5ECSA

Crystal structure of fip1 with gsh
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
214
structure length
214
Chain Sequence
b'LPILLDYWPSMFGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVAYAAEYRKNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase U20
publication title Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 87
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5ecsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5ecsA01
22GSA 2PVQA 1A8YA 1ZOFA 5ECQB 3KMOA 4OCEA 1TTZA 4QL7A 3UBKA 1YKAA 2DMLA 3PH9A 3CBUA 2HSMB 2B1KA 3TOUA 3UAPA 4ZBAA 3IAS2 4NHZA 13GSA 2IJYA 3GTUA 4XS4A 1XWCA 3CSHA 2H0IA 4BA7A 3LGCA 4G0IA 3VWWA 2TIRA 3E9JB 4MPGA 3HJOA 1Y25A 1SL0B 4KCEA 3HY2A 1T3BA 4ZILA 4KAEA 2JACA 3KXOA 4ECIA 3A2XA 2IMIA 1SL2B 4MF5A 3GFKA 4OFTA 5CYYA 5E59A 3KP8A 1E6BA 3EURA 2J9HA 4MLYA 3ISOA 2M46A 5JWRB 2OE0A 1IYIA 5D9XA 5IQYA 5D9WA 3ZMKA 3O3TA 2PU9C 4Q5NA 2GZYA 2VO4A 2NBSA 3RHBA 3IOSA 4MF6A 3I9V2 4KE3A 5J4UA 1XIYA 6GSSA 1OKTA 2VCZA 6GSXA 3IC4A 3A2WA 1U88A 4V2NA 3Q19A 4BVXB 3RBTA 2I9HA 1U3AA 2YJ7A 1GSDA 2DJ1A 2WB9A 3W8SA 1KTEA 1ZYQB 5G31A 1Z9HA 4TXOA 2C4JA 1GL8A 4N10A 5EL8A 2DJ3A 1QK8A 1DE1A 1PGTA 2DJ2A 4FO5A 4KNDA 4XIHA 1V57A 4HI7A 1TKDB 2H70A 3F3RA 1DUGA 5F06A 1PD21 3ZFBA 3GKNA 5ID2B 1K3LA 1N2AA 2FA4A 2LNTA 2O85A 3KEBA 2B5YA 2X64A 4PNFA 3FZ4A 1FW1A 5G30A 3TJBA 2M72A 1B4QA 3Q6OA 1RW1A 3RPPA 4HEA2 2JU5A 1LJRA 2LKUA 3FYGA 2I3YA 2IIYA 1Y6EA 2GQLA 5J3RA 2FWHA 1AXDA 1OC9B 4N11A 4TR1B 2VD0A 3R3EA 2IMDA 3DKSA 4POBA 5FWGA 2AAWA 4OFMA 2H6YA 2GSRA 2ZCTA 4E8HA 2GVPA 3D4TA 1OYJA 3GIXA 1MD4A 1PL1A 3EWLA 3RPNA 2KHPA 2I81A 5DALB 3CYNA 2A2RA 1WIKA 3HJPA 5EY6A 2CV4A 4FYUA 3TCOA 3GSSA 1HD2A 4G10A 1FB0A 4OO4A 4EE0A 3L0HA 5ECOB 4GSTA 4KW6A 4WKWA 2YP6A 2YWMA 4NV2A 3NIVA 4XS1A 2RM5A 2QGVA 5EVOA 3PINA 1FOVA 1A2MA 1VF3A 1OC8A 3EE2A 3TKSC 1T4YA 1QXHA 1EOGA 10GSA 4JZQA 1K3YA 2CVKA 1UN2A 3ZRDA 3GV1A 2VCVA 4IGJA 1Q4JA 2CQ9A 3UARA 4ZBBA 3DWVA 4BWQA 3EMPA 2QSIA 1BYEA 2YANA 1XOAA 3LWAA 4O32A 3U6VA 2C3QA 2A4VA 1GSYA 3BCIA 4WF4A 4JEDA 1M2AA 5ELGA 2X8HA 2EIQA 5HQPA 3D21A 4KA0A 2FA8A 2X8CA 3S9FA 2GLRA 1XOBA 5IOXA 3H4KA 2FUG2 4RI6A 3HXSA 3J7Yk 2H6XA 1H75A 1O8XA 1A23A 1OE8A 4ACSA 2FD3A 5GSTA 1ON4A 3KH9A 4WXTA 1MDIA 4Z7XA 4ZL7A 5ENUA 2B7JA 3GH6A 2H19A 4TKYA 3M1GA 2OACA 1X5CA 1SK1A 3VI7A 1DBYA 3KMNA 2VCWA 5HFKA 1ILOA 3GTUB 5CRHA 3TKPA 1K0DA 4XHMA 4XS4B 3TJFA 4LMVA 3ERWA 2F9SA 1X9MB 2LEGA 4PQ1A 3QCPA 2EIRA 4MJBA 2XPEA 2ZNMA 3DIEA 3LXTA 4KH7A 5IMCA 5B8AA 2KUCA 2B7KA 2AJQB 4ILFA 4ZXGA 3CSJA 1GTBA 1BAYA 1O7UA 3GKXA 4QQ7A 5IIZA 3FR3A 2ALBA 3UOMA 1LU4A 2C3TA 1X9SB 2N5FA 3L9VA 3RDWA 5ECRB 3QOUA 4LA1A 4WETA 3C71A 2OE1A 1HNCA 3CSIA 2LQOA 1A2JA 3M0FA 1K3OA 2M80A 3E0UA 1K0AA 2H1GA 5JCGA 1IYHA 3CTFA 5CRGA 3KIJA 3F4TA 2PGTA 3SWLA 4HQZA 2RUFA 1G6YA 2WFCA 3FEUA 1UC7A 2XPDA 4MPFA 4GWRA 4HOJA 1TI3A 1B48A 4LL1B 3ZTLA 3TRQA 2NVLA 4GQCA 3CTGA 5E4WA 4MCUA 3FR6A 1JHBA 2MMAA 2HSYA 3QFBC 6GSYA 1A8LA 1SK2A 3N5OA 1KEBA 1A0FA 1ZL9A 5D93A 5HR0A 6GSVA 3C1RA 3M3MA 4EUYA 1CQHA 2V32A 4J2FA 4L8EA 2VIMA 1FVJA 2V1MA 2HXKA 3PR8A 4IHUA 1NHOA 2H0GA 3U5RE 1GTUA 4JR6A 2H72A 3P8WA 2ZUPA 3KZQA 2FCHA 4YQMA 1T7PB 1R26A 3TJJA 4K7OA 1GP1A 4IBPA 2KOKA 2OKAA 4YAPA 2L6CA 2JL4A 3EVIA 3LSZA 4BL7A 2FGXA 1XXUA 2YV7A 3F6DA 5L71A 2REMA 5B7CA 3FZAA 2VM2A 1SKWB 1O6JA 4K0NA 2XBQA 3LXZA 4PQHA 3KP9A 1YEPA 5COHA 4DSQA 2YCDA 3KTBA 2XHFA 3MNGA 3LQ7A 5H5RA 1J9BA 3ZVJD 2MBSA 4D73A 2R4VA 3I69A 4EDZA 1I5GA 3BBYA 2FLSA 3GURA 4IVFA 1BG5A 1VGLA 4GF0A 2AV4A 2P5RA 3LFLA 5AIVA 1XVWA 4L0UA 2AB6A 2QKEA 2DSAA 1PKZA 1ERVA 1QUWA 4O5RA 1G7EA 1K0MA 4WEYA 3ZIJA 1XCCA 2K18A 4KX4A 1YF0A 3E3EA 3LYPA 1X5DA 2HRKA 1EV4A 3VWVA 4AJ8A 2JSYA 5JCWA 2VLVA 1U87A 3QPMA 2G0FA 2F51A 4G9HA 4IJ3A 2K8SA 3GKKA 3ZL5A 1XW9A 4H86A 2X99A 1AQVA 3O76A 4ECBA 1F9MA 4PXOA 5A4UA 5GSSA 4TR3A 4EL1A 1GRXA 4GXZA 3DVXA 1Z3EA 4IN0A 2YWNA 2LJAA 4K7IA 5B6NA 4POMA 4ZBDA 4BWSA 4MZCA 4ZIJA 2D2ZA 4BVYA 1QMVA 4XRAA 4XCSA 4TRXA 14GSA 2YV9A 2BMXA 4MH2A 3W6GA 1X0RA 3UMAA 2VUPA 6GSTA 2VM1A 2WZ9A 2R5GA 2DIYA 1GSEA 1TOFA 5J41A 5HR1A 3QDNA 3G7JA 1EGOA 2LRTA 5FHIA 3HD5A 1SENA 3EC3A 3VWXA 1LBKA 3GL3A 4L0WA 2LS5A 4FQUA 1B9XC 1Z7PA 4YH2A 1TRSA 3FRCA 2NTOA 5DCGA 2ON7A 4F2IA 4NMUA 3J7Yb 4KCAA 2OA7A 4Q5QA 2MMOA 2FWEA 20GSA 3GRXA 5CREA 2H01A 2TRCP 5IO0A 2V2GA 4EC0A 1N8JA 3GA4A 4G0LA 2CVBA 1THOA 2GT6A 3IHQA 1XWKA 2G2QA 1VRSD 3LJRA 3VK9A 4K7NA 2O87A 3JCML 4RI7A 2RIIA 3VFIA 5H5SA 3WGXA 1O81A 3VI5A 4YQVA 4I2TA 5HR3A 3DMLA 4LLRA 1AQXA 1I9DA 2YJHA 5DJMA 4PNGA 1EWXA 4TR4A 1V58A 3IAM2 3TUEA 1A24A 1AC1A 5ECSA 2O8VB 2HFDA 3TKSE 2GSQA 4GSNA 6GSWA 3C8EA 3HDCA 4IJIA 5G1KA 3Q18A 1SK0A 1MD3A 3DXBA 2C0GA 2LTKA 4IKHA 5IOWA 5CAXA 2F8FA 2HSNB 3D5JA 4ISDA 5G5EA 2GZZA 1SD8A 2DBCA 2B6MA 2H74A 4CHSA 4NWYA 4TXVA 4F82A 5D9TA 4V2LA 2DMMA 3F3QA 2OBIA 1GLPA 4MK3A 1S3DA 3MWHA 1R7HA 4DVCA 1FB6A 3EMXA 4PUAA 18GSA 3KTLA 4EDYA 4BPYA 2LRCA 1VF1A 4J57E 5FT3A 1FHEA 4KDYA 4MJEA 3IV4A 4TW5A 2VCXA 4RUVA 2PN8A 4N0ZA 2DJKA 4JE1A 3QAGA 5G2ZA 1T4ZA 1HYUA 4K6XA 5ECIB 2GGTA 2CX3A 5ELAA 2CAQA 3IK7A 4AJ6A 4ZL9A 4HS1A 4KB3A 3O6TA 2WDUA 3NZNA 3KD0A 4MABA 4BL7B 1OAZA 7GSSA 3I43A 5C04A 1M0UA 2R37A 1YKCA 3GH9A 2JSZA 5ECKB 2VCTA 4MJAA 1F37A 1XWGA 1NM3A 1G6WA 5IO2A 3L9SA 5LCZA 5F07A 1NW2A 2V6OA 3P2AA 3ZYWA 1WWJA 1QFNA 4HZ4A 3EU4A 4MP4A 3F4RA 1ZYEA 3GNJA 3KJYA 4XS6A 2VCQA 2H1BA 2MMNA 3ZLPA 2GSSA 3TJKA 4PQIA 3HYPA 2PWJA 2HRAA 4TR0A 3VWUA 3HCZA 3APSA 4D73B 3FK8A 2JZTA 4LMWA 1RQMA 6GSUA 2F8AA 3L9UA 1F2EA 1R4WA 1TXXA 1XW6A 4P3YB 1XFLA 3C7MA 3TGZA 2WCIA 2ON5A 3P7XA 2V6KA 2H73A 3DRNA 1K0BA 5D9VA 2VOCA 1YQ1A 3NOFA 1O85A 2LSTA 5JWOB 4E8EA 4OCFA 2PERA 2XC2A 2HZFA 5BMUA 4IP6A 4NV5A 3HZ8A 1SD9A 2HRKB 3LEFA 16GSA 3CXGA 3SBCA 4G0KA 1KBNA 2GQMA 2L5OA 4MA9A 1FO5A 1Z6MA 5IMFA 2H0HA 1VF2A 1WE0A 2C80A 1EP7A 3ZIVA 4V2MA 3HA9A 1U3IA 1BQ7A 5KN0A 1PQNA 4BVYB 5DAKA 1TU8A 3ZFLA 3ERFA 5AIXA 2HNLA 3DVWA 2GT5A 4AF2A 5KN3A 4TXOB 1J08A 4RQRA 1YDKA 1OVNA 2XBIA 3CMIA 4ECCA 4NPBA 11GSA 3GHAA 2CT6A 2AYTA 4DSSA 1OC3A 2IMEA 2AUVA 4IS0A 4ECJA 1XWBA 1GTAA 1PA3A 5J9BA 3M9JA 5C00A 3KCMA 2N5AA 1X5EA 3L4NA 5KN1A 4V1Ag 4YQUA 4WR4A 2YPMA 3GX8A 5DDLA 4OO5A 2P31A 2X8GA 1QQ2A 1A0RP 5F0GA 3IXRA 3R2QA 5AGYA 3H79A 5H5QA 4GQFA 5LD0A 1TP9A 2HI7A 2WJUA 2YOIA 2F3MA 1O73A 2H1DA 2B3SA 1NHYA 2FNOA 2V41A 1SKSB 2L4CA 5ECMB 2HT9A 1EEJA 2GDRA 2WS2A 5F05A 1SJZA 1F3BA 4KDXA 5IMAA 2C0FA 4O92A 4QL9A 1WJKA 5IPGA 1G0TA 2YZUA 5DQSA 2HRFA 4MDCA 1JFUA 1JLVA 2H71A 5ABRA 4DSRA 4IW9A 3VPTA 5D8IA 2C8UA 2RUEA 2GS3A 1R5PA 2VL2A 3TRXA 2YZHA 1Z5YE 2HZEA 4G19A 3M9KA 1T8EB 4FH8A 4NAXA 2BJXA 2CAIA 2KLXA 3ME7A 5B8BA 4CDOA 2R6KA 1FVKA 4JRRA 1VF4A 1SL1B 1PL2A 3F9UA 1QGVA 1EGRA 1PMTA 3H8QA 5IMVA 2FWGA 1J0FA 4MZBA 4NXIA 1DE2A 1W4VA 1K0NA 3ED3A 3TDGA 4HU7A 3US3A 2P5QA 3P90A 4GTUA 2AHEA 3GMFA 2LRNA 1V2AA 3UVTA 4NHWA 4F0BA 2CA8A 3IK9A 1GSUA 2LQQA 1M2DA 5JWQB 1GSSA 2O89A 4CW9A 1TK0B 2C3NA 4J56E 1SKRB 4FYBA 4EKZA 4X1UA 1M9AA 5G1LA 3KH7A 3GSTA 2IMFA 4KDUA 1W89A 3V1WA 1ACVA 3GN3A 3IC8A 3MDKA 1M9BA 2NDOA 1XVQA 3EU3A 1ERWA 5GAPD 12GSA 4IQ1A 1TRVA 1MDKA 2H1AA 4I6XA 4MH3A 5CRDA 3W8JA 1GNEA 4K2DA 4PTSA 1GSFA 4I97A 1USBA 4OMVA 3HJMA 2PBJA 2WULA 1PN9A 1YEXA 1JZOA 1GLQA 2IN3A 3FW2A 1YJ6A 3BD2A 1FG4A 3D22A 4ZB9A 5HFIA 1F3AA 1ABAA 3ZZXA 3GYKA 4FYCA 3EYTA 2I4AA 1HQOA 4I2UA 1ST9A 4YAVA 4PX1A 4KGIA 4EO3A 3QD9A 5ECLB 1URMA 2OE3A 3ME8A 4HDEA 1SJ6A 1GNWA 4JBBA 2ES7A 2C1YA 1O8WA 4HU9A 4N0VA 4MF7A 1JZWA 2IPAA 5CP1A 3HVSA 1JLWA 1E2YA 2DLXA 4TVEA 2VD1A 2UZ8A 4O7HA 2H6ZA 5J9CA 2HYXA 3IRAA 3DD3A 1AIUA 9GSSA 3G7IA 2K6VA 3ZMLA 1ZCPA 3H1NA 2B1LA 2FY6A 1SYXA 2YN1A 3RHCA 1C72A 3WYWA 4KF9A 2LV3A 3BJ5A 4HQSA 4X43A 3LG6A 2CVDA 4PGTA 4WBJA 5B6MA 3KGKA 1TI1A 2HE3A 3VPQA 4HJMA 1S3AA 2I1UA 2P0GA 3ERGA 3IDVA 2A2SA 5D73A 1B8XA 2JZRA 4KSOA 1M2BA 2E2MA 1PKWA 3IBHA 1K0CA 8GSSA 1YY7A 3D0ZA 5DAKB 3I6AA 3C73A 2HRNA 4WR5A 5F8BA 2EC4A 2IFQA 1MTCA 1M99A 3UL3A 4EXJA 3M8NA 2LUSA 2MYGA 1TJDA 1SJIA 3F63A 2HQTA 4AJ7A 2L4QA 4L5OA 1ZMAA 3WD6A 5AN1A 2CZ3A 1V40A 3MAKA 5EPFA 3ZITA 1GULA 4EVMA 2B5EA 4POLA 5GAND 4DSSB 5CO3A 4FIWA 1TDIA 2K8VA 2QC7A 2GQKA 4LL4B 2H66A 2H75A 1XW5A 2CZ2A 2K9FA 2OJLA 2Z9SA 3FY7A 1YZXA 4F03A 4HJ2A 2VAFA 1TRUA 5DCHA 2C0DA 2MMZA 2YNXA 5GZZB 3HHVA 2NPBA 1G7OA 1S3CA 2RM6A 3GUSA 3L78A 1TK5B 2HSMA 4AGSA 3C1SA 2BTOT 3K8NA 1V98A 1WRYA 4K8MA 2KP2A 3QMXA 4POKA 2L6DA 3DYRA 2KP1A 2O7KA 5ECHB 1EEMA 1CQGA 2R2JA 3HVVA 3N9JA 5HFGA 2VL2C 3LORA 2VLUA 2IWTA 1XBSA 2E7PA 3EINA 1OE7A 4Q5RA 3VURA 3UJ1A 2YWOA 5G5FA 1R5AA 1GUMA 1RK4A 3PGTA 4TN8A 4ZL8A 1WP0A 2LJKA 3QAVA 4JR4A 1PX6A 1ZGNA 1PSQA 1PRXA 4HZ2A 3UEMA 3FR9A 3GL5A 1TK8B 4KUNA 3WT2A 1GH2A 2LNSA 3F8UA 2VL3A 1HNAA 4GSSA 3UVHA 3HVXA 5J5NA 2HZEB 1XZOA 3WGEA 1JZDA 4L5LA 2JADA 3QFAC 3F6FA 1THXA 1OKDA 1MEKA 1EP8A 5DJLA 3LYKA 3RAZA 4X0XA 1AW9A 2B5XA 2H8LA 4BVXA 1B4PA 1K0OA 2GTUA 1SU9A 4IP1A 2WRTA 1EV9A 4PURA 3UBLA 3TKRA 1YF1A 3F4SA 2TRXA 2RLIA 3A2VA 1BJXA 1TRWA 2PMTA 4KSMA 5A4VA 1TU7A 2WGRA 4K0GA 3TB2A 5INYA 3FKFA 3BOAA 1BX9A 1WOUA 5IPHA 1B9YC 4ID0A 1BEDA 4MMMA 5ID2A 3VLNA 2GSTA 17GSA 4RQXA 3TOTA 3QR6A 2HSHA 3UIWA 2DIZA 2EIOA 5A5KA 1Z6NA 2FHEA 4DEJA 4OD7A 5DVBA 5ECNB 4F9ZA 1FAAA 2VL9A 1H4OA 5KEJA 1ERTA 5KN2A 2GZPA 3TJGA 1WPIA 4EF0A 4ZB6A 1ML6A 2H30A 3HKRA 5IMDA 5ECPB 4TOPA 4MJCA 2L59A 4HUAA 3OR5A 1PX7A 1M7TA 3CRTA 3HZ4A 3IPZA 1Z7RA 4K1FA 1GUKA 1OC9A 2DC5A 2IL3A 4TR1A 1U6TA 3FZ9A 4F0CA 2N5BA 3H93A 3ZREA 2MZCA 4USSA 4OWYA 5LNKe 5JCUA 4ML6A 5HR2A 4Q5FA 4I8BA 4ULXA 2OADA 1UVZA 1X9WB 1UA5A 1XPVA 1TW9A 5DALA 4GCIA 2H76A 2CX4A 2PPTA 5IM9A 3D6IA 3FZ5A 1AQWA 1ZZYA 3WGDA 3PPUA 2L5LA 5DQYA 3DEXA 4G2EA 5AISA 4PUFC 4ML1A 2OBKA 3G7YA 4V1Ap 4IQAA 3IA1A 3Q74A 1MDJA 2YWIA 4OFNA 2PVOC 3IE3A 3F0IA 3CRUA 4N30A 1A2LA 3MSZA 4XTSA 4JU5A 3GX0A 3DGQA 2C0EA 1T00A 3A5WA 5CNWA 1JZRA 2FWFA 1DSBA 3AY8A 3TRPA 1V9WA 2R3XA 1SYRA 19GSA 1AUCA 4XRDA 4WF5A 4I5QA 1F6MC 3D4MA 1GWCA 1EOHA 2JZSA 1GSQA 3A3TA 5IMZA 1HNBA 2IFQB 4GLTA 2DJJA 1GUHA 2IMKA 3TKSA 5D96A 1WMJA 1AAZA 2MBTA 3FHKA 3BCKA 4ZB8A 3ZVJA 2L57A 3APOA 4WBRD 1T1VA 4GRFA 2DJ0A 5DBQA 1KNGA 3IR4A 3QAWA 1Q98A 1EZKA 5A4WA 5CRWA 2VLTA 2E2GA 3WT1A 4K9ZA 2J23A 2HLSA 4IELA 3GKMA 3G9BA 1XWAA 2PUKC 3TKQA 3APQA 3KM6A 1ERUA 4MZWA 1NSWA 2LJRA 2E0QA 1GTIA
