5ECYA

Structure of the shigella flexneri vapc mutant d98n crystal form 2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
HLKFMLDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHTGQIRAELARQGRPVGPFNQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis on the active site architecture of an activated VapC toxin from Shigella flexneri
rcsb
source organism Shigella flexneri
molecule tags Hydrolase
molecule keywords tRNA(fMet)-specific endonuclease VapC
total genus 54
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5ecyA00
3ZD9A 2H1CA 1UL1X 1B43A 2HWXA 2QIPA 2MDTA 3H8SA 5K8JB 3DBOB 5ECDA 3Q8KA 4XGQA 1RXVA 3TNDA 1RXWA 2H1OA 3ZDAA 3ZDEA 3QEBZ 1UT8A 2IHNA 3ZDBA 5SV2A 3QEAZ 2FE1A 1MC8A 5L6LB 2IZOA 1O4WA 5H4HA 5FV7A 3H8JA 1TFRA 5HNKA 3ZDDA 3ORYA 3ZVKA 1A76A 3H7IA 1Y82A 4CHGA 1TAQA 3Q8LA 4MJ7A 1EXNA 1W8IA 2WP8J 3H8WA 5ECWA 3Q8MA 2LCQA 3ZDCA 1V96A 3I8OA 1A77A 3H87A 4XGRA 1V8OA 5ECYA 5HMLA 1TAUA 4WA8A 2BSQA 3IX7A 1V8PA 2DOKA 5ED0A 3ZD8A 2HWYA 1UT5A 5HP4A 1XO1A 1BGXT 2HWWA 5HMMA 1YE5A 5L6MB 5H4GA 3QE9Y
chains in the Genus database with same CATH superfamily
2WFZA 2ISSD 4MDYA 3Q9LA 4GYKA 3KU1A 4KN9S 4AUMA 2JLZA 2QRZA 2P9TA 4RSMA 1YBHA 2R87A 5IKOA 2DCMA 2FSGA 1G5PA 1MJGA 3PNQA 4EFDA 3CZCA 4LCEA 4PHHA 3TSZA 5HUQA 1AV7A 5ALQA 4QZVA 1RYNA 1KSFX 1VKHA 4X64B 3H3JA 3R9IA 2H92A 1GNSA 1O8CA 3CF2A 4QYXA 2FY8A 1V3VA 3QNWA 3KD2A 2ENWA 4AJJA 1G16A 1ZOSA 3U16A 4CT5A 1CUXA 1N3LA 1G8FA 1RZ3A 1YH3A 2XHZA 1NLZA 5HILA 5CCDA 1JPUA 2MINA 4GG1A 4GX2A 1IN7A 2VDMB 3EZ7A 3QPUA 1L5MA 2GA9A 1TYCA 3OPMA 3STUA 3Q7EA 2IU4A 1L7RA 2QT1A 3V8EA 4DR3B 1DSSG 5HVNA 1XZHA 2E2WA 3ZGXA 1Z26A 4GI3A 2W11A 1ECFA 4GMHA 1MJGM 4ARUA 3PI6A 2OO5A 3I1FA 2CLLB 3EOAI 1CJSA 2GZSA 3GCZA 2AFRA 5EXXA 1C7ZA 3BFKA 1J8MF 1E0KA 4ETMA 1L4HA 1TEZA 4FKMA 1OZHA 4YR7A 1FTGA 1QOQB 2CVZA 4JY7A 2PPVA 5LIRA 1UOPA 1ODCA 3ZXSA 4C7VA 1P1IA 3R0VA 4DJDC 2Y4NA 2E4UA 2WJAA 1SU4A 4YO8A 1TJ4A 5FBKA 3E7XA 5IT9A 2FW9A 2FMXA 4FCTA 4PG8A 2H0QA 2Y99A 3G23A 5JZOA 4OK6A 1VGRA 2WQZA 1EA5A 3MN1A 5CB6A 5F4ZA 3TQSA 5HTOA 1JEYA 5ALIA 1QG2A 2GRJA 1XMOB 1BOOA 2AEEA 5TX7A 4AQ7A 5F1KA 3RFVA 3SVZA 2FQ1A 3ANMA 4DNXA 2QD2A 2NNWB 3QXSA 1OHHD 5DGCA 3SQWA 3EWIA 1G21B 3SX0A 2FOXA 1NXVA 4RY8A 3NEAA 4NE2A 5EE3A 3L92A 3RU7A 3WK9A 4I08A 4OKSA 1UH5A 1XIVA 3PEYA 2HSJA 1KGSA 2GSDA 3JASA 3IR6A 4H3KB 3R7AA 3RYFA 4B3FX 3T1TA 2JCGA 2D7DA 2RIRA 3THXA 4KOEC 1K6JA 3TRJA 1H9AA 4MVJP 5KOJB 3FWYA 2NVBA 5C1OA 2OV3A 4FOPA 4HAIA 5AUNB 3M6FA 5SICE 4JK3A 2GXQA 1ZLXA 1E7YA 4HXEB 4RQUA 4X3OA 4UTOA 4KR2A 2X9VA 4I9NA 1XCGB 3BGDA 1AMNA 1LNQA 1VOTA 2V6MA 4LBZA 2XGSA 3BC1A 1KKUA 5E9JA 4BMNA 3M5WA 1YKSA 1LK7A 1ZK0A 2BF7A 4P92A 4WKPA 4CIVA 4HD8A 5JUWA 1SKMA 2WUFA 3DV9A 4FNAA 1NQAO 1L4LA 1IOVA 4NCXA 1P9OA 2ERYA 1ZW1A 1EJ0A 4J94A 4JR2A 1R9GA 1VKJA 2QP3A 5BRNA 4FGKA 4AWAA 2BMJA 1VL8A 2EZ4A 2XDQA 5CIYA 1AMOA 3D8TA 4H7KA 1KA9H 2X2PA 1BHQ1 3UT0A 1VE7A 5EP2A 3GG2A 1BEZA 1O97D 1XPJA 1DRJA 2WNSA 3L5OA 1FVFA 5J47A 1CF4A 4R54A 3IV7A 4KNYA 3QUBA 3GN2A 1SRRA 2NVUA 2AE1A 3LE8A 2HBZA 1JDZA 1RTTA 3RW9A 3MERA 1V5EA 1E5TA 4UBNA 2Z08A 2G36A 1AGPA 3K8ZA 3DMGA 4WLNA 5JW6A 3TIGA 1OROA 3ITKA 3SIWA 5CEEA 4Y9RA 3T5CA 2JH9A 1IN8A 3E7DA 3IURA 4NV1A 3O3MB 1WG8A 5HRUA 1PO7A 2QTWB 1X77A 1FXWA 1N6OA 2RK6A 2WVJA 3MQ4A 5DM1A 4DRYA 4WBNB 2EBWA 4NJMA 5GJCA 1WPGA 4WD3A 4AD8A 3NOQA 3L0ZA 2B7BA 4GWLA 2GSWA 2C20A 1S89A 2VBCA 3ZDDA 3TEJA 4CCYA 1ULAA 1L7AA 2B37A 4Q9AA 3IUBA 4TVKA 3I2FA 4YMVA 4MV7A 1S8FA 1TQ8A 4MPPA 3CRRA 1RFGE 1NOJA 4C3VA 1P2TA 3D8SA 3I05A 1B0UA 1KFCB 3GLHA 3I8SA 4P3YA 3FPLA 4QL3A 5A3VA 1R0KA 4UMEA 4AS3A 3RRYA 3EX7C 3THXB 3EZYA 1W94A 1E96A 5CBKA 5WRFA 4B6QA 1U11A 2VUTA 2IPNA 3KDSE 1GCUA 3H5NA 3LW8A 3ILSA 1LDMA 3ZQJA 2P5TB 3VR0A 3FCSB 1EFDN 2C7OA 3ZZUA 2I67A 3W5BA 1HSZA 3KHSA 5ALVA 1Z3IX 4LUCA 1HWYA 1UKYA 4B0PA 1PV4A 3WLHA 4JL6A 1OLSA 3RWMB 3TN7A 3E22B 4L5AA 3D7RA 2AI1A 2GZ3A 2GHQA 1Q92A 2ZB4A 3HBJA 5M3BA 5CFOA 2XOEA 3BAZA 3QJ5A 2IH5A 1U94A 4HUQB 4E15A 1PD0A 3FTPA 2PUBA 4E32A 1VG0B 1PNTA 3X1XA 