2V1MA 5IMCA 2L5LA 4IP1A 3G7JA 1ZYEA 4KH7A 3RPNA 1ILOA 3PGTA 3UL3A 3KGKA 2PN8A 3I69A 1J9BA 5DQYA 5G1LA 2QKEA 3ZYWA 2NDOA 5ECMB 2JSZA 2C4JA 3ZREA 1PMTA 1V2AA 1HYUA 2LV3A 3IA1A 1TTZA 4O7HA 5D96A 3L4NA 3DRNA 1QGVA 3FW2A 4YQUA 4DSSA 2R37A 4PQ1A 2DIZA 3IAS2 1U3IA 4POLA 3FZ4A 3C7MA 4ECBA 4RI6A 3G7YA 4G0IA 1HNCA 5IMFA 3VK9A 4H86A 2R3XA 2HE3A 2WGRA 1YF1A 4JE1A 3D0ZA 3PINA 4LL4B 2WB9A 5JWRB 3RHBA 6GSWA 4WF4A 3D22A 2H1BA 5AISA 1SKRB 3QMXA 1G6YA 1TP9A 5H5QA 2VM2A 2VUPA 1T7PB 4EE0A 3IK9A 2LUSA 1F3BA 4K2DA 3ME8A 2CVDA 2H0IA 4N0VA 1TU7A 1XWAA 4WR5A 3CTFA 4PUFC 2MBTA 4TXOB 1HNBA 1JZRA 1ON4A 1GTAA 2P5RA 1PQNA 4AJ7A 4KSOA 4I2TA 1N8JA 3UARA 4QL7A 2RIIA 2ZNMA 4YH2A 2L57A 3GHAA 2OE1A 1NW2A 4ZBAA 2PU9C 1ERVA 1OE7A 3VWWA 5A4UA 3TKSC 4QQ7A 3FZ9A 3QFBC 1ZMAA 4K7NA 2F3MA 2VCQA 5AGYA 4ZL9A 4IS0A 2NVLA 5EL8A 4IGJA 3ZMLA 2YZHA 3GKKA 3UIWA 3EINA 2F8AA 1O8WA 4G0KA 4JBBA 4TKYA 1BX9A 1SKSB 3U5RE 1M9BA 3TCOA 2KOKA 3DEXA 1NHOA 2R4VA 5F05A 1TRWA 4ECIA 1Q4JA 5JCUA 2K6VA 1NM3A 3F3QA 4TXOA 3GN3A 3IHQA 4DSRA 4GQFA 1V9WA 3N9JA 1M7TA 3UAPA 6GSXA 4EUYA 1OVNA 1UA5A 2MMNA 4E8HA 4JRRA 1I5GA 4LMVA 2FWFA 1ML6A 3F63A 5DDLA 4YQMA 3UOMA 4F03A 1B9YC 3UBKA 3TB2A 4JZQA 2VOCA 3FZAA 3KMNA 17GSA 3FKFA 1SK2A 4J2FA 2M46A 3KH9A 3M9KA 1H4OA 3W6GA 4ZBDA 4ILFA 3FEUA 4YQVA 5LNKe 4WETA 1GUMA 2TRXA 2K8VA 3IPZA 1PX6A 1T4ZA 1O81A 1EV9A 2LQQA 4HS1A 4FQUA 2R6KA 4GQCA 1XW9A 4N0ZA 3HD5A 1SD9A 5G30A 4L8EA 2CX4A 1U3AA 1LU4A 2GT6A 2X64A 1T3BA 2FWGA 1MDIA 1FO5A 1PX7A 3A5WA 1SL2B 4K0NA 5JWQB 2CA8A 1XW5A 1J0FA 4TRXA 1BQ7A 3PH9A 1GTIA 5GSTA 4HJMA 4BVXB 5DJMA 19GSA 5ECNB 2H71A 3KZQA 5IPGA 2YWOA 2YANA 3HYPA 4ZBBA 1Z7PA 4TR1B 1AQXA 4IQAA 1THOA 2AJQB 3GUSA 1VGLA 4ZILA 4EL1A 2WRTA 3EURA 1MD3A 3BCIA 4BWQA 4KSMA 2LNTA 5KN1A 1SK0A 4XS6A 2DJJA 3DGQA 3LFLA 4USSA 8GSSA 2YWMA 3QAVA 3D4MA 3CSJA 2H6YA 4FIWA 1ERUA 4POMA 2F51A 1GWCA 2XC2A 2H01A 3A2WA 4KX4A 2AAWA 2JZTA 1WMJA 2HSNB 2GZPA 3DKSA 4F9ZA 4K9ZA 2FHEA 4ZB9A 4IELA 5ECHB 1ERWA 2ON5A 4O5RA 2H19A 4IJ3A 3QCPA 2PPTA 4P3YB 4OFTA 5IMVA 3ME7A 2PBJA 2VL2C 2PVQA 2F9SA 5HR3A 4O92A 1WJKA 2DJ2A 2H70A 1F2EA 2QGVA 5LCZA 3FR6A 1U87A 3NZNA 4K6XA 5ECKB 2JZSA 1V40A 2B6MA 2YNXA 2V6KA 1GSUA 4N11A 3EU4A 5INYA 1JZOA 2H0HA 1F9MA 3C8EA 1O73A 3MDKA 5IO2A 1RQMA 3QD9A 3N5OA 3KTLA 3P90A 3EMXA 1LBKA 3ZFLA 1K0CA 3F4RA 5ID2A 5B8AA 13GSA 1H75A 3GRXA 2I1UA 4PNGA 3L78A 2H1AA 3F3RA 2HZEB 4TR4A 4XS1A 2JACA 1QK8A 3WGDA 3TRXA 5BMUA 1K3YA 5D93A 4TVEA 3S9FA 1FAAA 3H79A 5KN3A 3VURA 4PGTA 1X5CA 3US3A 1IYIA 1TK8B 2XPDA 1FVKA 4MJCA 4RI7A 3WT2A 2C0EA 1A0FA 3KP8A 3RPPA 5G1KA 3IDVA 3IK7A 1O8XA 5IMZA 2CQ9A 1MDJA 2C3QA 1XW6A 2YJHA 4WR4A 3TUEA 2AB6A 1GRXA 2MMAA 5E4WA 4IQ1A 1ZL9A 1TRUA 3KP9A 1EGOA 2HYXA 1G7EA 3I6AA 3LXTA 1WP0A 2YWNA 1WIKA 1K3OA 4MH2A 5GSSA 2OE0A 2LQOA 3JCML 1G0TA 1A0RP 6GSTA 4QL9A 3GKMA 1IYHA 4ZXGA 1OC3A 5F07A 4J57E 2OJLA 1SD8A 3CYNA 1WPIA 4IVFA 2VM1A 2YOIA 3GFKA 1M2DA 4MPFA 5LD0A 1USBA 1FB0A 4JR6A 5EVOA 2YPMA 3FY7A 3TRQA 2XPEA 4OO5A 4HI7A 3UBLA 1M2BA 3BBYA 1DBYA 5CP1A 2GT5A 2C0DA 3GA4A 3RBTA 3TKSA 4Q5RA 2XBIA 3LG6A 1FVJA 1HQOA 6GSSA 1Z3EA 5ABRA 3A3TA 3LYKA 2GGTA 2VCVA 4Q5QA 4K0GA 1XWGA 4KB3A 1TKDB 2E7PA 22GSA 3VWXA 1R26A 1EGRA 2G0FA 3CRUA 2LJKA 3CRTA 2HNLA 1TRSA 3W8SA 1FHEA 1VF2A 4LL1B 4HUAA 4D73B 2FCHA 3C71A 1AQVA 5JCGA 16GSA 2H1DA 4ML1A 3TRPA 2KP2A 3EU3A 1W4VA 2KLXA 4BL7B 1SYRA 2Z9SA 2HRNA 3QR6A 5CRGA 2CAIA 1XVWA 5J5NA 1UVZA 5ELAA 1Z6NA 5D9TA 3KD0A 4MZBA 4XRAA 1GP1A 4XIHA 4RQRA 3LORA 3UEMA 1F6MC 1TI1A 1NHYA 1URMA 4MMMA 1SK1A 3HY2A 5G2ZA 5A5KA 2B1KA 3M9JA 2OADA 3VI5A 3GL5A 2ZUPA 2TRCP 2DJKA 1KEBA 2CZ2A 2GZYA 2H30A 1M2AA 3TOTA 4WKWA 1U6TA 1K0MA 3TOUA 3CMIA 4EKZA 5ECIB 1TK0B 1YQ1A 4D73A 5FWGA 5DCGA 3A2XA 1OC9B 3CSHA 2DLXA 1XWKA 1GUKA 3G9BA 4F2IA 2JZRA 3UVHA 1PA3A 4PUAA 5D8IA 3HKRA 3P2AA 3DD3A 4TXVA 4IBPA 4FYUA 4BL7A 3RDWA 2VD0A 11GSA 1Z7RA 1YF0A 4JEDA 2FUG2 4NV5A 2C8UA 1R7HA 1BJXA 1JZDA 3CTGA 1A2JA 5HR0A 3VWVA 1T00A 3A2VA 2GLRA 4RQXA 2GSSA 5AIXA 1XWBA 5DCHA 1GL8A 2K9FA 2LRNA 4TN8A 1ZGNA 3GIXA 1CQHA 2LNSA 2V32A 1Z5YE 5C00A 2EIQA 5IO0A 2LS5A 3GSSA 2HRAA 2WCIA 3E3EA 3EMPA 3OR5A 2D2ZA 4L5OA 2FWHA 3LEFA 4K1FA 3O3TA 2RM6A 1PKZA 3AY8A 1VRSD 1Z9HA 1OC9A 2B5XA 2O89A 5DQSA 1E2YA 1ZZYA 1XVQA 4GRFA 1ACVA 2ES7A 3GTUB 3J7Yb 4ZL8A 3HHVA 4KCEA 1UN2A 1PGTA 2HLSA 4HU9A 1PSQA 1K0BA 4GLTA 2HSHA 1GSSA 4PTSA 4YAVA 4I5QA 1X9SB 1ZYQB 3CXGA 3VLNA 5D9WA 5J3RA 4KDXA 4MZCA 2FA4A 1PL2A 4G19A 1T4YA 3BJ5A 2H72A 2K8SA 4HOJA 5H5SA 2E2GA 1N2AA 3VFIA 1X5DA 3DXBA 2E2MA 2DC5A 3K8NA 2V6OA 2B5EA 3LJRA 4KW6A 2O8VB 2NTOA 1GTUA 4BVYA 2IMEA 1YDKA 4EDYA 4L0UA 2X8GA 2P5QA 1A24A 2H0GA 1X9MB 4WBJA 1G6WA 4TW5A 2GDRA 1GUHA 1YJ6A 2XBQA 2P31A 2YWIA 3FYGA 3F4SA 1X5EA 3GTUA 3GX0A 1JLWA 1GSQA 2GTUA 3M0FA 3F0IA 5FT3A 1TW9A 1XCCA 3IC8A 2E0QA 1TJDA 3HXSA 1GULA 4OMVA 4PXOA 3P7XA 1Y25A 1B8XA 2VCZA 4OCEA 2YJ7A 1ABAA 1V57A 4MP4A 1A23A 4MK3A 4PQIA 2OACA 1GSFA 2O7KA 2IFQB 4IKHA 4MZWA 1HD2A 2FLSA 1VF1A 2N5FA 1OKDA 4GSSA 3TJBA 1WE0A 1GSYA 3H1NA 4DVCA 5E59A 3EC3A 2JADA 4F0BA 5EPFA 5F0GA 4CDOA 3DMLA 3P8WA 5KEJA 4BPYA 3Q6OA 4F0CA 4ZB6A 1JLVA 2FGXA 5ID2B 4X1UA 2C0FA 4PX1A 4L0WA 2HSMB 1VF3A 3WD6A 1A8LA 3GH9A 2L6CA 1QUWA 2WDUA 5IMAA 5ECQB 1S3AA 3I43A 1QFNA 3D5JA 4V2NA 2AHEA 1VF4A 3HJMA 3IAM2 3GURA 1OE8A 4I6XA 5IIZA 5DALB 5H5RA 4IN0A 2O85A 4FH8A 2IFQA 2VL3A 2MMOA 2A2RA 5KN0A 3APSA 1GTBA 3LXZA 5CREA 4G0LA 5ECSA 3R3EA 5J9CA 3EYTA 1DUGA 1GH2A 5CO3A 2LSTA 4G9HA 3GYKA 4ML6A 2VCXA 2YV9A 3PPUA 4NHWA 3KMOA 6GSYA 1THXA 2GQKA 2VIMA 2LEGA 3GKXA 2DJ3A 2RUFA 3Q18A 1YEXA 4NMUA 1K3LA 4ID0A 1XIYA 2HSMA 2A2SA 1I9DA 1QQ2A 2BMXA 2DSAA 2HXKA 5G5FA 3UVTA 3Q74A 5COHA 3D6IA 3LYPA 2I3YA 1EOGA 2A4VA 1SJIA 4JR4A 3D4TA 2UZ8A 3ZTLA 1F37A 4V2MA 2WJUA 2REMA 2WULA 1EP7A 4K7IA 3C1RA 5DALA 4KF9A 2N5BA 3QOUA 1X9WB 3M8NA 5HFKA 1O7UA 1TDIA 3EVIA 3F9UA 5IM9A 3KJYA 3APQA 2YV7A 3L9VA 3H8QA 12GSA 3DVXA 2DIYA 2CAQA 3VPQA 2LRCA 1TOFA 3HZ4A 5L71A 1JZWA 5IQYA 1K0DA 4FYCA 3VI7A 1EZKA 14GSA 3UMAA 5G31A 3BCKA 1PN9A 3E0UA 6GSUA 1QXHA 3NIVA 2ZCTA 3ZZXA 5B6NA 2CZ3A 2H75A 4I97A 1X0RA 2H1GA 1PD21 5DVBA 1AUCA 2CVBA 2LTKA 5CRWA 3GNJA 4X0XA 1DE1A 1SENA 2X99A 5D9VA
chains in the Genus database with same CATH superfamily
3CSIA 1JHBA 1YKAA 3WGXA 3FK8A 5J41A 3QPMA 4YAPA 1WOUA 2MBSA 3RHCA 1GSDA 2VAFA 1B48A 1AC1A 4IP6A 2TIRA 3L9UA 2CV4A 2WVXB 1K0NA 1SJZA 4NV2A 4GF0A 2RUEA 1PRXA 3FRCA 3FR9A 1V58A 1S4BP 1EOHA 3MAKA 5D9XA 2DMMA 2HRFA 5DJLA 2B7KA 3IE3A 2HT9A 4Q5FA 3LWAA 2L6DA 1Z6MA 2EIOA 3WGEA 1FB6A 3F8UA 5JWOB 3ZFBA 2G2QA 3ZIVA 4MLYA 2H8LA 3MIXA 1XXUA 2WVYA 2F8FA 2P0GA 4IW9A 4L5LA 3HDCA 3TDGA 5HQPA 1AAZA 1R5PA 3IRAA 2R0PA 2R2JA 2B5YA 2PMTA 3ZVJA 3IC4A 2HRKB 3HJPA 3TJGA 2GZZA 2I81A 3HA9A 3LGCA 4ACSA 3F4TA 2LRTA 4MJAA 1SL0B 2GS3A 4POBA 4KA0A 3VWUA 4EDZA 4AJ8A 4OD7A 5G5EA 2JL4A 1K0OA 5A1NB 2HI7A 1GLPA 3ERFA 1AIUA 4XTSA 3J7Yk 3KTBA 2B7JA 3ED3A 1M99A 1TU8A 4GSNA 2PUKC 1AXDA 4ZB7A 3HVVA 2O36A 3TJKA 2MZCA 1WWJA 4WXTA 2JSYA 4OFMA 1PL1A 2OBIA 1CQGA 2DBCA 3H93A 1KBNA 3E9JB 5C04A 1I1IP 4CHSA 2EFHA 2R5GA 4TR0A 5HR1A 5A4WA 5ELGA 4YKFA 1TI3A 3M1GA 1GNWA 2HRKA 2H66A 3GH6A 3Q19A 5HFGA 4AJ6A 4V1Ap 1M0UA 4ZL7A 1U88A 3RAZA 3QFAC 4XHMA 3FHKA 4POKA 1OKTA 3FZ5A 1K0AA 2C3TA 3KEBA 4MH3A 4OCFA 2NBSA 3ERWA 3CWGA 4AI6A 3DVWA 4PURA 4EXJA 5A1NA 3V1WA 5B7CA 3O76A 2FWEA 2EFEA 4FO5A 1T8EB 3ZRDA 1KTEA 2H1LA 3QDNA 2V41A 4MABA 1B4QA 2EC4A 1RW1A 2X49A 1FG4A 5IOWA 1DE2A 2I4AA 3HCZA 2N5AA 1EP8A 1O85A 1O6JA 2DJ0A 4MF6A 5J9BA 5JCWA 2KP1A 2EIRA 4BVYB 3IR4A 5ECLB 2CX3A 1LJRA 2GQLA 3TJJA 3KIJA 3CBUA 3TGZA 7GSSA 4GXZA 1Y1UA 4KDYA 2IMFA 3ISOA 1MEKA 4MCUA 1BG5A 1OAZA 2DJ1A 1YZXA 4V1Ag 4RUVA 1UC7A 4MJEA 1MD4A 1BEDA 3QAGA 2DKIA 4OWYA 3ERGA 4GTUA 4O32A 2IIYA 1Y6EA 2XHFA 3QAWA 2DMLA 4TR3A 2B3SA 3KXOA 3PR8A 1NSWA 4AGSA 1RK4A 2IWTA 2JU5A 3GSTA 4N10A 2VCWA 5D73A 5CRDA 4DEJA 5DAKB 2VL2A 1SVLA 4K8MA 4KCAA 3LQ7A 1KNGA 1TK5B 1EEMA 1R5AA 3IBHA 1E6BA 18GSA 2LJRA 2NPBA 1MDKA 2BJXA 2PWJA 3F6FA 3ZL5A 5GAPD 4LA1A 4HZ2A 5A4VA 2AYTA 1XOAA 4N3ZA 3IHGA 2L59A 4NWYA 1SU9A 1SVMA 3DIEA 3APOA 3UJ1A 1ZOFA 1ERTA 2V2GA 3HZ8A 2H6ZA 1JFUA 20GSA 1XBSA 1MTCA 3TKRA 1FW1A 4HJ2A 4WEYA 4Z2TA 2QC7A 4BA7A 1XWCA 2QA1A 4XS4B 2IMKA 1YKCA 3G7IA 5AN1A 4MA9A 3CHXC 2H74A 3MNGA 2IJYA 4GSTA 3WYWA 4EF0A 3HVSA 4NHZA 4PQHA 3C73A 1HNAA 3TKPA 5DAKA 3EWLA 5ECPB 5AIVA 1B4PA 1A2LA 2C80A 4ECJA 1B9XC 3KH7A 1YEPA 5IMDA 4IJIA 2HSYA 2WW2A 3ZITA 1YY7A 5J4VA 5DBQA 1SL1B 2IMDA 2YP6A 4J56E 2OBKA 4PNFA 2HFDA 4KGIA 4MPGA 5KN2A 1FOHA 4KNDA 4KDUA 2J23A 2CVKA 5CRHA 4Z7XA 5HFIA 1DSBA 2ON7A 1XOBA 2CT6A 1XFLA 2M80A 4MF5A 3GV1A 4ZB8A 3R2QA 2WFCA 4I2UA 5ECRB 2J9HA 2GVPA 3M3MA 4KE3A 2IPAA 4XS4A 5CNWA 10GSA 1PKWA 1AW9A 4GWRA 4AF2A 2KUCA 4K7OA 3EE2A 2VO4A 9GSSA 2FY6A 1BG1A 5ECOB 2H73A 4HDEA 6GSVA 5GZZB 3ZMKA 4KUNA 2HZFA 3FR3A 1F3AA 5EY6A 1WRYA 1PFOA 1SKWB 2IMIA 2R0GA 3BD2A 2WS2A 2OE3A 2KHPA 4DSQA 3ZLPA 2PGTA 4LLRA 3HVXA 2VLUA 3GKNA 5B8BA 4AKIA 4OFNA 3IV4A 2YN1A 2K18A 1TRVA 2L5OA 1EEJA 2A4HA 1C72A 4E68A 1A8YA 3H4KA 5CYYA 4OO4A 4BVXA 1V98A 1Q98A 1BAYA 1OC8A 3TKSE 2R0CA 4LMWA 2L4CA 3U6VA 4WBRD 2C3NA 2BTOT 2ALBA 3I9V2 1G7OA 4TR1A 3NOFA 2VLVA 4NXIA 2WZ9A 2C0GA 1EV4A 4TOPA 