chains in the Genus database with same CATH superfamily
22GSA 2PVQA 1A8YA 1ZOFA 5ECQB 3KMOA 4OCEA 1TTZA 4G01A 4QL7A 3UBKA 1YKAA 2DMLA 3PH9A 3CBUA 2HSMB 2B1KA 3TOUA 3UAPA 4ZBAA 3IAS2 4NHZA 13GSA 2IJYA 3GTUA 2WW0A 4XS4A 1XWCA 3CSHA 2H0IA 4BA7A 3LGCA 4G0IA 3VWWA 2TIRA 3E9JB 4PHZC 4MPGA 3HJOA 1Y25A 1SL0B 3HY2A 4KCEA 1T3BA 4ZILA 4KAEA 2JACA 3KXOA 4ECIA 3A2XA 2IMIA 1SL2B 4MF5A 3GFKA 4OFTA 5CYYA 5E59A 3KP8A 1E6BA 3EURA 2J9HA 4MLYA 3ISOA 2M46A 5JWRB 2OE0A 1IYIA 5D9XA 5IQYA 5D9WA 1S3RA 3ZMKA 3O3TA 2PU9C 4Q5NA 2GZYA 2VO4A 2NBSA 3RHBA 3IOSA 5J47A 4MF6A 3I9V2 4KE3A 5J4UA 1XIYA 4AKHA 6GSSA 1OKTA 2VCZA 6GSXA 3IC4A 3A2WA 1U88A 4V2NA 3Q19A 4BVXB 3RBTA 2I9HA 1U3AA 2YJ7A 1GSDA 2DJ1A 2WB9A 3W8SA 1KTEA 1ZYQB 5G31A 1Z9HA 4TXOA 2C4JA 1TXUA 1N25A 1GL8A 4N10A 5EL8A 2O5VA 2DJ3A 1QK8A 1DE1A 1PGTA 2DJ2A 4FO5A 4KNDA 4XIHA 1V57A 4HI7A 1TKDB 2H70A 3F3RA 1DUGA 5F06A 1PD21 3ZFBA 3GKNA 5ID2B 1K3LA 1N2AA 2FA4A 2LNTA 2O85A 3KEBA 2B5YA 2X64A 4PNFA 3FZ4A 1FW1A 5G30A 3TJBA 2M72A 1B4QA 3Q6OA 1RW1A 3RPPA 4HEA2 2JU5A 2A2PA 1LJRA 2LKUA 3FYGA 1YEWC 2I3YA 2IIYA 1Y6EA 1PFOA 2GQLA 5J3RA 1SVLA 2FWHA 3FMWA 1AXDA 1OC9B 4N11A 4TR1B 2VD0A 3R3EA 2IMDA 3DKSA 4O5QA 4POBA 5FWGA 2AAWA 4OFMA 2H6YA 2GSRA 2ZCTA 4E8HA 2GVPA 3D4TA 1OYJA 3GIXA 1MD4A 1PL1A 3EWLA 3RPNA 2KHPA 2I81A 5DALB 3CYNA 2A2RA 1WIKA 3HJPA 5EY6A 2CV4A 4FYUA 3TCOA 3GSSA 1HD2A 4G10A 2R0PA 1FB0A 4OO4A 4EE0A 3L0HA 5ECOB 4GSTA 4KW6A 4WKWA 2WVYA 2YP6A 2YWMA 4NV2A 3NIVA 4XS1A 2RM5A 2QGVA 5EVOA 3PINA 1FOVA 1A2MA 1VF3A 1OC8A 3EE2A 1SVMA 3TKSC 1T4YA 1QXHA 4Z2TA 1EOGA 10GSA 4JZQA 1K3YA 2CVKA 1UN2A 3ZRDA 3GV1A 2VCVA 4IGJA 1Q4JA 2CQ9A 3UARA 4ZBBA 3DWVA 4BWQA 3EMPA 2DKHA 2QSIA 1BYEA 2YANA 1XOAA 3LWAA 4O32A 3U6VA 2H1LA 2C3QA 2A4VA 1GSYA 3BCIA 4WF4A 5KOXA 4JEDA 1M2AA 5ELGA 2X8HA 2EIQA 5HQPA 3D21A 4KA0A 2FA8A 2X8CA 3S9FA 2GLRA 1XOBA 5IOXA 3H4KA 3HVNA 2FUG2 4RI6A 3HXSA 3J7Yk 2H6XA 1H75A 1O8XA 1A23A 1OE8A 4ACSA 2FD3A 5GSTA 1ON4A 3KH9A 4WXTA 1MDIA 4Z7XA 4ZL7A 5ENUA 2B7JA 3GH6A 2H19A 4TKYA 3M1GA 2OACA 1X5CA 1SK1A 3VI7A 1DBYA 3KMNA 2VCWA 5HFKA 1ILOA 3GTUB 5CRHA 3TKPA 1K0DA 4XHMA 4XS4B 3TJFA 4LMVA 3ERWA 2F9SA 1X9MB 2LEGA 4PQ1A 3QCPA 2EIRA 4MJBA 2XPEA 2ZNMA 3DIEA 3LXTA 4KH7A 5IMCA 5B8AA 2VKZG 2KUCA 2WW1A 2B7KA 2AJQB 4ILFA 4ZXGA 3CSJA 1GTBA 1BAYA 1O7UA 3GKXA 4QQ7A 5IIZA 3FR3A 2ALBA 3UOMA 1LU4A 2C3TA 1X9SB 2N5FA 3L9VA 3RDWA 5ECRB 3QOUA 4LA1A 4WETA 4N3ZA 3C71A 2OE1A 1HNCA 3CSIA 2LQOA 1A2JA 3M0FA 1K3OA 2M80A 3E0UA 1K0AA 2H1GA 5JCGA 1IYHA 3CTFA 5CRGA 3KIJA 3F4TA 2PGTA 3SWLA 4HQZA 2RUFA 1G6YA 2WFCA 3FEUA 1UC7A 2XPDA 4MPFA 2OT3A 4GWRA 4HOJA 1TI3A 2O3EA 1B48A 2HSNA 4LL1B 3ZTLA 3TRQA 2NVLA 4GQCA 3CTGA 5E4WA 4MCUA 3FR6A 1JHBA 2MMAA 2HSYA 3QFBC 6GSYA 1A8LA 1SK2A 3N5OA 1KEBA 1A0FA 1ZL9A 5D93A 5HR0A 6GSVA 2EFDA 2EFCA 3C1RA 3M3MA 4EUYA 1CQHA 4K5SA 2V32A 4J2FA 4L8EA 2VIMA 1FVJA 2V1MA 2HXKA 3PR8A 4IHUA 1NHOA 2H0GA 3U5RE 1GTUA 4JR6A 2H72A 3P8WA 2ZUPA 3KZQA 2FCHA 4YQMA 5A34A 4QMKA 1T7PB 1R26A 3TJJA 4K7OA 1GP1A 4IBPA 2KOKA 2OKAA 4YAPA 2L6CA 2JL4A 3EVIA 3LSZA 4BL7A 2FGXA 1XXUA 2YV7A 3F6DA 5L71A 2REMA 3IHGA 5B7CA 3FZAA 2VM2A 1SKWB 1O6JA 4K0NA 2XBQA 4YKGA 3LXZA 4PQHA 3KP9A 1YEPA 4CY6A 5COHA 4DSQA 2YCDA 3KTBA 2XHFA 3MNGA 3LQ7A 5H5RA 1J9BA 3ZVJD 5KOWA 2MBSA 1ZYNA 4D73A 2R4VA 3I69A 4EDZA 1I5GA 4X4JA 3BBYA 2FLSA 3GURA 4IVFA 1BG5A 1VGLA 4GF0A 2AV4A 2P5RA 3RGBC 3LFLA 5AIVA 4ICYA 1XVWA 4L0UA 2AB6A 2QKEA 2DSAA 1PKZA 1ERVA 1QUWA 4O5RA 1G7EA 1K0MA 4WEYA 3ZIJA 1XCCA 2K18A 4KX4A 1YF0A 3E3EA 3LYPA 1X5DA 2HRKA 1EV4A 3VWVA 4AJ8A 2JSYA 5JCWA 2VLVA 1U87A 3QPMA 2G0FA 2F51A 4G9HA 4IJ3A 2K8SA 3GKKA 2WW3A 3ZL5A 1XW9A 4H86A 2X99A 4Z2RA 1AQVA 3O76A 4ECBA 1F9MA 4PXOA 5A4UA 5GSSA 4TR3A 4EL1A 2X49A 1GRXA 4GXZA 2UV8G 3DVXA 1Z3EA 4IN0A 2YWNA 2LJAA 4K7IA 5B6NA 4POMA 4ZBDA 4BWSA 4MZCA 4ZIJA 2D2ZA 4BVYA 1QMVA 4XRAA 4XCSA 4TRXA 14GSA 2YV9A 2BMXA 4MH2A 3W6GA 1X0RA 3UMAA 2VUPA 6GSTA 2VM1A 2WZ9A 2R5GA 2DIYA 1ZYPA 1GSEA 1TOFA 5J41A 5HR1A 3QDNA 3G7JA 1EGOA 2LRTA 5FHIA 3HD5A 1SENA 3EC3A 3VWXA 1LBKA 3GL3A 4L0WA 2LS5A 4FQUA 1B9XC 1Z7PA 4YH2A 1TRSA 3FRCA 2NTOA 5DCGA 2ON7A 4F2IA 4NMUA 3J7Yb 4KCAA 2OA7A 5J4YA 4Q5QA 2MMOA 2FWEA 20GSA 3GRXA 5CREA 2H01A 2TRCP 5IO0A 2V2GA 4EC0A 1N8JA 3GA4A 4G0LA 2CVBA 1THOA 2GT6A 3IHQA 1XWKA 2G2QA 1VRSD 3LJRA 3VK9A 4K7NA 2O87A 3JCML 4RI7A 2RIIA 3VFIA 5H5SA 3WGXA 1O81A 1BF5A 3VI5A 4YQVA 4ZB7A 4I2TA 5HR3A 3DMLA 4LLRA 1AQXA 1I9DA 2YJHA 5DJMA 4PNGA 1EWXA 4TR4A 1V58A 3IAM2 3TUEA 1A24A 1AC1A 5ECSA 5J40A 2O8VB 2HFDA 3TKSE 2GSQA 4GSNA 6GSWA 3C8EA 3HDCA 4IJIA 5G1KA 3Q18A 1SK0A 1MD3A 3DXBA 2C0GA 1M3IA 1Y1UA 2LTKA 4IKHA 5IOWA 3TU3B 5CAXA 2F8FA 2HSNB 3D5JA 4ISDA 5G5EA 5A5HA 2GZZA 1SD8A 2DBCA 2B6MA 2H74A 4CHSA 4NWYA 4TXVA 4F82A 5D9TA 3RFRC 4V2LA 1BG1A 2DMMA 3F3QA 2OBIA 1GLPA 4MK3A 1S3DA 3MWHA 1R7HA 4DVCA 1FB6A 3EMXA 4PUAA 18GSA 3KTLA 4EDYA 5A1NA 4BPYA 2LRCA 1VF1A 4J57E 5FT3A 1FHEA 4KDYA 4MJEA 3IV4A 4TW5A 2VCXA 4RUVA 2PN8A 4N0ZA 2DJKA 4JE1A 3QAGA 5A34B 5G2ZA 1FOHA 1T4ZA 1HYUA 4K6XA 5ECIB 2GGTA 2CX3A 5ELAA 2CAQA 3IK7A 4YKFA 4AJ6A 4ZL9A 4HS1A 4KB3A 3O6TA 2WDUA 3NZNA 3KD0A 2WVXA 4MABA 4BL7B 1OAZA 7GSSA 3I43A 5C04A 1M0UA 2R37A 1YKCA 3GH9A 2JSZA 5ECKB 2VCTA 4MJAA 1F37A 1XWGA 1NM3A 1G6WA 5IO2A 3L9SA 5LCZA 5F07A 2QA2A 1NW2A 2V6OA 3P2AA 3ZYWA 1WWJA 1QFNA 4HZ4A 3EU4A 4MP4A 3F4RA 1ZYEA 3GNJA 3KJYA 4XS6A 2VCQA 2H1BA 2MMNA 3ZLPA 2GSSA 3TJKA 4PQIA 3HYPA 2PWJA 2HRAA 2EFEA 4TR0A 3VWUA 3HCZA 3APSA 4D73B 3FK8A 2JZTA 4LMWA 1RQMA 6GSUA 2F8AA 3L9UA 1F2EA 1R4WA 1TXXA 1XW6A 4P3YB 1XFLA 3C7MA 3TGZA 1M3JA 2WCIA 2ON5A 3P7XA 2V6KA 2H73A 3DRNA 4GDFA 1K0BA 5D9VA 2VOCA 1YQ1A 3NOFA 1O85A 2LSTA 5JWOB 4E8EA 4OCFA 3CWGA 2PERA 2O36A 2R0GA 2XC2A 2HZFA 5BMUA 4IP6A 4NV5A 3HZ8A 1SD9A 2HRKB 3LEFA 16GSA 3CXGA 3SBCA 4G0KA 1KBNA 2GQMA 2L5OA 4MA9A 1FO5A 1Z6MA 5IMFA 2H0HA 1VF2A 1WE0A 2C80A 1EP7A 3ZIVA 4V2MA 3HA9A 1U3IA 1BQ7A 5KN0A 1PQNA 4BVYB 5DAKA 1TU8A 3ZFLA 3ERFA 5AIXA 2HNLA 3DVWA 2GT5A 4AI6A 4AF2A 5BRTA 5KN3A 4TXOB 1J08A 5J4VA 4RQRA 1YDKA 1OVNA 2XBIA 3CMIA 4ECCA 4BIKA 4NPBA 4K5RA 11GSA 3GHAA 2CT6A 2AYTA 4DSSA 1OC3A 2IMEA 2AUVA 4IS0A 4ECJA 1XWBA 1XG8A 1GTAA 1PA3A 5J9BA 3M9JA 5C00A 3KCMA 2N5AA 1X5EA 3L4NA 5KN1A 4V1Ag 4YQUA 4WR4A 2YPMA 3GX8A 5DDLA 4OO5A 2P31A 2X8GA 1QQ2A 1A0RP 5F0GA 3IXRA 3R2QA 5AGYA 3H79A 5H5QA 4GQFA 5LD0A 1TP9A 2HI7A 2YOIA 2WJUA 2F3MA 1O73A 2H1DA 2B3SA 1NHYA 2FNOA 2V41A 1SKSB 2L4CA 3A5IA 5ECMB 2HT9A 1EEJA 2GDRA 2WS2A 5F05A 1SJZA 1F3BA 4KDXA 5IMAA 2C0FA 4O92A 4QL9A 1WJKA 5IPGA 1G0TA 2YZUA 5DQSA 2HRFA 4MDCA 1JFUA 1JLVA 2H71A 5ABRA 4DSRA 4IW9A 3VPTA 5D8IA 2C8UA 2RUEA 2GS3A 1R5PA 2VL2A 3TRXA 2YZHA 1Z5YE 2HZEA 4EIPA 4G19A 3M9KA 1T8EB 4FH8A 4NAXA 2BJXA 2CAIA 2KLXA 3ME7A 5B8BA 4CDOA 2R6KA 2WVZA 1FVKA 4JRRA 1VF4A 1SL1B 1PL2A 3F9UA 1QGVA 1EGRA 1PMTA 3H8QA 5IMVA 2FWGA 1J0FA 4MZBA 4NXIA 1DE2A 1W4VA 1K0NA 3ED3A 3TDGA 1YVLA 4HU7A 3US3A 2P5QA 3P90A 4GTUA 2AHEA 3GMFA 2LRNA 1V2AA 3UVTA 4NHWA 4F0BA 2CA8A 3IK9A 1GSUA 5A1NB 1M2DA 2LQQA 1GSSA 2O89A 5JWQB 4CW9A 2EFHA 1TK0B 2C3NA 4J56E 1SKRB 3CHXC 4FYBA 4EKZA 4X1UA 1M9AA 5G1LA 2R0CA 3KH7A 3GSTA 2IMFA 4KDUA 1W89A 3V1WA 1ACVA 3GN3A 3IC8A 3MDKA 1M9BA 2NDOA 1XVQA 3EU3A 1ERWA 5GAPD 12GSA 4IQ1A 1TRVA 2WVXB 1MDKA 2H1AA 4O5UA 4I6XA 4MH3A 5CRDA 3W8JA 1GNEA 4AKIA 4K2DA 4PTSA 2DKIA 1GSFA 4I97A 1USBA 4OMVA 3HJMA 2PBJA 2WULA 1PN9A 1YEXA 1JZOA 1GLQA 2IN3A 3FW2A 1YJ6A 3BD2A 1FG4A 3D22A 4ZB9A 5HFIA 1F3AA 1ABAA 3ZZXA 3GYKA 4FYCA 3EYTA 2I4AA 1HQOA 4I2UA 1ST9A 4YAVA 4PX1A 4KGIA 4EO3A 5ECLB 3QD9A 1URMA 2OE3A 3ME8A 4HDEA 3MYDA 1SJ6A 1GNWA 4JBBA 2ES7A 2C1YA 1O8WA 4HU9A 4N0VA 4MF7A 1JZWA 2IPAA 5CP1A 3HVSA 1JLWA 1E2YA 2DLXA 4TVEA 3CQFA 2VD1A 2UZ8A 4O7HA 2H6ZA 5J9CA 2HYXA 3IRAA 3DD3A 1AIUA 9GSSA 3G7IA 2K6VA 3ZMLA 1ZCPA 3H1NA 2B1LA 2FY6A 1SYXA 2YN1A 3RHCA 1C72A 5BMUB 3WYWA 4KF9A 2LV3A 3BJ5A 4MNNA 4HQSA 4X43A 4EIQA 2QA1A 3LG6A 2CVDA 4PGTA 4WBJA 5B6MA 3KGKA 1TI1A 2HE3A 3VPQA 4HJMA 1S3AA 2I1UA 2P0GA 3ERGA 3IDVA 4K2XA 2A2SA 5D73A 1B8XA 2JZRA 4KSOA 1M2BA 2E2MA 1PKWA 3MIXA 3IBHA 1K0CA 8GSSA 1YY7A 3D0ZA 5DAKB 3I6AA 3C73A 2HRNA 4WR5A 5F8BA 2EC4A 2IFQA 1MTCA 1M99A 3UL3A 4EXJA 3M8NA 2LUSA 2MYGA 1TJDA 1SJIA 3F63A 2HQTA 4AJ7A 2L4QA 4L5OA 1ZMAA 3WD6A 5AN1A 4CY8A 2CZ3A 1V40A 3MAKA 5EPFA 3ZITA 1GULA 4EVMA 2B5EA 4POLA 5GAND 4DSSB 5CO3A 4FIWA 1TDIA 2K8VA 2QC7A 2GQKA 4LL4B 2H66A 2H75A 1XW5A 2CZ2A 2K9FA 2OJLA 2Z9SA 3FY7A 1YZXA 4F03A 4HJ2A 2VAFA 1TRUA 5DCHA 2C0DA 2MMZA 2YNXA 1I1IP 5GZZB 3HHVA 2NPBA 1G7OA 1S3CA 2RM6A 2WZSA 3GUSA 3L78A 1TK5B 2HSMA 4AGSA 3C1SA 2BTOT 3K8NA 1V98A 1WRYA 4K8MA 2KP2A 3QMXA 4POKA 2L6DA 3DYRA 2KP1A 2O7KA 5ECHB 1EEMA 1CQGA 2R2JA 3HVVA 3N9JA 5HFGA 2VL2C 3LORA 2VLUA 2IWTA 1XBSA 2E7PA 3EINA 1OE7A 4Q5RA 3VURA 3UJ1A 2YWOA 5G5FA 1R5AA 1GUMA 1RK4A 3PGTA 4TN8A 4ZL8A 1WP0A 2LJKA 3QAVA 4JR4A 1PX6A 1ZGNA 1PSQA 1PRXA 4HZ2A 3UEMA 3FR9A 3GL5A 1TK8B 4KUNA 3WT2A 1GH2A 2LNSA 3F8UA 2VL3A 1HNAA 4GSSA 3UVHA 3HVXA 5J5NA 2HZEB 1XZOA 3WGEA 1JZDA 4L5LA 2JADA 3QFAC 3F6FA 1THXA 1OKDA 1MEKA 1EP8A 5DJLA 3LYKA 3RAZA 4X0XA 1AW9A 2B5XA 2H8LA 3LW9A 4BVXA 1B4PA 1K0OA 2GTUA 1SU9A 4IP1A 