4CM4A 3JATB 1XELA 4UBOA 1GZ7A 3U49A 1J8YF 1R64A 4IZIA 1D6MA 1RVV1 2MYTA 2QZPA 1VB3A 3ZE0B 2ZIGA 3WMWA 3KQHA 1XDGA 2CXUA 3KJIA 1I7NA 1MZVA 4B43A 1E7MA 1WHSB 3CRW1 1QZXA 1XDSA 1IYZA 3M6AA 3C3MA 2WTBA 4MHSA 1BS9A 3C3CA 2VPIA 3AFIA 3N2KA 5FOUA 3SKVA 1P60A 1T2VA 1X38A 4KFSA 4NZYA 4FD2A 1JV2B 1I9GA 1NT4A 3RRMA 2GZMA 4CKZA 4RENA 5F52A 3ZX5A 1FP1D 3TLAA 2FZEA 4FI3C 4PO9A 3FOAA 4WY5A 2QTZA 3E0QA 5BW8A 1OXUA 2W6ID 3GEMA 5GVRA 3A9WA 1E2LA 4JT4A 2TS1A 4K9RA 4J03A 2WSYB 2H1IA 2YFKA 3CX6A 4OP1A 4WOKA 3PR2B 4G25A 3WQSB 4HR7A 4AFNA 4TT3D 4JZYA 4WLFA 1P4GA 2MR5A 1QH9A 2WF8A 4Q15A 5DASA 3VC2A 5BRAA 3NDRA 2FV8A 1HURA 1T5HX 3BJZA 4BVKA 4LYYA 3KWLA 3WYFA 5J9FA 3ZHXA 1FUIA 2GTPA 4BCDA 3SYMA 3GNTA 4BFCA 2Z0MA 5K8LA 3IKJA 5AK3A 2XH8A 5MGNA 2VJMA 4QUAA 1HFEL 3HH8A 2V03A 4W82A 1EP9A 4S3MA 3HR7A 4EPRA 4TS4A 1Q20A 4UUMA 2XGOA 4REQA 2QLMA 1DUSA 3MJVA 5JSFA 3GGOA 3U7HB 3KXKA 4I1YA 1T0UA 1O9HA 3PRYA 4HFMA 5AI4A 2QXTA 5D1NA 4MR8B 4LXGA 2I65A 5ITVA 2A30A 5FNZA 1TC1A 1CULC 2QD5A 1UDCA 4LSWA 5H70A 1W5TA 2G7MC 2ZIZA 4BQEA 5LU9A 2ZZKA 1P7CA 2QTHA 1H6CA 3JWJA 3P26A 1L8AA 1CQWA 1N8TA 4KHZA 3S1AA 4H4DA 5CDSA 1H4QA 4J1SA 5G4LA 3K8YA 4LG1A 1P62B 1H42A 2B94A 1I2ZA 3H5AA 3HRIA 4PFQA 5SYAA 1XVVA 3ETEA 3L6BA 5ALEA 4BEVA 3V4ZA 2VFAA 3NGLA 4LJ4A 2IWHA 5ITWA 1HT1E 2RKWA 1ND6A 3AFGA 3UK7A 5KNDD 4D96A 4G5SA 1PGPA 4OBBA 1GDHA 5JNSA 4EZIA 1VHQA 2XB6A 5KCZA 3GMIA 2V7PA 1B0AA 1V7PC 3PTLA 3VHXA 3CX8A 2JKZA 4HQKA 5I4BA 4DLKA 2J0SA 2DWUA 3ONVA 3FRHA 3SS7X 4RCYA 4PX3A 3T0GA 5CLQA 3EGEA 1CIPA 1FXWF 4J6FA 3EPKA 3ZHZA 1EIWA 2QPOA 4LXTA 3JQ7A 2FR8C 1TW2A 4X84A 1A7JA 2J3LA 1ORRA 2GJKA 5KYXB 2P2NA 1TVKB 5I5EA 4FE3A 2HU5A 2I2XB 1XU4A 1JG7A 3KJNA 3NIFB 2CE7A 2H7VA 3JWHA 3RASA 4O25A 3NMUF 1Q7EA 1NLFA 1B6RA 2X9NA 2P91A 3FNIA 1EPUA 2WJVA 3L0PA 3PNSA 2HSWA 4N5IX 4A1OA 1KTIA 5FPHA 4ZCPA 3CLRD 3L7MA 1VKZA 4B4DA 5CNKA 1SQGA 1JIJA 1B4DA 1ZMXA 3AXSA 3PWSA 3M1IA 4A6DA 4DXDA 1TPYA 4HDAA 2E6KA 3LCMA 5BSHA 4LHZA 2X8WA 4RVFA 1QIGA 4CLHA 5KB3A 5ES4B 1JVBA 5JLAA 2FZGA 2FFHA 3WRWA 1JR3E 3KYJB 3M4XA 2HDNB 4OGGA 4GLJA 3D2BA 4Q3NA 4S24A 1A5BB 3VR5H 2K7FA 1PQPA 2OWEA 4OHBA 2YZ2A 3AEUB 4GXTA 3F6CA 5DDIP 1JB1A 2OXCA 1KZ9A 2XNCA 3KKEA 5E6SA 3WJAA 4RV4A 1E2NA 4EJSB 1L4BA 2DQSA 2BDUA 4CTKA 4M46A 2RAFA 1PQ4A 1XP8A 3M3HA 3N8NA 1ZK2A 3AF0A 1JRLA 2IVFA 3ON5A 5LA6B 2UZ1B 3U7QA 2W2LD 3AUFA 2GJ8A 1N0HA 3AR4A 1T5OA 4Z5XA 3R9WA 5K6AC 2R2GA 2X1HA 4YK7A 2GZAA 5BN1A 5KYXA 3CR8A 4LXUA 1KH2A 1T4BA 2WTUA 1QE3A 3O9ZA 4B9EA 3T7IA 4DLXA 3T1OA 4U9UA 3V7YA 3G1TA 1FVXA 4RJIA 3GLIE 2J07A 5L4SA 2PH7A 4KUEA 3W77A 4RHEA 4V38A 4YMTA 5JNTA 5BQOA 4FP9A 1SIWA 4H7JA 4DCPA 2CLFB 3CLKA 2PXXA 4Q3CA 2QM0A 2EKDA 3T3EA 3JZMA 5AVXA 3VSAA 1CFZA 1DJQA 4WHMA 3UANA 3VQTA 4C0KA 5HFNA 4GAEA 1C8BA 1JJVA 1OI4A 5BV0A 3GEEA 2ZETA 3QLUC 2A33A 3PDJA 1ZBDA 1K6MA 1PSDA 4KK4A 5SZIA 1AIPA 5TF0A 1MPXA 3MD0A 1GGJA 4KQ6A 4GP6A 3T7SA 3UAWA 4IPTA 5K8JB 1EWTA 1WLSA 3ESCA 3JQEA 4OQMA 1L4EA 3S2EA 1CY1A 2OHOA 2NTNA 4MRVA 4V24A 4BBJA 2CV1A 2ASEA 4FGJA 4FT2A 2AX3A 2JL1A 3B36A 3UZUA 1VHTA 2D0OB 2Q0QA 2IEZA 4PW0A 2WZCA 1A69A 2FGJA 1V5FA 3WBFA 5EEGA 2WAMA 5BSGA 3K6SB 1E9SA 1PT6A 3HUEA 4RA9A 1E2JA 1OFVA 4ZT6A 4ARZB 5L53A 2HA3A 3QH4A 5I7VA 3K9GA 1KYQA 1V1MA 3DMRA 3FLMA 2QAGA 2OR3A 4ANFA 5MN5A 4DLRA 2C82A 4K05A 1YB4A 4M8IA 2PUAA 4UHHA 3JYLA 1N5JA 3CLSD 4QJIA 4TMZA 1CY8A 4PCVA 4ZJPA 3L4EA 5DT9A 3E8MA 3AM3A 2ZIAA 1C0LA 1CUHA 2NV2B 5T3UA 1TTTA 1POWA 3DDUA 3UC9A 3JZFA 3MFQA 4JBHA 3K05A 1M2VB 3CVJA 4N39A 5FR2A 1G8AA 4KDEA 3KAKA 3EUAA 1Y7IA 4CMEC 4C4AA 2C8KA 3AQIA 4RNDB 1NLYA 2CKDA 4PFSA 4XOIA 3B1KA 1MT0A 2GEUA 5FTWA 5HDBB 1OUMA 3AEXA 4DSUA 1Y33E 2G72A 5LDDC 1R8XA 3UM9A 4TLEA 2QLJA 2VT7A 1SCIA 5FQOA 1D5WA 3PDUA 3ZWXA 4O5OA 4BBPA 5KKAA 2WUVA 2E7ZA 4RK5A 1I1HA 3PUHA 1W48A 3PQEA 2HA7A 2VTBB 4A36A 2C84A 4Q3DA 1JKFA 1GKKA 2ZAIA 5JE8A 4C87A 4XB1A 4EABA 1EM6A 1G5FA 2J5XA 3RH0A 1SD5A 4G4IA 4HL6A 1AA9A 3DL7A 1IMOA 1B23P 4IHQA 2QGFA 3M6WA 4X7BA 3GT0A 4CFYA 4AUEA 1YVEI 5P21A 1ZCFA 1O96B 4LVNA 3REOA 2BEUB 5HF9A 2NU8B 