3IOSA 4HQZA 1S3CA 5KOWA 5F06A 5A34B 1GSEA 2OKAA 3C1SA 4X43A 4ULXA 1GLQA 2AV4A 4EVMA 2OT3A 5IOXA 3WT1A 2YZUA 1EWXA 5IPHA 4HZ4A 3IXRA 5HR2A 4MDCA 2LKUA 3GMFA 2B1LA 4ISDA 4ZIJA 5GAND 5F8BA 4I8BA 4MF7A 3VPTA 3KM6A 2H6XA 3MYDA 2VLTA 5B6MA 3A5IA 1ZYNA 4N30A 4FYBA 3D21A 2MYGA 5J4UA 4Z2RA 4G10A 1W89A 2PERA 1GNEA 3BOAA 2LJAA 3ZIJA 2L4QA 2RLIA 2M72A 2VL9A 1AQWA 1ST9A 2FA8A 4HU7A 1R4WA 4XCSA 4XRDA 1TXXA 2O87A 1OYJA 3DWVA 1T1VA 3SBCA 4KAEA 3L0HA 4NPBA 2QSIA 2WW1A 5A34A 3SWLA 4BWSA 2IN3A 3MWHA 2IL3A 3TKQA 3GL3A 2GQMA 1A2MA 2OA7A 3F6DA 4EO3A 3LSZA 3FMWA 1S3DA 3L9SA 2FNOA 2I9HA 3W8JA 2FD3A 3DYRA 4ECCA 2HZEA 4V2LA 2AUVA 2YCDA 5ENUA 2A2PA 4K5SA 4G2EA 3O6TA 3KCMA 3GX8A 1FOVA 4EC0A 4WF5A 4DSSB 2GSRA 1XPVA 1QMVA 1SYXA 4E8EA 4JU5A 1TXUA 2GSQA 2VD1A 4HQSA 3HJOA 5FHIA 2C1YA 1BYEA 3ZVJD 4F82A 2GSTA 4HEA2 4Q5NA 1XG8A 1XZOA 2X8CA 4IHUA 4CW9A 1M9AA 4MJBA 2MMZA 2X8HA 5CAXA 2HQTA 2PVOC 2H76A 3TJFA 1J08A 4GCIA 3MSZA 4NAXA 1ZCPA 2RM5A 2VCTA 1SJ6A 2V1MA 5IMCA 2L5LA 4IP1A 3G7JA 1ZYEA 4KH7A 3RPNA 1ILOA 3PGTA 3UL3A 3KGKA 2PN8A 3I69A 1J9BA 5DQYA 5G1LA 2QKEA 3ZYWA 2NDOA 5ECMB 2JSZA 2C4JA 3ZREA 1PMTA 1V2AA 1HYUA 2LV3A 3IA1A 1TTZA 4O7HA 5D96A 3L4NA 3DRNA 1QGVA 3FW2A 4YQUA 4DSSA 2R37A 4PQ1A 2DIZA 3IAS2 1U3IA 4POLA 3FZ4A 3C7MA 4ECBA 4RI6A 3G7YA 4G0IA 1HNCA 5IMFA 3VK9A 4H86A 2R3XA 2HE3A 2WGRA 1YF1A 4JE1A 3D0ZA 3PINA 4LL4B 2WB9A 5J4YA 5JWRB 3RHBA 6GSWA 4WF4A 3D22A 2H1BA 4EIPA 5AISA 1SKRB 3QMXA 1G6YA 1TP9A 5H5QA 2VM2A 2VUPA 1T7PB 4EE0A 3IK9A 2LUSA 1F3BA 4K2DA 3ME8A 4CY6A 4O5UA 2CVDA 2H0IA 4N0VA 1TU7A 1XWAA 4WR5A 3CTFA 4PUFC 2MBTA 4TXOB 1HNBA 1JZRA 1ON4A 1GTAA 2P5RA 1PQNA 4AJ7A 4KSOA 4I2TA 1N8JA 3LW9A 4PHZC 3UARA 4QL7A 2RIIA 2ZNMA 4YH2A 2L57A 3GHAA 2OE1A 1NW2A 4ZBAA 2PU9C 1ERVA 1OE7A 3VWWA 4O5QA 5A4UA 3TKSC 4QQ7A 3FZ9A 3QFBC 1ZMAA 4K7NA 2F3MA 2VCQA 5AGYA 4ZL9A 4IS0A 2NVLA 5EL8A 4IGJA 3ZMLA 2YZHA 3GKKA 3UIWA 3EINA 2F8AA 1O8WA 4G0KA 4JBBA 4PI0C 4TKYA 1BX9A 1SKSB 3U5RE 1M9BA 3TCOA 2KOKA 3DEXA 1NHOA 2R4VA 5F05A 1TRWA 4ECIA 1Q4JA 5JCUA 2K6VA 1NM3A 3F3QA 4TXOA 3GN3A 3IHQA 4DSRA 4GQFA 1V9WA 3N9JA 1M7TA 3UAPA 6GSXA 4EUYA 1OVNA 1UA5A 2MMNA 4E8HA 4JRRA 1I5GA 4FXYP 4LMVA 2FWFA 1ML6A 3F63A 5DDLA 4YQMA 3UOMA 4F03A 1B9YC 3UBKA 3TB2A 4JZQA 2VOCA 3FZAA 3KMNA 17GSA 3FKFA 1SK2A 4J2FA 2M46A 3KH9A 3M9KA 1H4OA 3W6GA 4ZBDA 4ILFA 3FEUA 4YQVA 5LNKe 4WETA 1GUMA 2TRXA 2K8VA 3IPZA 1PX6A 1T4ZA 1O81A 1EV9A 2LQQA 4HS1A 4FQUA 2R6KA 4GQCA 1XW9A 4N0ZA 3HD5A 1SD9A 5G30A 4L8EA 2CX4A 1U3AA 1LU4A 2GT6A 2X64A 1T3BA 2FWGA 1MDIA 1FO5A 1PX7A 3A5WA 1SL2B 4K0NA 5JWQB 2CA8A 1N25A 1XW5A 1J0FA 4TRXA 1BQ7A 3PH9A 1GTIA 5GSTA 1BF5A 4HJMA 4BVXB 5DJMA 2QA2A 19GSA 1M3JA 5ECNB 2H71A 3KZQA 5IPGA 2YWOA 2YANA 3HYPA 4ZBBA 1Z7PA 4TR1B 1AQXA 4IQAA 3TU3B 1THOA 2AJQB 4GDFA 3GUSA 1VGLA 4ZILA 4EL1A 2WRTA 3EURA 1MD3A 3BCIA 4BWQA 4KSMA 2LNTA 5KN1A 1SK0A 4XS6A 2DJJA 3DGQA 3LFLA 4USSA 8GSSA 2YWMA 3QAVA 3D4MA 3CSJA 2H6YA 4FIWA 1ERUA 4MNNA 4POMA 2F51A 1GWCA 2XC2A 2H01A 3A2WA 4KX4A 2AAWA 2JZTA 1WMJA 2HSNB 4A5PA 4AKXB 2GZPA 5BMUB 3DKSA 4F9ZA 4K9ZA 2FHEA 4ZB9A 4IELA 5ECHB 1ERWA 2ON5A 4O5RA 2H19A 4IJ3A 3QCPA 2PPTA 4P3YB 4K2XA 4OFTA 5IMVA 3ME7A 2PBJA 2VL2C 2PVQA 2F9SA 5HR3A 4O92A 1WJKA 2DJ2A 2H70A 3CQFA 1F2EA 2QGVA 5LCZA 3FR6A 1U87A 3NZNA 4K6XA 5ECKB 2JZSA 1V40A 2B6MA 2YNXA 2V6KA 1GSUA 4N11A 3EU4A 1YEWC 5INYA 1JZOA 2H0HA 1F9MA 3C8EA 1O73A 3MDKA 5IO2A 4ICYA 1RQMA 3QD9A 3N5OA 3KTLA 3P90A 3EMXA 1LBKA 2X4AA 3ZFLA 1K0CA 3F4RA 5ID2A 5B8AA 13GSA 3HVNA 1H75A 3GRXA 1PN0A 2I1UA 4PNGA 3EPTA 3L78A 2WW0A 2H1AA 3F3RA 2HZEB 4TR4A 4XS1A 2HSNA 1QK8A 2JACA 3WGDA 3TRXA 5BMUA 1K3YA 5D93A 4TVEA 2EFCA 3S9FA 1FAAA 3H79A 5KN3A 3VURA 1S3RA 4PGTA 1X5CA 3US3A 1IYIA 1TK8B 2XPDA 1FVKA 4MJCA 4RI7A 3WT2A 2C0EA 1A0FA 3KP8A 3RPPA 5G1KA 3IDVA 3IK7A 1O8XA 4Z2UA 5IMZA 2CQ9A 1MDJA 2C3QA 1XW6A 2YJHA 4WR4A 3TUEA 2AB6A 1GRXA 2MMAA 5E4WA 4IQ1A 1ZL9A 1TRUA 3KP9A 1EGOA 2O5VA 2HYXA 1G7EA 3I6AA 3LXTA 1WP0A 2YWNA 1WIKA 1K3OA 4MH2A 5GSSA 2OE0A 2LQOA 3JCML 1G0TA 1A0RP 6GSTA 4QL9A 3GKMA 1IYHA 4ZXGA 1OC3A 5F07A 4J57E 2OJLA 1SD8A 3CYNA 1WPIA 4IVFA 2VM1A 2YOIA 3GFKA 1M2DA 4MPFA 5LD0A 1USBA 1FB0A 4JR6A 5EVOA 2YPMA 3FY7A 3TRQA 2XPEA 4OO5A 2UV8G 4HI7A 3UBLA 1M2BA 3BBYA 1DBYA 5CP1A 2GT5A 2C0DA 3GA4A 3RBTA 4G01A 3TKSA 4Q5RA 2WZSA 2XBIA 5KOXA 3LG6A 1FVJA 1HQOA 6GSSA 1Z3EA 5ABRA 3A3TA 3LYKA 2GGTA 2VCVA 4Q5QA 4K0GA 1XWGA 4KB3A 1TKDB 2E7PA 22GSA 3VWXA 1R26A 1EGRA 2G0FA 3CRUA 2LJKA 3CRTA 2HNLA 1TRSA 3W8SA 1FHEA 1VF2A 4LL1B 4HUAA 4D73B 2FCHA 3C71A 1AQVA 5JCGA 16GSA 2H1DA 4ML1A 3TRPA 4CY8A 2KP2A 3EU3A 1W4VA 2KLXA 4BL7B 1SYRA 2Z9SA 2HRNA 3QR6A 5CRGA 2CAIA 1XVWA 5J5NA 1UVZA 5ELAA 1Z6NA 4W66A 5D9TA 3KD0A 4MZBA 4XRAA 1GP1A 4XIHA 4RQRA 3LORA 2WVXA 3UEMA 1F6MC 1TI1A 1NHYA 1URMA 4MMMA 1SK1A 3HY2A 5G2ZA 5A5KA 2B1KA 3M9JA 2OADA 3VI5A 3GL5A 2ZUPA 2TRCP 2DJKA 1KEBA 2CZ2A 2GZYA 2H30A 1M2AA 3TOTA 4WKWA 1U6TA 1K0MA 3TOUA 3CMIA 4EKZA 5ECIB 1TK0B 1YQ1A 4D73A 5FWGA 5DCGA 3A2XA 1OC9B 3CSHA 2DLXA 4AKGA 1XWKA 1GUKA 3G9BA 4F2IA 2JZRA 3UVHA 1PA3A 4PUAA 5D8IA 3HKRA 3P2AA 3DD3A 4TXVA 4EIQA 4IBPA 2DKHA 4FYUA 4BL7A 3RDWA 2VD0A 11GSA 1Z7RA 1YF0A 4JEDA 2FUG2 4NV5A 2C8UA 1R7HA 1BJXA 1JZDA 3CTGA 1A2JA 5HR0A 3VWVA 1T00A 3A2VA 2GLRA 4RQXA 2GSSA 5AIXA 1XWBA 5DCHA 1GL8A 2K9FA 2LRNA 4TN8A 1ZGNA 3GIXA 1CQHA 2LNSA 2V32A 1Z5YE 5C00A 2EIQA 5IO0A 2LS5A 3GSSA 2HRAA 2WCIA 3E3EA 3EMPA 3OR5A 2D2ZA 4L5OA 2FWHA 5BRTA 3LEFA 4K1FA 3O3TA 2RM6A 1PKZA 3AY8A 2WW3A 1VRSD 1Z9HA 1OC9A 2B5XA 2O89A 5DQSA 1E2YA 1ZZYA 1XVQA 4GRFA 4AKHA 1ACVA 2ES7A 3GTUB 3J7Yb 4ZL8A 3HHVA 4KCEA 4K5RA 1UN2A 1PGTA 2HLSA 4HU9A 1PSQA 1K0BA 4GLTA 2HSHA 1GSSA 4PTSA 4YAVA 1M3IA 4I5QA 1X9SB 1ZYQB 3CXGA 3VLNA 5D9WA 5J3RA 4KDXA 4MZCA 2FA4A 1PL2A 4G19A 1T4YA 3BJ5A 2H72A 4YKGA 2K8SA 4HOJA 5H5SA 2E2GA 1N2AA 3VFIA 1X5DA 3DXBA 2E2MA 2DC5A 3K8NA 2V6OA 2B5EA 3LJRA 4KW6A 2O8VB 2NTOA 1GTUA 4BVYA 4HSCX 2IMEA 1YDKA 4EDYA 4L0UA 1YVLA 2X8GA 2P5QA 1A24A 2H0GA 1X9MB 3RFRC 4WBJA 1G6WA 4TW5A 2GDRA 1GUHA 1YJ6A 2XBQA 2P31A 2YWIA 3FYGA 3F4SA 4PI2C 1X5EA 3GTUA 3GX0A 1JLWA 1GSQA 2GTUA 3M0FA 3F0IA 5FT3A 1TW9A 1XCCA 3IC8A 2E0QA 1TJDA 3HXSA 1GULA 4OMVA 4PXOA 3P7XA 1Y25A 1B8XA 2VCZA 4OCEA 2YJ7A 1ABAA 1V57A 4MP4A 1A23A 4MK3A 4PQIA 2OACA 1GSFA 2O7KA 2IFQB 4IKHA 4MZWA 1HD2A 2FLSA 1VF1A 2N5FA 1OKDA 4GSSA 2VKZG 3TJBA 1WE0A 1GSYA 3H1NA 1ZYPA 4DVCA 5E59A 4X4JA 3EC3A 2JADA 4F0BA 5EPFA 5F0GA 4CDOA 3DMLA 3P8WA 5KEJA 4BPYA 3Q6OA 4F0CA 4ZB6A 1JLVA 2FGXA 5ID2B 2WVZA 4X1UA 2C0FA 4PX1A 4L0WA 2HSMB 1VF3A 3WD6A 1A8LA 3GH9A 2L6CA 1QUWA 2WDUA 5IMAA 5ECQB 1S3AA 3I43A 1QFNA 3D5JA 4V2NA 2AHEA 1VF4A 3HJMA 3IAM2 3GURA 1OE8A 3HMJG 4I6XA 5IIZA 5DALB 5H5RA 4IN0A 2O85A 4FH8A 2IFQA 2VL3A 2MMOA 2A2RA 5KN0A 3APSA 1GTBA 3LXZA 5CREA 4G0LA 5ECSA 3R3EA 5J9CA 3EYTA 1DUGA 1GH2A 5CO3A 2LSTA 4G9HA 3GYKA 4ML6A 2VCXA 2YV9A 3PPUA 4NHWA 3KMOA 6GSYA 2EFDA 1THXA 2GQKA 2VIMA 2LEGA 3GKXA 2DJ3A 2RUFA 3Q18A 1YEXA 4NMUA 1K3LA 4ID0A 1XIYA 2HSMA 2A2SA 1I9DA 1QQ2A 3RGBC 2BMXA 2DSAA 5A5HB 2HXKA 5G5FA 3UVTA 3Q74A 5COHA 3D6IA 3LYPA 2I3YA 1EOGA 2A4VA 1SJIA 4JR4A 3D4TA 2UZ8A 3ZTLA 1F37A 4V2MA 2WJUA 2REMA 2WULA 1EP7A 4K7IA 5J47A 3C1RA 5DALA 4KF9A 2N5BA 3QOUA 1X9WB 3M8NA 5HFKA 1O7UA 1TDIA 3EVIA 3F9UA 1SVOA 5IM9A 3KJYA 3APQA 2YV7A 3L9VA 3H8QA 12GSA 3DVXA 2DIYA 2CAQA 3VPQA 2LRCA 1TOFA 3HZ4A 5L71A 1JZWA 5IQYA 1K0DA 5J40A 4FYCA 3VI7A 1EZKA 14GSA 3UMAA 5G31A 4BIKA 3BCKA 1PN9A 3E0UA 6GSUA 1QXHA 3NIVA 2ZCTA 3ZZXA 5B6NA 2CZ3A 2H75A 4I97A 1X0RA 2H1GA 5A5HA 1PD21 2O3EA 4QMKA 5DVBA 1AUCA 2CVBA 2LTKA 5CRWA 3GNJA 4X0XA 1DE1A 1SENA 2X99A 5D9VA
chains in the Genus database with same CATH topology
3CSIA 1JHBA 1YKAA 3WGXA 3FK8A 5J41A 3QPMA 4YAPA 1WOUA 2MBSA 3RHCA 1GSDA 2VAFA 1B48A 1AC1A 4IP6A 2TIRA 3L9UA 2CV4A 1K0NA 1SJZA 4NV2A 4GF0A 2RUEA 1PRXA 3FRCA 3FR9A 1V58A 1EOHA 3MAKA 5D9XA 2DMMA 2HRFA 5DJLA 2B7KA 3IE3A 2HT9A 4Q5FA 3LWAA 2L6DA 1Z6MA 2EIOA 3WGEA 1FB6A 3F8UA 5JWOB 3ZFBA 2G2QA 3ZIVA 4MLYA 2H8LA 3MIXA 1XXUA 2F8FA 2P0GA 4IW9A 4L5LA 3HDCA 3TDGA 5HQPA 1AAZA 1R5PA 3IRAA 2R0PA 2R2JA 2B5YA 2PMTA 3ZVJA 3IC4A 2HRKB 3HJPA 3TJGA 2GZZA 2I81A 3HA9A 3LGCA 4ACSA 3F4TA 2LRTA 4MJAA 1SL0B 2GS3A 4POBA 4KA0A 3VWUA 4EDZA 4AJ8A 4OD7A 5G5EA 2JL4A 1K0OA 5A1NB 2HI7A 1GLPA 3ERFA 1AIUA 4XTSA 3J7Yk 3KTBA 2B7JA 3ED3A 1M99A 1TU8A 4GSNA 2PUKC 1AXDA 4ZB7A 3HVVA 3TJKA 2MZCA 1WWJA 4WXTA 2JSYA 4OFMA 1PL1A 2OBIA 1CQGA 2DBCA 3H93A 1KBNA 3E9JB 5C04A 4CHSA 2EFHA 2R5GA 4TR0A 5HR1A 5A4WA 5ELGA 4YKFA 1TI3A 3M1GA 1GNWA 2HRKA 2H66A 3GH6A 3Q19A 5HFGA 4AJ6A 4V1Ap 1M0UA 4ZL7A 1U88A 3RAZA 3QFAC 4XHMA 3FHKA 4POKA 1OKTA 3FZ5A 1K0AA 2C3TA 3KEBA 4MH3A 4OCFA 2NBSA 3ERWA 3CWGA 4AI6A 3DVWA 4PURA 4EXJA 5A1NA 3V1WA 5B7CA 3O76A 2FWEA 2EFEA 4FO5A 1T8EB 3ZRDA 1KTEA 2H1LA 3QDNA 2V41A 4MABA 1B4QA 2EC4A 1RW1A 2X49A 1FG4A 5IOWA 1DE2A 2I4AA 3HCZA 2N5AA 1EP8A 1O85A 1O6JA 2DJ0A 4MF6A 5J9BA 5JCWA 2KP1A 2EIRA 4BVYB 3IR4A 5ECLB 2CX3A 1LJRA 2GQLA 3TJJA 3KIJA 3CBUA 3TGZA 7GSSA 4GXZA 1Y1UA 4KDYA 2IMFA 3ISOA 1MEKA 4MCUA 1BG5A 1OAZA 2DJ1A 1YZXA 4V1Ag 4RUVA 1UC7A 4MJEA 1MD4A 1BEDA 3QAGA 2DKIA 4OWYA 3ERGA 4GTUA 4O32A 2IIYA 1Y6EA 2XHFA 3QAWA 2DMLA 4TR3A 2B3SA 3KXOA 3PR8A 1NSWA 4AGSA 