2WRTA 1EV9A 4PURA 3UBLA 4AKXB 3TKRA 1YF1A 3F4SA 2TRXA 2RLIA 3A2VA 1BJXA 1TRWA 2PMTA 4KSMA 5A4VA 1TU7A 4Z2UA 2WGRA 4K0GA 3TB2A 5INYA 3FKFA 3BOAA 1BX9A 1WOUA 1S4BP 5IPHA 2A4HA 1B9YC 4ID0A 1BEDA 4MMMA 5ID2A 3VLNA 2GSTA 17GSA 4RQXA 1PN0A 3TOTA 3QR6A 2HSHA 3UIWA 2DIZA 2EIOA 5A5KA 1Z6NA 2FHEA 4DEJA 4OD7A 5DVBA 5ECNB 4F9ZA 1FAAA 2VL9A 4PI2C 1H4OA 5KEJA 1ERTA 5KN2A 2GZPA 3TJGA 1WPIA 2X4AA 4EF0A 4ZB6A 1ML6A 2H30A 3HKRA 5IMDA 5ECPB 4TOPA 4MJCA 2L59A 3HMJG 3EPTA 4HUAA 3OR5A 1PX7A 1M7TA 3CRTA 3HZ4A 3IPZA 2WW2A 1Z7RA 4K1FA 1GUKA 1OC9A 2DC5A 2IL3A 4TR1A 1U6TA 3FZ9A 4F0CA 2N5BA 4W66A 3H93A 3ZREA 2MZCA 4USSA 4OWYA 5LNKe 5JCUA 4ML6A 5HR2A 4Q5FA 4I8BA 4ULXA 2OADA 1UVZA 1X9WB 1UA5A 1XPVA 1TW9A 5DALA 4GCIA 2H76A 2CX4A 2PPTA 5IM9A 3D6IA 3FZ5A 1AQWA 1ZZYA 3WGDA 3PPUA 2L5LA 5DQYA 3DEXA 4G2EA 1SVOA 5AISA 4PUFC 4ML1A 2OBKA 3G7YA 4V1Ap 4IQAA 3IA1A 3Q74A 1MDJA 2YWIA 4A5PA 4OFNA 2PVOC 3IE3A 3F0IA 3CRUA 4N30A 1A2LA 3MSZA 4XTSA 4JU5A 3GX0A 3DGQA 2C0EA 1T00A 3A5WA 5CNWA 4HSCX 1JZRA 2FWFA 1DSBA 3AY8A 3TRPA 1V9WA 2R3XA 1SYRA 19GSA 1AUCA 4XRDA 4WF5A 4I5QA 1F6MC 3D4MA 1GWCA 1EOHA 2JZSA 1GSQA 3A3TA 5IMZA 1HNBA 2IFQB 4GLTA 2DJJA 1GUHA 2IMKA 3TKSA 5D96A 1WMJA 1AAZA 2MBTA 3FHKA 3BCKA 4ZB8A 3ZVJA 2L57A 3APOA 4WBRD 1T1VA 4GRFA 2DJ0A 5DBQA 1KNGA 3IR4A 3QAWA 1Q98A 1EZKA 5A4WA 5CRWA 2VLTA 2E2GA 3WT1A 4PI0C 5A5HB 4K9ZA 2J23A 4E68A 2HLSA 4IELA 3GKMA 3G9BA 1XWAA 2PUKC 3TKQA 3APQA 3KM6A 1ERUA 4MZWA 1NSWA 2LJRA 4FXYP 4AKGA 2E0QA 1GTIA
chains in the Genus database with same CATH topology
22GSA 2PVQA 1A8YA 1ZOFA 5ECQB 3KMOA 4OCEA 1TTZA 4G01A 4QL7A 3UBKA 1YKAA 2DMLA 3PH9A 3CBUA 2HSMB 2B1KA 3TOUA 3UAPA 4ZBAA 3IAS2 4NHZA 13GSA 2IJYA 3GTUA 4XS4A 1XWCA 3CSHA 2H0IA 4BA7A 3LGCA 4G0IA 3VWWA 2TIRA 3E9JB 4MPGA 3HJOA 1Y25A 1SL0B 3HY2A 4KCEA 1T3BA 4ZILA 4KAEA 2JACA 3KXOA 4ECIA 3A2XA 2IMIA 1SL2B 4MF5A 3GFKA 4OFTA 5CYYA 5E59A 3KP8A 1E6BA 3EURA 2J9HA 4MLYA 3ISOA 2M46A 5JWRB 2OE0A 1IYIA 5D9XA 5IQYA 5D9WA 3ZMKA 3O3TA 2PU9C 4Q5NA 2GZYA 2VO4A 2NBSA 3RHBA 3IOSA 5J47A 4MF6A 3I9V2 4KE3A 5J4UA 1XIYA 4AKHA 6GSSA 1OKTA 2VCZA 6GSXA 3IC4A 3A2WA 1U88A 4V2NA 3Q19A 4BVXB 3RBTA 2I9HA 1U3AA 2YJ7A 1GSDA 2DJ1A 2WB9A 3W8SA 1KTEA 1ZYQB 5G31A 1Z9HA 4TXOA 2C4JA 1TXUA 1N25A 1GL8A 4N10A 5EL8A 2O5VA 2DJ3A 1QK8A 1DE1A 1PGTA 2DJ2A 4FO5A 4KNDA 4XIHA 1V57A 4HI7A 1TKDB 2H70A 3F3RA 1DUGA 5F06A 1PD21 3ZFBA 3GKNA 5ID2B 1K3LA 1N2AA 2FA4A 2LNTA 2O85A 3KEBA 2B5YA 2X64A 4PNFA 3FZ4A 1FW1A 5G30A 3TJBA 2M72A 1B4QA 3Q6OA 1RW1A 3RPPA 4HEA2 2JU5A 2A2PA 1LJRA 2LKUA 3FYGA 2I3YA 2IIYA 1Y6EA 2GQLA 5J3RA 1SVLA 2FWHA 3FMWA 1AXDA 1OC9B 4N11A 4TR1B 2VD0A 3R3EA 2IMDA 3DKSA 4O5QA 4POBA 5FWGA 2AAWA 4OFMA 2H6YA 2GSRA 2ZCTA 4E8HA 2GVPA 3D4TA 1OYJA 3GIXA 1MD4A 1PL1A 3EWLA 3RPNA 2KHPA 2I81A 5DALB 3CYNA 2A2RA 1WIKA 3HJPA 5EY6A 2CV4A 4FYUA 3TCOA 3GSSA 1HD2A 4G10A 2R0PA 1FB0A 4OO4A 4EE0A 3L0HA 5ECOB 4GSTA 4KW6A 4WKWA 2YP6A 2YWMA 4NV2A 3NIVA 4XS1A 2RM5A 2QGVA 5EVOA 3PINA 1FOVA 1A2MA 1VF3A 1OC8A 3EE2A 1SVMA 3TKSC 1T4YA 1QXHA 4Z2TA 1EOGA 10GSA 4JZQA 1K3YA 2CVKA 1UN2A 3ZRDA 3GV1A 2VCVA 4IGJA 1Q4JA 2CQ9A 3UARA 4ZBBA 3DWVA 4BWQA 3EMPA 2DKHA 2QSIA 1BYEA 2YANA 1XOAA 3LWAA 4O32A 3U6VA 2H1LA 2C3QA 2A4VA 1GSYA 3BCIA 4WF4A 5KOXA 4JEDA 1M2AA 5ELGA 2X8HA 2EIQA 5HQPA 3D21A 4KA0A 2FA8A 2X8CA 3S9FA 2GLRA 1XOBA 5IOXA 3H4KA 2FUG2 4RI6A 3HXSA 3J7Yk 2H6XA 1H75A 1O8XA 1A23A 1OE8A 4ACSA 2FD3A 5GSTA 1ON4A 3KH9A 4WXTA 1MDIA 4Z7XA 4ZL7A 5ENUA 2B7JA 3GH6A 2H19A 4TKYA 3M1GA 2OACA 1X5CA 1SK1A 3VI7A 1DBYA 3KMNA 2VCWA 5HFKA 1ILOA 3GTUB 5CRHA 3TKPA 1K0DA 4XHMA 4XS4B 3TJFA 4LMVA 3ERWA 2F9SA 1X9MB 2LEGA 4PQ1A 3QCPA 2EIRA 4MJBA 2XPEA 2ZNMA 3DIEA 3LXTA 4KH7A 5IMCA 5B8AA 2VKZG 2KUCA 2B7KA 2AJQB 4ILFA 4ZXGA 3CSJA 1GTBA 1BAYA 1O7UA 3GKXA 4QQ7A 5IIZA 3FR3A 2ALBA 3UOMA 1LU4A 2C3TA 1X9SB 2N5FA 3L9VA 3RDWA 5ECRB 3QOUA 4LA1A 4WETA 4N3ZA 3C71A 2OE1A 1HNCA 3CSIA 2LQOA 1A2JA 3M0FA 1K3OA 2M80A 3E0UA 1K0AA 2H1GA 5JCGA 1IYHA 3CTFA 5CRGA 3KIJA 3F4TA 2PGTA 3SWLA 4HQZA 2RUFA 1G6YA 2WFCA 3FEUA 1UC7A 2XPDA 4MPFA 2OT3A 4GWRA 4HOJA 1TI3A 1B48A 2HSNA 4LL1B 3ZTLA 3TRQA 2NVLA 4GQCA 3CTGA 5E4WA 4MCUA 3FR6A 1JHBA 2MMAA 2HSYA 3QFBC 6GSYA 1A8LA 1SK2A 3N5OA 1KEBA 1A0FA 1ZL9A 5D93A 5HR0A 6GSVA 2EFDA 2EFCA 3C1RA 3M3MA 4EUYA 1CQHA 4K5SA 2V32A 4J2FA 4L8EA 2VIMA 1FVJA 2V1MA 2HXKA 3PR8A 4IHUA 1NHOA 2H0GA 3U5RE 1GTUA 4JR6A 2H72A 3P8WA 2ZUPA 3KZQA 2FCHA 4YQMA 5A34A 4QMKA 1T7PB 1R26A 3TJJA 4K7OA 1GP1A 4IBPA 2KOKA 2OKAA 4YAPA 2L6CA 2JL4A 3EVIA 3LSZA 4BL7A 2FGXA 1XXUA 2YV7A 3F6DA 5L71A 2REMA 3IHGA 5B7CA 3FZAA 2VM2A 1SKWB 1O6JA 4K0NA 2XBQA 4YKGA 3LXZA 4PQHA 3KP9A 1YEPA 4CY6A 5COHA 4DSQA 2YCDA 3KTBA 2XHFA 3MNGA 3LQ7A 5H5RA 1J9BA 3ZVJD 5KOWA 2MBSA 1ZYNA 4D73A 2R4VA 3I69A 4EDZA 1I5GA 4X4JA 3BBYA 2FLSA 3GURA 4IVFA 1BG5A 1VGLA 4GF0A 2AV4A 2P5RA 3LFLA 5AIVA 4ICYA 1XVWA 4L0UA 2AB6A 2QKEA 2DSAA 1PKZA 1ERVA 1QUWA 4O5RA 1G7EA 1K0MA 4WEYA 3ZIJA 1XCCA 2K18A 4KX4A 1YF0A 3E3EA 3LYPA 1X5DA 2HRKA 1EV4A 3VWVA 4AJ8A 2JSYA 5JCWA 2VLVA 1U87A 3QPMA 2G0FA 2F51A 4G9HA 4IJ3A 2K8SA 3GKKA 3ZL5A 1XW9A 4H86A 2X99A 4Z2RA 1AQVA 3O76A 4ECBA 1F9MA 4PXOA 5A4UA 5GSSA 4TR3A 4EL1A 2X49A 1GRXA 4GXZA 2UV8G 3DVXA 1Z3EA 4IN0A 2YWNA 2LJAA 4K7IA 5B6NA 4POMA 4ZBDA 4BWSA 4MZCA 4ZIJA 2D2ZA 4BVYA 1QMVA 4XRAA 4XCSA 4TRXA 14GSA 2YV9A 2BMXA 4MH2A 3W6GA 1X0RA 3UMAA 2VUPA 6GSTA 2VM1A 2WZ9A 2R5GA 2DIYA 1ZYPA 1GSEA 1TOFA 5J41A 5HR1A 3QDNA 3G7JA 1EGOA 2LRTA 5FHIA 3HD5A 1SENA 3EC3A 3VWXA 1LBKA 3GL3A 4L0WA 2LS5A 4FQUA 1B9XC 1Z7PA 4YH2A 1TRSA 3FRCA 2NTOA 5DCGA 2ON7A 4F2IA 4NMUA 3J7Yb 4KCAA 2OA7A 5J4YA 4Q5QA 2MMOA 2FWEA 20GSA 3GRXA 5CREA 2H01A 2TRCP 5IO0A 2V2GA 4EC0A 1N8JA 3GA4A 4G0LA 2CVBA 1THOA 2GT6A 3IHQA 1XWKA 2G2QA 1VRSD 3LJRA 3VK9A 4K7NA 2O87A 3JCML 4RI7A 2RIIA 3VFIA 5H5SA 3WGXA 1O81A 1BF5A 3VI5A 4YQVA 4ZB7A 4I2TA 5HR3A 3DMLA 4LLRA 1AQXA 1I9DA 2YJHA 5DJMA 4PNGA 1EWXA 4TR4A 1V58A 3IAM2 3TUEA 1A24A 1AC1A 5ECSA 5J40A 2O8VB 2HFDA 3TKSE 2GSQA 4GSNA 6GSWA 3C8EA 3HDCA 4IJIA 5G1KA 3Q18A 1SK0A 1MD3A 3DXBA 2C0GA 1Y1UA 2LTKA 4IKHA 5IOWA 3TU3B 5CAXA 2F8FA 2HSNB 3D5JA 4ISDA 5G5EA 5A5HA 2GZZA 1SD8A 2DBCA 2B6MA 2H74A 4CHSA 4NWYA 4TXVA 4F82A 5D9TA 4V2LA 1BG1A 2DMMA 3F3QA 2OBIA 1GLPA 4MK3A 1S3DA 3MWHA 1R7HA 4DVCA 1FB6A 3EMXA 4PUAA 18GSA 3KTLA 4EDYA 5A1NA 4BPYA 2LRCA 1VF1A 4J57E 5FT3A 1FHEA 4KDYA 4MJEA 3IV4A 4TW5A 2VCXA 4RUVA 2PN8A 4N0ZA 2DJKA 4JE1A 3QAGA 5A34B 5G2ZA 1FOHA 1T4ZA 1HYUA 4K6XA 5ECIB 2GGTA 2CX3A 5ELAA 2CAQA 3IK7A 4YKFA 4AJ6A 4ZL9A 4HS1A 4KB3A 3O6TA 2WDUA 3NZNA 3KD0A 4MABA 4BL7B 1OAZA 7GSSA 3I43A 5C04A 1M0UA 2R37A 1YKCA 3GH9A 2JSZA 5ECKB 2VCTA 4MJAA 1F37A 1XWGA 1NM3A 1G6WA 5IO2A 3L9SA 5LCZA 5F07A 2QA2A 1NW2A 2V6OA 3P2AA 3ZYWA 1WWJA 1QFNA 4HZ4A 3EU4A 4MP4A 3F4RA 1ZYEA 3GNJA 3KJYA 4XS6A 2VCQA 2H1BA 2MMNA 3ZLPA 2GSSA 3TJKA 4PQIA 3HYPA 2PWJA 2HRAA 2EFEA 4TR0A 3VWUA 3HCZA 3APSA 4D73B 3FK8A 2JZTA 4LMWA 1RQMA 6GSUA 2F8AA 3L9UA 1F2EA 1R4WA 1TXXA 1XW6A 4P3YB 1XFLA 3C7MA 3TGZA 2WCIA 2ON5A 3P7XA 2V6KA 2H73A 3DRNA 4GDFA 1K0BA 5D9VA 2VOCA 1YQ1A 3NOFA 1O85A 2LSTA 5JWOB 4E8EA 4OCFA 3CWGA 2PERA 2R0GA 2XC2A 2HZFA 5BMUA 4IP6A 4NV5A 3HZ8A 1SD9A 2HRKB 3LEFA 16GSA 3CXGA 3SBCA 4G0KA 1KBNA 2GQMA 2L5OA 4MA9A 1FO5A 1Z6MA 5IMFA 2H0HA 1VF2A 1WE0A 2C80A 1EP7A 3ZIVA 4V2MA 3HA9A 1U3IA 1BQ7A 5KN0A 1PQNA 4BVYB 5DAKA 1TU8A 3ZFLA 3ERFA 5AIXA 2HNLA 3DVWA 2GT5A 4AI6A 4AF2A 5BRTA 5KN3A 4TXOB 1J08A 5J4VA 4RQRA 1YDKA 1OVNA 2XBIA 3CMIA 4ECCA 4NPBA 4K5RA 11GSA 3GHAA 2CT6A 2AYTA 4DSSA 1OC3A 2IMEA 2AUVA 4IS0A 4ECJA 1XWBA 1GTAA 1PA3A 5J9BA 3M9JA 5C00A 3KCMA 2N5AA 1X5EA 3L4NA 5KN1A 4V1Ag 4YQUA 4WR4A 2YPMA 3GX8A 5DDLA 4OO5A 2P31A 2X8GA 1QQ2A 1A0RP 5F0GA 3IXRA 3R2QA 5AGYA 3H79A 5H5QA 4GQFA 5LD0A 1TP9A 2HI7A 2YOIA 2WJUA 2F3MA 1O73A 2H1DA 2B3SA 1NHYA 2FNOA 2V41A 1SKSB 2L4CA 3A5IA 5ECMB 2HT9A 1EEJA 2GDRA 2WS2A 5F05A 1SJZA 1F3BA 4KDXA 5IMAA 2C0FA 4O92A 4QL9A 1WJKA 5IPGA 1G0TA 2YZUA 5DQSA 2HRFA 4MDCA 1JFUA 1JLVA 2H71A 5ABRA 4DSRA 4IW9A 3VPTA 5D8IA 2C8UA 2RUEA 2GS3A 1R5PA 2VL2A 3TRXA 2YZHA 1Z5YE 2HZEA 4EIPA 4G19A 3M9KA 1T8EB 4FH8A 4NAXA 2BJXA 2CAIA 2KLXA 3ME7A 5B8BA 4CDOA 2R6KA 1FVKA 4JRRA 1VF4A 1SL1B 1PL2A 3F9UA 1QGVA 1EGRA 1PMTA 3H8QA 5IMVA 2FWGA 1J0FA 4MZBA 4NXIA 1DE2A 1W4VA 1K0NA 3ED3A 3TDGA 1YVLA 4HU7A 3US3A 2P5QA 3P90A 4GTUA 2AHEA 3GMFA 2LRNA 1V2AA 3UVTA 4NHWA 4F0BA 2CA8A 3IK9A 1GSUA 5A1NB 1M2DA 2LQQA 1GSSA 2O89A 5JWQB 4CW9A 2EFHA 1TK0B 2C3NA 4J56E 1SKRB 4FYBA 4EKZA 4X1UA 1M9AA 5G1LA 2R0CA 3KH7A 3GSTA 2IMFA 4KDUA 1W89A 3V1WA 1ACVA 3GN3A 3IC8A 3MDKA 1M9BA 2NDOA 1XVQA 3EU3A 1ERWA 5GAPD 12GSA 4IQ1A 1TRVA 1MDKA 2H1AA 4O5UA 4I6XA 4MH3A 5CRDA 3W8JA 1GNEA 4AKIA 4K2DA 4PTSA 2DKIA 1GSFA 4I97A 1USBA 4OMVA 3HJMA 2PBJA 2WULA 1PN9A 1YEXA 1JZOA 1GLQA 2IN3A 3FW2A 1YJ6A 3BD2A 1FG4A 3D22A 4ZB9A 5HFIA 1F3AA 1ABAA 3ZZXA 3GYKA 4FYCA 3EYTA 2I4AA 1HQOA 4I2UA 1ST9A 4YAVA 4PX1A 4KGIA 4EO3A 5ECLB 3QD9A 1URMA 2OE3A 3ME8A 4HDEA 3MYDA 1SJ6A 1GNWA 4JBBA 2ES7A 2C1YA 1O8WA 4HU9A 4N0VA 4MF7A 1JZWA 2IPAA 5CP1A 3HVSA 1JLWA 1E2YA 2DLXA 4TVEA 2VD1A 2UZ8A 4O7HA 2H6ZA 5J9CA 2HYXA 3IRAA 3DD3A 1AIUA 9GSSA 3G7IA 2K6VA 3ZMLA 1ZCPA 3H1NA 2B1LA 2FY6A 1SYXA 2YN1A 3RHCA 1C72A 5BMUB 3WYWA 4KF9A 2LV3A 3BJ5A 4MNNA 4HQSA 4X43A 4EIQA 2QA1A 3LG6A 2CVDA 4PGTA 4WBJA 5B6MA 3KGKA 1TI1A 2HE3A 3VPQA 4HJMA 1S3AA 2I1UA 2P0GA 3ERGA 3IDVA 4K2XA 2A2SA 5D73A 1B8XA 2JZRA 4KSOA 1M2BA 2E2MA 1PKWA 3MIXA 3IBHA 1K0CA 8GSSA 1YY7A 3D0ZA 5DAKB 3I6AA 3C73A 2HRNA 4WR5A 5F8BA 2EC4A 2IFQA 1MTCA 1M99A 3UL3A 4EXJA 3M8NA 2LUSA 2MYGA 1TJDA 1SJIA 3F63A 2HQTA 4AJ7A 2L4QA 4L5OA 1ZMAA 3WD6A 5AN1A 4CY8A 2CZ3A 1V40A 3MAKA 5EPFA 3ZITA 1GULA 4EVMA 2B5EA 4POLA 5GAND 4DSSB 5CO3A 4FIWA 1TDIA 2K8VA 2QC7A 2GQKA 