2O8DA 1HE2A 4I50B 3V4OA 1MO4A 2FW6A 2ZBDA 3ER6A 2Q4EA 1UC4B 4N0PA 1V16A 3IBCA 5E1OA 4CJXA 2ZTHA 4DJAA 4BP1A 4E2FA 4UBLA 3RLIA 1R2QA 1WZIA 1MUUA 3O4IA 3RS5A 3CVVA 4K9SA 4QUJA 5CXXA 3GPLA 3Q8MA 2GCPA 4QTUB 3HGMA 1RYYA 2Y92A 3DWIA 3G7NA 4RVUA 4JYPA 4K86A 4UTXA 5ALZA 1NVUQ 1XB2A 2WWRA 1TI7A 5C8YF 2VQFB 2QTMA 4BV3A 3DNFA 4IGIA 3UMFA 5I7FA 1CB7A 2UVDA 4ALNA 3G6WA 4HGYA 1XQ9A 4W6ZA 4ONEA 4DIUA 2R5NA 2J87A 1Y1TA 1M5RA 3NDBB 1XLUA 3GJQA 1K98A 4ND5A 1BA3A 3GRCA 1V3UA 5KX5A 3IODA 4S0XA 4Q93A 4JU9A 4X8MA 1Z2CA 4CEHB 5BN4B 1LY1A 2O7SA 3CR7A 4FDVA 4ARAA 4BECA 2WWIA 3RWOA 2IF0A 5HOQA 1NW3A 4Y2QA 5JS7A 2C95A 2J5KA 4HQNA 5HEKA 4IXTA 1JDVA 1BCRA 2ZIWB 3OP1A 3I72A 3C97A 3L0IB 4OFWA 4I50A 4ZA2A 3VDXA 1E1LA 3BXOA 2P4SA 4TUYF 4A0RA 1P1JA 2X1LA 3FB1A 1XZPA 4MW6A 2POQX 3P9CA 2EU8A 2Q27A 2XMCA 3ZY2A 5H4GA 2O48X 5AWFC 1BGWA 2VN8A 3LDUA 2YQ4A 2WD7A 1DKOA 4JX8A 3LHDA 2V7VA 5IEJA 4LY0A 3FMIA 5FLKA 4B76A 4FVTA 2Q6IA 2ZRCA 3G0IA 4QUGA 3DP7A 1D2GA 5UKDA 3UAOA 2BE7A 4KQFA 1JMYA 5KTMA 4Z7JA 1AQUA 2QAIA 3ET4A 1Z07A 3RU2A 3P9KA 2GPNA 4RL4A 4FW9A 2SKDA 5FEUA 3TB4A 3GJSA 4D92A 2JFVA 1NGSA 1JJIA 2B6NA 2CNWD 4OXIA 1SQFA 3HDGA 4FCVA 4ZI3A 1OU4A 1XALA 4OVKA 2HK6A 2GETA 3BD8A 4FS3A 4TMTA 4TQAA 5IKXA 2Q1UA 1G63A 1MAUA 3EWSA 2FUG6 2GYUA 2O2GA 2Z4TA 3D8BA 2C3UA 1O6BA 2PZKA 3L18A 3R0XA 1YK0A 2Y0CA 2E82A 3PI7A 1U9JA 2QPLA 2XTZA 4DR6B 1VE5A 3OTHA 4RF2A 1GD1O 3CSUA 3WLEA 3B13B 3LYAA 2WIDA 2CBZA 3HYRA 4JUDX 1ABFA 5JXGA 4FYMA 4C0JA 1SU7A 3WWPA 5AVUA 5C7IO 4OF4A 2ZYUX 1JEQA 2BR4A 3KQYA 5A02A 4NJMB 4WCVA 4ZU1X 1W73A 2D1FA 3TTTA 1E92A 1MX3A 5ER6A 5IBQA 1W5SA 4EY7A 1N3YA 2EKPA 2JHAA 3Q2IA 1VPTA 4PRLA 4YRZA 3VPHA 2CDBA 3K0CC 3PQCA 3L8HA 4K1LA 3ROZA 4ZVSA 2OZEA 3KUXA 3TX2A 1XZLA 3KR0A 3DL4A 4P7JA 3FWZA 1YDFA 4NZPA 1GJRA 1L5NA 4YPOA 3Q6MA 5C0OE 3RT1A 3LF2A 3T7TA 1Z5VA 4EITA 3GDWA 1UDAA 2W90A 4EGFA 5JPDA 3I6ZA 3GGDA 4YWHA 4W1RA 1ZD2P 3A9RA 5CGQB 3SHQA 1N0WA 3LUJA 3WWOA 1QMGA 5HM6A 1OXXK 1G6Q1 4LJ7A 5BUZA 4KSBA 3MNFA 2QP9X 3O1HB 1KPGA 1LSOA 3GLHE 5TQ2B 1VI2A 1D1TA 4YDSA 5BXQC 2TSYB 4G5QA 5HHTA 2X8BA 3PD1A 4K7JA 4MP8A 4QDZA 4G9BA 3ZCPA 2DH6A 4DRXB 1E69A 2E4WA 4DSTA 1UDWA 3TO5A 3EHDA 1KY3A 1OXBB 3JYNA 3WOVA 1SKBA 1C3EA 1RR6A 3L49A 4YRNA 4O2BB 5JH7B 4LOAA 1YU9A 3IQWA 1T4DA 1L4KA 1YF3A 3EEYA 1Z2DA 2PKEA 2H4YA 2PXAA 2ZSFA 1Z13A 3E9CA 3KZMA 3OF5A 4GRAA 3F7NA 4J4TA 4O2AF 5EHGA 3JQAD 1T9GS 3GUUA 3ROPA 1PLLA 4MYUA 4RZUA 3H9GA 2VQSA 3ZVRA 4XIGS 4GEKA 3LP5A 2FQWA 2VYQA 3OEHA 4UBKA 1QG6A 4LYAA 4QEKA 1OQAA 1PSZA 4AL4A 4CG3A 2QZ9A 2F1KA 4FYPA 4L08A 4U7PB 1U3VA 4Y2SA 4OLFA 3U7EB 3UK1A 2DUWA 1XA3A 3WDMA 3QX7A 1QXSA 2EZ8A 2Q4DA 3Q8KA 1RXVA 1MOZA 4EY6A 1ZKDA 1YR7A 1TW3A 2REXB 2EL9A 4YAUA 3OBIA 3WAJA 2E21A 4XSHA 2YWDA 3WLTA 4CLRB 3KR9A 2OLJA 4I55F 1XBTA 2H4JA 3DS8A 1MW9X 1YIOA 1NYLA 3GUYA 3IO3A 3ORYA 2PRIA 3BWDD 4Y1FA 1DEOA 1Q57A 3W1VA 2ZYDA 1EVKA 3E22A 2NO5A 4KN5A 1EFTA 1M75A 1GDTA 4CM5A 4HBZA 2JGLA 4F93B 4L5IA 3OQHA 4UTRA 3OLCX 4B8YA 1NVXQ 3DAYA 4NV3A 4I1VA 1CE8B 4ZT2A 3ICVA 1II8B 5ERYA 3TUJC 3JARA 4RV9A 4M2LA 3NHYA 4O1MA 2OCAA 5BXYA 3FTEA 4R2KA 3S40A 3DLAA 2PWPA 3QOWA 2YV1A 1IY2A 1CCWA 5D2CA 5LP6A 1W7AA 2ZCVA 1COWD 1Y3IA 1NX6A 1TVEA 1P5RA 4U2EA 4G9GA 4G01B 1YB5A 3PQ6A 3UC5A 3EPJA 1NX9A 4QLAA 3CLRC 1VLJA 2ZB7A 3L1UA 4HVTA 2YWEA 4OCZA 4UQOA 3ZNNA 4M1SA 3ABOB 5JSKA 1QFMA 1LF0A 4F2HA 4F7DA 4G0XA 2Z5VA 3DBVO 4WXPA 4BB5A 4DNOA 5KQRA 4TTJA 4ODIA 1FQOA 1BGVA 3G2QA 3C45A 2XYQA 3KX2A 3RUCA 4EUHA 3U7GA 3V8PA 2XWPA 4YRDA 4AMYA 4XSGA 4JVLA 4HWTA 4CMCA 1Q0TA 1YCFA 1VPLA 2H4XA 3SZLA 3G49A 1LH0A 3R8XA 4BOYA 1VMAA 4O4JA 5FTJA 4B17A 3HYCA 3MHTA 3P9RA 1J39A 1DT5A 4DF3A 1JG2A 2CY0A 2VH1A 2X40A 1E2KA 3D0QA 3DTNA 4IY1A 5IJ9A 4HYTA 1Y3CE 3I9NA 4EJ2A 3IUNA 4J2OA 1I4WA 2DERA 4UVEA 3GPIA 2OFOA 4BNKA 1JX6A 5BYJA 2YFQA 4EYGA 2FZCA 2YZ7A 1S7CA 1UIRA 4TYPA 2H00A 3K0HA 2VDQB 3K96A 1WB6A 2W8BA 1QRTA 3G8CA 1U0NA 1ADGA 1VYHA 1XTSA 2BEWB 3A0UA 3IHKA 5B3KA 1KJ8A 1UQTA 1ZISA 1P9RA 4Q47A 2LKCA 2MDTA 2CWDA 1IY0A 3RSGA 4H18A 3R7SA 2RI0A 3LGAA 4OXKA 4HI0E 3KLBA 