1RK4A 2IWTA 2JU5A 3GSTA 4N10A 2VCWA 5D73A 5CRDA 4DEJA 5DAKB 2VL2A 1SVLA 4K8MA 4KCAA 3LQ7A 1KNGA 1TK5B 1EEMA 1R5AA 3IBHA 1E6BA 18GSA 2LJRA 2NPBA 1MDKA 2BJXA 2PWJA 3F6FA 3ZL5A 5GAPD 4LA1A 4HZ2A 5A4VA 2AYTA 1XOAA 4N3ZA 3IHGA 2L59A 4NWYA 1SU9A 1SVMA 3DIEA 3APOA 3UJ1A 1ZOFA 1ERTA 2V2GA 3HZ8A 2H6ZA 1JFUA 20GSA 1XBSA 1MTCA 3TKRA 1FW1A 4HJ2A 4WEYA 4Z2TA 2QC7A 4BA7A 1XWCA 2QA1A 4XS4B 2IMKA 1YKCA 3G7IA 5AN1A 4MA9A 2H74A 3MNGA 2IJYA 4GSTA 3WYWA 4EF0A 3HVSA 4NHZA 4PQHA 3C73A 1HNAA 3TKPA 5DAKA 3EWLA 5ECPB 5AIVA 1B4PA 1A2LA 2C80A 4ECJA 1B9XC 3KH7A 1YEPA 5IMDA 4IJIA 2HSYA 3ZITA 1YY7A 5J4VA 5DBQA 1SL1B 2IMDA 2YP6A 4J56E 2OBKA 4PNFA 2HFDA 4KGIA 4MPGA 5KN2A 1FOHA 4KNDA 4KDUA 2J23A 2CVKA 5CRHA 4Z7XA 5HFIA 1DSBA 2ON7A 1XOBA 2CT6A 1XFLA 2M80A 4MF5A 3GV1A 4ZB8A 3R2QA 2WFCA 4I2UA 5ECRB 2J9HA 2GVPA 3M3MA 4KE3A 2IPAA 4XS4A 5CNWA 10GSA 1PKWA 1AW9A 4GWRA 4AF2A 2KUCA 4K7OA 3EE2A 2VO4A 9GSSA 2FY6A 1BG1A 5ECOB 2H73A 4HDEA 6GSVA 5GZZB 3ZMKA 4KUNA 2HZFA 3FR3A 1F3AA 5EY6A 1WRYA 1SKWB 2IMIA 2R0GA 3BD2A 2WS2A 2OE3A 2KHPA 4DSQA 3ZLPA 2PGTA 4LLRA 2VLUA 3HVXA 3GKNA 5B8BA 4AKIA 4OFNA 3IV4A 2YN1A 2K18A 1TRVA 2L5OA 1EEJA 2A4HA 1C72A 4E68A 1A8YA 3H4KA 5CYYA 4OO4A 4BVXA 1V98A 1Q98A 1BAYA 1OC8A 3TKSE 2R0CA 4LMWA 2L4CA 3U6VA 4WBRD 2C3NA 2BTOT 2ALBA 3I9V2 1G7OA 4TR1A 3NOFA 2VLVA 4NXIA 2WZ9A 2C0GA 1EV4A 4TOPA 3IOSA 4HQZA 1S3CA 5KOWA 5F06A 5A34B 1GSEA 2OKAA 3C1SA 4X43A 4ULXA 1GLQA 2AV4A 4EVMA 2OT3A 5IOXA 3WT1A 2YZUA 1EWXA 5IPHA 4HZ4A 3IXRA 5HR2A 4MDCA 2LKUA 3GMFA 2B1LA 4ISDA 4ZIJA 5GAND 5F8BA 4I8BA 4MF7A 3VPTA 3KM6A 2H6XA 3MYDA 2VLTA 5B6MA 3A5IA 1ZYNA 4N30A 4FYBA 3D21A 2MYGA 5J4UA 4Z2RA 4G10A 1W89A 2PERA 1GNEA 3BOAA 2LJAA 3ZIJA 2L4QA 2RLIA 2M72A 2VL9A 1AQWA 1ST9A 2FA8A 4HU7A 1R4WA 4XCSA 4XRDA 1TXXA 2O87A 1OYJA 3DWVA 1T1VA 3SBCA 4KAEA 3L0HA 4NPBA 2QSIA 5A34A 3SWLA 4BWSA 2IN3A 3MWHA 2IL3A 3TKQA 3GL3A 2GQMA 1A2MA 2OA7A 3F6DA 4EO3A 3LSZA 3FMWA 1S3DA 3L9SA 2FNOA 2I9HA 3W8JA 2FD3A 3DYRA 4ECCA 2HZEA 4V2LA 2AUVA 2YCDA 5ENUA 2A2PA 4K5SA 4G2EA 3O6TA 3KCMA 3GX8A 1FOVA 4EC0A 4WF5A 4DSSB 2GSRA 1XPVA 1QMVA 1SYXA 4E8EA 4JU5A 1TXUA 2GSQA 2VD1A 4HQSA 3HJOA 5FHIA 2C1YA 1BYEA 3ZVJD 4F82A 2GSTA 4HEA2 4Q5NA 1XZOA 2X8CA 4IHUA 4CW9A 1M9AA 4MJBA 2MMZA 2X8HA 5CAXA 2HQTA 2PVOC 2H76A 3TJFA 1J08A 4GCIA 3MSZA 4NAXA 1ZCPA 2RM5A 2VCTA 1SJ6A 2V1MA 5IMCA 2L5LA 4IP1A 3G7JA 1ZYEA 4KH7A 3RPNA 1ILOA 3PGTA 3UL3A 3KGKA 2PN8A 3I69A 1J9BA 5DQYA 5G1LA 2QKEA 3ZYWA 2NDOA 5ECMB 2JSZA 2C4JA 3ZREA 1PMTA 1V2AA 1HYUA 2LV3A 3IA1A 1TTZA 4O7HA 5D96A 3L4NA 3DRNA 1QGVA 3FW2A 4YQUA 4DSSA 2R37A 4PQ1A 2DIZA 3IAS2 1U3IA 4POLA 3FZ4A 3C7MA 4ECBA 4RI6A 3G7YA 4G0IA 1HNCA 5IMFA 3VK9A 4H86A 2R3XA 2HE3A 2WGRA 1YF1A 4JE1A 3D0ZA 3PINA 4LL4B 2WB9A 5J4YA 5JWRB 3RHBA 6GSWA 4WF4A 3D22A 2H1BA 4EIPA 5AISA 1SKRB 3QMXA 1G6YA 1TP9A 5H5QA 2VM2A 2VUPA 1T7PB 4EE0A 3IK9A 2LUSA 1F3BA 4K2DA 3ME8A 4CY6A 4O5UA 2CVDA 2H0IA 4N0VA 1TU7A 1XWAA 4WR5A 3CTFA 4PUFC 2MBTA 4TXOB 1HNBA 1JZRA 1ON4A 1GTAA 2P5RA 1PQNA 4AJ7A 4KSOA 4I2TA 1N8JA 3LW9A 3UARA 4QL7A 2RIIA 2ZNMA 4YH2A 2L57A 3GHAA 2OE1A 1NW2A 4ZBAA 2PU9C 1ERVA 1OE7A 3VWWA 4O5QA 5A4UA 3TKSC 4QQ7A 3FZ9A 3QFBC 1ZMAA 4K7NA 2F3MA 2VCQA 5AGYA 4ZL9A 4IS0A 2NVLA 5EL8A 4IGJA 3ZMLA 2YZHA 3GKKA 3UIWA 3EINA 2F8AA 1O8WA 4G0KA 4JBBA 4TKYA 1BX9A 1SKSB 3U5RE 1M9BA 3TCOA 2KOKA 3DEXA 1NHOA 2R4VA 5F05A 1TRWA 4ECIA 1Q4JA 5JCUA 2K6VA 1NM3A 3F3QA 4TXOA 3GN3A 3IHQA 4DSRA 4GQFA 1V9WA 3N9JA 1M7TA 3UAPA 6GSXA 4EUYA 1OVNA 1UA5A 2MMNA 4E8HA 4JRRA 1I5GA 4LMVA 2FWFA 1ML6A 3F63A 5DDLA 4YQMA 3UOMA 4F03A 1B9YC 3UBKA 3TB2A 4JZQA 2VOCA 3FZAA 3KMNA 17GSA 3FKFA 1SK2A 4J2FA 2M46A 3KH9A 3M9KA 1H4OA 3W6GA 4ZBDA 4ILFA 3FEUA 4YQVA 5LNKe 4WETA 1GUMA 2TRXA 2K8VA 3IPZA 1PX6A 1T4ZA 1O81A 1EV9A 2LQQA 4HS1A 4FQUA 2R6KA 4GQCA 1XW9A 4N0ZA 3HD5A 1SD9A 5G30A 4L8EA 2CX4A 1U3AA 1LU4A 2GT6A 2X64A 1T3BA 2FWGA 1MDIA 1FO5A 1PX7A 3A5WA 1SL2B 4K0NA 5JWQB 2CA8A 1N25A 1XW5A 1J0FA 4TRXA 1BQ7A 3PH9A 1GTIA 5GSTA 1BF5A 4HJMA 4BVXB 5DJMA 2QA2A 19GSA 5ECNB 2H71A 3KZQA 5IPGA 2YWOA 2YANA 3HYPA 4ZBBA 1Z7PA 4TR1B 1AQXA 4IQAA 3TU3B 1THOA 2AJQB 4GDFA 3GUSA 1VGLA 4ZILA 4EL1A 2WRTA 3EURA 1MD3A 3BCIA 4BWQA 4KSMA 2LNTA 5KN1A 1SK0A 4XS6A 2DJJA 3DGQA 3LFLA 4USSA 8GSSA 2YWMA 3QAVA 3D4MA 3CSJA 2H6YA 4FIWA 1ERUA 4MNNA 4POMA 2F51A 1GWCA 2XC2A 2H01A 3A2WA 4KX4A 2AAWA 2JZTA 1WMJA 2HSNB 4A5PA 4AKXB 2GZPA 5BMUB 3DKSA 4F9ZA 4K9ZA 2FHEA 4ZB9A 4IELA 5ECHB 1ERWA 2ON5A 4O5RA 2H19A 4IJ3A 3QCPA 2PPTA 4P3YB 4K2XA 4OFTA 5IMVA 3ME7A 2PBJA 2VL2C 2PVQA 2F9SA 5HR3A 4O92A 1WJKA 2DJ2A 2H70A 1F2EA 2QGVA 5LCZA 3FR6A 1U87A 3NZNA 4K6XA 5ECKB 2JZSA 1V40A 2B6MA 2YNXA 2V6KA 1GSUA 4N11A 3EU4A 5INYA 1JZOA 2H0HA 1F9MA 3C8EA 1O73A 3MDKA 5IO2A 4ICYA 1RQMA 3QD9A 3N5OA 3KTLA 3P90A 3EMXA 1LBKA 2X4AA 3ZFLA 1K0CA 3F4RA 5ID2A 5B8AA 13GSA 1H75A 3GRXA 1PN0A 2I1UA 4PNGA 3EPTA 3L78A 2H1AA 3F3RA 2HZEB 4TR4A 4XS1A 2HSNA 1QK8A 2JACA 3WGDA 3TRXA 5BMUA 1K3YA 5D93A 4TVEA 2EFCA 3S9FA 1FAAA 3H79A 5KN3A 3VURA 4PGTA 1X5CA 3US3A 1IYIA 1TK8B 2XPDA 1FVKA 4MJCA 4RI7A 3WT2A 2C0EA 1A0FA 3KP8A 3RPPA 5G1KA 3IDVA 3IK7A 1O8XA 4Z2UA 5IMZA 2CQ9A 1MDJA 2C3QA 1XW6A 2YJHA 4WR4A 3TUEA 2AB6A 1GRXA 2MMAA 5E4WA 4IQ1A 1ZL9A 1TRUA 3KP9A 1EGOA 2O5VA 2HYXA 1G7EA 3I6AA 3LXTA 1WP0A 2YWNA 1WIKA 1K3OA 4MH2A 5GSSA 2OE0A 2LQOA 3JCML 1G0TA 1A0RP 6GSTA 4QL9A 3GKMA 1IYHA 4ZXGA 1OC3A 5F07A 4J57E 2OJLA 1SD8A 3CYNA 1WPIA 4IVFA 2VM1A 2YOIA 3GFKA 1M2DA 4MPFA 5LD0A 1USBA 1FB0A 4JR6A 5EVOA 2YPMA 3FY7A 3TRQA 2XPEA 4OO5A 2UV8G 4HI7A 3UBLA 1M2BA 3BBYA 1DBYA 5CP1A 2GT5A 2C0DA 3GA4A 3RBTA 4G01A 3TKSA 4Q5RA 2XBIA 5KOXA 3LG6A 1FVJA 1HQOA 6GSSA 1Z3EA 5ABRA 3A3TA 3LYKA 2GGTA 2VCVA 4Q5QA 4K0GA 1XWGA 4KB3A 1TKDB 2E7PA 22GSA 3VWXA 1R26A 1EGRA 2G0FA 3CRUA 2LJKA 3CRTA 2HNLA 1TRSA 3W8SA 1FHEA 1VF2A 4LL1B 4HUAA 4D73B 2FCHA 3C71A 1AQVA 5JCGA 16GSA 2H1DA 4ML1A 3TRPA 4CY8A 2KP2A 3EU3A 1W4VA 2KLXA 4BL7B 1SYRA 2Z9SA 2HRNA 3QR6A 5CRGA 2CAIA 1XVWA 5J5NA 1UVZA 5ELAA 1Z6NA 4W66A 5D9TA 3KD0A 4MZBA 4XRAA 1GP1A 4XIHA 4RQRA 3LORA 3UEMA 1F6MC 1TI1A 1NHYA 1URMA 4MMMA 1SK1A 3HY2A 5G2ZA 5A5KA 2B1KA 3M9JA 2OADA 3VI5A 3GL5A 2ZUPA 2TRCP 2DJKA 1KEBA 2CZ2A 2GZYA 2H30A 1M2AA 3TOTA 4WKWA 1U6TA 1K0MA 3TOUA 3CMIA 4EKZA 5ECIB 1TK0B 1YQ1A 4D73A 5FWGA 5DCGA 3A2XA 1OC9B 3CSHA 2DLXA 4AKGA 1XWKA 1GUKA 3G9BA 4F2IA 2JZRA 3UVHA 1PA3A 4PUAA 5D8IA 3HKRA 3P2AA 3DD3A 4TXVA 4EIQA 4IBPA 2DKHA 4FYUA 4BL7A 3RDWA 2VD0A 11GSA 1Z7RA 1YF0A 4JEDA 2FUG2 4NV5A 2C8UA 1R7HA 1BJXA 1JZDA 3CTGA 1A2JA 5HR0A 3VWVA 1T00A 3A2VA 2GLRA 4RQXA 2GSSA 5AIXA 1XWBA 5DCHA 1GL8A 2K9FA 2LRNA 4TN8A 1ZGNA 3GIXA 1CQHA 2LNSA 2V32A 1Z5YE 5C00A 2EIQA 5IO0A 2LS5A 3GSSA 2HRAA 2WCIA 3E3EA 3EMPA 3OR5A 2D2ZA 4L5OA 2FWHA 5BRTA 3LEFA 4K1FA 3O3TA 2RM6A 1PKZA 3AY8A 1VRSD 1Z9HA 1OC9A 2B5XA 2O89A 5DQSA 1E2YA 1ZZYA 1XVQA 4GRFA 4AKHA 1ACVA 2ES7A 3GTUB 3J7Yb 4ZL8A 3HHVA 4KCEA 4K5RA 1UN2A 1PGTA 2HLSA 4HU9A 1PSQA 1K0BA 4GLTA 2HSHA 1GSSA 4PTSA 4YAVA 4I5QA 1X9SB 1ZYQB 3CXGA 3VLNA 5D9WA 5J3RA 4KDXA 4MZCA 2FA4A 1PL2A 4G19A 1T4YA 3BJ5A 2H72A 4YKGA 2K8SA 4HOJA 5H5SA 2E2GA 1N2AA 3VFIA 1X5DA 3DXBA 2E2MA 2DC5A 3K8NA 2V6OA 2B5EA 3LJRA 4KW6A 2O8VB 2NTOA 1GTUA 4BVYA 2IMEA 1YDKA 4EDYA 4L0UA 1YVLA 2X8GA 2P5QA 1A24A 2H0GA 1X9MB 4WBJA 1G6WA 4TW5A 2GDRA 1GUHA 1YJ6A 2XBQA 2P31A 2YWIA 3FYGA 3F4SA 1X5EA 3GTUA 3GX0A 1JLWA 1GSQA 2GTUA 3M0FA 3F0IA 5FT3A 1TW9A 1XCCA 3IC8A 2E0QA 1TJDA 3HXSA 1GULA 4OMVA 4PXOA 3P7XA 1Y25A 1B8XA 2VCZA 4OCEA 2YJ7A 1ABAA 1V57A 4MP4A 1A23A 4MK3A 4PQIA 2OACA 1GSFA 2O7KA 2IFQB 4IKHA 4MZWA 1HD2A 2FLSA 1VF1A 2N5FA 1OKDA 4GSSA 2VKZG 3TJBA 1WE0A 1GSYA 3H1NA 1ZYPA 4DVCA 5E59A 4X4JA 3EC3A 2JADA 4F0BA 5EPFA 5F0GA 4CDOA 3DMLA 3P8WA 5KEJA 4BPYA 3Q6OA 4F0CA 4ZB6A 1JLVA 2FGXA 5ID2B 4X1UA 2C0FA 4PX1A 4L0WA 2HSMB 1VF3A 3WD6A 1A8LA 3GH9A 2L6CA 1QUWA 2WDUA 5IMAA 5ECQB 1S3AA 3I43A 1QFNA 3D5JA 4V2NA 2AHEA 1VF4A 3HJMA 3IAM2 3GURA 1OE8A 3HMJG 4I6XA 5IIZA 5DALB 5H5RA 4IN0A 2O85A 4FH8A 2IFQA 2VL3A 2MMOA 2A2RA 5KN0A 3APSA 1GTBA 3LXZA 5CREA 4G0LA 5ECSA 3R3EA 5J9CA 3EYTA 1DUGA 1GH2A 5CO3A 2LSTA 4G9HA 3GYKA 4ML6A 2VCXA 2YV9A 3PPUA 4NHWA 3KMOA 6GSYA 2EFDA 1THXA 2GQKA 2VIMA 2LEGA 3GKXA 2DJ3A 2RUFA 3Q18A 1YEXA 4NMUA 1K3LA 4ID0A 1XIYA 2HSMA 2A2SA 1I9DA 1QQ2A 2BMXA 2DSAA 5A5HB 2HXKA 5G5FA 3UVTA 3Q74A 5COHA 3D6IA 3LYPA 2I3YA 1EOGA 2A4VA 1SJIA 4JR4A 3D4TA 2UZ8A 3ZTLA 1F37A 4V2MA 2WJUA 2REMA 2WULA 1EP7A 4K7IA 5J47A 3C1RA 5DALA 4KF9A 2N5BA 3QOUA 1X9WB 3M8NA 5HFKA 1O7UA 1TDIA 3EVIA 3F9UA 1SVOA 5IM9A 3KJYA 3APQA 2YV7A 3L9VA 3H8QA 12GSA 3DVXA 2DIYA 2CAQA 3VPQA 2LRCA 1TOFA 3HZ4A 5L71A 1JZWA 5IQYA 1K0DA 5J40A 4FYCA 3VI7A 1EZKA 14GSA 3UMAA 5G31A 3BCKA 1PN9A 3E0UA 6GSUA 1QXHA 3NIVA 2ZCTA 3ZZXA 5B6NA 2CZ3A 2H75A 4I97A 1X0RA 2H1GA 5A5HA 1PD21 4QMKA 5DVBA 1AUCA 2CVBA 2LTKA 5CRWA 3GNJA 4X0XA 1DE1A 1SENA 2X99A 5D9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSI A;  1JHB A;  1YKA A;  3WGX A;  3FK8 A;  5J41 A;  3QPM A;  4YAP A;  1WOU A;  2MBS A;  3RHC A;  1GSD A;  2VAF A;  1B48 A;  1AC1 A;  4IP6 A;  2TIR A;  3L9U A;  2CV4 A;  1K0N A;  1SJZ A;  4NV2 A;  4GF0 A;  2RUE A;  1PRX A;  3FRC A;  3FR9 A;  1V58 A;  1EOH A;  3MAK A;  5D9X A;  2DMM A;  2HRF A;  5DJL A;  2B7K A;  3IE3 A;  2HT9 A;  4Q5F A;  3LWA A;  2L6D A;  1Z6M A;  2EIO A;  3WGE A;  1FB6 A;  3F8U A;  5JWO B;  3ZFB A;  2G2Q A;  3ZIV A;  4MLY A;  2H8L A;  1XXU A;  2F8F A;  2P0G A;  4IW9 A;  4L5L A;  3HDC A;  3TDG A;  5HQP A;  1AAZ A;  1R5P A;  3IRA A;  2R2J A;  2B5Y A;  2PMT A;  3ZVJ A;  3IC4 A;  2HRK B;  3HJP A;  3TJG A;  2GZZ A;  2I81 A;  3HA9 A;  3LGC A;  4ACS A;  3F4T A;  2LRT A;  4MJA A;  1SL0 B;  2GS3 A;  4POB A;  4KA0 A;  3VWU A;  4EDZ A;  4AJ8 A;  4OD7 A;  5G5E A;  2JL4 A;  1K0O A;  2HI7 A;  1GLP A;  3ERF A;  1AIU A;  4XTS A;  3J7Y k;  3KTB A;  2B7J A;  3ED3 A;  1M99 A;  1TU8 A;  4GSN A;  2PUK C;  1AXD A;  3HVV A;  3TJK A;  2MZC A;  1WWJ A;  4WXT A;  2JSY A;  4OFM A;  1PL1 A;  2OBI A;  1CQG A;  2DBC A;  3H93 A;  1KBN A;  3E9J B;  5C04 A;  4CHS A;  2R5G A;  4TR0 A;  5HR1 A;  5A4W A;  5ELG A;  1TI3 A;  3M1G A;  1GNW A;  2HRK A;  2H66 A;  3GH6 A;  3Q19 A;  5HFG A;  4AJ6 A;  4V1A p;  1M0U A;  4ZL7 A;  1U88 A;  3RAZ A;  3QFA C;  4XHM A;  3FHK A;  4POK A;  1OKT A;  3FZ5 A;  1K0A A;  2C3T A;  3KEB A;  4MH3 A;  4OCF A;  2NBS A;  3ERW A;  3DVW A;  4PUR A;  4EXJ A;  3V1W A;  5B7C A;  3O76 A;  2FWE A;  4FO5 A;  1T8E B;  3ZRD A;  1KTE A;  3QDN A;  2V41 A;  4MAB A;  1B4Q A;  2EC4 A;  1RW1 A;  5IOW A;  1FG4 A;  1DE2 A;  2I4A A;  3HCZ A;  2N5A A;  1EP8 A;  1O85 A;  1O6J A;  2DJ0 A;  4MF6 A;  5J9B A;  5JCW A;  2KP1 A;  2EIR A;  4BVY B;  3IR4 A;  5ECL B;  2CX3 A;  1LJR A;  2GQL A;  3TJJ A;  3KIJ A;  3CBU A;  3TGZ A;  7GSS A;  4GXZ A;  4KDY A;  2IMF A;  3ISO A;  1MEK A;  4MCU A;  1BG5 A;  1OAZ A;  2DJ1 A;  1YZX A;  4V1A g;  4RUV A;  1UC7 A;  4MJE A;  1MD4 A;  1BED A;  3QAG A;  4OWY A;  3ERG A;  4GTU A;  4O32 A;  2IIY A;  1Y6E A;  2XHF A;  3QAW A;  2DML A;  4TR3 A;  2B3S A;  3KXO A;  3PR8 A;  1NSW A;  4AGS A;  1RK4 A;  2IWT A;  2JU5 A;  3GST A;  4N10 A;  2VCW A;  5D73 A;  5CRD A;  4DEJ A;  5DAK B;  2VL2 A;  4K8M A;  4KCA A;  3LQ7 A;  1KNG A;  1TK5 B;  1EEM A;  1R5A A;  3IBH A;  1E6B A;  18GS A;  2LJR A;  2NPB A;  1MDK A;  2BJX A;  2PWJ A;  3F6F A;  3ZL5 A;  5GAP D;  4LA1 A;  4HZ2 A;  5A4V A;  2AYT A;  1XOA A;  2L59 A;  4NWY A;  1SU9 A;  3DIE A;  3APO A;  3UJ1 A;  1ZOF A;  1ERT A;  2V2G A;  3HZ8 A;  2H6Z A;  1JFU A;  20GS A;  1XBS A;  1MTC A;  3TKR A;  1FW1 A;  4HJ2 A;  4WEY A;  2QC7 A;  4BA7 A;  1XWC A;  4XS4 B;  2IMK A;  1YKC A;  3G7I A;  5AN1 A;  4MA9 A;  2H74 A;  3MNG A;  2IJY A;  4GST A;  3WYW A;  4EF0 A;  3HVS A;  4NHZ A;  4PQH A;  3C73 A;  1HNA A;  3TKP A;  5DAK A;  3EWL A;  5ECP B;  5AIV A;  1B4P A;  1A2L A;  2C80 A;  4ECJ A;  1B9X C;  3KH7 A;  1YEP A;  5IMD A;  4IJI A;  2HSY A;  3ZIT A;  1YY7 A;  5DBQ A;  1SL1 B;  2IMD A;  2YP6 A;  4J56 E;  2OBK A;  4PNF A;  2HFD A;  4KGI A;  4MPG A;  5KN2 A;  4KND A;  4KDU A;  2J23 A;  2CVK A;  5CRH A;  4Z7X A;  5HFI A;  1DSB A;  2ON7 A;  1XOB A;  2CT6 A;  1XFL A;  2M80 A;  4MF5 A;  3GV1 A;  4ZB8 A;  3R2Q A;  2WFC A;  4I2U A;  5ECR B;  2J9H A;  2GVP A;  3M3M A;  4KE3 A;  2IPA A;  4XS4 A;  5CNW A;  10GS A;  1PKW A;  1AW9 A;  4GWR A;  4AF2 A;  2KUC A;  4K7O A;  3EE2 A;  2VO4 A;  9GSS A;  2FY6 A;  5ECO B;  2H73 A;  4HDE A;  6GSV A;  5GZZ B;  3ZMK A;  4KUN A;  2HZF A;  3FR3 A;  1F3A A;  5EY6 A;  1WRY A;  1SKW B;  2IMI A;  3BD2 A;  2WS2 A;  2OE3 A;  2KHP A;  4DSQ A;  3ZLP A;  2PGT A;  4LLR A;  2VLU A;  3HVX A;  3GKN A;  5B8B A;  4OFN A;  3IV4 A;  2YN1 A;  2K18 A;  1TRV A;  2L5O A;  1EEJ A;  1C72 A;  3H4K A;  1A8Y A;  5CYY A;  4OO4 A;  4BVX A;  1V98 A;  1Q98 A;  1BAY A;  1OC8 A;  3TKS E;  4LMW A;  2L4C A;  3U6V A;  4WBR D;  2C3N A;  2BTO T;  2ALB A;  3I9V 2;  1G7O A;  4TR1 A;  3NOF A;  2VLV A;  4NXI A;  2WZ9 A;  2C0G A;  1EV4 A;  4TOP A;  3IOS A;  4HQZ A;  1S3C A;  5F06 A;  1GSE A;  2OKA A;  3C1S A;  4X43 A;  4ULX A;  1GLQ A;  2AV4 A;  4EVM A;  5IOX A;  3WT1 A;  2YZU A;  1EWX A;  5IPH A;  4HZ4 A;  3IXR A;  5HR2 A;  4MDC A;  2LKU A;  3GMF A;  2B1L A;  4ISD A;  4ZIJ A;  5GAN D;  5F8B A;  4I8B A;  4MF7 A;  3VPT A;  3KM6 A;  2H6X A;  2VLT A;  5B6M A;  4N30 A;  4FYB A;  3D21 A;  2MYG A;  5J4U A;  4G10 A;  1W89 A;  2PER A;  1GNE A;  3BOA A;  2LJA A;  3ZIJ A;  2L4Q A;  2RLI A;  2M72 A;  2VL9 A;  1AQW A;  1ST9 A;  2FA8 A;  4HU7 A;  1R4W A;  4XCS A;  4XRD A;  1TXX A;  2O87 A;  1OYJ A;  3DWV A;  1T1V A;  3SBC A;  4KAE A;  3L0H A;  4NPB A;  2QSI A;  3SWL A;  4BWS A;  2IN3 A;  3MWH A;  2IL3 A;  3TKQ A;  3GL3 A;  2GQM A;  1A2M A;  2OA7 A;  3F6D A;  4EO3 A;  3LSZ A;  1S3D A;  3L9S A;  2FNO A;  2I9H A;  3W8J A;  2FD3 A;  3DYR A;  4ECC A;  2HZE A;  4V2L A;  2AUV A;  2YCD A;  5ENU A;  4G2E A;  3O6T A;  3KCM A;  3GX8 A;  1FOV A;  4EC0 A;  4WF5 A;  4DSS B;  2GSR A;  1XPV A;  1QMV A;  1SYX A;  4E8E A;  4JU5 A;  2VD1 A;  2GSQ A;  4HQS A;  3HJO A;  5FHI A;  2C1Y A;  1BYE A;  3ZVJ D;  4F82 A;  2GST A;  4HEA 2;  4Q5N A;  1XZO A;  2X8C A;  4IHU A;  4CW9 A;  1M9A A;  4MJB A;  2MMZ A;  2X8H A;  5CAX A;  2HQT A;  2PVO C;  2H76 A;  3TJF A;  1J08 A;  4GCI A;  3MSZ A;  4NAX A;  1ZCP A;  2RM5 A;  2VCT A;  1SJ6 A;  2V1M A;  5IMC A;  2L5L A;  4IP1 A;  3G7J A;  1ZYE A;  4KH7 A;  3RPN A;  1ILO A;  3PGT A;  3UL3 A;  3KGK A;  2PN8 A;  3I69 A;  1J9B A;  5DQY A;  5G1L A;  2QKE A;  3ZYW A;  2NDO A;  5ECM B;  2JSZ A;  2C4J A;  3ZRE A;  1PMT A;  1V2A A;  1HYU A;  2LV3 A;  3IA1 A;  1TTZ A;  4O7H A;  5D96 A;  3L4N A;  3DRN A;  1QGV A;  3FW2 A;  4YQU A;  4DSS A;  2R37 A;  4PQ1 A;  2DIZ A;  3IAS 2;  1U3I A;  4POL A;  3FZ4 A;  3C7M A;  4ECB A;  4RI6 A;  3G7Y A;  4G0I A;  1HNC A;  5IMF A;  3VK9 A;  4H86 A;  2R3X A;  2HE3 A;  2WGR A;  1YF1 A;  4JE1 A;  3D0Z A;  3PIN A;  4LL4 B;  2WB9 A;  5JWR B;  3RHB A;  6GSW A;  4WF4 A;  3D22 A;  2H1B A;  5AIS A;  1SKR B;  3QMX A;  1G6Y A;  1TP9 A;  5H5Q A;  2VM2 A;  2VUP A;  1T7P B;  4EE0 A;  3IK9 A;  2LUS A;  1F3B A;  4K2D A;  3ME8 A;  2CVD A;  2H0I A;  4N0V A;  1TU7 A;  1XWA A;  4WR5 A;  3CTF A;  4PUF C;  2MBT A;  4TXO B;  1HNB A;  1JZR A;  1ON4 A;  1GTA A;  2P5R A;  1PQN A;  4AJ7 A;  4KSO A;  4I2T A;  1N8J A;  3UAR A;  4QL7 A;  2RII A;  2ZNM A;  4YH2 A;  2L57 A;  3GHA A;  2OE1 A;  1NW2 A;  4ZBA A;  2PU9 C;  1ERV A;  1OE7 A;  3VWW A;  5A4U A;  3TKS C;  4QQ7 A;  3FZ9 A;  3QFB C;  1ZMA A;  4K7N A;  2F3M A;  2VCQ A;  5AGY A;  4ZL9 A;  4IS0 A;  2NVL A;  5EL8 A;  4IGJ A;  3ZML A;  2YZH A;  3GKK A;  3UIW A;  3EIN A;  2F8A A;  1O8W A;  4G0K A;  4JBB A;  4TKY A;  1BX9 A;  1SKS B;  3U5R E;  1M9B A;  3TCO A;  2KOK A;  3DEX A;  1NHO A;  2R4V A;  5F05 A;  1TRW A;  4ECI A;  1Q4J A;  5JCU A;  2K6V A;  1NM3 A;  3F3Q A;  4TXO A;  3GN3 A;  3IHQ A;  4DSR A;  4GQF A;  1V9W A;  3N9J A;  1M7T A;  3UAP A;  6GSX A;  4EUY A;  1OVN A;  1UA5 A;  2MMN A;  4E8H A;  4JRR A;  1I5G A;  4LMV A;  2FWF A;  1ML6 A;  3F63 A;  5DDL A;  4YQM A;  3UOM A;  4F03 A;  1B9Y C;  3UBK A;  3TB2 A;  4JZQ A;  2VOC A;  3FZA A;  3KMN A;  17GS A;  3FKF A;  1SK2 A;  4J2F A;  2M46 A;  3KH9 A;  3M9K A;  1H4O A;  3W6G A;  4ZBD A;  4ILF A;  3FEU A;  4YQV A;  5LNK e;  4WET A;  1GUM A;  2TRX A;  2K8V A;  3IPZ A;  1PX6 A;  1T4Z A;  1O81 A;  1EV9 A;  2LQQ A;  4HS1 A;  4FQU A;  2R6K A;  4GQC A;  1XW9 A;  4N0Z A;  3HD5 A;  1SD9 A;  5G30 A;  4L8E A;  2CX4 A;  1U3A A;  1LU4 A;  2GT6 A;  2X64 A;  1T3B A;  2FWG A;  1MDI A;  1FO5 A;  1PX7 A;  3A5W A;  1SL2 B;  4K0N A;  5JWQ B;  2CA8 A;  1XW5 A;  1J0F A;  4TRX A;  1BQ7 A;  3PH9 A;  1GTI A;  5GST A;  4HJM A;  4BVX B;  5DJM A;  19GS A;  5ECN B;  2H71 A;  3KZQ A;  5IPG A;  2YWO A;  2YAN A;  3HYP A;  4ZBB A;  1Z7P A;  4TR1 B;  1AQX A;  4IQA A;  1THO A;  2AJQ B;  3GUS A;  1VGL A;  4ZIL A;  4EL1 A;  2WRT A;  3EUR A;  1MD3 A;  3BCI A;  4BWQ A;  4KSM A;  2LNT A;  5KN1 A;  1SK0 A;  4XS6 A;  2DJJ A;  3DGQ A;  3LFL A;  4USS A;  8GSS A;  2YWM A;  3QAV A;  3D4M A;  3CSJ A;  2H6Y A;  4FIW A;  1ERU A;  4POM A;  2F51 A;  1GWC A;  2XC2 A;  2H01 A;  3A2W A;  4KX4 A;  2AAW A;  2JZT A;  1WMJ A;  2HSN B;  2GZP A;  3DKS A;  4F9Z A;  4K9Z A;  2FHE A;  4ZB9 A;  4IEL A;  5ECH B;  1ERW A;  2ON5 A;  4O5R A;  2H19 A;  4IJ3 A;  3QCP A;  2PPT A;  4P3Y B;  4OFT A;  5IMV A;  3ME7 A;  2PBJ A;  2VL2 C;  2PVQ A;  2F9S A;  5HR3 A;  4O92 A;  1WJK A;  2DJ2 A;  2H70 A;  1F2E A;  2QGV A;  5LCZ A;  3FR6 A;  1U87 A;  3NZN A;  4K6X A;  5ECK B;  2JZS A;  1V40 A;  2B6M A;  2YNX A;  2V6K A;  1GSU A;  4N11 A;  3EU4 A;  5INY A;  1JZO A;  2H0H A;  1F9M A;  3C8E A;  1O73 A;  3MDK A;  5IO2 A;  1RQM A;  3QD9 A;  3N5O A;  3KTL A;  3P90 A;  3EMX A;  1LBK A;  3ZFL A;  1K0C A;  3F4R A;  5ID2 A;  5B8A A;  13GS A;  1H75 A;  3GRX A;  2I1U A;  4PNG A;  3L78 A;  2H1A A;  3F3R A;  2HZE B;  4TR4 A;  4XS1 A;  2JAC A;  1QK8 A;  3WGD A;  3TRX A;  5BMU A;  1K3Y A;  5D93 A;  4TVE A;  3S9F A;  1FAA A;  3H79 A;  5KN3 A;  3VUR A;  4PGT A;  1X5C A;  3US3 A;  1IYI A;  1TK8 B;  2XPD A;  1FVK A;  4MJC A;  4RI7 A;  3WT2 A;  2C0E A;  1A0F A;  3KP8 A;  3RPP A;  5G1K A;  3IDV A;  3IK7 A;  1O8X A;  5IMZ A;  2CQ9 A;  1MDJ A;  2C3Q A;  1XW6 A;  2YJH A;  4WR4 A;  3TUE A;  2AB6 A;  1GRX A;  2MMA A;  5E4W A;  4IQ1 A;  1ZL9 A;  1TRU A;  3KP9 A;  1EGO A;  2HYX A;  1G7E A;  3I6A A;  3LXT A;  1WP0 A;  2YWN A;  1WIK A;  1K3O A;  4MH2 A;  5GSS A;  2OE0 A;  2LQO A;  3JCM L;  1G0T A;  1A0R P;  6GST A;  4QL9 A;  3GKM A;  1IYH A;  4ZXG A;  1OC3 A;  5F07 A;  4J57 E;  2OJL A;  1SD8 A;  3CYN A;  1WPI A;  4IVF A;  2VM1 A;  2YOI A;  3GFK A;  1M2D A;  4MPF A;  5LD0 A;  1USB A;  1FB0 A;  4JR6 A;  5EVO A;  2YPM A;  3FY7 A;  3TRQ A;  2XPE A;  4OO5 A;  4HI7 A;  3UBL A;  1M2B A;  3BBY A;  1DBY A;  5CP1 A;  2GT5 A;  2C0D A;  3GA4 A;  3RBT A;  3TKS A;  4Q5R A;  2XBI A;  3LG6 A;  1FVJ A;  1HQO A;  6GSS A;  1Z3E A;  5ABR A;  3A3T A;  3LYK A;  2GGT A;  2VCV A;  4Q5Q A;  4K0G A;  1XWG A;  4KB3 A;  1TKD B;  2E7P A;  22GS A;  3VWX A;  1R26 A;  1EGR A;  2G0F A;  3CRU A;  2LJK A;  3CRT A;  2HNL A;  1TRS A;  3W8S A;  1FHE A;  1VF2 A;  4LL1 B;  4HUA A;  4D73 B;  2FCH A;  3C71 A;  1AQV A;  5JCG A;  16GS A;  2H1D A;  4ML1 A;  3TRP A;  2KP2 A;  3EU3 A;  1W4V A;  2KLX A;  4BL7 B;  1SYR A;  2Z9S A;  2HRN A;  3QR6 A;  5CRG A;  2CAI A;  1XVW A;  5J5N A;  1UVZ A;  5ELA A;  1Z6N A;  5D9T A;  3KD0 A;  4MZB A;  4XRA A;  1GP1 A;  4XIH A;  4RQR A;  3LOR A;  3UEM A;  1F6M C;  1TI1 A;  1NHY A;  1URM A;  4MMM A;  1SK1 A;  3HY2 A;  5G2Z A;  5A5K A;  2B1K A;  3M9J A;  2OAD A;  3VI5 A;  3GL5 A;  2ZUP A;  2TRC P;  2DJK A;  1KEB A;  2CZ2 A;  2GZY A;  2H30 A;  1M2A A;  3TOT A;  4WKW A;  1U6T A;  1K0M A;  3TOU A;  3CMI A;  4EKZ A;  5ECI B;  1TK0 B;  1YQ1 A;  4D73 A;  5FWG A;  5DCG A;  3A2X A;  1OC9 B;  3CSH A;  2DLX A;  1XWK A;  1GUK A;  3G9B A;  4F2I A;  2JZR A;  3UVH A;  1PA3 A;  4PUA A;  5D8I A;  3HKR A;  3P2A A;  3DD3 A;  4TXV A;  4IBP A;  4FYU A;  4BL7 A;  3RDW A;  2VD0 A;  11GS A;  1Z7R A;  1YF0 A;  4JED A;  2FUG 2;  4NV5 A;  2C8U A;  1R7H A;  1BJX A;  1JZD A;  3CTG A;  1A2J A;  5HR0 A;  3VWV A;  1T00 A;  3A2V A;  2GLR A;  4RQX A;  2GSS A;  5AIX A;  1XWB A;  5DCH A;  1GL8 A;  2K9F A;  2LRN A;  4TN8 A;  1ZGN A;  3GIX A;  1CQH A;  2LNS A;  2V32 A;  1Z5Y E;  5C00 A;  2EIQ A;  5IO0 A;  2LS5 A;  3GSS A;  2HRA A;  2WCI A;  3E3E A;  3EMP A;  3OR5 A;  2D2Z A;  4L5O A;  2FWH A;  3LEF A;  4K1F A;  3O3T A;  2RM6 A;  1PKZ A;  3AY8 A;  1VRS D;  1Z9H A;  1OC9 A;  2B5X A;  2O89 A;  5DQS A;  1E2Y A;  1ZZY A;  1XVQ A;  4GRF A;  1ACV A;  2ES7 A;  3GTU B;  3J7Y b;  4ZL8 A;  3HHV A;  4KCE A;  1UN2 A;  1PGT A;  2HLS A;  4HU9 A;  1PSQ A;  1K0B A;  4GLT A;  2HSH A;  1GSS A;  4PTS A;  4YAV A;  4I5Q A;  1X9S B;  1ZYQ B;  3CXG A;  3VLN A;  5D9W A;  5J3R A;  4KDX A;  4MZC A;  2FA4 A;  1PL2 A;  4G19 A;  1T4Y A;  3BJ5 A;  2H72 A;  2K8S A;  4HOJ A;  5H5S A;  2E2G A;  1N2A A;  3VFI A;  1X5D A;  3DXB A;  2E2M A;  2DC5 A;  3K8N A;  2V6O A;  2B5E A;  3LJR A;  4KW6 A;  2O8V B;  2NTO A;  1GTU A;  4BVY A;  2IME A;  1YDK A;  4EDY A;  4L0U A;  2X8G A;  2P5Q A;  1A24 A;  2H0G A;  1X9M B;  4WBJ A;  1G6W A;  4TW5 A;  2GDR A;  1GUH A;  1YJ6 A;  2XBQ A;  2P31 A;  2YWI A;  3FYG A;  3F4S A;  1X5E A;  3GTU A;  3GX0 A;  1JLW A;  1GSQ A;  2GTU A;  3M0F A;  3F0I A;  5FT3 A;  1TW9 A;  1XCC A;  3IC8 A;  2E0Q A;  1TJD A;  3HXS A;  1GUL A;  4OMV A;  4PXO A;  3P7X A;  1Y25 A;  1B8X A;  2VCZ A;  4OCE A;  2YJ7 A;  1ABA A;  1V57 A;  4MP4 A;  1A23 A;  4MK3 A;  4PQI A;  2OAC A;  1GSF A;  2O7K A;  2IFQ B;  4IKH A;  4MZW A;  1HD2 A;  2FLS A;  1VF1 A;  2N5F A;  1OKD A;  4GSS A;  3TJB A;  1WE0 A;  1GSY A;  3H1N A;  4DVC A;  5E59 A;  3EC3 A;  2JAD A;  4F0B A;  5EPF A;  5F0G A;  4CDO A;  3DML A;  3P8W A;  5KEJ A;  4BPY A;  3Q6O A;  4F0C A;  4ZB6 A;  1JLV A;  2FGX A;  5ID2 B;  4X1U A;  2C0F A;  4PX1 A;  4L0W A;  2HSM B;  1VF3 A;  3WD6 A;  1A8L A;  3GH9 A;  2L6C A;  1QUW A;  2WDU A;  5IMA A;  5ECQ B;  1S3A A;  3I43 A;  1QFN A;  3D5J A;  4V2N A;  2AHE A;  1VF4 A;  3HJM A;  3IAM 2;  3GUR A;  1OE8 A;  4I6X A;  5IIZ A;  5DAL B;  5H5R A;  4IN0 A;  2O85 A;  4FH8 A;  2IFQ A;  2VL3 A;  2MMO A;  2A2R A;  5KN0 A;  3APS A;  1GTB A;  3LXZ A;  5CRE A;  4G0L A;  5ECS A;  3R3E A;  5J9C A;  3EYT A;  1DUG A;  1GH2 A;  5CO3 A;  2LST A;  4G9H A;  3GYK A;  4ML6 A;  2VCX A;  2YV9 A;  3PPU A;  4NHW A;  3KMO A;  6GSY A;  1THX A;  2GQK A;  2VIM A;  2LEG A;  3GKX A;  2DJ3 A;  2RUF A;  3Q18 A;  1YEX A;  4NMU A;  1K3L A;  4ID0 A;  1XIY A;  2HSM A;  2A2S A;  1I9D A;  1QQ2 A;  2BMX A;  2DSA A;  2HXK A;  5G5F A;  3UVT A;  3Q74 A;  5COH A;  3D6I A;  3LYP A;  2I3Y A;  1EOG A;  2A4V A;  1SJI A;  4JR4 A;  3D4T A;  2UZ8 A;  3ZTL A;  1F37 A;  4V2M A;  2WJU A;  2REM A;  2WUL A;  1EP7 A;  4K7I A;  3C1R A;  5DAL A;  4KF9 A;  2N5B A;  3QOU A;  1X9W B;  3M8N A;  5HFK A;  1O7U A;  1TDI A;  3EVI A;  3F9U A;  5IM9 A;  3KJY A;  3APQ A;  2YV7 A;  3L9V A;  3H8Q A;  12GS A;  3DVX A;  2DIY A;  2CAQ A;  3VPQ A;  2LRC A;  1TOF A;  3HZ4 A;  5L71 A;  1JZW A;  5IQY A;  1K0D A;  4FYC A;  3VI7 A;  1EZK A;  14GS A;  3UMA A;  5G31 A;  3BCK A;  1PN9 A;  3E0U A;  6GSU A;  1QXH A;  3NIV A;  2ZCT A;  3ZZX A;  5B6N A;  2CZ3 A;  2H75 A;  4I97 A;  1X0R A;  2H1G A;  1PD2 1;  5DVB A;  1AUC A;  2CVB A;  2LTK A;  5CRW A;  3GNJ A;  4X0X A;  1DE1 A;  1SEN A;  2X99 A;  5D9V A; 
#chains in the Genus database with same CATH topology
 3CSI A;  1JHB A;  1YKA A;  3WGX A;  3FK8 A;  5J41 A;  3QPM A;  4YAP A;  1WOU A;  2MBS A;  3RHC A;  1GSD A;  2VAF A;  1B48 A;  1AC1 A;  4IP6 A;  2TIR A;  3L9U A;  2CV4 A;  2WVX B;  1K0N A;  1SJZ A;  4NV2 A;  4GF0 A;  2RUE A;  1PRX A;  3FRC A;  3FR9 A;  1V58 A;  1S4B P;  1EOH A;  3MAK A;  5D9X A;  2DMM A;  2HRF A;  5DJL A;  2B7K A;  3IE3 A;  2HT9 A;  4Q5F A;  3LWA A;  2L6D A;  1Z6M A;  2EIO A;  3WGE A;  1FB6 A;  3F8U A;  5JWO B;  3ZFB A;  2G2Q A;  3ZIV A;  4MLY A;  2H8L A;  3MIX A;  1XXU A;  2WVY A;  2F8F A;  2P0G A;  4IW9 A;  4L5L A;  3HDC A;  3TDG A;  5HQP A;  1AAZ A;  1R5P A;  3IRA A;  2R0P A;  2R2J A;  2B5Y A;  2PMT A;  3ZVJ A;  3IC4 A;  2HRK B;  3HJP A;  3TJG A;  2GZZ A;  2I81 A;  3HA9 A;  3LGC A;  4ACS A;  3F4T A;  2LRT A;  4MJA A;  1SL0 B;  2GS3 A;  4POB A;  4KA0 A;  3VWU A;  4EDZ A;  4AJ8 A;  4OD7 A;  5G5E A;  2JL4 A;  1K0O A;  5A1N B;  2HI7 A;  1GLP A;  3ERF A;  1AIU A;  4XTS A;  3J7Y k;  3KTB A;  2B7J A;  3ED3 A;  1M99 A;  1TU8 A;  4GSN A;  2PUK C;  1AXD A;  4ZB7 A;  3HVV A;  2O36 A;  3TJK A;  2MZC A;  1WWJ A;  4WXT A;  2JSY A;  4OFM A;  1PL1 A;  2OBI A;  1CQG A;  2DBC A;  3H93 A;  1KBN A;  3E9J B;  5C04 A;  1I1I P;  4CHS A;  2EFH A;  2R5G A;  4TR0 A;  5HR1 A;  5A4W A;  5ELG A;  4YKF A;  1TI3 A;  3M1G A;  1GNW A;  2HRK A;  2H66 A;  3GH6 A;  3Q19 A;  5HFG A;  4AJ6 A;  4V1A p;  1M0U A;  4ZL7 A;  1U88 A;  3RAZ A;  3QFA C;  4XHM A;  3FHK A;  4POK A;  1OKT A;  3FZ5 A;  1K0A A;  2C3T A;  3KEB A;  4MH3 A;  4OCF A;  2NBS A;  3ERW A;  3CWG A;  4AI6 A;  3DVW A;  4PUR A;  4EXJ A;  5A1N A;  3V1W A;  5B7C A;  3O76 A;  2FWE A;  2EFE A;  4FO5 A;  1T8E B;  3ZRD A;  1KTE A;  2H1L A;  3QDN A;  2V41 A;  4MAB A;  1B4Q A;  2EC4 A;  1RW1 A;  2X49 A;  1FG4 A;  5IOW A;  1DE2 A;  2I4A A;  3HCZ A;  2N5A A;  1EP8 A;  1O85 A;  1O6J A;  2DJ0 A;  4MF6 A;  5J9B A;  5JCW A;  2KP1 A;  2EIR A;  4BVY B;  3IR4 A;  5ECL B;  2CX3 A;  1LJR A;  2GQL A;  3TJJ A;  3KIJ A;  3CBU A;  3TGZ A;  7GSS A;  4GXZ A;  1Y1U A;  4KDY A;  2IMF A;  3ISO A;  1MEK A;  4MCU A;  1BG5 A;  1OAZ A;  2DJ1 A;  1YZX A;  4V1A g;  4RUV A;  1UC7 A;  4MJE A;  1MD4 A;  1BED A;  3QAG A;  2DKI A;  4OWY A;  3ERG A;  4GTU A;  4O32 A;  2IIY A;  1Y6E A;  2XHF A;  3QAW A;  2DML A;  4TR3 A;  2B3S A;  3KXO A;  3PR8 A;  1NSW A;  4AGS A;  1RK4 A;  2IWT A;  2JU5 A;  3GST A;  4N10 A;  2VCW A;  5D73 A;  5CRD A;  4DEJ A;  5DAK B;  2VL2 A;  1SVL A;  4K8M A;  4KCA A;  3LQ7 A;  1KNG A;  1TK5 B;  1EEM A;  1R5A A;  3IBH A;  1E6B A;  18GS A;  2LJR A;  2NPB A;  1MDK A;  2BJX A;  2PWJ A;  3F6F A;  3ZL5 A;  5GAP D;  4LA1 A;  4HZ2 A;  5A4V A;  2AYT A;  1XOA A;  4N3Z A;  3IHG A;  2L59 A;  4NWY A;  1SU9 A;  1SVM A;  3DIE A;  3APO A;  3UJ1 A;  1ZOF A;  1ERT A;  2V2G A;  3HZ8 A;  2H6Z A;  1JFU A;  20GS A;  1XBS A;  1MTC A;  3TKR A;  1FW1 A;  4HJ2 A;  4WEY A;  4Z2T A;  2QC7 A;  4BA7 A;  1XWC A;  2QA1 A;  4XS4 B;  2IMK A;  1YKC A;  3G7I A;  5AN1 A;  4MA9 A;  3CHX C;  2H74 A;  3MNG A;  2IJY A;  4GST A;  3WYW A;  4EF0 A;  3HVS A;  4NHZ A;  4PQH A;  3C73 A;  1HNA A;  3TKP A;  5DAK A;  3EWL A;  5ECP B;  5AIV A;  1B4P A;  1A2L A;  2C80 A;  4ECJ A;  1B9X C;  3KH7 A;  1YEP A;  5IMD A;  4IJI A;  2HSY A;  2WW2 A;  3ZIT A;  1YY7 A;  5J4V A;  5DBQ A;  1SL1 B;  2IMD A;  2YP6 A;  4J56 E;  2OBK A;  4PNF A;  2HFD A;  4KGI A;  4MPG A;  5KN2 A;  1FOH A;  4KND A;  4KDU A;  2J23 A;  2CVK A;  5CRH A;  4Z7X A;  5HFI A;  1DSB A;  2ON7 A;  1XOB A;  2CT6 A;  1XFL A;  2M80 A;  4MF5 A;  3GV1 A;  4ZB8 A;  3R2Q A;  2WFC A;  4I2U A;  5ECR B;  2J9H A;  2GVP A;  3M3M A;  4KE3 A;  2IPA A;  4XS4 A;  5CNW A;  10GS A;  1PKW A;  1AW9 A;  4GWR A;  4AF2 A;  2KUC A;  4K7O A;  3EE2 A;  2VO4 A;  9GSS A;  2FY6 A;  1BG1 A;  5ECO B;  2H73 A;  4HDE A;  6GSV A;  5GZZ B;  3ZMK A;  4KUN A;  2HZF A;  3FR3 A;  1F3A A;  5EY6 A;  1WRY A;  1PFO A;  1SKW B;  2IMI A;  2R0G A;  3BD2 A;  2WS2 A;  2OE3 A;  2KHP A;  4DSQ A;  3ZLP A;  2PGT A;  4LLR A;  3HVX A;  2VLU A;  3GKN A;  5B8B A;  4AKI A;  4OFN A;  3IV4 A;  2YN1 A;  2K18 A;  1TRV A;  2L5O A;  1EEJ A;  2A4H A;  1C72 A;  4E68 A;  1A8Y A;  3H4K A;  5CYY A;  4OO4 A;  4BVX A;  1V98 A;  1Q98 A;  1BAY A;  1OC8 A;  3TKS E;  2R0C A;  4LMW A;  2L4C A;  3U6V A;  4WBR D;  2C3N A;  2BTO T;  2ALB A;  3I9V 2;  1G7O A;  4TR1 A;  3NOF A;  2VLV A;  4NXI A;  2WZ9 A;  2C0G A;  1EV4 A;  4TOP A;  3IOS A;  4HQZ A;  1S3C A;  5KOW A;  5F06 A;  5A34 B;  1GSE A;  2OKA A;  3C1S A;  4X43 A;  4ULX A;  1GLQ A;  2AV4 A;  4EVM A;  2OT3 A;  5IOX A;  3WT1 A;  2YZU A;  1EWX A;  5IPH A;  4HZ4 A;  3IXR A;  5HR2 A;  4MDC A;  2LKU A;  3GMF A;  2B1L A;  4ISD A;  4ZIJ A;  5GAN D;  5F8B A;  4I8B A;  4MF7 A;  3VPT A;  3KM6 A;  2H6X A;  3MYD A;  2VLT A;  5B6M A;  3A5I A;  1ZYN A;  4N30 A;  4FYB A;  3D21 A;  2MYG A;  5J4U A;  4Z2R A;  4G10 A;  1W89 A;  2PER A;  1GNE A;  3BOA A;  2LJA A;  3ZIJ A;  2L4Q A;  2RLI A;  2M72 A;  2VL9 A;  1AQW A;  1ST9 A;  2FA8 A;  4HU7 A;  1R4W A;  4XCS A;  4XRD A;  1TXX A;  2O87 A;  1OYJ A;  3DWV A;  1T1V A;  3SBC A;  4KAE A;  3L0H A;  4NPB A;  2QSI A;  2WW1 A;  5A34 A;  3SWL A;  4BWS A;  2IN3 A;  3MWH A;  2IL3 A;  3TKQ A;  3GL3 A;  2GQM A;  1A2M A;  2OA7 A;  3F6D A;  4EO3 A;  3LSZ A;  3FMW A;  1S3D A;  3L9S A;  2FNO A;  2I9H A;  3W8J A;  2FD3 A;  3DYR A;  4ECC A;  2HZE A;  4V2L A;  2AUV A;  2YCD A;  5ENU A;  2A2P A;  4K5S A;  4G2E A;  3O6T A;  3KCM A;  3GX8 A;  1FOV A;  4EC0 A;  4WF5 A;  4DSS B;  2GSR A;  1XPV A;  1QMV A;  1SYX A;  4E8E A;  4JU5 A;  1TXU A;  2GSQ A;  2VD1 A;  4HQS A;  3HJO A;  5FHI A;  2C1Y A;  1BYE A;  3ZVJ D;  4F82 A;  2GST A;  4HEA 2;  4Q5N A;  1XG8 A;  1XZO A;  2X8C A;  4IHU A;  4CW9 A;  1M9A A;  4MJB A;  2MMZ A;  2X8H A;  5CAX A;  2HQT A;  2PVO C;  2H76 A;  3TJF A;  1J08 A;  4GCI A;  3MSZ A;  4NAX A;  1ZCP A;  2RM5 A;  2VCT A;  1SJ6 A;  2V1M A;  5IMC A;  2L5L A;  4IP1 A;  3G7J A;  1ZYE A;  4KH7 A;  3RPN A;  1ILO A;  3PGT A;  3UL3 A;  3KGK A;  2PN8 A;  3I69 A;  1J9B A;  5DQY A;  5G1L A;  2QKE A;  3ZYW A;  2NDO A;  5ECM B;  2JSZ A;  2C4J A;  3ZRE A;  1PMT A;  1V2A A;  1HYU A;  2LV3 A;  3IA1 A;  1TTZ A;  4O7H A;  5D96 A;  3L4N A;  3DRN A;  1QGV A;  3FW2 A;  4YQU A;  4DSS A;  2R37 A;  4PQ1 A;  2DIZ A;  3IAS 2;  1U3I A;  4POL A;  3FZ4 A;  3C7M A;  4ECB A;  4RI6 A;  3G7Y A;  4G0I A;  1HNC A;  5IMF A;  3VK9 A;  4H86 A;  2R3X A;  2HE3 A;  2WGR A;  1YF1 A;  4JE1 A;  3D0Z A;  3PIN A;  4LL4 B;  2WB9 A;  5J4Y A;  5JWR B;  3RHB A;  6GSW A;  4WF4 A;  3D22 A;  2H1B A;  4EIP A;  5AIS A;  1SKR B;  3QMX A;  1G6Y A;  1TP9 A;  5H5Q A;  2VM2 A;  2VUP A;  1T7P B;  4EE0 A;  3IK9 A;  2LUS A;  1F3B A;  4K2D A;  3ME8 A;  4CY6 A;  4O5U A;  2CVD A;  2H0I A;  4N0V A;  1TU7 A;  1XWA A;  4WR5 A;  3CTF A;  4PUF C;  2MBT A;  4TXO B;  1HNB A;  1JZR A;  1ON4 A;  1GTA A;  2P5R A;  1PQN A;  4AJ7 A;  4KSO A;  4I2T A;  1N8J A;  3LW9 A;  4PHZ C;  3UAR A;  4QL7 A;  2RII A;  2ZNM A;  4YH2 A;  2L57 A;  3GHA A;  2OE1 A;  1NW2 A;  4ZBA A;  2PU9 C;  1ERV A;  1OE7 A;  3VWW A;  4O5Q A;  5A4U A;  3TKS C;  4QQ7 A;  3FZ9 A;  3QFB C;  1ZMA A;  4K7N A;  2F3M A;  2VCQ A;  5AGY A;  4ZL9 A;  4IS0 A;  2NVL A;  5EL8 A;  4IGJ A;  3ZML A;  2YZH A;  3GKK A;  3UIW A;  3EIN A;  2F8A A;  1O8W A;  4G0K A;  4JBB A;  4PI0 C;  4TKY A;  1BX9 A;  1SKS B;  3U5R E;  1M9B A;  3TCO A;  2KOK A;  3DEX A;  1NHO A;  2R4V A;  5F05 A;  1TRW A;  4ECI A;  1Q4J A;  5JCU A;  2K6V A;  1NM3 A;  3F3Q A;  4TXO A;  3GN3 A;  3IHQ A;  4DSR A;  4GQF A;  1V9W A;  3N9J A;  1M7T A;  3UAP A;  6GSX A;  4EUY A;  1OVN A;  1UA5 A;  2MMN A;  4E8H A;  4JRR A;  1I5G A;  4FXY P;  4LMV A;  2FWF A;  1ML6 A;  3F63 A;  5DDL A;  4YQM A;  3UOM A;  4F03 A;  1B9Y C;  3UBK A;  3TB2 A;  4JZQ A;  2VOC A;  3FZA A;  3KMN A;  17GS A;  3FKF A;  1SK2 A;  4J2F A;  2M46 A;  3KH9 A;  3M9K A;  1H4O A;  3W6G A;  4ZBD A;  4ILF A;  3FEU A;  4YQV A;  5LNK e;  4WET A;  1GUM A;  2TRX A;  2K8V A;  3IPZ A;  1PX6 A;  1T4Z A;  1O81 A;  1EV9 A;  2LQQ A;  4HS1 A;  4FQU A;  2R6K A;  4GQC A;  1XW9 A;  4N0Z A;  3HD5 A;  1SD9 A;  5G30 A;  4L8E A;  2CX4 A;  1U3A A;  1LU4 A;  2GT6 A;  2X64 A;  1T3B A;  2FWG A;  1MDI A;  1FO5 A;  1PX7 A;  3A5W A;  1SL2 B;  4K0N A;  5JWQ B;  2CA8 A;  1N25 A;  1XW5 A;  1J0F A;  4TRX A;  1BQ7 A;  3PH9 A;  1GTI A;  5GST A;  1BF5 A;  4HJM A;  4BVX B;  5DJM A;  2QA2 A;  19GS A;  1M3J A;  5ECN B;  2H71 A;  3KZQ A;  5IPG A;  2YWO A;  2YAN A;  3HYP A;  4ZBB A;  1Z7P A;  4TR1 B;  1AQX A;  4IQA A;  3TU3 B;  1THO A;  2AJQ B;  4GDF A;  3GUS A;  1VGL A;  4ZIL A;  4EL1 A;  2WRT A;  3EUR A;  1MD3 A;  3BCI A;  4BWQ A;  4KSM A;  2LNT A;  5KN1 A;  1SK0 A;  4XS6 A;  2DJJ A;  3DGQ A;  3LFL A;  4USS A;  8GSS A;  2YWM A;  3QAV A;  3D4M A;  3CSJ A;  2H6Y A;  4FIW A;  1ERU A;  4MNN A;  4POM A;  2F51 A;  1GWC A;  2XC2 A;  2H01 A;  3A2W A;  4KX4 A;  2AAW A;  2JZT A;  1WMJ A;  2HSN B;  4A5P A;  4AKX B;  2GZP A;  5BMU B;  3DKS A;  4F9Z A;  4K9Z A;  2FHE A;  4ZB9 A;  4IEL A;  5ECH B;  1ERW A;  2ON5 A;  4O5R A;  2H19 A;  4IJ3 A;  3QCP A;  2PPT A;  4P3Y B;  4K2X A;  4OFT A;  5IMV A;  3ME7 A;  2PBJ A;  2VL2 C;  2PVQ A;  2F9S A;  5HR3 A;  4O92 A;  1WJK A;  2DJ2 A;  2H70 A;  3CQF A;  1F2E A;  2QGV A;  5LCZ A;  3FR6 A;  1U87 A;  3NZN A;  4K6X A;  5ECK B;  2JZS A;  1V40 A;  2B6M A;  2YNX A;  2V6K A;  1GSU A;  4N11 A;  3EU4 A;  1YEW C;  5INY A;  1JZO A;  2H0H A;  1F9M A;  3C8E A;  1O73 A;  3MDK A;  5IO2 A;  4ICY A;  1RQM A;  3QD9 A;  3N5O A;  3KTL A;  3P90 A;  3EMX A;  1LBK A;  2X4A A;  3ZFL A;  1K0C A;  3F4R A;  5ID2 A;  5B8A A;  13GS A;  3HVN A;  1H75 A;  3GRX A;  1PN0 A;  2I1U A;  4PNG A;  3EPT A;  3L78 A;  2WW0 A;  2H1A A;  3F3R A;  2HZE B;  4TR4 A;  4XS1 A;  2HSN A;  1QK8 A;  2JAC A;  3WGD A;  3TRX A;  5BMU A;  1K3Y A;  5D93 A;  4TVE A;  2EFC A;  3S9F A;  1FAA A;  3H79 A;  5KN3 A;  3VUR A;  1S3R A;  4PGT A;  1X5C A;  3US3 A;  1IYI A;  1TK8 B;  2XPD A;  1FVK A;  4MJC A;  4RI7 A;  3WT2 A;  2C0E A;  1A0F A;  3KP8 A;  3RPP A;  5G1K A;  3IDV A;  3IK7 A;  1O8X A;  4Z2U A;  5IMZ A;  2CQ9 A;  1MDJ A;  2C3Q A;  1XW6 A;  2YJH A;  4WR4 A;  3TUE A;  2AB6 A;  1GRX A;  2MMA A;  5E4W A;  4IQ1 A;  1ZL9 A;  1TRU A;  3KP9 A;  1EGO A;  2O5V A;  2HYX A;  1G7E A;  3I6A A;  3LXT A;  1WP0 A;  2YWN A;  1WIK A;  1K3O A;  4MH2 A;  5GSS A;  2OE0 A;  2LQO A;  3JCM L;  1G0T A;  1A0R P;  6GST A;  4QL9 A;  3GKM A;  1IYH A;  4ZXG A;  1OC3 A;  5F07 A;  4J57 E;  2OJL A;  1SD8 A;  3CYN A;  1WPI A;  4IVF A;  2VM1 A;  2YOI A;  3GFK A;  1M2D A;  4MPF A;  5LD0 A;  1USB A;  1FB0 A;  4JR6 A;  5EVO A;  2YPM A;  3FY7 A;  3TRQ A;  2XPE A;  4OO5 A;  2UV8 G;  4HI7 A;  3UBL A;  1M2B A;  3BBY A;  1DBY A;  5CP1 A;  2GT5 A;  2C0D A;  3GA4 A;  3RBT A;  4G01 A;  3TKS A;  4Q5R A;  2WZS A;  2XBI A;  5KOX A;  3LG6 A;  1FVJ A;  1HQO A;  6GSS A;  1Z3E A;  5ABR A;  3A3T A;  3LYK A;  2GGT A;  2VCV A;  4Q5Q A;  4K0G A;  1XWG A;  4KB3 A;  1TKD B;  2E7P A;  22GS A;  3VWX A;  1R26 A;  1EGR A;  2G0F A;  3CRU A;  2LJK A;  3CRT A;  2HNL A;  1TRS A;  3W8S A;  1FHE A;  1VF2 A;  4LL1 B;  4HUA A;  4D73 B;  2FCH A;  3C71 A;  1AQV A;  5JCG A;  16GS A;  2H1D A;  4ML1 A;  3TRP A;  4CY8 A;  2KP2 A;  3EU3 A;  1W4V A;  2KLX A;  4BL7 B;  1SYR A;  2Z9S A;  2HRN A;  3QR6 A;  5CRG A;  2CAI A;  1XVW A;  5J5N A;  1UVZ A;  5ELA A;  1Z6N A;  4W66 A;  5D9T A;  3KD0 A;  4MZB A;  4XRA A;  1GP1 A;  4XIH A;  4RQR A;  3LOR A;  2WVX A;  3UEM A;  1F6M C;  1TI1 A;  1NHY A;  1URM A;  4MMM A;  1SK1 A;  3HY2 A;  5G2Z A;  5A5K A;  2B1K A;  3M9J A;  2OAD A;  3VI5 A;  3GL5 A;  2ZUP A;  2TRC P;  2DJK A;  1KEB A;  2CZ2 A;  2GZY A;  2H30 A;  1M2A A;  3TOT A;  4WKW A;  1U6T A;  1K0M A;  3TOU A;  3CMI A;  4EKZ A;  5ECI B;  1TK0 B;  1YQ1 A;  4D73 A;  5FWG A;  5DCG A;  3A2X A;  1OC9 B;  3CSH A;  2DLX A;  4AKG A;  1XWK A;  1GUK A;  3G9B A;  4F2I A;  2JZR A;  3UVH A;  1PA3 A;  4PUA A;  5D8I A;  3HKR A;  3P2A A;  3DD3 A;  4TXV A;  4EIQ A;  4IBP A;  2DKH A;  4FYU A;  4BL7 A;  3RDW A;  2VD0 A;  11GS A;  1Z7R A;  1YF0 A;  4JED A;  2FUG 2;  4NV5 A;  2C8U A;  1R7H A;  1BJX A;  1JZD A;  3CTG A;  1A2J A;  5HR0 A;  3VWV A;  1T00 A;  3A2V A;  2GLR A;  4RQX A;  2GSS A;  5AIX A;  1XWB A;  5DCH A;  1GL8 A;  2K9F A;  2LRN A;  4TN8 A;  1ZGN A;  3GIX A;  1CQH A;  2LNS A;  2V32 A;  1Z5Y E;  5C00 A;  2EIQ A;  5IO0 A;  2LS5 A;  3GSS A;  2HRA A;  2WCI A;  3E3E A;  3EMP A;  3OR5 A;  2D2Z A;  4L5O A;  2FWH A;  5BRT A;  3LEF A;  4K1F A;  3O3T A;  2RM6 A;  1PKZ A;  3AY8 A;  2WW3 A;  1VRS D;  1Z9H A;  1OC9 A;  2B5X A;  2O89 A;  5DQS A;  1E2Y A;  1ZZY A;  1XVQ A;  4GRF A;  4AKH A;  1ACV A;  2ES7 A;  3GTU B;  3J7Y b;  4ZL8 A;  3HHV A;  4KCE A;  4K5R A;  1UN2 A;  1PGT A;  2HLS A;  4HU9 A;  1PSQ A;  1K0B A;  4GLT A;  2HSH A;  1GSS A;  4PTS A;  4YAV A;  1M3I A;  4I5Q A;  1X9S B;  1ZYQ B;  3CXG A;  3VLN A;  5D9W A;  5J3R A;  4KDX A;  4MZC A;  2FA4 A;  1PL2 A;  4G19 A;  1T4Y A;  3BJ5 A;  2H72 A;  4YKG A;  2K8S A;  