4LL4B 2H66A 2H75A 1XW5A 2CZ2A 2K9FA 2OJLA 2Z9SA 3FY7A 1YZXA 4F03A 4HJ2A 2VAFA 1TRUA 5DCHA 2C0DA 2MMZA 2YNXA 5GZZB 3HHVA 2NPBA 1G7OA 1S3CA 2RM6A 3GUSA 3L78A 1TK5B 2HSMA 4AGSA 3C1SA 2BTOT 3K8NA 1V98A 1WRYA 4K8MA 2KP2A 3QMXA 4POKA 2L6DA 3DYRA 2KP1A 2O7KA 5ECHB 1EEMA 1CQGA 2R2JA 3HVVA 3N9JA 5HFGA 2VL2C 3LORA 2VLUA 2IWTA 1XBSA 2E7PA 3EINA 1OE7A 4Q5RA 3VURA 3UJ1A 2YWOA 5G5FA 1R5AA 1GUMA 1RK4A 3PGTA 4TN8A 4ZL8A 1WP0A 2LJKA 3QAVA 4JR4A 1PX6A 1ZGNA 1PSQA 1PRXA 4HZ2A 3UEMA 3FR9A 3GL5A 1TK8B 4KUNA 3WT2A 1GH2A 2LNSA 3F8UA 2VL3A 1HNAA 4GSSA 3UVHA 3HVXA 5J5NA 2HZEB 1XZOA 3WGEA 1JZDA 4L5LA 2JADA 3QFAC 3F6FA 1THXA 1OKDA 1MEKA 1EP8A 5DJLA 3LYKA 3RAZA 4X0XA 1AW9A 2B5XA 2H8LA 3LW9A 4BVXA 1B4PA 1K0OA 2GTUA 1SU9A 4IP1A 2WRTA 1EV9A 4PURA 3UBLA 4AKXB 3TKRA 1YF1A 3F4SA 2TRXA 2RLIA 3A2VA 1BJXA 1TRWA 2PMTA 4KSMA 5A4VA 1TU7A 4Z2UA 2WGRA 4K0GA 3TB2A 5INYA 3FKFA 3BOAA 1BX9A 1WOUA 5IPHA 2A4HA 1B9YC 4ID0A 1BEDA 4MMMA 5ID2A 3VLNA 2GSTA 17GSA 4RQXA 1PN0A 3TOTA 3QR6A 2HSHA 3UIWA 2DIZA 2EIOA 5A5KA 1Z6NA 2FHEA 4DEJA 4OD7A 5DVBA 5ECNB 4F9ZA 1FAAA 2VL9A 1H4OA 5KEJA 1ERTA 5KN2A 2GZPA 3TJGA 1WPIA 2X4AA 4EF0A 4ZB6A 1ML6A 2H30A 3HKRA 5IMDA 5ECPB 4TOPA 4MJCA 2L59A 3HMJG 3EPTA 4HUAA 3OR5A 1PX7A 1M7TA 3CRTA 3HZ4A 3IPZA 1Z7RA 4K1FA 1GUKA 1OC9A 2DC5A 2IL3A 4TR1A 1U6TA 3FZ9A 4F0CA 2N5BA 4W66A 3H93A 3ZREA 2MZCA 4USSA 4OWYA 5LNKe 5JCUA 4ML6A 5HR2A 4Q5FA 4I8BA 4ULXA 2OADA 1UVZA 1X9WB 1UA5A 1XPVA 1TW9A 5DALA 4GCIA 2H76A 2CX4A 2PPTA 5IM9A 3D6IA 3FZ5A 1AQWA 1ZZYA 3WGDA 3PPUA 2L5LA 5DQYA 3DEXA 4G2EA 1SVOA 5AISA 4PUFC 4ML1A 2OBKA 3G7YA 4V1Ap 4IQAA 3IA1A 3Q74A 1MDJA 2YWIA 4A5PA 4OFNA 2PVOC 3IE3A 3F0IA 3CRUA 4N30A 1A2LA 3MSZA 4XTSA 4JU5A 3GX0A 3DGQA 2C0EA 1T00A 3A5WA 5CNWA 1JZRA 2FWFA 1DSBA 3AY8A 3TRPA 1V9WA 2R3XA 1SYRA 19GSA 1AUCA 4XRDA 4WF5A 4I5QA 1F6MC 3D4MA 1GWCA 1EOHA 2JZSA 1GSQA 3A3TA 5IMZA 1HNBA 2IFQB 4GLTA 2DJJA 1GUHA 2IMKA 3TKSA 5D96A 1WMJA 1AAZA 2MBTA 3FHKA 3BCKA 4ZB8A 3ZVJA 2L57A 3APOA 4WBRD 1T1VA 4GRFA 2DJ0A 5DBQA 1KNGA 3IR4A 3QAWA 1Q98A 1EZKA 5A4WA 5CRWA 2VLTA 2E2GA 3WT1A 5A5HB 4K9ZA 2J23A 4E68A 2HLSA 4IELA 3GKMA 3G9BA 1XWAA 2PUKC 3TKQA 3APQA 3KM6A 1ERUA 4MZWA 1NSWA 2LJRA 4AKGA 2E0QA 1GTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 22GS A;  2PVQ A;  1A8Y A;  1ZOF A;  5ECQ B;  3KMO A;  4OCE A;  1TTZ A;  4QL7 A;  3UBK A;  1YKA A;  2DML A;  3PH9 A;  3CBU A;  2HSM B;  2B1K A;  3TOU A;  3UAP A;  4ZBA A;  3IAS 2;  4NHZ A;  13GS A;  2IJY A;  3GTU A;  4XS4 A;  1XWC A;  3CSH A;  2H0I A;  4BA7 A;  3LGC A;  4G0I A;  3VWW A;  2TIR A;  3E9J B;  4MPG A;  3HJO A;  1Y25 A;  1SL0 B;  4KCE A;  3HY2 A;  1T3B A;  4ZIL A;  4KAE A;  2JAC A;  3KXO A;  4ECI A;  3A2X A;  2IMI A;  1SL2 B;  4MF5 A;  3GFK A;  4OFT A;  5CYY A;  5E59 A;  3KP8 A;  1E6B A;  3EUR A;  2J9H A;  4MLY A;  3ISO A;  2M46 A;  5JWR B;  2OE0 A;  1IYI A;  5D9X A;  5IQY A;  5D9W A;  3ZMK A;  3O3T A;  2PU9 C;  4Q5N A;  2GZY A;  2VO4 A;  2NBS A;  3RHB A;  3IOS A;  4MF6 A;  3I9V 2;  4KE3 A;  5J4U A;  1XIY A;  6GSS A;  1OKT A;  2VCZ A;  6GSX A;  3IC4 A;  3A2W A;  1U88 A;  4V2N A;  3Q19 A;  4BVX B;  3RBT A;  2I9H A;  1U3A A;  2YJ7 A;  1GSD A;  2DJ1 A;  2WB9 A;  3W8S A;  1KTE A;  1ZYQ B;  5G31 A;  1Z9H A;  4TXO A;  2C4J A;  1GL8 A;  4N10 A;  5EL8 A;  2DJ3 A;  1QK8 A;  1DE1 A;  1PGT A;  2DJ2 A;  4FO5 A;  4KND A;  4XIH A;  1V57 A;  4HI7 A;  1TKD B;  2H70 A;  3F3R A;  1DUG A;  5F06 A;  1PD2 1;  3ZFB A;  3GKN A;  5ID2 B;  1K3L A;  1N2A A;  2FA4 A;  2LNT A;  2O85 A;  3KEB A;  2B5Y A;  2X64 A;  4PNF A;  3FZ4 A;  1FW1 A;  5G30 A;  3TJB A;  2M72 A;  1B4Q A;  3Q6O A;  1RW1 A;  3RPP A;  4HEA 2;  2JU5 A;  1LJR A;  2LKU A;  3FYG A;  2I3Y A;  2IIY A;  1Y6E A;  2GQL A;  5J3R A;  2FWH A;  1AXD A;  1OC9 B;  4N11 A;  4TR1 B;  2VD0 A;  3R3E A;  2IMD A;  3DKS A;  4POB A;  5FWG A;  2AAW A;  4OFM A;  2H6Y A;  2GSR A;  2ZCT A;  4E8H A;  2GVP A;  3D4T A;  1OYJ A;  3GIX A;  1MD4 A;  1PL1 A;  3EWL A;  3RPN A;  2KHP A;  2I81 A;  5DAL B;  3CYN A;  2A2R A;  1WIK A;  3HJP A;  5EY6 A;  2CV4 A;  4FYU A;  3TCO A;  3GSS A;  1HD2 A;  4G10 A;  1FB0 A;  4OO4 A;  4EE0 A;  3L0H A;  5ECO B;  4GST A;  4KW6 A;  4WKW A;  2YP6 A;  2YWM A;  4NV2 A;  3NIV A;  4XS1 A;  2RM5 A;  2QGV A;  5EVO A;  3PIN A;  1FOV A;  1A2M A;  1VF3 A;  1OC8 A;  3EE2 A;  3TKS C;  1T4Y A;  1QXH A;  1EOG A;  10GS A;  4JZQ A;  1K3Y A;  2CVK A;  1UN2 A;  3ZRD A;  3GV1 A;  2VCV A;  4IGJ A;  1Q4J A;  2CQ9 A;  3UAR A;  4ZBB A;  3DWV A;  4BWQ A;  3EMP A;  2QSI A;  1BYE A;  2YAN A;  1XOA A;  3LWA A;  4O32 A;  3U6V A;  2C3Q A;  2A4V A;  1GSY A;  3BCI A;  4WF4 A;  4JED A;  1M2A A;  5ELG A;  2X8H A;  2EIQ A;  5HQP A;  3D21 A;  4KA0 A;  2FA8 A;  2X8C A;  3S9F A;  2GLR A;  1XOB A;  5IOX A;  3H4K A;  2FUG 2;  4RI6 A;  3HXS A;  3J7Y k;  2H6X A;  1H75 A;  1O8X A;  1A23 A;  1OE8 A;  4ACS A;  2FD3 A;  5GST A;  1ON4 A;  3KH9 A;  4WXT A;  1MDI A;  4Z7X A;  4ZL7 A;  5ENU A;  2B7J A;  3GH6 A;  2H19 A;  4TKY A;  3M1G A;  2OAC A;  1X5C A;  1SK1 A;  3VI7 A;  1DBY A;  3KMN A;  2VCW A;  5HFK A;  1ILO A;  3GTU B;  5CRH A;  3TKP A;  1K0D A;  4XHM A;  4XS4 B;  3TJF A;  4LMV A;  3ERW A;  2F9S A;  1X9M B;  2LEG A;  4PQ1 A;  3QCP A;  2EIR A;  4MJB A;  2XPE A;  2ZNM A;  3DIE A;  3LXT A;  4KH7 A;  5IMC A;  5B8A A;  2KUC A;  2B7K A;  2AJQ B;  4ILF A;  4ZXG A;  3CSJ A;  1GTB A;  1BAY A;  1O7U A;  3GKX A;  4QQ7 A;  5IIZ A;  3FR3 A;  2ALB A;  3UOM A;  1LU4 A;  2C3T A;  1X9S B;  2N5F A;  3L9V A;  3RDW A;  5ECR B;  3QOU A;  4LA1 A;  4WET A;  3C71 A;  2OE1 A;  1HNC A;  3CSI A;  2LQO A;  1A2J A;  3M0F A;  1K3O A;  2M80 A;  3E0U A;  1K0A A;  2H1G A;  5JCG A;  1IYH A;  3CTF A;  5CRG A;  3KIJ A;  3F4T A;  2PGT A;  3SWL A;  4HQZ A;  2RUF A;  1G6Y A;  2WFC A;  3FEU A;  1UC7 A;  2XPD A;  4MPF A;  4GWR A;  4HOJ A;  1TI3 A;  1B48 A;  4LL1 B;  3ZTL A;  3TRQ A;  2NVL A;  4GQC A;  3CTG A;  5E4W A;  4MCU A;  3FR6 A;  1JHB A;  2MMA A;  2HSY A;  3QFB C;  6GSY A;  1A8L A;  1SK2 A;  3N5O A;  1KEB A;  1A0F A;  1ZL9 A;  5D93 A;  5HR0 A;  6GSV A;  3C1R A;  3M3M A;  4EUY A;  1CQH A;  2V32 A;  4J2F A;  4L8E A;  2VIM A;  1FVJ A;  2V1M A;  2HXK A;  3PR8 A;  4IHU A;  1NHO A;  2H0G A;  3U5R E;  1GTU A;  4JR6 A;  2H72 A;  3P8W A;  2ZUP A;  3KZQ A;  2FCH A;  4YQM A;  1T7P B;  1R26 A;  3TJJ A;  4K7O A;  1GP1 A;  4IBP A;  2KOK A;  2OKA A;  4YAP A;  2L6C A;  2JL4 A;  3EVI A;  3LSZ A;  4BL7 A;  2FGX A;  1XXU A;  2YV7 A;  3F6D A;  5L71 A;  2REM A;  5B7C A;  3FZA A;  2VM2 A;  1SKW B;  1O6J A;  4K0N A;  2XBQ A;  3LXZ A;  4PQH A;  3KP9 A;  1YEP A;  5COH A;  4DSQ A;  2YCD A;  3KTB A;  2XHF A;  3MNG A;  3LQ7 A;  5H5R A;  1J9B A;  3ZVJ D;  2MBS A;  4D73 A;  2R4V A;  3I69 A;  4EDZ A;  1I5G A;  3BBY A;  2FLS A;  3GUR A;  4IVF A;  1BG5 A;  1VGL A;  4GF0 A;  2AV4 A;  2P5R A;  3LFL A;  5AIV A;  1XVW A;  4L0U A;  2AB6 A;  2QKE A;  2DSA A;  1PKZ A;  1ERV A;  1QUW A;  4O5R A;  1G7E A;  1K0M A;  4WEY A;  3ZIJ A;  1XCC A;  2K18 A;  4KX4 A;  1YF0 A;  3E3E A;  3LYP A;  1X5D A;  2HRK A;  1EV4 A;  3VWV A;  4AJ8 A;  2JSY A;  5JCW A;  2VLV A;  1U87 A;  3QPM A;  2G0F A;  2F51 A;  4G9H A;  4IJ3 A;  2K8S A;  3GKK A;  3ZL5 A;  1XW9 A;  4H86 A;  2X99 A;  1AQV A;  3O76 A;  4ECB A;  1F9M A;  4PXO A;  5A4U A;  5GSS A;  4TR3 A;  4EL1 A;  1GRX A;  4GXZ A;  3DVX A;  1Z3E A;  4IN0 A;  2YWN A;  2LJA A;  4K7I A;  5B6N A;  4POM A;  4ZBD A;  4BWS A;  4MZC A;  4ZIJ A;  2D2Z A;  4BVY A;  1QMV A;  4XRA A;  4XCS A;  4TRX A;  14GS A;  2YV9 A;  2BMX A;  4MH2 A;  3W6G A;  1X0R A;  3UMA A;  2VUP A;  6GST A;  2VM1 A;  2WZ9 A;  2R5G A;  2DIY A;  1GSE A;  1TOF A;  5J41 A;  5HR1 A;  3QDN A;  3G7J A;  1EGO A;  2LRT A;  5FHI A;  3HD5 A;  1SEN A;  3EC3 A;  3VWX A;  1LBK A;  3GL3 A;  4L0W A;  2LS5 A;  4FQU A;  1B9X C;  1Z7P A;  4YH2 A;  1TRS A;  3FRC A;  2NTO A;  5DCG A;  2ON7 A;  4F2I A;  4NMU A;  3J7Y b;  4KCA A;  2OA7 A;  4Q5Q A;  2MMO A;  2FWE A;  20GS A;  3GRX A;  5CRE A;  2H01 A;  2TRC P;  5IO0 A;  2V2G A;  4EC0 A;  1N8J A;  3GA4 A;  4G0L A;  2CVB A;  1THO A;  2GT6 A;  3IHQ A;  1XWK A;  2G2Q A;  1VRS D;  3LJR A;  3VK9 A;  4K7N A;  2O87 A;  3JCM L;  4RI7 A;  2RII A;  3VFI A;  5H5S A;  3WGX A;  1O81 A;  3VI5 A;  4YQV A;  4I2T A;  5HR3 A;  3DML A;  4LLR A;  1AQX A;  1I9D A;  2YJH A;  5DJM A;  4PNG A;  1EWX A;  4TR4 A;  1V58 A;  3IAM 2;  3TUE A;  1A24 A;  1AC1 A;  5ECS A;  2O8V B;  2HFD A;  3TKS E;  2GSQ A;  4GSN A;  6GSW A;  3C8E A;  3HDC A;  4IJI A;  5G1K A;  3Q18 A;  1SK0 A;  1MD3 A;  3DXB A;  2C0G A;  2LTK A;  4IKH A;  5IOW A;  5CAX A;  2F8F A;  2HSN B;  3D5J A;  4ISD A;  5G5E A;  2GZZ A;  1SD8 A;  2DBC A;  2B6M A;  2H74 A;  4CHS A;  4NWY A;  4TXV A;  4F82 A;  5D9T A;  4V2L A;  2DMM A;  3F3Q A;  2OBI A;  1GLP A;  4MK3 A;  1S3D A;  3MWH A;  1R7H A;  4DVC A;  1FB6 A;  3EMX A;  4PUA A;  18GS A;  3KTL A;  4EDY A;  4BPY A;  2LRC A;  1VF1 A;  4J57 E;  5FT3 A;  1FHE A;  4KDY A;  4MJE A;  3IV4 A;  4TW5 A;  2VCX A;  4RUV A;  2PN8 A;  4N0Z A;  2DJK A;  4JE1 A;  3QAG A;  5G2Z A;  1T4Z A;  1HYU A;  4K6X A;  5ECI B;  2GGT A;  2CX3 A;  5ELA A;  2CAQ A;  3IK7 A;  4AJ6 A;  4ZL9 A;  4HS1 A;  4KB3 A;  3O6T A;  2WDU A;  3NZN A;  3KD0 A;  4MAB A;  4BL7 B;  1OAZ A;  7GSS A;  3I43 A;  5C04 A;  1M0U A;  2R37 A;  1YKC A;  3GH9 A;  2JSZ A;  5ECK B;  2VCT A;  4MJA A;  1F37 A;  1XWG A;  1NM3 A;  1G6W A;  5IO2 A;  3L9S A;  5LCZ A;  5F07 A;  1NW2 A;  2V6O A;  3P2A A;  3ZYW A;  1WWJ A;  1QFN A;  4HZ4 A;  3EU4 A;  4MP4 A;  3F4R A;  1ZYE A;  3GNJ A;  3KJY A;  4XS6 A;  2VCQ A;  2H1B A;  2MMN A;  3ZLP A;  2GSS A;  3TJK A;  4PQI A;  3HYP A;  2PWJ A;  2HRA A;  4TR0 A;  3VWU A;  3HCZ A;  3APS A;  4D73 B;  3FK8 A;  2JZT A;  4LMW A;  1RQM A;  6GSU A;  2F8A A;  3L9U A;  1F2E A;  1R4W A;  1TXX A;  1XW6 A;  4P3Y B;  1XFL A;  3C7M A;  3TGZ A;  2WCI A;  2ON5 A;  3P7X A;  2V6K A;  2H73 A;  3DRN A;  1K0B A;  5D9V A;  2VOC A;  1YQ1 A;  3NOF A;  1O85 A;  2LST A;  5JWO B;  4E8E A;  4OCF A;  2PER A;  2XC2 A;  2HZF A;  5BMU A;  4IP6 A;  4NV5 A;  3HZ8 A;  1SD9 A;  2HRK B;  3LEF A;  16GS A;  3CXG A;  3SBC A;  4G0K A;  1KBN A;  2GQM A;  2L5O A;  4MA9 A;  1FO5 A;  1Z6M A;  5IMF A;  2H0H A;  1VF2 A;  1WE0 A;  2C80 A;  1EP7 A;  3ZIV A;  4V2M A;  3HA9 A;  1U3I A;  1BQ7 A;  5KN0 A;  1PQN A;  4BVY B;  5DAK A;  1TU8 A;  3ZFL A;  3ERF A;  5AIX A;  2HNL A;  3DVW A;  2GT5 A;  4AF2 A;  5KN3 A;  4TXO B;  1J08 A;  4RQR A;  1YDK A;  1OVN A;  2XBI A;  3CMI A;  4ECC A;  4NPB A;  11GS A;  3GHA A;  2CT6 A;  2AYT A;  4DSS A;  1OC3 A;  2IME A;  2AUV A;  4IS0 A;  4ECJ A;  1XWB A;  1GTA A;  1PA3 A;  5J9B A;  3M9J A;  5C00 A;  3KCM A;  2N5A A;  1X5E A;  3L4N A;  5KN1 A;  4V1A g;  4YQU A;  4WR4 A;  2YPM A;  3GX8 A;  5DDL A;  4OO5 A;  2P31 A;  2X8G A;  1QQ2 A;  1A0R P;  5F0G A;  3IXR A;  3R2Q A;  5AGY A;  3H79 A;  5H5Q A;  4GQF A;  5LD0 A;  1TP9 A;  2HI7 A;  2WJU A;  2YOI A;  2F3M A;  1O73 A;  2H1D A;  2B3S A;  1NHY A;  2FNO A;  2V41 A;  1SKS B;  2L4C A;  5ECM B;  2HT9 A;  1EEJ A;  2GDR A;  2WS2 A;  5F05 A;  1SJZ A;  1F3B A;  4KDX A;  5IMA A;  2C0F A;  4O92 A;  4QL9 A;  1WJK A;  5IPG A;  1G0T A;  2YZU A;  5DQS A;  2HRF A;  4MDC A;  1JFU A;  1JLV A;  2H71 A;  5ABR A;  4DSR A;  4IW9 A;  3VPT A;  5D8I A;  2C8U A;  2RUE A;  2GS3 A;  1R5P A;  2VL2 A;  3TRX A;  2YZH A;  1Z5Y E;  2HZE A;  4G19 A;  3M9K A;  1T8E B;  4FH8 A;  4NAX A;  2BJX A;  2CAI A;  2KLX A;  3ME7 A;  5B8B A;  4CDO A;  2R6K A;  1FVK A;  4JRR A;  1VF4 A;  1SL1 B;  1PL2 A;  3F9U A;  1QGV A;  1EGR A;  1PMT A;  3H8Q A;  5IMV A;  2FWG A;  1J0F A;  4MZB A;  4NXI A;  1DE2 A;  1W4V A;  1K0N A;  3ED3 A;  3TDG A;  4HU7 A;  3US3 A;  2P5Q A;  3P90 A;  4GTU A;  2AHE A;  3GMF A;  2LRN A;  1V2A A;  3UVT A;  4NHW A;  4F0B A;  2CA8 A;  3IK9 A;  1GSU A;  2LQQ A;  1M2D A;  5JWQ B;  1GSS A;  2O89 A;  4CW9 A;  1TK0 B;  2C3N A;  4J56 E;  1SKR B;  4FYB A;  4EKZ A;  4X1U A;  1M9A A;  5G1L A;  3KH7 A;  3GST A;  2IMF A;  4KDU A;  1W89 A;  3V1W A;  1ACV A;  3GN3 A;  3IC8 A;  3MDK A;  1M9B A;  2NDO A;  1XVQ A;  3EU3 A;  1ERW A;  5GAP D;  12GS A;  4IQ1 A;  1TRV A;  1MDK A;  2H1A A;  4I6X A;  4MH3 A;  5CRD A;  3W8J A;  1GNE A;  4K2D A;  4PTS A;  1GSF A;  4I97 A;  1USB A;  4OMV A;  3HJM A;  2PBJ A;  2WUL A;  1PN9 A;  1YEX A;  1JZO A;  1GLQ A;  2IN3 A;  3FW2 A;  1YJ6 A;  3BD2 A;  1FG4 A;  3D22 A;  4ZB9 A;  5HFI A;  1F3A A;  1ABA A;  3ZZX A;  3GYK A;  4FYC A;  3EYT A;  2I4A A;  1HQO A;  4I2U A;  1ST9 A;  4YAV A;  4PX1 A;  4KGI A;  4EO3 A;  3QD9 A;  5ECL B;  1URM A;  2OE3 A;  3ME8 A;  4HDE A;  1SJ6 A;  1GNW A;  4JBB A;  2ES7 A;  2C1Y A;  1O8W A;  4HU9 A;  4N0V A;  4MF7 A;  1JZW A;  2IPA A;  5CP1 A;  3HVS A;  1JLW A;  1E2Y A;  2DLX A;  4TVE A;  2VD1 A;  2UZ8 A;  4O7H A;  2H6Z A;  5J9C A;  2HYX A;  3IRA A;  3DD3 A;  1AIU A;  9GSS A;  3G7I A;  2K6V A;  3ZML A;  1ZCP A;  3H1N A;  2B1L A;  2FY6 A;  1SYX A;  2YN1 A;  3RHC A;  1C72 A;  3WYW A;  4KF9 A;  2LV3 A;  3BJ5 A;  4HQS A;  4X43 A;  3LG6 A;  2CVD A;  4PGT A;  4WBJ A;  5B6M A;  3KGK A;  1TI1 A;  2HE3 A;  3VPQ A;  4HJM A;  1S3A A;  2I1U A;  2P0G A;  3ERG A;  3IDV A;  2A2S A;  5D73 A;  1B8X A;  2JZR A;  4KSO A;  1M2B A;  2E2M A;  1PKW A;  3IBH A;  1K0C A;  8GSS A;  1YY7 A;  3D0Z A;  5DAK B;  3I6A A;  3C73 A;  2HRN A;  4WR5 A;  5F8B A;  2EC4 A;  2IFQ A;  1MTC A;  1M99 A;  3UL3 A;  4EXJ A;  3M8N A;  2LUS A;  2MYG A;  1TJD A;  1SJI A;  3F63 A;  2HQT A;  4AJ7 A;  2L4Q A;  4L5O A;  1ZMA A;  3WD6 A;  5AN1 A;  2CZ3 A;  1V40 A;  3MAK A;  5EPF A;  3ZIT A;  1GUL A;  4EVM A;  2B5E A;  4POL A;  5GAN D;  4DSS B;  5CO3 A;  4FIW A;  1TDI A;  2K8V A;  2QC7 A;  2GQK A;  4LL4 B;  2H66 A;  2H75 A;  1XW5 A;  2CZ2 A;  2K9F A;  2OJL A;  2Z9S A;  3FY7 A;  1YZX A;  4F03 A;  4HJ2 A;  2VAF A;  1TRU A;  5DCH A;  2C0D A;  2MMZ A;  2YNX A;  5GZZ B;  3HHV A;  2NPB A;  1G7O A;  1S3C A;  2RM6 A;  3GUS A;  3L78 A;  1TK5 B;  2HSM A;  4AGS A;  3C1S A;  2BTO T;  3K8N A;  1V98 A;  1WRY A;  4K8M A;  2KP2 A;  3QMX A;  4POK A;  2L6D A;  3DYR A;  2KP1 A;  2O7K A;  5ECH B;  1EEM A;  1CQG A;  2R2J A;  3HVV A;  3N9J A;  5HFG A;  2VL2 C;  3LOR A;  2VLU A;  2IWT A;  1XBS A;  2E7P A;  3EIN A;  1OE7 A;  4Q5R A;  3VUR A;  3UJ1 A;  2YWO A;  5G5F A;  1R5A A;  1GUM A;  1RK4 A;  3PGT A;  4TN8 A;  4ZL8 A;  1WP0 A;  2LJK A;  3QAV A;  4JR4 A;  1PX6 A;  1ZGN A;  1PSQ A;  1PRX A;  4HZ2 A;  3UEM A;  3FR9 A;  3GL5 A;  1TK8 B;  4KUN A;  3WT2 A;  1GH2 A;  2LNS A;  3F8U A;  2VL3 A;  1HNA A;  4GSS A;  3UVH A;  3HVX A;  5J5N A;  2HZE B;  1XZO A;  3WGE A;  1JZD A;  4L5L A;  2JAD A;  3QFA C;  3F6F A;  1THX A;  1OKD A;  1MEK A;  1EP8 A;  5DJL A;  3LYK A;  3RAZ A;  4X0X A;  1AW9 A;  2B5X A;  2H8L A;  4BVX A;  1B4P A;  1K0O A;  2GTU A;  1SU9 A;  4IP1 A;  2WRT A;  1EV9 A;  4PUR A;  3UBL A;  3TKR A;  1YF1 A;  3F4S A;  2TRX A;  2RLI A;  3A2V A;  1BJX A;  1TRW A;  2PMT A;  4KSM A;  5A4V A;  1TU7 A;  2WGR A;  4K0G A;  3TB2 A;  5INY A;  3FKF A;  3BOA A;  1BX9 A;  1WOU A;  5IPH A;  1B9Y C;  4ID0 A;  1BED A;  4MMM A;  5ID2 A;  3VLN A;  2GST A;  17GS A;  4RQX A;  3TOT A;  3QR6 A;  2HSH A;  3UIW A;  2DIZ A;  2EIO A;  5A5K A;  1Z6N A;  2FHE A;  4DEJ A;  4OD7 A;  5DVB A;  5ECN B;  4F9Z A;  1FAA A;  2VL9 A;  1H4O A;  5KEJ A;  1ERT A;  5KN2 A;  2GZP A;  3TJG A;  1WPI A;  4EF0 A;  4ZB6 A;  1ML6 A;  2H30 A;  3HKR A;  5IMD A;  5ECP B;  4TOP A;  4MJC A;  2L59 A;  4HUA A;  3OR5 A;  1PX7 A;  1M7T A;  3CRT A;  3HZ4 A;  3IPZ A;  1Z7R A;  4K1F A;  1GUK A;  1OC9 A;  2DC5 A;  2IL3 A;  4TR1 A;  1U6T A;  3FZ9 A;  4F0C A;  2N5B A;  3H93 A;  3ZRE A;  2MZC A;  4USS A;  4OWY A;  5LNK e;  5JCU A;  4ML6 A;  5HR2 A;  4Q5F A;  4I8B A;  4ULX A;  2OAD A;  1UVZ A;  1X9W B;  1UA5 A;  1XPV A;  1TW9 A;  5DAL A;  4GCI A;  2H76 A;  2CX4 A;  2PPT A;  5IM9 A;  3D6I A;  3FZ5 A;  1AQW A;  1ZZY A;  3WGD A;  3PPU A;  2L5L A;  5DQY A;  3DEX A;  4G2E A;  5AIS A;  4PUF C;  4ML1 A;  2OBK A;  3G7Y A;  4V1A p;  4IQA A;  3IA1 A;  3Q74 A;  1MDJ A;  2YWI A;  4OFN A;  2PVO C;  3IE3 A;  3F0I A;  3CRU A;  4N30 A;  1A2L A;  3MSZ A;  4XTS A;  4JU5 A;  3GX0 A;  3DGQ A;  2C0E A;  1T00 A;  3A5W A;  5CNW A;  1JZR A;  2FWF A;  1DSB A;  3AY8 A;  3TRP A;  1V9W A;  2R3X A;  1SYR A;  19GS A;  1AUC A;  4XRD A;  4WF5 A;  4I5Q A;  1F6M C;  3D4M A;  1GWC A;  1EOH A;  2JZS A;  1GSQ A;  3A3T A;  5IMZ A;  1HNB A;  2IFQ B;  4GLT A;  2DJJ A;  1GUH A;  2IMK A;  3TKS A;  5D96 A;  1WMJ A;  1AAZ A;  2MBT A;  3FHK A;  3BCK A;  4ZB8 A;  3ZVJ A;  2L57 A;  3APO A;  4WBR D;  1T1V A;  4GRF A;  2DJ0 A;  5DBQ A;  1KNG A;  3IR4 A;  3QAW A;  1Q98 A;  1EZK A;  5A4W A;  5CRW A;  2VLT A;  2E2G A;  3WT1 A;  4K9Z A;  2J23 A;  2HLS A;  4IEL A;  3GKM A;  3G9B A;  1XWA A;  2PUK C;  3TKQ A;  3APQ A;  3KM6 A;  1ERU A;  4MZW A;  1NSW A;  2LJR A;  2E0Q A;  1GTI A; 
#chains in the Genus database with same CATH topology
 22GS A;  2PVQ A;  1A8Y A;  1ZOF A;  5ECQ B;  3KMO A;  4OCE A;  1TTZ A;  4G01 A;  4QL7 A;  3UBK A;  1YKA A;  2DML A;  3PH9 A;  3CBU A;  2HSM B;  2B1K A;  3TOU A;  3UAP A;  4ZBA A;  3IAS 2;  4NHZ A;  13GS A;  2IJY A;  3GTU A;  2WW0 A;  4XS4 A;  1XWC A;  3CSH A;  2H0I A;  4BA7 A;  3LGC A;  4G0I A;  3VWW A;  2TIR A;  3E9J B;  4PHZ C;  4MPG A;  3HJO A;  1Y25 A;  1SL0 B;  3HY2 A;  4KCE A;  1T3B A;  4ZIL A;  4KAE A;  2JAC A;  3KXO A;  4ECI A;  3A2X A;  2IMI A;  1SL2 B;  4MF5 A;  3GFK A;  4OFT A;  5CYY A;  5E59 A;  3KP8 A;  1E6B A;  3EUR A;  2J9H A;  4MLY A;  3ISO A;  2M46 A;  5JWR B;  2OE0 A;  1IYI A;  5D9X A;  5IQY A;  5D9W A;  1S3R A;  3ZMK A;  3O3T A;  2PU9 C;  4Q5N A;  2GZY A;  2VO4 A;  2NBS A;  3RHB A;  3IOS A;  5J47 A;  4MF6 A;  3I9V 2;  4KE3 A;  5J4U A;  1XIY A;  4AKH A;  6GSS A;  1OKT A;  2VCZ A;  6GSX A;  3IC4 A;  3A2W A;  1U88 A;  4V2N A;  3Q19 A;  4BVX B;  3RBT A;  2I9H A;  1U3A A;  2YJ7 A;  1GSD A;  2DJ1 A;  2WB9 A;  3W8S A;  1KTE A;  1ZYQ B;  5G31 A;  1Z9H A;  4TXO A;  2C4J A;  1TXU A;  1N25 A;  1GL8 A;  4N10 A;  5EL8 A;  2O5V A;  2DJ3 A;  1QK8 A;  1DE1 A;  1PGT A;  2DJ2 A;  4FO5 A;  4KND A;  4XIH A;  1V57 A;  4HI7 A;  1TKD B;  2H70 A;  3F3R A;  1DUG A;  5F06 A;  1PD2 1;  3ZFB A;  3GKN A;  5ID2 B;  1K3L A;  1N2A A;  2FA4 A;  2LNT A;  2O85 A;  3KEB A;  2B5Y A;  2X64 A;  4PNF A;  3FZ4 A;  1FW1 A;  5G30 A;  3TJB A;  2M72 A;  1B4Q A;  3Q6O A;  1RW1 A;  3RPP A;  4HEA 2;  2JU5 A;  2A2P A;  1LJR A;  2LKU A;  3FYG A;  1YEW C;  2I3Y A;  2IIY A;  1Y6E A;  1PFO A;  2GQL A;  5J3R A;  1SVL A;  2FWH A;  3FMW A;  1AXD A;  1OC9 B;  4N11 A;  4TR1 B;  2VD0 A;  3R3E A;  2IMD A;  3DKS A;  4O5Q A;  4POB A;  5FWG A;  2AAW A;  4OFM A;  2H6Y A;  2GSR A;  2ZCT A;  4E8H A;  2GVP A;  3D4T A;  1OYJ A;  3GIX A;  1MD4 A;  1PL1 A;  3EWL A;  3RPN A;  2KHP A;  2I81 A;  5DAL B;  3CYN A;  2A2R A;  1WIK A;  3HJP A;  5EY6 A;  2CV4 A;  4FYU A;  3TCO A;  3GSS A;  1HD2 A;  4G10 A;  2R0P A;  1FB0 A;  4OO4 A;  4EE0 A;  3L0H A;  5ECO B;  4GST A;  4KW6 A;  4WKW A;  2WVY A;  2YP6 A;  2YWM A;  4NV2 A;  3NIV A;  4XS1 A;  2RM5 A;  2QGV A;  5EVO A;  3PIN A;  1FOV A;  1A2M A;  1VF3 A;  1OC8 A;  3EE2 A;  1SVM A;  3TKS C;  1T4Y A;  1QXH A;  4Z2T A;  1EOG A;  10GS A;  4JZQ A;  1K3Y A;  2CVK A;  1UN2 A;  3ZRD A;  3GV1 A;  2VCV A;  4IGJ A;  1Q4J A;  2CQ9 A;  3UAR A;  4ZBB A;  3DWV A;  4BWQ A;  3EMP A;  2DKH A;  2QSI A;  1BYE A;  2YAN A;  1XOA A;  3LWA A;  4O32 A;  3U6V A;  2H1L A;  2C3Q A;  2A4V A;  1GSY A;  3BCI A;  4WF4 A;  5KOX A;  4JED A;  1M2A A;  5ELG A;  2X8H A;  2EIQ A;  5HQP A;  3D21 A;  4KA0 A;  2FA8 A;  2X8C A;  3S9F A;  2GLR A;  1XOB A;  5IOX A;  3H4K A;  3HVN A;  2FUG 2;  4RI6 A;  3HXS A;  3J7Y k;  2H6X A;  1H75 A;  1O8X A;  1A23 A;  1OE8 A;  4ACS A;  2FD3 A;  5GST A;  1ON4 A;  3KH9 A;  4WXT A;  1MDI A;  4Z7X A;  4ZL7 A;  5ENU A;  2B7J A;  3GH6 A;  2H19 A;  4TKY A;  3M1G A;  2OAC A;  1X5C A;  1SK1 A;  3VI7 A;  1DBY A;  3KMN A;  2VCW A;  5HFK A;  1ILO A;  3GTU B;  5CRH A;  3TKP A;  1K0D A;  4XHM A;  4XS4 B;  3TJF A;  4LMV A;  3ERW A;  2F9S A;  1X9M B;  2LEG A;  4PQ1 A;  3QCP A;  2EIR A;  4MJB A;  2XPE A;  2ZNM A;  3DIE A;  3LXT A;  4KH7 A;  5IMC A;  5B8A A;  2VKZ G;  2KUC A;  2WW1 A;  2B7K A;  2AJQ B;  4ILF A;  4ZXG A;  3CSJ A;  1GTB A;  1BAY A;  1O7U A;  3GKX A;  4QQ7 A;  5IIZ A;  3FR3 A;  2ALB A;  3UOM A;  1LU4 A;  2C3T A;  1X9S B;  2N5F A;  3L9V A;  3RDW A;  5ECR B;  3QOU A;  4LA1 A;  4WET A;  4N3Z A;  3C71 A;  2OE1 A;  1HNC A;  3CSI A;  2LQO A;  1A2J A;  3M0F A;  1K3O A;  2M80 A;  3E0U A;  1K0A A;  2H1G A;  5JCG A;  1IYH A;  3CTF A;  5CRG A;  3KIJ A;  3F4T A;  2PGT A;  3SWL A;  4HQZ A;  2RUF A;  1G6Y A;  2WFC A;  3FEU A;  1UC7 A;  2XPD A;  4MPF A;  2OT3 A;  4GWR A;  4HOJ A;  1TI3 A;  2O3E A;  1B48 A;  2HSN A;  4LL1 B;  3ZTL A;  3TRQ A;  2NVL A;  4GQC A;  3CTG A;  5E4W A;  4MCU A;  3FR6 A;  1JHB A;  2MMA A;  2HSY A;  3QFB C;  6GSY A;  1A8L A;  1SK2 A;  3N5O A;  1KEB A;  1A0F A;  1ZL9 A;  5D93 A;  5HR0 A;  6GSV A;  2EFD A;  2EFC A;  3C1R A;  3M3M A;  4EUY A;  1CQH A;  4K5S A;  2V32 A;  4J2F A;  4L8E A;  2VIM A;  1FVJ A;  2V1M A;  2HXK A;  3PR8 A;  4IHU A;  1NHO A;  2H0G A;  3U5R E;  1GTU A;  4JR6 A;  2H72 A;  3P8W A;  2ZUP A;  3KZQ A;  2FCH A;  4YQM A;  5A34 A;  4QMK A;  1T7P B;  1R26 A;  3TJJ A;  4K7O A;  1GP1 A;  4IBP A;  2KOK A;  2OKA A;  4YAP A;  2L6C A;  2JL4 A;  3EVI A;  3LSZ A;  4BL7 A;  2FGX A;  1XXU A;  2YV7 A;  3F6D A;  5L71 A;  2REM A;  3IHG A;  5B7C A;  3FZA A;  2VM2 A;  1SKW B;  1O6J A;  4K0N A;  2XBQ A;  4YKG A;  3LXZ A;  4PQH A;  3KP9 A;  1YEP A;  4CY6 A;  5COH A;  4DSQ A;  2YCD A;  3KTB A;  2XHF A;  3MNG A;  3LQ7 A;  5H5R A;  1J9B A;  3ZVJ D;  5KOW A;  2MBS A;  1ZYN A;  4D73 A;  2R4V A;  3I69 A;  4EDZ A;  1I5G A;  4X4J A;  3BBY A;  2FLS A;  3GUR A;  4IVF A;  1BG5 A;  1VGL A;  4GF0 A;  2AV4 A;  2P5R A;  3RGB C;  3LFL A;  5AIV A;  4ICY A;  1XVW A;  4L0U A;  2AB6 A;  2QKE A;  2DSA A;  1PKZ A;  1ERV A;  1QUW A;  4O5R A;  1G7E A;  1K0M A;  4WEY A;  3ZIJ A;  1XCC A;  2K18 A;  4KX4 A;  1YF0 A;  3E3E A;  3LYP A;  1X5D A;  2HRK A;  1EV4 A;  3VWV A;  4AJ8 A;  2JSY A;  5JCW A;  2VLV A;  1U87 A;  3QPM A;  2G0F A;  2F51 A;  4G9H A;  4IJ3 A;  2K8S A;  3GKK A;  2WW3 A;  3ZL5 A;  1XW9 A;  4H86 A;  2X99 A;  4Z2R A;  1AQV A;  3O76 A;  4ECB A;  1F9M A;  4PXO A;  5A4U A;  5GSS A;  4TR3 A;  4EL1 A;  2X49 A;  1GRX A;  4GXZ A;  2UV8 G;  3DVX A;  1Z3E A;  4IN0 A;  2YWN A;  2LJA A;  4K7I A;  5B6N A;  4POM A;  4ZBD A;  4BWS A;  4MZC A;  4ZIJ A;  2D2Z A;  4BVY A;  1QMV A;  4XRA A;  4XCS A;  4TRX A;  14GS A;  2YV9 A;  2BMX A;  4MH2 A;  3W6G A;  1X0R A;  3UMA A;  2VUP A;  6GST A;  2VM1 A;  2WZ9 A;  2R5G A;  2DIY A;  1ZYP A;  1GSE A;  1TOF A;  5J41 A;  5HR1 A;  3QDN A;  3G7J A;  1EGO A;  2LRT A;  5FHI A;  3HD5 A;  1SEN A;  3EC3 A;  3VWX A;  1LBK A;  3GL3 A;  4L0W A;  2LS5 A;  4FQU A;  1B9X C;  1Z7P A;  4YH2 A;  1TRS A;  3FRC A;  2NTO A;  5DCG A;  2ON7 A;  4F2I A;  4NMU A;  3J7Y b;  4KCA A;  2OA7 A;  5J4Y A;  4Q5Q A;  2MMO A;  2FWE A;  20GS A;  3GRX A;  5CRE A;  2H01 A;  2TRC P;  5IO0 A;  2V2G A;  4EC0 A;  1N8J A;  3GA4 A;  4G0L A;  2CVB A;  1THO A;  2GT6 A;  3IHQ A;  1XWK A;  2G2Q A;  1VRS D;  3LJR A;  3VK9 A;  4K7N A;  2O87 A;  3JCM L;  4RI7 A;  2RII A;  3VFI A;  5H5S A;  3WGX A;  1O81 A;  1BF5 A;  3VI5 A;  4YQV A;  4ZB7 A;  4I2T A;  5HR3 A;  3DML A;  4LLR A;  1AQX A;  1I9D A;  2YJH A;  5DJM A;  4PNG A;  1EWX A;  4TR4 A;  1V58 A;  3IAM 2;  3TUE A;  1A24 A;  1AC1 A;  5ECS A;  5J40 A;  2O8V B;  2HFD A;  3TKS E;  2GSQ A;  4GSN A;  6GSW A;  3C8E A;  3HDC A;  4IJI A;  5G1K A;  3Q18 A;  1SK0 A;  1MD3 A;  3DXB A;  2C0G A;  1M3I A;  1Y1U A;  2LTK A;  4IKH A;  5IOW A;  3TU3 B;  5CAX A;  2F8F A;  2HSN B;  3D5J A;  4ISD A;  5G5E A;  5A5H A;  2GZZ A;  1SD8 A;  2DBC A;  2B6M A;  2H74 A;  4CHS A;  4NWY A;  4TXV A;  4F82 A;  5D9T A;  3RFR C;  4V2L A;  1BG1 A;  2DMM A;  3F3Q A;  2OBI A;  1GLP A;  4MK3 A;  1S3D A;  3MWH A;  1R7H A;  4DVC A;  1FB6 A;  3EMX A;  4PUA A;  18GS A;  3KTL A;  4EDY A;  5A1N A;  4BPY A;  2LRC A;  1VF1 A;  4J57 E;  5FT3 A;  1FHE A;  4KDY A;  4MJE A;  3IV4 A;  4TW5 A;  2VCX A;  4RUV A;  2PN8 A;  4N0Z A;  2DJK A;  4JE1 A;  3QAG A;  5A34 B;  5G2Z A;  1FOH A;  1T4Z A;  1HYU A;  4K6X A;  5ECI B;  2GGT A;  2CX3 A;  5ELA A;  2CAQ A;  3IK7 A;  4YKF A;  4AJ6 A;  4ZL9 A;  4HS1 A;  4KB3 A;  3O6T A;  2WDU A;  3NZN A;  3KD0 A;  2WVX A;  4MAB A;  4BL7 B;  1OAZ A;  7GSS A;  3I43 A;  5C04 A;  1M0U A;  2R37 A;  1YKC A;  3GH9 A;  2JSZ A;  5ECK B;  2VCT A;  4MJA A;  1F37 A;  1XWG A;  1NM3 A;  1G6W A;  5IO2 A;  3L9S A;  5LCZ A;  5F07 A;  2QA2 A;  1NW2 A;  2V6O A;  3P2A A;  3ZYW A;  1WWJ A;  1QFN A;  4HZ4 A;  3EU4 A;  4MP4 A;  3F4R A;  1ZYE A;  3GNJ A;  3KJY A;  4XS6 A;  2VCQ A;  2H1B A;  2MMN A;  3ZLP A;  2GSS A;  3TJK A;  4PQI A;  3HYP A;  2PWJ A;  2HRA A;  2EFE A;  4TR0 A;  3VWU A;  3HCZ A;  3APS A;  4D73 B;  3FK8 A;  2JZT A;  4LMW A;  1RQM A;  6GSU A;  2F8A A;  3L9U A;  1F2E A;  1R4W A;  1TXX A;  1XW6 A;  4P3Y B;  1XFL A;  3C7M A;  3TGZ A;  1M3J A;  2WCI A;  2ON5 A;  3P7X A;  2V6K A;  2H73 A;  3DRN A;  4GDF A;  1K0B A;  5D9V A;  2VOC A;  1YQ1 A;  3NOF A;  1O85 A;  2LST A;  5JWO B;  4E8E A;  4OCF A;  3CWG A;  2PER A;  2O36 A;  2R0G A;  2XC2 A;  2HZF A;  5BMU A;  4IP6 A;  4NV5 A;  3HZ8 A;  1SD9 A;  2HRK B;  3LEF A;  16GS A;  3CXG A;  3SBC A;  4G0K A;  1KBN A;  2GQM A;  2L5O A;  4MA9 A;  1FO5 A;  1Z6M A;  5IMF A;  2H0H A;  1VF2 A;  1WE0 A;  2C80 A;  1EP7 A;  3ZIV A;  4V2M A;  3HA9 A;  1U3I A;  1BQ7 A;  5KN0 A;  1PQN A;  4BVY B;  5DAK A;  1TU8 A;  3ZFL A;  3ERF A;  5AIX A;  2HNL A;  3DVW A;  2GT5 A;  4AI6 A;  4AF2 A;  5BRT A;  5KN3 A;  4TXO B;  1J08 A;  5J4V A;  4RQR A;  1YDK A;  1OVN A;  2XBI A;  3CMI A;  4ECC A;  4BIK A;  4NPB A;  4K5R A;  11GS A;  3GHA A;  2CT6 A;  2AYT A;  4DSS A;  1OC3 A;  2IME A;  2AUV A;  4IS0 A;  4ECJ A;  1XWB A;  1XG8 A;  1GTA A;  1PA3 A;  5J9B A;  3M9J A;  5C00 A;  3KCM A;  2N5A A;  1X5E A;  3L4N A;  5KN1 A;  4V1A g;  4YQU A;  4WR4 A;  2YPM A;  3GX8 A;  5DDL A;  4OO5 A;  2P31 A;  2X8G A;  1QQ2 A;  1A0R P;  5F0G A;  3IXR A;  3R2Q A;  5AGY A;  3H79 A;  5H5Q A;  4GQF A;  5LD0 A;  1TP9 A;  2HI7 A;  2YOI A;  2WJU A;  2F3M A;  1O73 A;  2H1D A;  2B3S A;  1NHY A;  2FNO A;  2V41 A;  1SKS B;  2L4C A;  3A5I A;  5ECM B;  2HT9 A;  1EEJ A;  2GDR A;  2WS2 A;  5F05 A;  1SJZ A;  1F3B A;  4KDX A;  5IMA A;  2C0F A;  4O92 A;  4QL9 A;  1WJK A;  5IPG A;  1G0T A;  2YZU A;  5DQS A;  2HRF A;  4MDC A;  1JFU A;  1JLV A;  2H71 A;  5ABR A;  4DSR A;  4IW9 A;  3VPT A;  5D8I A;  2C8U A;  2RUE A;  2GS3 A;  1R5P A;  2VL2 A;  3TRX A;  2YZH A;  1Z5Y E;  2HZE A;  4EIP A;  4G19 A;  3M9K A;  1T8E B;  4FH8 A;  4NAX A;  2BJX A;  2CAI A;  2KLX A;  3ME7 A;  5B8B A;  4CDO A;  2R6K A;  2WVZ A;  1FVK A;  4JRR A;  1VF4 A;  1SL1 B;  1PL2 A;  3F9U A;  1QGV A;  1EGR A;  1PMT A;  3H8Q A;  5IMV A;  2FWG A;  1J0F A;  4MZB A;  4NXI A;  1DE2 A;  1W4V A;  1K0N A;  3ED3 A;  3TDG A;  1YVL A;  4HU7 A;  3US3 A;  2P5Q A;  3P90 A;  4GTU A;  2AHE A;  3GMF A;  2LRN A;  1V2A A;  3UVT A;  4NHW A;  4F0B A;  2CA8 A;  3IK9 A;  1GSU A;  5A1N B;  1M2D A;  2LQQ A;  1GSS A;  2O89 A;  5JWQ B;  4CW9 A;  2EFH A;  1TK0 B;  2C3N A;  4J56 E;  1SKR B;  3CHX C;  4FYB A;  4EKZ A;  4X1U A;  1M9A A;  5G1L A;  2R0C A;  3KH7 A;  3GST A;  2IMF A;  4KDU A;  1W89 A;  3V1W A;  1ACV A;  3GN3 A;  3IC8 A;  3MDK A;  1M9B A;  2NDO A;  1XVQ A;  3EU3 A;  1ERW A;  5GAP D;  12GS A;  4IQ1 A;  1TRV A;  2WVX B;  1MDK A;  2H1A A;  4O5U A;  4I6X A;  4MH3 A;  5CRD A;  3W8J A;  1GNE A;  4AKI A;  4K2D A;  4PTS A;  2DKI A;  1GSF A;  4I97 A;  1USB A;  4OMV A;  3HJM A;  2PBJ A;  2WUL A;  1PN9 A;  1YEX A;  1JZO A;  1GLQ A;  2IN3 A;  3FW2 A;  1YJ6 A;  3BD2 A;  1FG4 A;  3D22 A;  4ZB9 A;  5HFI A;  1F3A A;  1ABA A;  3ZZX A;  3GYK A;  4FYC A;  3EYT A;  2I4A A;  1HQO A;  4I2U A;  1ST9 A;  4YAV A;  4PX1 A;  4KGI A;  4EO3 A;  5ECL B;  3QD9 A;  1URM A;  2OE3 A;  3ME8 A;  4HDE A;  3MYD A;  1SJ6 A;  1GNW A;  4JBB A;  2ES7 A;  2C1Y A;  1O8W A;  4HU9 A;  4N0V A;  4MF7 A;  1JZW A;  2IPA A;  5CP1 A;  3HVS A;  1JLW A;  1E2Y A;  2DLX A;  4TVE A;  3CQF A;  2VD1 A;  2UZ8 A;  4O7H A;  2H6Z A;  5J9C A;  2HYX A;  3IRA A;  3DD3 A;  1AIU A;  9GSS A;  3G7I A;  2K6V A;  3ZML A;  1ZCP A;  3H1N A;  2B1L A;  2FY6 A;  1SYX A;  2YN1 A;  3RHC A;  1C72 A;  5BMU B;  3WYW A;  4KF9 A;  2LV3 A;  3BJ5 A;  4MNN A;  4HQS A;  4X43 A;  4EIQ A;  2QA1 A;  3LG6 A;  2CVD A;  4PGT A;  4WBJ A;  5B6M A;  3KGK A;  1TI1 A;  2HE3 A;  3VPQ A;  4HJM A;  1S3A A;  2I1U A;  2P0G A;  3ERG A;  3IDV A;  4K2X A;  2A2S A;  5D73 A;  1B8X A;  2JZR A;  4KSO A;  1M2B A;  2E2M A;  1PKW A;  3MIX A;  3IBH A;  1K0C A;  8GSS A;  1YY7 A;  3D0Z A;  5DAK B;  3I6A A;  3C73 A;  2HRN A;  4WR5 A;  5F8B A;  2EC4 A;  2IFQ A;  1MTC A;  1M99 A;  3UL3 A;  4EXJ A;  3M8N A;  2LUS A;  2MYG A;  1TJD A;  1SJI A;  3F63 A;  2HQT A;  4AJ7 A;  2L4Q A;  4L5O A;  1ZMA A;  3WD6 A;  5AN1 A;  4CY8 A;  2CZ3 A;  1V40 A;  3MAK A;  5EPF A;  3ZIT A;  1GUL A;  4EVM A;  2B5E A;  4POL A;  5GAN D;  4DSS B;  5CO3 A;  4FIW A;  1TDI A;  2K8V A;  2QC7 A;  2GQK A;  4LL4 B;  2H66 A;  2H75 A;  1XW5 A;  2CZ2 A;  2K9F A;  2OJL A;  2Z9S A;  3FY7 A;  1YZX A;  4F03 A;  4HJ2 A;  2VAF A;  1TRU A;  5DCH A;  2C0D A;  2MMZ A;  2YNX A;  1I1I P;  5GZZ B;  3HHV A;  2NPB A;  1G7O A;  1S3C A;  2RM6 A;  2WZS A;  3GUS A;  3L78 A;  1TK5 B;  2HSM A;  4AGS A;  3C1S A;  2BTO T;  3K8N A;  1V98 A;  1WRY A;  4K8M A;  2KP2 A;  3QMX A;  4POK A;  2L6D A;  3DYR A;  2KP1 A;  2O7K A;  5ECH B;  1EEM A;  1CQG A;  2R2J A;  3HVV A;  3N9J A;  5HFG A;  2VL2 C;  3LOR A;  2VLU A;  2IWT A;  1XBS A;  2E7P A;  3EIN A;  1OE7 A;  4Q5R A;  3VUR A;  3UJ1 A;  2YWO A;  5G5F A;  1R5A A;  1GUM A;  1RK4 A;  3PGT A;  4TN8 A;  4ZL8 A;  1WP0 A;  2LJK A;  3QAV A;  4JR4 A;  1PX6 A;  1ZGN A;  1PSQ A;  1PRX A;  4HZ2 A;  3UEM A;  3FR9 A;  3GL5 A;  1TK8 B;  4KUN A;  3WT2 A;  1GH2 A;  2LNS A;  3F8U A;  2VL3 A;  1HNA A;  4GSS A;  3UVH A;  3HVX A;  5J5N A;  2HZE B;  1XZO A;  3WGE A;  1JZD A;  4L5L A;  2JAD A;  3QFA C;  3F6F A;  1THX A;  1OKD A;  1MEK A;  1EP8 A;  5DJL A;  3LYK A;  3RAZ A;  4X0X A;  1AW9 A;  2B5X A;  2H8L A;  3LW9 A;  4BVX A;  1B4P A;  1K0O A;  2GTU A;  1SU9 A;  4IP1 A;  2WRT A;  1EV9 A;  4PUR A;  3UBL A;  4AKX B;  3TKR A;  1YF1 A;  3F4S A;  2TRX A;  2RLI A;  3A2V A;  1BJX A;  1TRW A;  2PMT A;  4KSM A;  5A4V A;  1TU7 A;  4Z2U A;  2WGR A;  4K0G A;  3TB2 A;  5INY A;  3FKF A;  3BOA A;  1BX9 A;  1WOU A;  1S4B P;  5IPH A;  2A4H A;  1B9Y C;  4ID0 A;  1BED A;  4MMM A;  5ID2 A;  3VLN A;  2GST A;  17GS A;  4RQX A;  1PN0 A;  3TOT A;  3QR6 A;  2HSH A;  3UIW A;  2DIZ A;  2EIO A;  5A5K A;  1Z6N A;  2FHE A;  4DEJ A;  4OD7 A;  5DVB A;  5ECN B;  4F9Z A;  1FAA A;  2VL9 A;  4PI2 C;  1H4O A;  5KEJ A;  1ERT A;  5KN2 A;  2GZP A;  3TJG A;  1WPI A;  2X4A A;  4EF0 A;  4ZB6 A;  1ML6 A;  2H30 A;  3HKR A;  5IMD A;  5ECP B;  4TOP A;  4MJC A;  2L59 A;  3HMJ G;  3EPT A;  4HUA A;  3OR5 A;  1PX7 A;  1M7T A;  3CRT A;  3HZ4 A;  3IPZ A;  2WW2 A;  1Z7R A;  4K1F A;  1GUK A;  1OC9 A;  2DC5 A;  2IL3 A;  4TR1 A;  1U6T A;  3FZ9 A;  4F0C A;  2N5B A;  4W66 A;  3H93 A;  3ZRE A;  2MZC A;  4USS A;  4OWY A;  5LNK e;  5JCU A;  4ML6 A;  5HR2 A;  4Q5F A;  4I8B A;  4ULX A;  2OAD A;  1UVZ A;  1X9W B;  1UA5 A;  1XPV A;  1TW9 A;  5DAL A;  4GCI A;  2H76 A;  2CX4 A;  2PPT A;  5IM9 A;  3D6I A;  3FZ5 A;  1AQW A;  1ZZY A;  3WGD A;  3PPU A;  2L5L A;  5DQY A;  3DEX A;  4G2E A;  1SVO A;  5AIS A;  4PUF C;  4ML1 A;  2OBK A;  3G7Y A;  4V1A p;  4IQA A;  3IA1 A;  3Q74 A;  1MDJ A;  2YWI A;  4A5P A;  4OFN A;  2PVO C;  3IE3 A;  3F0I A;  3CRU A;  4N30 A;  1A2L A;  3MSZ A;  4XTS A;  4JU5 A;  3GX0 A;  3DGQ A;  2C0E A;  1T00 A;  3A5W A;  5CNW A;  4HSC X;  1JZR A;  2FWF A;  1DSB A;  3AY8 A;  3TRP A;  1V9W A;  2R3X A;  1SYR A;  19GS A;  1AUC A;  4XRD A;  4WF5 A;  4I5Q A;  1F6M C;  3D4M A;  1GWC A;  1EOH A;  2JZS A;  1GSQ A;  3A3T A;  5IMZ A;  1HNB A;  2IFQ B;  4GLT A;  2DJJ A;  1GUH A;  2IMK A;  3TKS A;  5D96 A;  1WMJ A;  1AAZ A;  2MBT A;  3FHK A;  3BCK A;  4ZB8 A;  3ZVJ A;  2L57 A;  3APO A;  4WBR D;  1T1V A;  4GRF A;  2DJ0 A;  5DBQ A;  1KNG A;  3IR4 A;  3QAW A;  1Q98 A;  1EZK A;  5A4W A;  5CRW A;  2VLT A;  2E2G A;  3WT1 A;  4PI0 C;  5A5H B;  4K9Z A;  2J23 A;  4E68 A;  2HLS A;  4IEL A;  3GKM A;  3G9B A;  1XWA A;  2PUK C;  3TKQ A;  3APQ A;  3KM6 A;  1ERU A;  4MZW A;  1NSW A;  2LJR A;  4FXY P;  4AKG A;  2E0Q A;  1GTI A; 
#chains in the Genus database with same CATH homology
 22GS A;  2PVQ A;  1A8Y A;  1ZOF A;  5ECQ B;  3KMO A;  4OCE A;  1TTZ A;  4G01 A;  4QL7 A;  3UBK A;  1YKA A;  2DML A;  3PH9 A;  3CBU A;  2HSM B;  2B1K A;  3TOU A;  3UAP A;  4ZBA A;  3IAS 2;  4NHZ A;  13GS A;  2IJY A;  3GTU A;  4XS4 A;  1XWC A;  3CSH A;  2H0I A;  4BA7 A;  3LGC A;  4G0I A;  3VWW A;  2TIR A;  3E9J B;  4MPG A;  3HJO A;  1Y25 A;  1SL0 B;  3HY2 A;  4KCE A;  1T3B A;  4ZIL A;  4KAE A;  2JAC A;  3KXO A;  4ECI A;  3A2X A;  2IMI A;  1SL2 B;  4MF5 A;  3GFK A;  4OFT A;  5CYY A;  5E59 A;  3KP8 A;  1E6B A;  3EUR A;  2J9H A;  4MLY A;  3ISO A;  2M46 A;  5JWR B;  2OE0 A;  1IYI A;  5D9X A;  5IQY A;  5D9W A;  3ZMK A;  3O3T A;  2PU9 C;  4Q5N A;  2GZY A;  2VO4 A;  2NBS A;  3RHB A;  3IOS A;  5J47 A;  4MF6 A;  3I9V 2;  4KE3 A;  5J4U A;  1XIY A;  4AKH A;  6GSS A;  1OKT A;  2VCZ A;  6GSX A;  3IC4 A;  3A2W A;  1U88 A;  4V2N A;  3Q19 A;  4BVX B;  3RBT A;  2I9H A;  1U3A A;  2YJ7 A;  1GSD A;  2DJ1 A;  2WB9 A;  3W8S A;  1KTE A;  1ZYQ B;  5G31 A;  1Z9H A;  4TXO A;  2C4J A;  1TXU A;  1N25 A;  1GL8 A;  4N10 A;  5EL8 A;  2O5V A;  2DJ3 A;  1QK8 A;  1DE1 A;  1PGT A;  2DJ2 A;  4FO5 A;  4KND A;  4XIH A;  1V57 A;  4HI7 A;  1TKD B;  2H70 A;  3F3R A;  1DUG A;  5F06 A;  1PD2 1;  3ZFB A;  3GKN A;  5ID2 B;  1K3L A;  1N2A A;  2FA4 A;  2LNT A;  2O85 A;  3KEB A;  2B5Y A;  2X64 A;  4PNF A;  3FZ4 A;  1FW1 A;  5G30 A;  3TJB A;  2M72 A;  1B4Q A;  3Q6O A;  1RW1 A;  3RPP A;  4HEA 2;  2JU5 A;  2A2P A;  1LJR A;  2LKU A;  3FYG A;  2I3Y A;  2IIY A;  1Y6E A;  2GQL A;  5J3R A;  1SVL A;  2FWH A;  3FMW A;  1AXD A;  1OC9 B;  4N11 A;  4TR1 B;  2VD0 A;  3R3E A;  2IMD A;  3DKS A;  4O5Q A;  4POB A;  5FWG A;  2AAW A;  4OFM A;  2H6Y A;  2GSR A;  2ZCT A;  4E8H A;  2GVP A;  3D4T A;  1OYJ A;  3GIX A;  1MD4 A;  1PL1 A;  3EWL A;  3RPN A;  2KHP A;  2I81 A;  5DAL B;  3CYN A;  2A2R A;  1WIK A;  3HJP A;  5EY6 A;  2CV4 A;  4FYU A;  3TCO A;  3GSS A;  1HD2 A;  4G10 A;  2R0P A;  1FB0 A;  4OO4 A;  4EE0 A;  3L0H A;  5ECO B;  4GST A;  4KW6 A;  4WKW A;  2YP6 A;  2YWM A;  4NV2 A;  3NIV A;  4XS1 A;  2RM5 A;  2QGV A;  5EVO A;  3PIN A;  1FOV A;  1A2M A;  1VF3 A;  1OC8 A;  3EE2 A;  1SVM A;  3TKS C;  1T4Y A;  1QXH A;  4Z2T A;  1EOG A;  10GS A;  4JZQ A;  1K3Y A;  2CVK A;  1UN2 A;  3ZRD A;  3GV1 A;  2VCV A;  4IGJ A;  1Q4J A;  2CQ9 A;  3UAR A;  4ZBB A;  3DWV A;  4BWQ A;  3EMP A;  2DKH A;  2QSI A;  1BYE A;  2YAN A;  1XOA A;  3LWA A;  4O32 A;  3U6V A;  2H1L A;  2C3Q A;  2A4V A;  1GSY A;  3BCI A;  4WF4 A;  5KOX A;  4JED A;  1M2A A;  5ELG A;  2X8H A;  2EIQ A;  5HQP A;  3D21 A;  4KA0 A;  2FA8 A;  2X8C A;  3S9F A;  2GLR A;  1XOB A;  5IOX A;  3H4K A;  2FUG 2;  4RI6 A;  3HXS A;  3J7Y k;  2H6X A;  1H75 A;  1O8X A;  1A23 A;  1OE8 A;  4ACS A;  2FD3 A;  5GST A;  1ON4 A;  3KH9 A;  4WXT A;  1MDI A;  4Z7X A;  4ZL7 A;  5ENU A;  2B7J A;  3GH6 A;  2H19 A;  4TKY A;  3M1G A;  2OAC A;  1X5C A;  1SK1 A;  3VI7 A;  1DBY A;  3KMN A;  2VCW A;  5HFK A;  1ILO A;  3GTU B;  5CRH A;  3TKP A;  1K0D A;  4XHM A;  4XS4 B;  3TJF A;  4LMV A;  3ERW A;  2F9S A;  1X9M B;  2LEG A;  4PQ1 A;  3QCP A;  2EIR A;  4MJB A;  2XPE A;  2ZNM A;  3DIE A;  3LXT A;  4KH7 A;  5IMC A;  5B8A A;  2VKZ G;  2KUC A;  2B7K A;  2AJQ B;  4ILF A;  4ZXG A;  3CSJ A;  1GTB A;  1BAY A;  1O7U A;  3GKX A;  4QQ7 A;  5IIZ A;  3FR3 A;  2ALB A;  3UOM A;  1LU4 A;  2C3T A;  1X9S B;  2N5F A;  3L9V A;  3RDW A;  5ECR B;  3QOU A;  4LA1 A;  4WET A;  4N3Z A;  3C71 A;  2OE1 A;  1HNC A;  3CSI A;  2LQO A;  1A2J A;  3M0F A;  1K3O A;  2M80 A;  3E0U A;  1K0A A;  2H1G A;  5JCG A;  1IYH A;  3CTF A;  5CRG A;  3KIJ A;  3F4T A;  2PGT A;  3SWL A;  4HQZ A;  2RUF A;  1G6Y A;  2WFC A;  3FEU A;  1UC7 A;  2XPD A;  4MPF A;  2OT3 A;  4GWR A;  4HOJ A;  1TI3 A;  1B48 A;  2HSN A;  4LL1 B;  3ZTL A;  3TRQ A;  2NVL A;  4GQC A;  3CTG A;  5E4W A;  4MCU A;  3FR6 A;  1JHB A;  2MMA A;  2HSY A;  3QFB C;  6GSY A;  1A8L A;  1SK2 A;  3N5O A;  1KEB A;  1A0F A;  1ZL9 A;  5D93 A;  5HR0 A;  6GSV A;  2EFD A;  2EFC A;  3C1R A;  3M3M A;  4EUY A;  1CQH A;  4K5S A;  2V32 A;  4J2F A;  4L8E A;  2VIM A;  1FVJ A;  2V1M A;  2HXK A;  3PR8 A;  4IHU A;  1NHO A;  2H0G A;  3U5R E;  1GTU A;  4JR6 A;  2H72 A;  3P8W A;  2ZUP A;  3KZQ A;  2FCH A;  4YQM A;  5A34 A;  4QMK A;  1T7P B;  1R26 A;  3TJJ A;  4K7O A;  1GP1 A;  4IBP A;  2KOK A;  2OKA A;  4YAP A;  2L6C A;  2JL4 A;  3EVI A;  3LSZ A;  4BL7 A;  2FGX A;  1XXU A;  2YV7 A;  3F6D A;  5L71 A;  2REM A;  3IHG A;  5B7C A;  3FZA A;  2VM2 A;  1SKW B;  1O6J A;  4K0N A;  2XBQ A;  4YKG A;  3LXZ A;  4PQH A;  3KP9 A;  1YEP A;  4CY6 A;  5COH A;  4DSQ A;  2YCD A;  3KTB A;  2XHF A;  3MNG A;  3LQ7 A;  5H5R A;  1J9B A;  3ZVJ D;  5KOW A;  2MBS A;  1ZYN A;  4D73 A;  2R4V A;  3I69 A;  4EDZ A;  1I5G A;  4X4J A;  3BBY A;  2FLS A;  3GUR A;  4IVF A;  1BG5 A;  1VGL A;  4GF0 A;  2AV4 A;  2P5R A;  3LFL A;  5AIV A;  4ICY A;  1XVW A;  4L0U A;  2AB6 A;  2QKE A;  2DSA A;  1PKZ A;  1ERV A;  1QUW A;  4O5R A;  1G7E A;  1K0M A;  4WEY A;  3ZIJ A;  1XCC A;  2K18 A;  4KX4 A;  1YF0 A;  3E3E A;  3LYP A;  1X5D A;  2HRK A;  1EV4 A;  3VWV A;  4AJ8 A;  2JSY A;  5JCW A;  2VLV A;  1U87 A;  3QPM A;  2G0F A;  2F51 A;  4G9H A;  4IJ3 A;  2K8S A;  3GKK A;  3ZL5 A;  1XW9 A;  4H86 A;  2X99 A;  4Z2R A;  1AQV A;  3O76 A;  4ECB A;  1F9M A;  4PXO A;  5A4U A;  5GSS A;  4TR3 A;  4EL1 A;  2X49 A;  1GRX A;  4GXZ A;  2UV8 G;  3DVX A;  1Z3E A;  4IN0 A;  2YWN A;  2LJA A;  4K7I A;  5B6N A;  4POM A;  4ZBD A;  4BWS A;  4MZC A;  4ZIJ A;  2D2Z A;  4BVY A;  1QMV A;  4XRA A;  4XCS A;  4TRX A;  14GS A;  2YV9 A;  2BMX A;  4MH2 A;  3W6G A;  1X0R A;  3UMA A;  2VUP A;  6GST A;  2VM1 A;  2WZ9 A;  2R5G A;  2DIY A;  1ZYP A;  1GSE A;  1TOF A;  5J41 A;  5HR1 A;  3QDN A;  3G7J A;  1EGO A;  2LRT A;  5FHI A;  3HD5 A;  1SEN A;  3EC3 A;  3VWX A;  1LBK A;  3GL3 A;  4L0W