2CHQA 5JNUA 3OEHD 3RVMA 3UMYA 1TZMA 2SKEA 1LEHA 1TMYA 4FHZA 4LQCA 2YFYA 3PDWA 4LJSA 4D25A 3K09A 3KOUA 2EIXA 1ZGCA 4J16C 3PHIA 4JBNA 4UUBA 3UXMA 4ZIRB 2XXAB 4GZ5A 3NM4A 4F3CA 4F1JA 1AGYA 2F1HA 2YV4A 1O5IA 5KDDA 4LF4B 4UQPA 4TXNA 1Q1QA 1TYEB 2IIBA 4FZVA 3OWOA 1QNFA 1FNMA 4INOA 3CEHA 4YRKA 1AKNA 3TIXB 2A58A 2HNAA 4N7MA 2QLNA 1Y0BA 3QV1A 4ISCA 4NYIR 4G07A 5A04A 4KQKA 3W9SA 3G0DA 4DB2A 2I8CA 4X1OA 5KNCH 4ZCLA 5T4FA 4R40A 1FRZA 4M0KA 5F51A 3ADKA 3SFVA 4CLEA 4B7UA 2UZ1A 1LA2A 3HO8A 3K1JA 4ZK6A 1T9CA 1RXCA 1ZXXA 3JD0A 1QHIA 3QRWA 4LDRA 5HQJA 1QZZA 3OJLA 1U28C 1QIKA 4DCUA 4GOOD 4U0KA 2FFJA 3WFZA 4H1VA 5ALNA 3ZHBA 1SUAA 4I8DA 1VSUA 3EGOA 1PGJA 4Q1FA 1DO2A 4F6RA 1ODKA 1Y9ZA 2J8ZA 5ECWA 3U9TA 3U44B 2ZQYA 2VEOA 3MOSA 4BNDB 5J4HA 5K0EA 1KMCA 1W93A 4GLOA 2PG3A 5FRDA 1XKLA 1Y5RA 1FXSA 1BROA 2HIAA 1BQ4A 2LW7A 4ZOEA 5LXTA 5TT1A 1X7XA 5HKLA 3W9YA 3E4CA 1EBUA 4Q4HA 4XM0A 4Q3EA 4E11A 1QWSA 3QFSA 1W8DA 2G1AA 2G07A 4IO0A 1Q84A 2I6UA 1NRIA 3NIGB 2J48A 3FUXA 4PYOA 3TOSA 1ENZA 2C3OA 2YFHA 2Z3ZA 3AHGA 1HE5A 3CRNA 1HFWA 3G17A 3K2QA 4QAJA 1SY7A 1FDIA 1TKCA 2WHPA 4GT1A 4D8UA 4EA6A 4G8CA 4L27A 1OI3A 4EJSA 1DWOA 4QREA 1ZI6A 2QYOA 2O07A 3P96A 3O7MA 4BMDA 4DIKA 2PMDA 1KO1A 2XNDA 3K15A 1NM5C 1JHXA 4GP9A 2BCGY 5C51B 2NV6A 2JI8A 3GUZA 1ZVJA 3TRHA 2HWWA 1NN5A 1T1GA 3BCUA 3RU9A 4HB4A 4ZYVA 2PH5A 3JVDA 4ZTUB 3PWKA 1G42A 1H4TA 1P7PA 1URPA 4M0FA 2B34A 2EZUA 4XPIB 1RRKA 5M29A 1RQ2A 5IJWA 4ZTZB 1J8VA 1QGED 5HIKA 4F04A 5HIJA 3GZNB 3KBOA 1P3DA 4S1TA 4BC1A 2J09A 1AQNA 3RUAA 2XQGA 3R44A 5K20A 3ZD6A 2ZRLA 1WLYA 5LDHA 1NBMD 1MV8A 3MCTA 1MORA 1ICIA 1E2MA 1E3IA 3FHTA 4OSOA 3NAGA 4FONA 4PN7A 5AJYA 4UOZA 3BG5A 5BYAA 3Q0TA 1GCGA 1B76A 5C5IA 4KITB 1IWBB 1FNDA 4JJ8A 4TVSA 4QRIA 3SQMA 5DPMA 2XZPA 5CURA 1X80A 3QV2A 4MQFB 2DWPA 2OC4A 5LQAA 3QITA 4B73A 2OGTA 5IJZA 5LZ5A 2AW5A 2ZULA 5IK2D 5JD5A 3H9JA 5BV8A 1JECA 2B0CA 1ISPA 2H31A 2PMKA 3KZKA 4HC4A 1QV7A 1HT3A 4PXAA 3AWIA 4RD4A 1EFHA 2DPMA 1XTTA 4IXMA 3ISJA 4HPWA 4D6XA 1VB5A 2AVNA 2CWWA 5K6TA 2Z3VA 1WHTB 1CQXA 1QGDA 1X7XB 1MIOA 3QHQA 4YXWD 1ODTC 3ESRA 4M8LA 3WLLA 3QVWA 1JNXX 5K09A 1KMIY 1G2OA 1TJ5A 4A6XA 4HKTA 3ZK8A 2FZWA 1P2GA 3VZRA 5CW1A 4E2WA 3G9ZA 3WGGA 1S0UA 3FUUA 5E4TA 1RWXA 2A0UA 4DCJA 3N59A 4NOKA 5C9ZA 3F5MA 1SZDA 2JAHA 4UZEA 4CN8A 4F8YA 1AOXA 1LI5A 2JPDA 3CZMA 1KC3A 4P0PB 4RPGA 4PIMA 1A88A 1KMQA 3QVKA 2FX2A 2QR5A 4Z0PA 4Z6KA 4MEJA 1UDRA 4FHDA 2HT6A 4DS3A 1CJCA 3AIMA 4JP2A 4Y6GB 4R68A 3LUCA 3I8XA 2NOAA 3PDCA 3TRKA 4TYWA 3ZZNA 3UV7A 4HWSA 5DYYA 5J2TA 1LUAA 4FQ5A 2GLUA 3CLTC 5A9SA 5EGNA 5G0UA 1H3FA 1UP6A 3L7DA 1M6YA 1BMTA 2VJAA 2UZ0A 3HL0A 3CG0A 3LC0A 1NQUA 2OFXA 3OSUA 3TNFA 4MWDA 4G0UA 3ELBA 4ESOA 1J9EA 1T9GR 5EIFA 3BWVA 4U39A 1Q7BA 3KZNA 4YRGA 2C7QA 1W36D 4LISA 5ELMA 1PAUA 3PGKA 5FIUA 2IZOA 3K71B 4UZSA 1YRYE 2OPBA 4YUZA 4P82A 4WK2B 2X3YA 1SOUA 4IDOA 1C9KA 1GTSA 1FUEA 2V65A 1EUCB 3TSAA 1QRDA 1Q1NA 2J33A 3KP1A 1QYVA 3ACBA 2AN5A 2IE0A 3TLGB 3TNJA 3OFND 4FD3A 5DM70 5TQJA 2FJUA 1MC5A 3FWHA 4EIWA 1P1RA 3C3XA 4PAMA 4A6EA 1X7GA 2XUFA 4B4WA 4CKXA 5A03A 3GN1A 1IONA 4F96A 1ECGA 3VX3A 5JRJA 2IZ0A 3QY9A 1OFGA 5IT4A 1NC1A 2C5HA 1P72A 1DVRA 1NXSA 4HN2A 1G98A 4PPQA 1NYQA 4WWHA 3ECAA 3O8BA 3PIRA 4D0SA 4AS1A 3DBIA 2HCRA 1B00A 3KKPA 4O8ZA 5L3SA 1CHNA 2XE8A 5JJKA 4NFYA 1N5MA 2R1VB 3IP1A 1WDMA 3RSHA 3P9IA 4P4LA 1IU9A 2JGKA 3FCEA 4G89A 3I04A 3EGDB 1L4UA 3ILYA 4Y7CA 2OAGA 2XUKA 3A1TA 3FHCB 1RYMA 3PC3A 4M4SA 2QDXA 4OK5A 2QN9A 4QYWA 1BTOA 2AFHB 1VCHA 1Z4IA 1IQUA 1ZI9A 1UDXA 2GVZC 2Q8PA 4K1XA 1YXMA 4U00A 4DJFC 1ECJA 2YR0A 3M4YA 1J2YA 2PD6A 2XVXA 1UAYA 2HEIA 1XDZA 1DC5A 3DXFA 2BDTA 1N77A 4C6HA 3D9QX 3HN6A 1JQJC 1LLUA 2G7ZA 3L7KA 1R0ZA 4H7DA 1KXJA 4NJOA 4YCDA 4ZPXA 1PNOA 4MIKA 3TLGA 5DK4A 2XMSA 3B1XA 3S2FA 3TDKA 4E21A 5FWXB 2COUA 3VNSA 3HB0A 1NF9A 5JJLA 1FP7A 3DD1A 1WE2A 3W6PA 1H0RA 1R3UA 1CUAA 4JYAB 2OTCA 1PI3A 2F1RA 3O8LA 3SQDA 1K68A 1P75A 5EA2A 3G2LA 2NUTA 1U81A 4YO7A 3N2IA 3AONB 1YUNA 4MKFA 2EVWX 3RAPR 3WL4A 5KJFA 3GBPA 1QQ7A 4ROTA 2ZDGA 4DCOA 3TTYA 3OZUA 1L8LA 3U4QA 