4HOJ A;  5H5S A;  2E2G A;  1N2A A;  3VFI A;  1X5D A;  3DXB A;  2E2M A;  2DC5 A;  3K8N A;  2V6O A;  2B5E A;  3LJR A;  4KW6 A;  2O8V B;  2NTO A;  1GTU A;  4BVY A;  4HSC X;  2IME A;  1YDK A;  4EDY A;  4L0U A;  1YVL A;  2X8G A;  2P5Q A;  1A24 A;  2H0G A;  1X9M B;  3RFR C;  4WBJ A;  1G6W A;  4TW5 A;  2GDR A;  1GUH A;  1YJ6 A;  2XBQ A;  2P31 A;  2YWI A;  3FYG A;  3F4S A;  4PI2 C;  1X5E A;  3GTU A;  3GX0 A;  1JLW A;  1GSQ A;  2GTU A;  3M0F A;  3F0I A;  5FT3 A;  1TW9 A;  1XCC A;  3IC8 A;  2E0Q A;  1TJD A;  3HXS A;  1GUL A;  4OMV A;  4PXO A;  3P7X A;  1Y25 A;  1B8X A;  2VCZ A;  4OCE A;  2YJ7 A;  1ABA A;  1V57 A;  4MP4 A;  1A23 A;  4MK3 A;  4PQI A;  2OAC A;  1GSF A;  2O7K A;  2IFQ B;  4IKH A;  4MZW A;  1HD2 A;  2FLS A;  1VF1 A;  2N5F A;  1OKD A;  4GSS A;  2VKZ G;  3TJB A;  1WE0 A;  1GSY A;  3H1N A;  1ZYP A;  4DVC A;  5E59 A;  4X4J A;  3EC3 A;  2JAD A;  4F0B A;  5EPF A;  5F0G A;  4CDO A;  3DML A;  3P8W A;  5KEJ A;  4BPY A;  3Q6O A;  4F0C A;  4ZB6 A;  1JLV A;  2FGX A;  5ID2 B;  2WVZ A;  4X1U A;  2C0F A;  4PX1 A;  4L0W A;  2HSM B;  1VF3 A;  3WD6 A;  1A8L A;  3GH9 A;  2L6C A;  1QUW A;  2WDU A;  5IMA A;  5ECQ B;  1S3A A;  3I43 A;  1QFN A;  3D5J A;  4V2N A;  2AHE A;  1VF4 A;  3HJM A;  3IAM 2;  3GUR A;  1OE8 A;  3HMJ G;  4I6X A;  5IIZ A;  5DAL B;  5H5R A;  4IN0 A;  2O85 A;  4FH8 A;  2IFQ A;  2VL3 A;  2MMO A;  2A2R A;  5KN0 A;  3APS A;  1GTB A;  3LXZ A;  5CRE A;  4G0L A;  5ECS A;  3R3E A;  5J9C A;  3EYT A;  1DUG A;  1GH2 A;  5CO3 A;  2LST A;  4G9H A;  3GYK A;  4ML6 A;  2VCX A;  2YV9 A;  3PPU A;  4NHW A;  3KMO A;  6GSY A;  2EFD A;  1THX A;  2GQK A;  2VIM A;  2LEG A;  3GKX A;  2DJ3 A;  2RUF A;  3Q18 A;  1YEX A;  4NMU A;  1K3L A;  4ID0 A;  1XIY A;  2HSM A;  2A2S A;  1I9D A;  1QQ2 A;  3RGB C;  2BMX A;  2DSA A;  5A5H B;  2HXK A;  5G5F A;  3UVT A;  3Q74 A;  5COH A;  3D6I A;  3LYP A;  2I3Y A;  1EOG A;  2A4V A;  1SJI A;  4JR4 A;  3D4T A;  2UZ8 A;  3ZTL A;  1F37 A;  4V2M A;  2WJU A;  2REM A;  2WUL A;  1EP7 A;  4K7I A;  5J47 A;  3C1R A;  5DAL A;  4KF9 A;  2N5B A;  3QOU A;  1X9W B;  3M8N A;  5HFK A;  1O7U A;  1TDI A;  3EVI A;  3F9U A;  1SVO A;  5IM9 A;  3KJY A;  3APQ A;  2YV7 A;  3L9V A;  3H8Q A;  12GS A;  3DVX A;  2DIY A;  2CAQ A;  3VPQ A;  2LRC A;  1TOF A;  3HZ4 A;  5L71 A;  1JZW A;  5IQY A;  1K0D A;  5J40 A;  4FYC A;  3VI7 A;  1EZK A;  14GS A;  3UMA A;  5G31 A;  4BIK A;  3BCK A;  1PN9 A;  3E0U A;  6GSU A;  1QXH A;  3NIV A;  2ZCT A;  3ZZX A;  5B6N A;  2CZ3 A;  2H75 A;  4I97 A;  1X0R A;  2H1G A;  5A5H A;  1PD2 1;  2O3E A;  4QMK A;  5DVB A;  1AUC A;  2CVB A;  2LTK A;  5CRW A;  3GNJ A;  4X0X A;  1DE1 A;  1SEN A;  2X99 A;  5D9V A; 
#chains in the Genus database with same CATH homology
 3CSI A;  1JHB A;  1YKA A;  3WGX A;  3FK8 A;  5J41 A;  3QPM A;  4YAP A;  1WOU A;  2MBS A;  3RHC A;  1GSD A;  2VAF A;  1B48 A;  1AC1 A;  4IP6 A;  2TIR A;  3L9U A;  2CV4 A;  1K0N A;  1SJZ A;  4NV2 A;  4GF0 A;  2RUE A;  1PRX A;  3FRC A;  3FR9 A;  1V58 A;  1EOH A;  3MAK A;  5D9X A;  2DMM A;  2HRF A;  5DJL A;  2B7K A;  3IE3 A;  2HT9 A;  4Q5F A;  3LWA A;  2L6D A;  1Z6M A;  2EIO A;  3WGE A;  1FB6 A;  3F8U A;  5JWO B;  3ZFB A;  2G2Q A;  3ZIV A;  4MLY A;  2H8L A;  3MIX A;  1XXU A;  2F8F A;  2P0G A;  4IW9 A;  4L5L A;  3HDC A;  3TDG A;  5HQP A;  1AAZ A;  1R5P A;  3IRA A;  2R0P A;  2R2J A;  2B5Y A;  2PMT A;  3ZVJ A;  3IC4 A;  2HRK B;  3HJP A;  3TJG A;  2GZZ A;  2I81 A;  3HA9 A;  3LGC A;  4ACS A;  3F4T A;  2LRT A;  4MJA A;  1SL0 B;  2GS3 A;  4POB A;  4KA0 A;  3VWU A;  4EDZ A;  4AJ8 A;  4OD7 A;  5G5E A;  2JL4 A;  1K0O A;  5A1N B;  2HI7 A;  1GLP A;  3ERF A;  1AIU A;  4XTS A;  3J7Y k;  3KTB A;  2B7J A;  3ED3 A;  1M99 A;  1TU8 A;  4GSN A;  2PUK C;  1AXD A;  4ZB7 A;  3HVV A;  3TJK A;  2MZC A;  1WWJ A;  4WXT A;  2JSY A;  4OFM A;  1PL1 A;  2OBI A;  1CQG A;  2DBC A;  3H93 A;  1KBN A;  3E9J B;  5C04 A;  4CHS A;  2EFH A;  2R5G A;  4TR0 A;  5HR1 A;  5A4W A;  5ELG A;  4YKF A;  1TI3 A;  3M1G A;  1GNW A;  2HRK A;  2H66 A;  3GH6 A;  3Q19 A;  5HFG A;  4AJ6 A;  4V1A p;  1M0U A;  4ZL7 A;  1U88 A;  3RAZ A;  3QFA C;  4XHM A;  3FHK A;  4POK A;  1OKT A;  3FZ5 A;  1K0A A;  2C3T A;  3KEB A;  4MH3 A;  4OCF A;  2NBS A;  3ERW A;  3CWG A;  4AI6 A;  3DVW A;  4PUR A;  4EXJ A;  5A1N A;  3V1W A;  5B7C A;  3O76 A;  2FWE A;  2EFE A;  4FO5 A;  1T8E B;  3ZRD A;  1KTE A;  2H1L A;  3QDN A;  2V41 A;  4MAB A;  1B4Q A;  2EC4 A;  1RW1 A;  2X49 A;  1FG4 A;  5IOW A;  1DE2 A;  2I4A A;  3HCZ A;  2N5A A;  1EP8 A;  1O85 A;  1O6J A;  2DJ0 A;  4MF6 A;  5J9B A;  5JCW A;  2KP1 A;  2EIR A;  4BVY B;  3IR4 A;  5ECL B;  2CX3 A;  1LJR A;  2GQL A;  3TJJ A;  3KIJ A;  3CBU A;  3TGZ A;  7GSS A;  4GXZ A;  1Y1U A;  4KDY A;  2IMF A;  3ISO A;  1MEK A;  4MCU A;  1BG5 A;  1OAZ A;  2DJ1 A;  1YZX A;  4V1A g;  4RUV A;  1UC7 A;  4MJE A;  1MD4 A;  1BED A;  3QAG A;  2DKI A;  4OWY A;  3ERG A;  4GTU A;  4O32 A;  2IIY A;  1Y6E A;  2XHF A;  3QAW A;  2DML A;  4TR3 A;  2B3S A;  3KXO A;  3PR8 A;  1NSW A;  4AGS A;  1RK4 A;  2IWT A;  2JU5 A;  3GST A;  4N10 A;  2VCW A;  5D73 A;  5CRD A;  4DEJ A;  5DAK B;  2VL2 A;  1SVL A;  4K8M A;  4KCA A;  3LQ7 A;  1KNG A;  1TK5 B;  1EEM A;  1R5A A;  3IBH A;  1E6B A;  18GS A;  2LJR A;  2NPB A;  1MDK A;  2BJX A;  2PWJ A;  3F6F A;  3ZL5 A;  5GAP D;  4LA1 A;  4HZ2 A;  5A4V A;  2AYT A;  1XOA A;  4N3Z A;  3IHG A;  2L59 A;  4NWY A;  1SU9 A;  1SVM A;  3DIE A;  3APO A;  3UJ1 A;  1ZOF A;  1ERT A;  2V2G A;  3HZ8 A;  2H6Z A;  1JFU A;  20GS A;  1XBS A;  1MTC A;  3TKR A;  1FW1 A;  4HJ2 A;  4WEY A;  4Z2T A;  2QC7 A;  4BA7 A;  1XWC A;  2QA1 A;  4XS4 B;  2IMK A;  1YKC A;  3G7I A;  5AN1 A;  4MA9 A;  2H74 A;  3MNG A;  2IJY A;  4GST A;  3WYW A;  4EF0 A;  3HVS A;  4NHZ A;  4PQH A;  3C73 A;  1HNA A;  3TKP A;  5DAK A;  3EWL A;  5ECP B;  5AIV A;  1B4P A;  1A2L A;  2C80 A;  4ECJ A;  1B9X C;  3KH7 A;  1YEP A;  5IMD A;  4IJI A;  2HSY A;  3ZIT A;  1YY7 A;  5J4V A;  5DBQ A;  1SL1 B;  2IMD A;  2YP6 A;  4J56 E;  2OBK A;  4PNF A;  2HFD A;  4KGI A;  4MPG A;  5KN2 A;  1FOH A;  4KND A;  4KDU A;  2J23 A;  2CVK A;  5CRH A;  4Z7X A;  5HFI A;  1DSB A;  2ON7 A;  1XOB A;  2CT6 A;  1XFL A;  2M80 A;  4MF5 A;  3GV1 A;  4ZB8 A;  3R2Q A;  2WFC A;  4I2U A;  5ECR B;  2J9H A;  2GVP A;  3M3M A;  4KE3 A;  2IPA A;  4XS4 A;  5CNW A;  10GS A;  1PKW A;  1AW9 A;  4GWR A;  4AF2 A;  2KUC A;  4K7O A;  3EE2 A;  2VO4 A;  9GSS A;  2FY6 A;  1BG1 A;  5ECO B;  2H73 A;  4HDE A;  6GSV A;  5GZZ B;  3ZMK A;  4KUN A;  2HZF A;  3FR3 A;  1F3A A;  5EY6 A;  1WRY A;  1SKW B;  2IMI A;  2R0G A;  3BD2 A;  2WS2 A;  2OE3 A;  2KHP A;  4DSQ A;  3ZLP A;  2PGT A;  4LLR A;  2VLU A;  3HVX A;  3GKN A;  5B8B A;  4AKI A;  4OFN A;  3IV4 A;  2YN1 A;  2K18 A;  1TRV A;  2L5O A;  1EEJ A;  2A4H A;  1C72 A;  4E68 A;  1A8Y A;  3H4K A;  5CYY A;  4OO4 A;  4BVX A;  1V98 A;  1Q98 A;  1BAY A;  1OC8 A;  3TKS E;  2R0C A;  4LMW A;  2L4C A;  3U6V A;  4WBR D;  2C3N A;  2BTO T;  2ALB A;  3I9V 2;  1G7O A;  4TR1 A;  3NOF A;  2VLV A;  4NXI A;  2WZ9 A;  2C0G A;  1EV4 A;  4TOP A;  3IOS A;  4HQZ A;  1S3C A;  5KOW A;  5F06 A;  5A34 B;  1GSE A;  2OKA A;  3C1S A;  4X43 A;  4ULX A;  1GLQ A;  2AV4 A;  4EVM A;  2OT3 A;  5IOX A;  3WT1 A;  2YZU A;  1EWX A;  5IPH A;  4HZ4 A;  3IXR A;  5HR2 A;  4MDC A;  2LKU A;  3GMF A;  2B1L A;  4ISD A;  4ZIJ A;  5GAN D;  5F8B A;  4I8B A;  4MF7 A;  3VPT A;  3KM6 A;  2H6X A;  3MYD A;  2VLT A;  5B6M A;  3A5I A;  1ZYN A;  4N30 A;  4FYB A;  3D21 A;  2MYG A;  5J4U A;  4Z2R A;  4G10 A;  1W89 A;  2PER A;  1GNE A;  3BOA A;  2LJA A;  3ZIJ A;  2L4Q A;  2RLI A;  2M72 A;  2VL9 A;  1AQW A;  1ST9 A;  2FA8 A;  4HU7 A;  1R4W A;  4XCS A;  4XRD A;  1TXX A;  2O87 A;  1OYJ A;  3DWV A;  1T1V A;  3SBC A;  4KAE A;  3L0H A;  4NPB A;  2QSI A;  5A34 A;  3SWL A;  4BWS A;  2IN3 A;  3MWH A;  2IL3 A;  3TKQ A;  3GL3 A;  2GQM A;  1A2M A;  2OA7 A;  3F6D A;  4EO3 A;  3LSZ A;  3FMW A;  1S3D A;  3L9S A;  2FNO A;  2I9H A;  3W8J A;  2FD3 A;  3DYR A;  4ECC A;  2HZE A;  4V2L A;  2AUV A;  2YCD A;  5ENU A;  2A2P A;  4K5S A;  4G2E A;  3O6T A;  3KCM A;  3GX8 A;  1FOV A;  4EC0 A;  4WF5 A;  4DSS B;  2GSR A;  1XPV A;  1QMV A;  1SYX A;  4E8E A;  4JU5 A;  1TXU A;  2GSQ A;  2VD1 A;  4HQS A;  3HJO A;  5FHI A;  2C1Y A;  1BYE A;  3ZVJ D;  4F82 A;  2GST A;  4HEA 2;  4Q5N A;  1XZO A;  2X8C A;  4IHU A;  4CW9 A;  1M9A A;  4MJB A;  2MMZ A;  2X8H A;  5CAX A;  2HQT A;  2PVO C;  2H76 A;  3TJF A;  1J08 A;  4GCI A;  3MSZ A;  4NAX A;  1ZCP A;  2RM5 A;  2VCT A;  1SJ6 A;  2V1M A;  5IMC A;  2L5L A;  4IP1 A;  3G7J A;  1ZYE A;  4KH7 A;  3RPN A;  1ILO A;  3PGT A;  3UL3 A;  3KGK A;  2PN8 A;  3I69 A;  1J9B A;  5DQY A;  5G1L A;  2QKE A;  3ZYW A;  2NDO A;  5ECM B;  2JSZ A;  2C4J A;  3ZRE A;  1PMT A;  1V2A A;  1HYU A;  2LV3 A;  3IA1 A;  1TTZ A;  4O7H A;  5D96 A;  3L4N A;  3DRN A;  1QGV A;  3FW2 A;  4YQU A;  4DSS A;  2R37 A;  4PQ1 A;  2DIZ A;  3IAS 2;  1U3I A;  4POL A;  3FZ4 A;  3C7M A;  4ECB A;  4RI6 A;  3G7Y A;  4G0I A;  1HNC A;  5IMF A;  3VK9 A;  4H86 A;  2R3X A;  2HE3 A;  2WGR A;  1YF1 A;  4JE1 A;  3D0Z A;  