A;  2LS5 A;  4FQU A;  1B9X C;  1Z7P A;  4YH2 A;  1TRS A;  3FRC A;  2NTO A;  5DCG A;  2ON7 A;  4F2I A;  4NMU A;  3J7Y b;  4KCA A;  2OA7 A;  5J4Y A;  4Q5Q A;  2MMO A;  2FWE A;  20GS A;  3GRX A;  5CRE A;  2H01 A;  2TRC P;  5IO0 A;  2V2G A;  4EC0 A;  1N8J A;  3GA4 A;  4G0L A;  2CVB A;  1THO A;  2GT6 A;  3IHQ A;  1XWK A;  2G2Q A;  1VRS D;  3LJR A;  3VK9 A;  4K7N A;  2O87 A;  3JCM L;  4RI7 A;  2RII A;  3VFI A;  5H5S A;  3WGX A;  1O81 A;  1BF5 A;  3VI5 A;  4YQV A;  4ZB7 A;  4I2T A;  5HR3 A;  3DML A;  4LLR A;  1AQX A;  1I9D A;  2YJH A;  5DJM A;  4PNG A;  1EWX A;  4TR4 A;  1V58 A;  3IAM 2;  3TUE A;  1A24 A;  1AC1 A;  5ECS A;  5J40 A;  2O8V B;  2HFD A;  3TKS E;  2GSQ A;  4GSN A;  6GSW A;  3C8E A;  3HDC A;  4IJI A;  5G1K A;  3Q18 A;  1SK0 A;  1MD3 A;  3DXB A;  2C0G A;  1Y1U A;  2LTK A;  4IKH A;  5IOW A;  3TU3 B;  5CAX A;  2F8F A;  2HSN B;  3D5J A;  4ISD A;  5G5E A;  5A5H A;  2GZZ A;  1SD8 A;  2DBC A;  2B6M A;  2H74 A;  4CHS A;  4NWY A;  4TXV A;  4F82 A;  5D9T A;  4V2L A;  1BG1 A;  2DMM A;  3F3Q A;  2OBI A;  1GLP A;  4MK3 A;  1S3D A;  3MWH A;  1R7H A;  4DVC A;  1FB6 A;  3EMX A;  4PUA A;  18GS A;  3KTL A;  4EDY A;  5A1N A;  4BPY A;  2LRC A;  1VF1 A;  4J57 E;  5FT3 A;  1FHE A;  4KDY A;  4MJE A;  3IV4 A;  4TW5 A;  2VCX A;  4RUV A;  2PN8 A;  4N0Z A;  2DJK A;  4JE1 A;  3QAG A;  5A34 B;  5G2Z A;  1FOH A;  1T4Z A;  1HYU A;  4K6X A;  5ECI B;  2GGT A;  2CX3 A;  5ELA A;  2CAQ A;  3IK7 A;  4YKF A;  4AJ6 A;  4ZL9 A;  4HS1 A;  4KB3 A;  3O6T A;  2WDU A;  3NZN A;  3KD0 A;  4MAB A;  4BL7 B;  1OAZ A;  7GSS A;  3I43 A;  5C04 A;  1M0U A;  2R37 A;  1YKC A;  3GH9 A;  2JSZ A;  5ECK B;  2VCT A;  4MJA A;  1F37 A;  1XWG A;  1NM3 A;  1G6W A;  5IO2 A;  3L9S A;  5LCZ A;  5F07 A;  2QA2 A;  1NW2 A;  2V6O A;  3P2A A;  3ZYW A;  1WWJ A;  1QFN A;  4HZ4 A;  3EU4 A;  4MP4 A;  3F4R A;  1ZYE A;  3GNJ A;  3KJY A;  4XS6 A;  2VCQ A;  2H1B A;  2MMN A;  3ZLP A;  2GSS A;  3TJK A;  4PQI A;  3HYP A;  2PWJ A;  2HRA A;  2EFE A;  4TR0 A;  3VWU A;  3HCZ A;  3APS A;  4D73 B;  3FK8 A;  2JZT A;  4LMW A;  1RQM A;  6GSU A;  2F8A A;  3L9U A;  1F2E A;  1R4W A;  1TXX A;  1XW6 A;  4P3Y B;  1XFL A;  3C7M A;  3TGZ A;  2WCI A;  2ON5 A;  3P7X A;  2V6K A;  2H73 A;  3DRN A;  4GDF A;  1K0B A;  5D9V A;  2VOC A;  1YQ1 A;  3NOF A;  1O85 A;  2LST A;  5JWO B;  4E8E A;  4OCF A;  3CWG A;  2PER A;  2R0G A;  2XC2 A;  2HZF A;  5BMU A;  4IP6 A;  4NV5 A;  3HZ8 A;  1SD9 A;  2HRK B;  3LEF A;  16GS A;  3CXG A;  3SBC A;  4G0K A;  1KBN A;  2GQM A;  2L5O A;  4MA9 A;  1FO5 A;  1Z6M A;  5IMF A;  2H0H A;  1VF2 A;  1WE0 A;  2C80 A;  1EP7 A;  3ZIV A;  4V2M A;  3HA9 A;  1U3I A;  1BQ7 A;  5KN0 A;  1PQN A;  4BVY B;  5DAK A;  1TU8 A;  3ZFL A;  3ERF A;  5AIX A;  2HNL A;  3DVW A;  2GT5 A;  4AI6 A;  4AF2 A;  5BRT A;  5KN3 A;  4TXO B;  1J08 A;  5J4V A;  4RQR A;  1YDK A;  1OVN A;  2XBI A;  3CMI A;  4ECC A;  4NPB A;  4K5R A;  11GS A;  3GHA A;  2CT6 A;  2AYT A;  4DSS A;  1OC3 A;  2IME A;  2AUV A;  4IS0 A;  4ECJ A;  1XWB A;  1GTA A;  1PA3 A;  5J9B A;  3M9J A;  5C00 A;  3KCM A;  2N5A A;  1X5E A;  3L4N A;  5KN1 A;  4V1A g;  4YQU A;  4WR4 A;  2YPM A;  3GX8 A;  5DDL A;  4OO5 A;  2P31 A;  2X8G A;  1QQ2 A;  1A0R P;  5F0G A;  3IXR A;  3R2Q A;  5AGY A;  3H79 A;  5H5Q A;  4GQF A;  5LD0 A;  1TP9 A;  2HI7 A;  2YOI A;  2WJU A;  2F3M A;  1O73 A;  2H1D A;  2B3S A;  1NHY A;  2FNO A;  2V41 A;  1SKS B;  2L4C A;  3A5I A;  5ECM B;  2HT9 A;  1EEJ A;  2GDR A;  2WS2 A;  5F05 A;  1SJZ A;  1F3B A;  4KDX A;  5IMA A;  2C0F A;  4O92 A;  4QL9 A;  1WJK A;  5IPG A;  1G0T A;  2YZU A;  5DQS A;  2HRF A;  4MDC A;  1JFU A;  1JLV A;  2H71 A;  5ABR A;  4DSR A;  4IW9 A;  3VPT A;  5D8I A;  2C8U A;  2RUE A;  2GS3 A;  1R5P A;  2VL2 A;  3TRX A;  2YZH A;  1Z5Y E;  2HZE A;  4EIP A;  4G19 A;  3M9K A;  1T8E B;  4FH8 A;  4NAX A;  2BJX A;  2CAI A;  2KLX A;  3ME7 A;  5B8B A;  4CDO A;  2R6K A;  1FVK A;  4JRR A;  1VF4 A;  1SL1 B;  1PL2 A;  3F9U A;  1QGV A;  1EGR A;  1PMT A;  3H8Q A;  5IMV A;  2FWG A;  1J0F A;  4MZB A;  4NXI A;  1DE2 A;  1W4V A;  1K0N A;  3ED3 A;  3TDG A;  1YVL A;  4HU7 A;  3US3 A;  2P5Q A;  3P90 A;  4GTU A;  2AHE A;  3GMF A;  2LRN A;  1V2A A;  3UVT A;  4NHW A;  4F0B A;  2CA8 A;  3IK9 A;  1GSU A;  5A1N B;  1M2D A;  2LQQ A;  1GSS A;  2O89 A;  5JWQ B;  4CW9 A;  2EFH A;  1TK0 B;  2C3N A;  4J56 E;  1SKR B;  4FYB A;  4EKZ A;  4X1U A;  1M9A A;  5G1L A;  2R0C A;  3KH7 A;  3GST A;  2IMF A;  4KDU A;  1W89 A;  3V1W A;  1ACV A;  3GN3 A;  3IC8 A;  3MDK A;  1M9B A;  2NDO A;  1XVQ A;  3EU3 A;  1ERW A;  5GAP D;  12GS A;  4IQ1 A;  1TRV A;  1MDK A;  2H1A A;  4O5U A;  4I6X A;  4MH3 A;  5CRD A;  3W8J A;  1GNE A;  4AKI A;  4K2D A;  4PTS A;  2DKI A;  1GSF A;  4I97 A;  1USB A;  4OMV A;  3HJM A;  2PBJ A;  2WUL A;  1PN9 A;  1YEX A;  1JZO A;  1GLQ A;  2IN3 A;  3FW2 A;  1YJ6 A;  3BD2 A;  1FG4 A;  3D22 A;  4ZB9 A;  5HFI A;  1F3A A;  1ABA A;  3ZZX A;  3GYK A;  4FYC A;  3EYT A;  2I4A A;  1HQO A;  4I2U A;  1ST9 A;  4YAV A;  4PX1 A;  4KGI A;  4EO3 A;  5ECL B;  3QD9 A;  1URM A;  2OE3 A;  3ME8 A;  4HDE A;  3MYD A;  1SJ6 A;  1GNW A;  4JBB A;  2ES7 A;  2C1Y A;  1O8W A;  4HU9 A;  4N0V A;  4MF7 A;  1JZW A;  2IPA A;  5CP1 A;  3HVS A;  1JLW A;  1E2Y A;  2DLX A;  4TVE A;  2VD1 A;  2UZ8 A;  4O7H A;  2H6Z A;  5J9C A;  2HYX A;  3IRA A;  3DD3 A;  1AIU A;  9GSS A;  3G7I A;  2K6V A;  3ZML A;  1ZCP A;  3H1N A;  2B1L A;  2FY6 A;  1SYX A;  2YN1 A;  3RHC A;  1C72 A;  5BMU B;  3WYW A;  4KF9 A;  2LV3 A;  3BJ5 A;  4MNN A;  4HQS A;  4X43 A;  4EIQ A;  2QA1 A;  3LG6 A;  2CVD A;  4PGT A;  4WBJ A;  5B6M A;  3KGK A;  1TI1 A;  2HE3 A;  3VPQ A;  4HJM A;  1S3A A;  2I1U A;  2P0G A;  3ERG A;  3IDV A;  4K2X A;  2A2S A;  5D73 A;  1B8X A;  2JZR A;  4KSO A;  1M2B A;  2E2M A;  1PKW A;  3MIX A;  3IBH A;  1K0C A;  8GSS A;  1YY7 A;  3D0Z A;  5DAK B;  3I6A A;  3C73 A;  2HRN A;  4WR5 A;  5F8B A;  2EC4 A;  2IFQ A;  1MTC A;  1M99 A;  3UL3 A;  4EXJ A;  3M8N A;  2LUS A;  2MYG A;  1TJD A;  1SJI A;  3F63 A;  2HQT A;  4AJ7 A;  2L4Q A;  4L5O A;  1ZMA A;  3WD6 A;  5AN1 A;  4CY8 A;  2CZ3 A;  1V40 A;  3MAK A;  5EPF A;  3ZIT A;  1GUL A;  4EVM A;  2B5E A;  4POL A;  5GAN D;  4DSS B;  5CO3 A;  4FIW A;  1TDI A;  2K8V A;  2QC7 A;  2GQK A;  4LL4 B;  2H66 A;  2H75 A;  1XW5 A;  2CZ2 A;  2K9F A;  2OJL A;  2Z9S A;  3FY7 A;  1YZX A;  4F03 A;  4HJ2 A;  2VAF A;  1TRU A;  5DCH A;  2C0D A;  2MMZ A;  2YNX A;  5GZZ B;  3HHV A;  2NPB A;  1G7O A;  1S3C A;  2RM6 A;  3GUS A;  3L78 A;  1TK5 B;  2HSM A;  4AGS A;  3C1S A;  2BTO T;  3K8N A;  1V98 A;  1WRY A;  4K8M A;  2KP2 A;  3QMX A;  4POK A;  2L6D A;  3DYR A;  2KP1 A;  2O7K A;  5ECH B;  1EEM A;  1CQG A;  2R2J A;  3HVV A;  3N9J A;  5HFG A;  2VL2 C;  3LOR A;  2VLU A;  2IWT A;  1XBS A;  2E7P A;  3EIN A;  1OE7 A;  4Q5R A;  3VUR A;  3UJ1 A;  2YWO A;  5G5F A;  1R5A A;  1GUM A;  1RK4 A;  3PGT A;  4TN8 A;  4ZL8 A;  1WP0 A;  2LJK A;  3QAV A;  4JR4 A;  1PX6 A;  1ZGN A;  1PSQ A;  1PRX A;  4HZ2 A;  3UEM A;  3FR9 A;  3GL5 A;  1TK8 B;  4KUN A;  3WT2 A;  1GH2 A;  2LNS A;  3F8U A;  2VL3 A;  1HNA A;  4GSS A;  3UVH A;  3HVX A;  5J5N A;  2HZE B;  1XZO A;  3WGE A;  1JZD A;  4L5L A;  2JAD A;  3QFA C;  3F6F A;  1THX A;  1OKD A;  1MEK A;  1EP8 A;  5DJL A;  3LYK A;  3RAZ A;  4X0X A;  1AW9 A;  2B5X A;  2H8L A;  3LW9 A;  4BVX A;  1B4P A;  1K0O A;  2GTU A;  1SU9 A;  4IP1 A;  2WRT A;  1EV9 A;  4PUR A;  3UBL A;  4AKX B;  3TKR A;  1YF1 A;  3F4S A;  2TRX A;  2RLI A;  3A2V A;  1BJX A;  1TRW A;  2PMT A;  4KSM A;  5A4V A;  1TU7 A;  4Z2U A;  2WGR A;  4K0G A;  3TB2 A;  5INY A;  3FKF A;  3BOA A;  1BX9 A;  1WOU A;  5IPH A;  2A4H A;  1B9Y C;  4ID0 A;  1BED A;  4MMM A;  5ID2 A;  3VLN A;  2GST A;  17GS A;  4RQX A;  1PN0 A;  3TOT A;  3QR6 A;  2HSH A;  3UIW A;  2DIZ A;  2EIO A;  5A5K A;  1Z6N A;  2FHE A;  4DEJ A;  4OD7 A;  5DVB A;  5ECN B;  4F9Z A;  1FAA A;  2VL9 A;  1H4O A;  5KEJ A;  1ERT A;  5KN2 A;  2GZP A;  3TJG A;  1WPI A;  2X4A A;  4EF0 A;  4ZB6 A;  1ML6 A;  2H30 A;  3HKR A;  5IMD A;  5ECP B;  4TOP A;  4MJC A;  2L59 A;  3HMJ G;  3EPT A;  4HUA A;  3OR5 A;  1PX7 A;  1M7T A;  3CRT A;  3HZ4 A;  3IPZ A;  1Z7R A;  4K1F A;  1GUK A;  1OC9 A;  2DC5 A;  2IL3 A;  4TR1 A;  1U6T A;  3FZ9 A;  4F0C A;  2N5B A;  4W66 A;  3H93 A;  3ZRE A;  2MZC A;  4USS A;  4OWY A;  5LNK e;  5JCU A;  4ML6 A;  5HR2 A;  4Q5F A;  4I8B A;  4ULX A;  2OAD A;  1UVZ A;  1X9W B;  1UA5 A;  1XPV A;  1TW9 A;  5DAL A;  4GCI A;  2H76 A;  2CX4 A;  2PPT A;  5IM9 A;  3D6I A;  3FZ5 A;  1AQW A;  1ZZY A;  3WGD A;  3PPU A;  2L5L A;  5DQY A;  3DEX A;  4G2E A;  1SVO A;  5AIS A;  4PUF C;  4ML1 A;  2OBK A;  3G7Y A;  4V1A p;  4IQA A;  3IA1 A;  3Q74 A;  1MDJ A;  2YWI A;  4A5P A;  4OFN A;  2PVO C;  3IE3 A;  3F0I A;  3CRU A;  4N30 A;  1A2L A;  3MSZ A;  4XTS A;  4JU5 A;  3GX0 A;  3DGQ A;  2C0E A;  1T00 A;  3A5W A;  5CNW A;  1JZR A;  2FWF A;  1DSB A;  3AY8 A;  3TRP A;  1V9W A;  2R3X A;  1SYR A;  19GS A;  1AUC A;  4XRD A;  4WF5 A;  4I5Q A;  1F6M C;  3D4M A;  1GWC A;  1EOH A;  2JZS A;  1GSQ A;  3A3T A;  5IMZ A;  1HNB A;  2IFQ B;  4GLT A;  2DJJ A;  1GUH A;  2IMK A;  3TKS A;  5D96 A;  1WMJ A;  1AAZ A;  2MBT A;  3FHK A;  3BCK A;  4ZB8 A;  3ZVJ A;  2L57 A;  3APO A;  4WBR D;  1T1V A;  4GRF A;  2DJ0 A;  5DBQ A;  1KNG A;  3IR4 A;  3QAW A;  1Q98 A;  1EZK A;  5A4W A;  5CRW A;  2VLT A;  2E2G A;  3WT1 A;  5A5H B;  4K9Z A;  2J23 A;  4E68 A;  2HLS A;  4IEL A;  3GKM A;  3G9B A;  1XWA A;  2PUK C;  3TKQ A;  3APQ A;  3KM6 A;  1ERU A;  4MZW A;  1NSW A;  2LJR A;  4AKG A;  2E0Q A;  1GTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...