1Z62A 3GLHB 4QFDA 1WMFA 5A4AA 3U3KA 2ZVJA 1SXJA 4ZT4A 4ER3A 1E3JA 4YT8A 5C1DA 2YJ5A 3T9CA 2ZRDA 4Q4JB 4MHTA 5EPEA 3EQ7A 1EFLA 1Q83A 1ZYUA 3HABA 4WN3A 3M6IA 2DJIA 3QFHA 2X23A 2XKBA 1OT5A 3C70A 3PX7A 3DR5A 4XYMA 3CWQA 4RAQA 1R5BA 1YBFA 2OGSA 4ML3A 4B6EA 3NZEA 3T9AA 1LDNA 3BMQB 1UBTS 2XY4A 2B7CA 4G4SP 4KJXA 4R1TA 4RBNA 4XQ0A 4G9EA 1FJ2A 5EN4A 1QOZA 2QJOA 1CT9A 2Z98A 4EKEA 4XRGA 3WVNA 3IEVA 2P9BA 1U65A 1K5HA 3ZE8A 4ZYWA 2VR1A 3G88A 3IH5A 2GARA 2HGZA 2J3EA 2Q3MA 3FW1A 4M8NE 3KKNA 2PRJA 1QG0A 4BTLA 4MI9A 2FSUA 2G40A 3QVLA 4C7BA 4P31A 4Z9YA 4NE9A 2OP1A 3QLEA 3IL2A 1WU8A 1N9KA 4KRYA 5AICA 1LFAA 5KC8A 4MWCA 4P7BA 5T7BA 3L9WA 4DDWA 4Y2XA 2O2YA 3OFNA 4GQBA 3I04M 4L50A 1KVTA 1H6AA 1T35A 2WZDA 2H2IA 3CN9A 1C9MA 1VHDA 4N9WA 4E1AA 3KWMA 5I9NA 5LIPA 4MVJI 4JP1A 1XJWA 5FA8A 2CXOA 2I76A 4CMGA 2BWJA 2JAWA 4N0QA 4RVGA 2XA2A 2YHIB 1R18A 3E27A 3OZAA 3MTQA 4K87A 1JMKC 1Z4NA 1HEIA 3DT6A 3F3SA 4BFTA 1E2UA 1G20E 1BYUA 1OAAA 1F8UA 2G80A 3RU3A 4BCCA 2FN9A 4YUXA 4IYRA 4KUGA 1TAGA 4OSEA 3NHPA 4AJOA 2X0RA 2IZ1A 2HQSA 1R0SA 1YACA 3AHIA 2H4ZA 3HJFA 4HGRA 4NHOA 4BEJA 5JNRA 3FIUA 5TS3A 1WP4A 2ISQA 2PS3A 2Y1CA 1U3UA 4KBGA 3S27A 4OP3A 4B71A 2IBSA 5E7MA 2I91A 4KO3S 5B3JA 2JCXA 1OTYA 2J0UB 4TRMA 2VPYA 3DV2A 1RXUA 1XUOA 4N7BA 2CD9A 1H2ZA 2UYQA 1DBWA 3IP5A 1WXDA 3KRTA 4PZPA 2H08A 2FB9A 1CP3A 1D9XA 2CLKB 1UZMA 2WKQA 2XNDD 4G0MA 2DKOA 4M37A 3BCHA 5BSUA 5A6SB 1CJUC 4KI0A 3VH2A 1YIAA 3HVHA 4RCZA 1ZCZA 3BF8A 3FNGA 4IJ6A 5CX4A 5U4QA 2XD9A 1E1MA 1B2RA 1TNDA 3VH4A 3DE4X 2ON6A 4EKNB 2RHWA 3KUUA 4J7UA 3FJOA 3LC1O 5I9MA 1SH7A 4JEHA 1FFGA 3ICWA 5C18A 3JD2A 1A76A 3JQ8B 1T91A 2LIVA 1JLSA 2C2HA 3DTVB 4TQ9A 5FPPA 2JDIA 2FAXA 2Y05A 3I64A 1AN9A 3UH0A 1R5NA 1X8JA 2BEVB 4AECA 2JVKA 4JBIA 3NR2A 2QS9A 3FCCA 4P5DA 1C30B 2VWHA 2WUDA 4UVDA 3ZWBA 1Q17A 3MOGA 5CG1A 421PA 5A05A 4AS2A 4FCWA 4WASA 1V43A 2HHHB 3HXKA 1G41A 4HZUB 5DHTA 2R8PA 3EZLA 2IPMA 1N4AA 1N7GA 3FPAA 5K0GA 1FYXA 1FUUA 3UAGA 2IZ7A 3DO8A 1Q0LA 2YXBA 2LTAA 1I2BA 3HCRA 3TVDA 3IRVA 1I2CA 3TH5A 3UT6A 1PZNA 3OFKA 2XUGA 4U2FA 5IANA 4L4YA 4ZO6A 2C1EA 1QHNA 1Y89A 3RYTC 4EUFA 1TJ3A 3ICCA 4ZAYA 4MJ7A 3R76A 3RVDA 5IDWA 1E2HA 3UHJA 2WD9A 2E55A 2P35A 5T5QA 4DPMA 4J0JA 3M1AA 3D1VA 5MN4A 3J80A 2O7QA 2OT3B 3G2PA 3P0FA 1RCTE 1H4SA 1AGRA 3TOVA 2JW5A 2PJZA 1YCHA 1GV1A 1MOSA 1GR1A 1TM7E 3OU7A 3VO2A 4MGKR 4YA6A 2KMLA 2ACKA 2BCEA 3AG6A 3AR8A 3GJRA 4JQYA 5HMMA 1E9AA 4KC0A 4LZPA 2FP4A 1F60A 1FP6A 1FTQA 4GYWA 1FFSA 1PFQA 3H1AA 4ZVQA 2VJYA 2ZI5A 4EF6A 4QEZA 4LQLA 1YVPA 2PVCA 2JAQA 1PJ3A 3AJ9A 4ZANA 1O97C 4DILA 3AOEC 2UYOA 2I7CA 4BFYA 4P2BA 3QEMB 4EA9A 1JIVA 3WNZA 3JR7A 1K0UA 2QE7D 3ZR4B 4EB3A 2QLTA 2VHZA 4B32A 2GAJA 4OI0A 1P8AA 4FZRA 1OILA 3WGKA 2FLWA 4OHOA 4C4OA 3ZDCA 5TQVA 2BKVA 1XEFA 2ECFA 1II0A 1Z12A 2FNAA 1OGIA 3DBHB 1AUQA 1J2EA 3Q85A 3G2OA 4PG6A 2V3WA 4UXHA 1JAYA 4Z2YA 5JALA 4DUGA 4OX9Y 1WPQA 4YV1A 4GL4A 4MB0A 4EFLA 4ZGGA 5AVWA 3BL8A 5K45A 4N3NA 2QA5A 5JD3A 2DUNA 4URZR 4YMGA 1L7OA 2QTVB 4ZHSA 1U0JA 2PBLA 3OCZA 1GSAA 3OX4A 4PNHA 3ZQKA 1MTOA 1REQA 4OUDA 2H7YA 3X2SA 3DOCA 4TKLA 1GA4A 2NVUB 2HN9A 4ALKA 3ZXYA 4RMIA 5BPFA 3RYCB 2VP5A 3V3TA 3PSHA 5I5GA 2DFTA 2F2TA 3ASZA 4YRRA 1I3LA 4PF1A 3UK2A 1VDMA 1WDKA 2RGNA 3CRMA 3EIXA 3IOCA 3LUBA 2JEYA 4LZAA 4JUCA 1ZUD1 4NP6A 4YRBA 4PLVA 5FPQA 3CMCO 4PHCA 2BKXA 4GDMA 3MBKA 4F2WA 1NUQA 3PRJA 1KOGA 4TV8B 4L2IA 5EYPA 2ZJ2A 1B8NA 3ZHQA 3WIBA 4U6SA 1A2QA 2V9CA 3U31A 2OILA 1PFYA 2JGDA 1GTZA 2G1KA 1H05A 3HUUA 2A1IA 3CE9A 4I9GA 2HHCA 4ZRMA 2PD3A 1VPVA 1VBFA 1CQJA 4PSVA 2RSLA 5ADVA 4MH0R 3BGOS 4MAMA 3R20A 1MC8A 1OYVA 3GRUA 3ENKA 4O33A 2NG1A 2KQUA 5CBPA 2DWQA 3UOWA 2JFPA 4ISBA 2NX2A 3GP8A 3HEAA 5CNIA 5DI9A 3FETA 2QRHA 2J6HA 5ALXA 4ZI7B 5FF9A 4XASA 2J0UA 2OM6A 4TPKA 1O03A 1KE1A 3UA3A 3WHPA 4W9MC 1QTQA 1Z0FA 1LWNA 2O2XA 3AF4A 2FPIA 4OG2A 5JSUA 4BPRA 1GQSA 3FNHA 2WJYA 1NW5A 3OZXA 4AY4A 2P6MA 3THYB 1HPLA 2CFCA 3LG2A 4PZUA 1PYGA 2Q1XA 5FKJA 2O52A 5J43A 1PEYA 4AZ0B 4A73A 1KE2A 3IIIA 3SEQA 1G5HA 1UM9B 2NQ2C 3EEFA 4UVIA 5EFOA 1Y8RB 4BC0A 4WOJA 2BSXA 