3PIN A;  4LL4 B;  2WB9 A;  5J4Y A;  5JWR B;  3RHB A;  6GSW A;  4WF4 A;  3D22 A;  2H1B A;  4EIP A;  5AIS A;  1SKR B;  3QMX A;  1G6Y A;  1TP9 A;  5H5Q A;  2VM2 A;  2VUP A;  1T7P B;  4EE0 A;  3IK9 A;  2LUS A;  1F3B A;  4K2D A;  3ME8 A;  4CY6 A;  4O5U A;  2CVD A;  2H0I A;  4N0V A;  1TU7 A;  1XWA A;  4WR5 A;  3CTF A;  4PUF C;  2MBT A;  4TXO B;  1HNB A;  1JZR A;  1ON4 A;  1GTA A;  2P5R A;  1PQN A;  4AJ7 A;  4KSO A;  4I2T A;  1N8J A;  3LW9 A;  3UAR A;  4QL7 A;  2RII A;  2ZNM A;  4YH2 A;  2L57 A;  3GHA A;  2OE1 A;  1NW2 A;  4ZBA A;  2PU9 C;  1ERV A;  1OE7 A;  3VWW A;  4O5Q A;  5A4U A;  3TKS C;  4QQ7 A;  3FZ9 A;  3QFB C;  1ZMA A;  4K7N A;  2F3M A;  2VCQ A;  5AGY A;  4ZL9 A;  4IS0 A;  2NVL A;  5EL8 A;  4IGJ A;  3ZML A;  2YZH A;  3GKK A;  3UIW A;  3EIN A;  2F8A A;  1O8W A;  4G0K A;  4JBB A;  4TKY A;  1BX9 A;  1SKS B;  3U5R E;  1M9B A;  3TCO A;  2KOK A;  3DEX A;  1NHO A;  2R4V A;  5F05 A;  1TRW A;  4ECI A;  1Q4J A;  5JCU A;  2K6V A;  1NM3 A;  3F3Q A;  4TXO A;  3GN3 A;  3IHQ A;  4DSR A;  4GQF A;  1V9W A;  3N9J A;  1M7T A;  3UAP A;  6GSX A;  4EUY A;  1OVN A;  1UA5 A;  2MMN A;  4E8H A;  4JRR A;  1I5G A;  4LMV A;  2FWF A;  1ML6 A;  3F63 A;  5DDL A;  4YQM A;  3UOM A;  4F03 A;  1B9Y C;  3UBK A;  3TB2 A;  4JZQ A;  2VOC A;  3FZA A;  3KMN A;  17GS A;  3FKF A;  1SK2 A;  4J2F A;  2M46 A;  3KH9 A;  3M9K A;  1H4O A;  3W6G A;  4ZBD A;  4ILF A;  3FEU A;  4YQV A;  5LNK e;  4WET A;  1GUM A;  2TRX A;  2K8V A;  3IPZ A;  1PX6 A;  1T4Z A;  1O81 A;  1EV9 A;  2LQQ A;  4HS1 A;  4FQU A;  2R6K A;  4GQC A;  1XW9 A;  4N0Z A;  3HD5 A;  1SD9 A;  5G30 A;  4L8E A;  2CX4 A;  1U3A A;  1LU4 A;  2GT6 A;  2X64 A;  1T3B A;  2FWG A;  1MDI A;  1FO5 A;  1PX7 A;  3A5W A;  1SL2 B;  4K0N A;  5JWQ B;  2CA8 A;  1N25 A;  1XW5 A;  1J0F A;  4TRX A;  1BQ7 A;  3PH9 A;  1GTI A;  5GST A;  1BF5 A;  4HJM A;  4BVX B;  5DJM A;  2QA2 A;  19GS A;  5ECN B;  2H71 A;  3KZQ A;  5IPG A;  2YWO A;  2YAN A;  3HYP A;  4ZBB A;  1Z7P A;  4TR1 B;  1AQX A;  4IQA A;  3TU3 B;  1THO A;  2AJQ B;  4GDF A;  3GUS A;  1VGL A;  4ZIL A;  4EL1 A;  2WRT A;  3EUR A;  1MD3 A;  3BCI A;  4BWQ A;  4KSM A;  2LNT A;  5KN1 A;  1SK0 A;  4XS6 A;  2DJJ A;  3DGQ A;  3LFL A;  4USS A;  8GSS A;  2YWM A;  3QAV A;  3D4M A;  3CSJ A;  2H6Y A;  4FIW A;  1ERU A;  4MNN A;  4POM A;  2F51 A;  1GWC A;  2XC2 A;  2H01 A;  3A2W A;  4KX4 A;  2AAW A;  2JZT A;  1WMJ A;  2HSN B;  4A5P A;  4AKX B;  2GZP A;  5BMU B;  3DKS A;  4F9Z A;  4K9Z A;  2FHE A;  4ZB9 A;  4IEL A;  5ECH B;  1ERW A;  2ON5 A;  4O5R A;  2H19 A;  4IJ3 A;  3QCP A;  2PPT A;  4P3Y B;  4K2X A;  4OFT A;  5IMV A;  3ME7 A;  2PBJ A;  2VL2 C;  2PVQ A;  2F9S A;  5HR3 A;  4O92 A;  1WJK A;  2DJ2 A;  2H70 A;  1F2E A;  2QGV A;  5LCZ A;  3FR6 A;  1U87 A;  3NZN A;  4K6X A;  5ECK B;  2JZS A;  1V40 A;  2B6M A;  2YNX A;  2V6K A;  1GSU A;  4N11 A;  3EU4 A;  5INY A;  1JZO A;  2H0H A;  1F9M A;  3C8E A;  1O73 A;  3MDK A;  5IO2 A;  4ICY A;  1RQM A;  3QD9 A;  3N5O A;  3KTL A;  3P90 A;  3EMX A;  1LBK A;  2X4A A;  3ZFL A;  1K0C A;  3F4R A;  5ID2 A;  5B8A A;  13GS A;  1H75 A;  3GRX A;  1PN0 A;  2I1U A;  4PNG A;  3EPT A;  3L78 A;  2H1A A;  3F3R A;  2HZE B;  4TR4 A;  4XS1 A;  2HSN A;  1QK8 A;  2JAC A;  3WGD A;  3TRX A;  5BMU A;  1K3Y A;  5D93 A;  4TVE A;  2EFC A;  3S9F A;  1FAA A;  3H79 A;  5KN3 A;  3VUR A;  4PGT A;  1X5C A;  3US3 A;  1IYI A;  1TK8 B;  2XPD A;  1FVK A;  4MJC A;  4RI7 A;  3WT2 A;  2C0E A;  1A0F A;  3KP8 A;  3RPP A;  5G1K A;  3IDV A;  3IK7 A;  1O8X A;  4Z2U A;  5IMZ A;  2CQ9 A;  1MDJ A;  2C3Q A;  1XW6 A;  2YJH A;  4WR4 A;  3TUE A;  2AB6 A;  1GRX A;  2MMA A;  5E4W A;  4IQ1 A;  1ZL9 A;  1TRU A;  3KP9 A;  1EGO A;  2O5V A;  2HYX A;  1G7E A;  3I6A A;  3LXT A;  1WP0 A;  2YWN A;  1WIK A;  1K3O A;  4MH2 A;  5GSS A;  2OE0 A;  2LQO A;  3JCM L;  1G0T A;  1A0R P;  6GST A;  4QL9 A;  3GKM A;  1IYH A;  4ZXG A;  1OC3 A;  5F07 A;  4J57 E;  2OJL A;  1SD8 A;  3CYN A;  1WPI A;  4IVF A;  2VM1 A;  2YOI A;  3GFK A;  1M2D A;  4MPF A;  5LD0 A;  1USB A;  1FB0 A;  4JR6 A;  5EVO A;  2YPM A;  3FY7 A;  3TRQ A;  2XPE A;  4OO5 A;  2UV8 G;  4HI7 A;  3UBL A;  1M2B A;  3BBY A;  1DBY A;  5CP1 A;  2GT5 A;  2C0D A;  3GA4 A;  3RBT A;  4G01 A;  3TKS A;  4Q5R A;  2XBI A;  5KOX A;  3LG6 A;  1FVJ A;  1HQO A;  6GSS A;  1Z3E A;  5ABR A;  3A3T A;  3LYK A;  2GGT A;  2VCV A;  4Q5Q A;  4K0G A;  1XWG A;  4KB3 A;  1TKD B;  2E7P A;  22GS A;  3VWX A;  1R26 A;  1EGR A;  2G0F A;  3CRU A;  2LJK A;  3CRT A;  2HNL A;  1TRS A;  3W8S A;  1FHE A;  1VF2 A;  4LL1 B;  4HUA A;  4D73 B;  2FCH A;  3C71 A;  1AQV A;  5JCG A;  16GS A;  2H1D A;  4ML1 A;  3TRP A;  4CY8 A;  2KP2 A;  3EU3 A;  1W4V A;  2KLX A;  4BL7 B;  1SYR A;  2Z9S A;  2HRN A;  3QR6 A;  5CRG A;  2CAI A;  1XVW A;  5J5N A;  1UVZ A;  5ELA A;  1Z6N A;  4W66 A;  5D9T A;  3KD0 A;  4MZB A;  4XRA A;  1GP1 A;  4XIH A;  4RQR A;  3LOR A;  3UEM A;  1F6M C;  1TI1 A;  1NHY A;  1URM A;  4MMM A;  1SK1 A;  3HY2 A;  5G2Z A;  5A5K A;  2B1K A;  3M9J A;  2OAD A;  3VI5 A;  3GL5 A;  2ZUP A;  2TRC P;  2DJK A;  1KEB A;  2CZ2 A;  2GZY A;  2H30 A;  1M2A A;  3TOT A;  4WKW A;  1U6T A;  1K0M A;  3TOU A;  3CMI A;  4EKZ A;  5ECI B;  1TK0 B;  1YQ1 A;  4D73 A;  5FWG A;  5DCG A;  3A2X A;  1OC9 B;  3CSH A;  2DLX A;  4AKG A;  1XWK A;  1GUK A;  3G9B A;  4F2I A;  2JZR A;  3UVH A;  1PA3 A;  4PUA A;  5D8I A;  3HKR A;  3P2A A;  3DD3 A;  4TXV A;  4EIQ A;  4IBP A;  2DKH A;  4FYU A;  4BL7 A;  3RDW A;  2VD0 A;  11GS A;  1Z7R A;  1YF0 A;  4JED A;  2FUG 2;  4NV5 A;  2C8U A;  1R7H A;  1BJX A;  1JZD A;  3CTG A;  1A2J A;  5HR0 A;  3VWV A;  1T00 A;  3A2V A;  2GLR A;  4RQX A;  2GSS A;  5AIX A;  1XWB A;  5DCH A;  1GL8 A;  2K9F A;  2LRN A;  4TN8 A;  1ZGN A;  3GIX A;  1CQH A;  2LNS A;  2V32 A;  1Z5Y E;  5C00 A;  2EIQ A;  5IO0 A;  2LS5 A;  3GSS A;  2HRA A;  2WCI A;  3E3E A;  3EMP A;  3OR5 A;  2D2Z A;  4L5O A;  2FWH A;  5BRT A;  3LEF A;  4K1F A;  3O3T A;  2RM6 A;  1PKZ A;  3AY8 A;  1VRS D;  1Z9H A;  1OC9 A;  2B5X A;  2O89 A;  5DQS A;  1E2Y A;  1ZZY A;  1XVQ A;  4GRF A;  4AKH A;  1ACV A;  2ES7 A;  3GTU B;  3J7Y b;  4ZL8 A;  3HHV A;  4KCE A;  4K5R A;  1UN2 A;  1PGT A;  2HLS A;  4HU9 A;  1PSQ A;  1K0B A;  4GLT A;  2HSH A;  1GSS A;  4PTS A;  4YAV A;  4I5Q A;  1X9S B;  1ZYQ B;  3CXG A;  3VLN A;  5D9W A;  5J3R A;  4KDX A;  4MZC A;  2FA4 A;  1PL2 A;  4G19 A;  1T4Y A;  3BJ5 A;  2H72 A;  4YKG A;  2K8S A;  4HOJ A;  5H5S A;  2E2G A;  1N2A A;  3VFI A;  1X5D A;  3DXB A;  2E2M A;  2DC5 A;  3K8N A;  2V6O A;  2B5E A;  3LJR A;  4KW6 A;  2O8V B;  2NTO A;  1GTU A;  4BVY A;  2IME A;  1YDK A;  4EDY A;  4L0U A;  1YVL A;  2X8G A;  2P5Q A;  1A24 A;  2H0G A;  1X9M B;  4WBJ A;  1G6W A;  4TW5 A;  2GDR A;  1GUH A;  1YJ6 A;  2XBQ A;  2P31 A;  2YWI A;  3FYG A;  3F4S A;  1X5E A;  3GTU A;  3GX0 A;  1JLW A;  1GSQ A;  2GTU A;  3M0F A;  3F0I A;  5FT3 A;  1TW9 A;  1XCC A;  3IC8 A;  2E0Q A;  1TJD A;  3HXS A;  1GUL A;  4OMV A;  4PXO A;  3P7X A;  1Y25 A;  1B8X A;  2VCZ A;  4OCE A;  2YJ7 A;  1ABA A;  1V57 A;  4MP4 A;  1A23 A;  4MK3 A;  4PQI A;  2OAC A;  1GSF A;  2O7K A;  2IFQ B;  4IKH A;  4MZW A;  1HD2 A;  2FLS A;  1VF1 A;  2N5F A;  1OKD A;  4GSS A;  2VKZ G;  3TJB A;  1WE0 A;  1GSY A;  3H1N A;  1ZYP A;  4DVC A;  5E59 A;  4X4J A;  3EC3 A;  2JAD A;  4F0B A;  5EPF A;  5F0G A;  4CDO A;  3DML A;  3P8W A;  5KEJ A;  4BPY A;  3Q6O A;  4F0C A;  4ZB6 A;  1JLV A;  2FGX A;  5ID2 B;  4X1U A;  2C0F A;  4PX1 A;  4L0W A;  2HSM B;  1VF3 A;  3WD6 A;  1A8L A;  3GH9 A;  2L6C A;  1QUW A;  2WDU A;  5IMA A;  5ECQ B;  1S3A A;  3I43 A;  1QFN A;  3D5J A;  4V2N A;  2AHE A;  1VF4 A;  3HJM A;  3IAM 2;  3GUR A;  1OE8 A;  3HMJ G;  4I6X A;  5IIZ A;  5DAL B;  5H5R A;  4IN0 A;  2O85 A;  4FH8 A;  2IFQ A;  2VL3 A;  2MMO A;  2A2R A;  5KN0 A;  3APS A;  1GTB A;  3LXZ A;  5CRE A;  4G0L A;  5ECS A;  3R3E A;  5J9C A;  3EYT A;  1DUG A;  1GH2 A;  5CO3 A;  2LST A;  4G9H A;  3GYK A;  4ML6 A;  2VCX A;  2YV9 A;  3PPU A;  4NHW A;  3KMO A;  6GSY A;  2EFD A;  1THX A;  2GQK A;  2VIM A;  2LEG A;  3GKX A;  2DJ3 A;  2RUF A;  3Q18 A;  1YEX A;  4NMU A;  1K3L A;  4ID0 A;  1XIY A;  2HSM A;  2A2S A;  1I9D A;  1QQ2 A;  2BMX A;  2DSA A;  5A5H B;  2HXK A;  5G5F A;  3UVT A;  3Q74 A;  5COH A;  3D6I A;  3LYP A;  2I3Y A;  1EOG A;  2A4V A;  1SJI A;  4JR4 A;  3D4T A;  2UZ8 A;  3ZTL A;  1F37 A;  4V2M A;  2WJU A;  2REM A;  2WUL A;  1EP7 A;  4K7I A;  5J47 A;  3C1R A;  5DAL A;  4KF9 A;  2N5B A;  3QOU A;  1X9W B;  3M8N A;  5HFK A;  1O7U A;  1TDI A;  3EVI A;  3F9U A;  1SVO A;  5IM9 A;  3KJY A;  3APQ A;  2YV7 A;  3L9V A;  3H8Q A;  12GS A;  3DVX A;  2DIY A;  2CAQ A;  3VPQ A;  2LRC A;  1TOF A;  3HZ4 A;  5L71 A;  1JZW A;  5IQY A;  1K0D A;  5J40 A;  4FYC A;  3VI7 A;  1EZK A;  14GS A;  3UMA A;  5G31 A;  3BCK A;  1PN9 A;  3E0U A;  6GSU A;  1QXH A;  3NIV A;  2ZCT A;  3ZZX A;  5B6N A;  2CZ3 A;  2H75 A;  4I97 A;  1X0R A;  2H1G A;  5A5H A;  1PD2 1;  4QMK A;  5DVB A;  1AUC A;  2CVB A;  2LTK A;  5CRW A;  3GNJ A;  4X0X A;  1DE1 A;  1SEN A;  2X99 A;  5D9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...