4FJ0A 3X43A 1GPAA 3QKRB 4A8JA 3EMBA 1EUYA 4DIBA 4LYDA 2A4KA 3NBFA 3JQ8A 5LKAA 3U48A 3AVTA 2R5FA 4ZO9A 1PW5A 3BTVA 1PX2A 3VVCA 1FMCA 1G5QA 1UFQA 3IULA 4JA2A 2GCEA 3HO6A 1G64A 3V4SA 2MMCA 1ISHA 3HKCA 4UCXA 4IX9A 1L4YA 5EZYA 1JDTA 4CV3A 1NWCA 1CUUA 2VF4X 2P6UA 3DVRX 1C3OA 1T6NA 3M81A 2WDZA 2V45A 4MWZA 4QQNA 2ZBQA 1MENA 1MO5A 3W34A 1VG1A 2YRWA 1JL3A 3UT5A 3UYKA 3DO5A 3HE3A 5F9FA 4Z99A 5AHXA 1LBQA 1UOEA 5LDGA 1PW7A 5CD9A 2QL9A 2J9ZB 3S7ZA 3IALA 4A23A 2WW8A 4YRAA 3B5IA 1IATA 2BTQA 3OIYA 4I14A 1HKHA 4ZZ3A 1FP4B 4WESA 5C8ZA 1XLVA 1SK8A 2ZRGA 3ND6A 4MUXA 2QE7A 4XB6B 1J7KA 3KKZA 4ENWA 4PBTA 5JAHA 1UBUS 2EBUA 1Z8NA 3PVCA 4LWZA 1RHQA 1U7PA 4B6JA 4CT0A 3E70C 1A9QA 3JARB 1DTWB 2P11A 3WGTA 3STWA 4YCAA 4ZCQA 3QTTA 1WCWA 1RBZA 5DHQA 3AY7A 2HRCA 1Z5ZA 2QE6A 3TXAA 3SMVA 2VPXA 1TTHA 4FMCB 2F64A 4EO7A 1QGYA 2B6HA 3AR3A 1DAMA 1NFRA 2A5JA 3HCOA 3JTMA 3N7UA 2XNJA 3ONEA 5U4XA 4ENTA 4ENUA 2DQ4A 4I36A 4NCBA 3A1EA 1KEEA 2RAVA 3QF4A 3VKWA 4UDYX 5DJ5A 4BJ6A 1U6KA 3B7GA 1A72A 5HMLA 1CRLA 5CYGA 1U8ZA 5LLDA 5IASA 1GCIA 1SG0A 4G5RA 2XECA 1H1TA 1OIVA 1XD2A 4KX5A 3TBFA 3NBQA 1TVKA 4RHXA 4NARA 1W25A 4CE6A 5AVTA 4EHJA 1IEVA 2ALJA 2BM0A 1CW2B 4G41A 1ZNQO 3WL8A 4DLVA 1ILEA 1X14A 1MA3A 1GNQA 2HXGA 3ELUA 3LCJA 3PQ3A 1T8YA 1JAXA 3K30A 3OJ0A 3PHCA 5AI9A 4C9BA 3D4PA 5LZ7A 1AKRA 1IE3A 3VXKA 1Z5PA 1ISSA 4QDKA 1V2HE 3ZZTA 2OKCA 2BY4A 2RE8A 2EFDB 1U0EA 2FJPA 5H3LA 1GFZA 1LVUA 1HYHA 4I9UA 1AVTA 2PV0A 4LRUA 3MQFA 3TLBA 2FU5C 1PYDA 3VOTA 4F1KA 3RTCA 4PAOA 1O94A 1FUYB 3AEKA 3VO1A 2VA8A 1VJDA 2HCBA 2JLQA 3EJWA 4YJDA 1OAOA 2QIOA 3OCCA 3UUEA 3A1FA 4OBEA 3B7WA 4BE7B 5KOIA 3CS3A 3RREA 2RFLA 3D7SA 5EZSA 4FIDA 5ISMA 4R1OA 5HP4A 4D6YA 1JHDA 1QONA 3PR3A 2HU7A 4E2YA 1JEAA 2PUVA 4XD2A 5CXUA 3F9RA 2JZOA 5EZ5A 2ZBVA 2JD2A 1EUCA 3D81A 1HFKA 1QIHA 3G8BA 3MHPA 5BO5A 4BMSA 1EFRD 7YASA 5KJCA 1E0DA 3G8DA 3GDOA 3OJOA 1P0IA 5B57C 1NG1A 3RVSA 2GBGA 3KB6A 1FTNA 1IHUA 3L7NA 1X7YB 5HNKA 2PJDA 2Q5OA 2GT1A 4GXNA 2FRDC 4WZBA 1KKLA 1CJTC 2IDZA 2VJKA 3IFSA 4JEUA 4XVHA 3R3YA 4DTCA 4EQZA 4YCJA 3U1TA 4DNQA 2WM9B 2C9MA 1ADCA 1MOPA 2XA1A 3NI2A 5DSTA 3TRFA 2DHEA 2V98A 3NBKA 3T7AA 1T10A 5JAIA 4CNBA 4P93A 4I9FA 2YV2A 3T1QA 3ANXA 3O2JA 4YRPA 1H65A 3D6TB 4NC9A 1UP4A 1DKNA 4KP7A 1J6UA 1S2DA 1E3WB 2WYOA 2C7BA 4G0PA 1UMCB 4U5XA 3LPDA 5E6SB 2YXPX 4DBVO 4UM9D 1CUVA 1DEXA 2RGDA 1W1WA 2GASA 1Q7GA 2XJ9A 5DTMA 3TLXA 3EDOA 3TPFA 3VKHA 2HA6A 3LQ4A 3U7QB 4ITUA 1F3OA 3LFHA 1YI8A 3SZRA 4LWQA 1UKAA 2XLBA 4GOXA 4PCAA 1DB3A 4L8YA 1AUOA 1DRWA 2AOTB 4F3KA 3H2YA 2GX6A 3OPYA 2DECA 1X1DA 2VQEB 1GPYA 3OTGA 3JQFC 2W2MA 4Y1EA 4AT1A 1FX1A 3TD9A 4HDMB 2ZVDA 4RCVA 3EVDA 2ZB8A 2VKTA 4R6WA 3TGPA 2P2GA 2P41A 1A8UA 1PJZA 2BFCA 2ID7A 4QRHA 4YVFA 5E0KB 3URKA 3WISA 1FK8A 1ONOA 2FN8A 3Q9UA 3OU6A 3FTNA 1KFJB 2V6FA 3MB8A 1T4CB 3K9HA 2IKQA 3AFOA 2GUWA 4UDNA 2NUTB 4LEIA 1V25A 1V1MB 3L06A 5BWOA 1P2VA 3ZCXA 2X5XA 4PGFA 1D0SA 3WJ1A 1Y7TA 4MROA 2IW3A 1KEVA 1UEXC 2IPAB 4ZKDA 4Q01A 5JCXA 3ANYB 3WWYA 5KOYA 1VPWA 3D43A 4INPA 1R27A 4WEQA 3LK6A 1RP1A 3R0JA 4HLCA 3HBNA 4NNOA 5AKLA 3W3AH 3I8OA 2JFBA 4HNUA 1BDHA 4RLHA 1P6UA 4QOHA 2B92A 1MJFA 1W4AA 5FNVA 2J3QA 5D51S 1NRWA 4F12A 2HU2A 5IDYA 2DG2A 2VO1A 3IP3A 5KZMB 2I6GA 1JXMA 1K7FB 5DHPA 4X65B 3AFMA 2R48A 1Y9JA 4JVMA 1Y1QA 4DBLE 5KKNB 4ZU6X 5BN3B 3U5ZB 1RS0A 3C1AA 3OCUA 2NSLA 3JSXA 2OQIA 3CKYA 4NOJA 3UMCA 1LK5A 3B1WA 2P6PA 2PLNA 3LP8A 4RHFA 1ZRSA 3FDJA 2V59A 4KGZA 1RRPA 3AMVA 4DA9A 2IS6A 2AX4A 2H2DA 4RLFA 1QU2A 3WZMA 2I3BA 1U0GA 2HX1A 1SIUA 1VHJA 1ZP6A 2K7ZA 3GF4A 3IP8A 1JMVA 2OHIA 2VBGA 3ZXXA 4RZHA 3IEPA 2CV0A 2F9MA 1NXQA 3V97A 1P4SA 4HATA 4EYSA 2AFHA 4EGSA 2OV1A 3I1IA 2BDEA 4O1HA 4US0R 1P0CA 5AI5A 5CEJA 5I01A 3MELA 1TUBA 1Y4ZA 1M2GA 3ONDA 4MIEA 1L1QA 4RE5A 1YB6A 4WGFA 4D9GA 1TYAE 4A2PA 5DYIA 3AVWA 4ND7A 5AKIA 3B2QA 3GWZA 5CFQA 1JLLB 1E3LA 1E5XA 1R0CA 2JH8A 5K03A 2I80A 3GG9A 4FMBB 2V74B 5I48A 3IILA 2G25A 1RM4A 2P9EA 3FKJA 4KDCA 3RFCA 3S3TA 3AT1A 1WUYA 1SVMA 4H1TA 1P45A 3CEAA 1ZGJA 3B51X 3NVDA 2QX7A 4WGGA 2QGNA 2IH2A 2I8LA 2E6UX 1WKBA 4BMVA 2I1LA 4AJLA 1DRVA 1EH5A 1AE1A 1C3LA 1TCVA 2WFLB 3VNAA 1CR0A 4RELA 1EX7A 4F5EA 2WINI 4IOJA 2F59A 2DOKA 1U99A 3K35A 3F6SA 2NADA 4ENSA 3QLTA 5IW8A 3JASB 3RYFB 1ZVVA 2WDPA 2OFPA 3Q7TA 5JSZB 3KPUA 2ZYIA 5KAPA 1W581 3FCAA 3OIUA 1A2OA 3C15C 4UNIA 2XVAA 1F48A 3KT6A 3RFFA 3RRJA 5J1TB 3FN4A 1QP0A 4YAWA 4R16A 5E3HA 8OHMA 1A1VA 1Y9AA 3C24A 4DNPA 3IBTA 5C46F 1IMJA 3PQDA 1RQGA 3QX8A 1APBA 2ZGVA 2PL1A 2FEWB 4M54A 1S5PA 5EAIA 3V9AA 3A3NA 2VTBA 3T3IA 1DAFA 2W2PA 3KR1A 5AK6A 4YT2A 5FP0A 1FSSA 3HL4A 1DIRA 4Q48A 2C9ZA 3DUFB 2IYPA 2W2LA 1SC9A 4JN6B 4QPCA 1KAQA 4X6LA 3TD2A 3F5FA 3TSYA 5B3JC 3WV5A 3CIFA 4U02A 3UJPA 4MS3A 1U9CA 3TDMA 5D01A 4BGIA 5AVZA 1D2EA 4ZWNA 1QBGA 2A78A 4DOMA 5I7OA 4JQOA 1K88A 2A0YA 3MGAA 3OHMA 2QG4A 2GGSA 1QORA 1DELA 2Z2JA 1WP9A 3F8WA 1UZAA 2HSDA 2GYWA 2WPNA 4MINA 2ZRJA 4Z0HO 1A9OA 3H4TA 2Y8EA 4GH5A 5JSYA 2VSXA 3MT0A 1LJLA 2VTVA 1F20A 3N2ZB 1QB8A 4HQ6A 1KYTA 1YOVB 1UXHA 2PX6A 1E4VA 2RBEA 2WI8A 2FMFA 2IQIA 3F7MA 3MWGA 4JUFA 2LWIA 2MSNA 2GBIA 1G7RA 1LBEA 4WXEA 3IMFA 3WKDA 3UJ6A 5EI5A 3WMXA 2XCQA 3KJEA 5F5LA 5IJ0B 1TTPB 5GOTA 1M1YE 4ZYYA 5A1JA 4V0QA 4M7PA 2HU8A 1Y3BE 1Y8AA 3NYIA 1GT91 5BW6B 1FNNA 3CJQA 3TUIC 3C3PA 3QBDA 1EFVB 3AVVA 3OECA 4ZAFA 1NP6A 4ZAWA 1XHFA 3H7AA 4NDZA 5HE8A 4DA7A 4PLFA 4UNRA 1QGUB 3RS3A 3VYTB 3L7YA 2J3MA 3UAZA 3LXMA 3AB7A 4RE6A 3SMQA 1A2KC 2WWXA 3GRRA 3GCDA 5FORA 2IU3A 1A9PA 4NEGA 3QVVA 1MH1A 2PSJA 3ND8A 3HXOA 3SBEA 2FSFA 2A84A 3MD9A 3UQZA 1XWIA 4R9VA 3L79A 3UGKA 4IJUA 1RLJA 1A8HA 1TM5E 2DY0A 4GR9A 3N6XA 3JQ9C 3Q5DA 4FOOA 4X95A 4ARBA 2VZ8A 4DXAA 4DJ5X 3QLUA 4PRKA 4RNCA 4URFA 2DTDA 4HO1X 4X1YA 1WJGA 3DEAA 1MA0A 2UVPA 1R4MA 3L0DA 1V6SA 1ZCBA 3CM0A 2WTXA 5IAEA 4LXXA 2FWRA 3L6RA 1IXSB 3PJRA 1SCAA 3VSEA 3RGGA 2HBYA 3A27A 2YZNA 2R8ZA 5CM2Z 4HDOB 4MUMA 2YDYA 3DDWA 2Q5IA 1MN6A 1T2NA 3BXZA 3IEKA 4WCFA 3QXHA 4IQFA 5KTTA 4AG5A 3VVLA 3G82C 3ZKWA 3I6IA 3GLFB 3H0CA 3QG5A 3W90A 1O9BA 3DYVA 1WSWA 5I6DA 1UXGA 3S2IA 3GLFE 4MS3B 2H07A 2J08A 4RJLA 5TC4A 2ZUBA 2O1SA 4ETNA 2P6OA 1MABB 1FU4A 3N53A 4H17A 3H1BA 3JQDA 3L4BC 8ATCA 2QRKA 2QVXX 3N6VA 5L40A 4LXYA 4B6RA 1CETA 1T5BA 3ACCA 5CHEA 5ALPA 4OLBA 5EXPA 4KCGA 5HSGA 1TM4E 4GUDA 4PC2A 4Q9IA 4OX9B 5JNVA 1SUWA 5CLIA 1YHNA 3W3AA 4GBGA 4DMGA 2QB5A 3UK0A 1S8NA 3UPDA 4QTYA 1PDWA 1UOOA 2E37A 1YDEA 2J3KA 2OCPA 3COPA 4QBGB 2WB2A 2C5LA 4UU8A 2AEJA 2MWMA 1QLWA 1ZOPA 5AJZA 4MVWA 1GZUA 1RAIA 3OMWA 2B1IA 2Q3FA 1OHHA 1XV5A 1YFZA 2F8LA 3FZGA 4OM7A 3RFTA 3TW0A 3C6ZA 1DGQA 3RS9A 5J2UB 2PBRA 4ECEA 4MW9A 5JSHA 5ILOA 1IVNA 1Z8DA 4OXRA 3W1WA 2F43B 4CCWA 4N65A 4DWVA 1OSNA 4RTQA 4AKIA 2BFBA 1QO0A 3E5HA 2WIAA 4D44A 3WNQA 4BX3A 1UINA 4HK4A 3L4KA 1XGKA 3A26A 2O8EB 5ICFA 1D0IA 1OYOA 3BIJA 1L4MA 3TQTA 3PX2A 3SIRA 4JOQA 2A7XA 3NTQA 1E60A 1XTKA 3UMMA 2J6BA 1N6IA 1DRKA 1OWNA 5KNDA 4A8HA 1ULHA 1WXXA 2P68A 4FMPA 5HYVA 2XUZA 3WLMA 1KJIA 3C87A 4R1MA 2GDJA 1RC1A 2WD8A 4D1YA 4C7JA 1K66A 4LE2A 4RAOA 4IIFA 2CXQA 3RAFC 5DNUA 3GWGA 2VAMA 3CCFA 5JZBA 2IF2A 2NLOA 3AUAA 3AGPA 3M1YA 4EG5A 5JFGA 4HNRA 4RVNA 2ZTSA 1H8HA 2XDWA 4MO2A 4Q34A 2NTYC 2CHUA 1OC2A 2WZQA 4MVCA 1VJCA 3WGZA 4ZVVA 2KSQA 4CLRA 3R7BA 3FI9A 1YC2A 2Y0BA 1ACLA 2XD4A 3T15A 1TQDA 2QROA 3H8SA 3HB5X 5IZCC 4JLUA 1LJ8A 1UM9A 2B7LA 3GLUA 2JGMA 3KEMA 1F2UB 3JQGA 3IMKA 1G21A 5C8YA 1LWOA 1ZOOA 2PV7A 4W5TA 2J6IA 5CLGA 2W6CX 5LR6A 1OA0A 3VYUB 1ORIA 4D56A 1V35A 1WKCA 1NPTO 1NTRA 4FFVA 4AW9A 3EIHA 5E2BA 1JR3D 3IAS1 1P31A 1PEAA 2PX4A 2QDKA 3RC9A 3UB3A 1CJKC 1N0IA 1JI0A 2NW6A 2Q62A 3DZBA 3PXAA 3NBMA 1CUSA 3ZTTA 1CDOA 3W8RA 2YHBA 4GZMA 5EJGA 4E5NA 5BSVA 3A3KA 3PFFA 1XX6A 2CZCA 1ESMA 3WWDA 1BU8A 5E7JA 1H0KA 3ZU4A 3U1BA 4HQ0A 1NMZA 2PVSA 1BN6A 1AU9A 3K2IA 1OPXA 1UBGA 3RAEC 4PLPA 3UMVA 1O0SA 1NJ2A 2VAXA 3U9SA 2OFFA 1E9BA 2PU7A 2X6QA 3CYFA 1PLKA 3IELA 1M8PA 2B8NA 5SV2A 2O54A 5KNBH 1K9VF 3A6DA 3FXAA 4IILA 2E4AA 3DBRA 3A1VA 4O1IA 1INLA 5B3AA 1UMDA 2FGKA 2ERXA 1SKUA 2VBFA 2CUTA 4G67A 3MLBA 5J63A 4FB4A 3QFRA 4PSKA 3VI4B 4TKUB 1WIWA 1JJ7A 1KP2A 2FQQA 2ECOA 1AN0A 3AV0B 3C8ZA 3IKMB 3DNMA 4AKEA 2IYAA 4NZ9A 1X7WA 1EXWA 1LQTA 4HDRA 2R751 5HUHA 3V8MA 1RQNA 3HQ4O 4TXMA 5G0VA 2IUYA 2VJDA 1PJ4A 1KH1A 4N9QA 4IBOA 5ALOA 5CM8B 3WLFA 4LQDA 3PXDA 4GYJA 2NMVA 2RGAA 1YKGA 3AUUA 2VRBA 5DRYA 1X1TA 5B7PA 5JCOA 3I1JA 3ZY4A 1J2JA 5DSZA 1TD1A 1JPVA 2CF5A 4X90A 3W8DA 3X1KA 4IMRA 4IW3B 4M36A 4QO8A 1N6LA 3LYLA 3OFJA 4GOJA 2VAVA 2PLRA 2Q9UA 3RO7A 3C43A 3MB5A 4INJA 2UU9B 3LL7A 1FYWA 2H2AA 2IT1A 3LUDA 4KIWA 3SSNA 3TWOA 2CCGA 3L43A 3L7OA 5TPZD 1J07A 2B4RO 2Z04A 4C43A 5DLEA 3S6JA 3G02A 3VR3D 3ZWMA 3ZU5A 4PANA 3NVMB 4HX2A 4YUYA 1ZSNA 2VAWA 2Y76A 1VZ2A 1BQ3A 1KZ7B 2PZBA 1UWLA 5CT6A 5TDHA 5K8IA 1MCZA 1IZ7A 1FNBA 3VHLB 2HI0A 4XWGA 2DKNA 3G13A 4R01A 2JANA 3K92A 3KOOA 4JYBA 4ENVA 3IQEA 3GJ8A 2ZROA 5DFAA 1ZD1A 3HM9A 1E2PA 1ECBA 3WY9A 1NHGA 1W8IA 3FBTA 5LQRA 2WY2D 4DNFA 4JUIA 3ZV7A 2J3DA 4BB0A 4QRDA 1ONPA 1CY7A 1GLNA 1LXCA 2NUAA 2XPCA 1SIOA 1ZH2A 2ZJBA 1MXFA 2QHXA 4K5QA 3GT7A 4NH4A 1A2BA 1B16A 4BN0A 1OPRA 4M83A 1GZSA 2G4CA 2IQ5A 1Z33A 3E3NA 2CLIB 2DTXA 2QD3A 3FRIA 2NZ8A 2HO4A 4ITRC 5JAQA 3RIGA 3D8RA 1OOEA 3TAHA 2GPTA 3BD9A 2ZUCA 4D5GA 3QXXA 4L5YA 3RHSA 1DTWA 4Q4CA 2I78A 1BDJA 1XXHA 2BFFA 1YONA 4ZDJA 1T9HA 4G0WA 2RH4A 3HPQA 5JPCA 5DB4A 3AHCA 1YQTA 4EWLA 1W4ZA 2YJZA 3CG4A 3A10A 3I6YA 4JJKA 1BE1A 2J9FA 4G5XA 4AVYA 4PHTA 1ZN2A 4M6WB 1Z8FA 2HJHA 2XJ4A 2FPPA 3V1TC 1EXNA 2SICE 1CG6A 3M3PA 1Z36A 4IOKA 5ADUS 3CN7A 3QPDA 2BGRA 3H2ZA 2D5BA 1RWOA 5E9WA 5LCXA 1BXGB 1M2VA 3MTDA 4FE4A 4JYMA 4FDMA 4GSYA 2G9ZA 3EA0A 3H1FA 3E9YA 2GK4A 3BJEA 1RIIA 3P9ZA 1K7XB 2QUHA 4F4FA 1QFSA 4QXPA 3N39C 3VOAA 2XRZA 3LHFA 3BSSA 5KMGB 1JN0A 7MHTA 3O5AA 3FB4A 5BORA 4NK4A 2Y1OA 4HSGA 4B33A 1M72A 5JECA 3K0FA 3DM9B 2H51A 3W6ZA 4R9SA 3T4UA 5J4YA 2OHXA 1MVLA 4FN4A 4Q9DA 1VSQA 2GEJA 5ICMA 1R9MA 2CJPA 1OIWA 1XXHE 4WT7A 4M53A 3EZGA 1BDBA 2HSZA 3RJZA 3WICA 2B69A 5CK5A 4QPJC 2ZWPA 3ZGYA 4BLTA 1SWWA 3OOYA 5IUJC 2JJ1D 1IY1A 5FPKA 4K6FA 5AVVA 3C5WP 3SJCA 2ZZNA 5DISB 4OA5A 5C7OO 2XAAA 4UAUA 3CNQS 5HFAA 2NU8A 2PA3A 1PTJA 2QMZA 3R5KA 2X0EA 3V1MA 4DM3A 1A8IA 3CVWA 4EDHA 3A6EA 1Z4LA 2WMYA 1NDHA 3PUIA 2XHEA 3GD7A 3E35A 5D7BA 1RRMA 1LX6A 4OFBA 3PUKA 4JI4B 1TT7A 1DFHA 1GVNB 1R0BA 2G88A 3U4MA 4EMUA 1WULS 5KYVA 2HOQA 1I2DA 3CINA 4RF5A 3D0KA 1X1AA 3N7TA 3D5QA 3T7DA 2XZOA 4OQXA 5K7SA 4J9VA 3H2JA 2WAYA 3IXMA 1XE3A 1IXYA 4N41A 4O4LB 1K3UB 5CHYA 3E9MA 1UUFA 3R75A 2YC4C 4JT8A 1P9LA 3LUPA 5L6MB 1Z0IA 2EP8A 2Q2QA 1RAAA 2ZREA 3ME5A 1EHIA 4W5JA 1YR6A 1VIMA 3P32A 3FSGA 4GVLA 2GF2A 3U13A 2NZJA 2HMTA 3FSJX 8LDHA 3LOQA 3PNVA 2DC1A 3ETGA 3L9XA 3LY5A 2Q50A 2W93A 3DLPX 4Z4IA 4BE4A 3FGPA 1CUYA 4QUHA 2E87A 6GPBA 5EIBC 1V9LA 3ICEA 1G17A 1LFDB 3EMDA 1WZCA 4QQ8A 3SSOA 3UENA 1NI4B 5FEMA 4MKHA 4G0NA 4KIFA 4X7PA 1WV1A 1FDUA 3TJZA 5EE1A 1G0OA 2HCTA 3C5EA 2ID9A 3E1KA 3TJMA 5AW4A 2OXRA 1E2QA 1XQ1A 5TPWA 1CUIA 4BP8A 5FBRB 4S12A 2ZJOA 4RWEA 4CFSA 1D2AA 1T8PA 3DEFA 2XQFA 4IVNA 2FX5A 3ORFA 3VV3A 5CA1A 2XCRB 3ICOA 2HB6A 2NXEA 4TYQA 2OO7A 1A5SB 1KFBB 4UATA 3NNNA 4QXRA 5KJEA 4F4UA 3UMGA 4G5YA 1FFHA 5JD4A 1QDUA 1L5ZA 4BY9E 1ZOLA 2HBQA 1JDJA 5TE9A 4HN9A 1QG4A 6ADHA 3LFTA 5BR4A 2C2GA 3PPXA 2EFEB 3DDZX 2J9YB 3TZKA 2RHBA 3AETB 2AZDA 1M1ZA 1Y3AA 2GBLA 2QTRA 3TL3A 1PZEA 2XNKA 1UEJA 4KFUA 4CM8A 2Q6LA 4UREA 4B3DA 3LV8A 4J3FA 1E98A 1DS6A 1YL7A 1ZNXA 1PS9A 2O1XA 1KBZA 1W9HA 3RVBA 1BO6A 3R8CA 2Q9AA 3FOFC 4C4YA 4KLZA 2Q41A 1AS3A 1J56A 3LKVA 1JBQA 1V2GA 2P4QA 2RHJA 1EDBA 2GKSA 3HKDB 4G1FA 4MVJA 3RBVA 1D2NA 3ZU3A 1R4ZA 4DQUA 5EJ6A 1QPZA 4EG4A 4MRNA 3H86A 2HKIA 3QMVA 1RQLA 3NT2A 3LD9A 1EHCA 4EEZA 3NTOA 1GZDA 3FDZA 4Z86A 2R5WA 2C92A 2GZHA 4C03A 4MW2A 3HXQA 1ZD9A 4JLSA 3RANA 3ZYZA 1GL3A 1VLZA 3FPKA 2FH5B 3ANLA 3UBMA 2VCYA 3T06B 2WILA 1USGA 1U9YA 3P52A 4CXMA 2QV7A 4BO9A 1HDXA 3KJQA 3QA3E 1YZLA 1GG2A 3UWPA 4QOEA 3ZJVA 2HPVA 5DYTA 2KE5A 4RK0A 1LGYA 2OBXA 2JFUA 4LZWA 3EASA 3OZGA 3VZSA 3P9PA 5DHUA 3EZFA 1K3FA 5K8CA 4EJFA 3T1YB 5LC1A 3FVQA 1O5OA 3OIDA 3FZQA 2IITA 4L3VA 4WJKB 3KSMA 3L40A 1KK2A 2WM3A 4Z4HA 2EW2A 3DDHA 4N8EA 3AIOA 3UJBA 1R6VA 2BP7A 2EWWA 2YXDA 3AIKA 2PH1A 3O4JA 4MOWA 2GBLC 3MINB 5ECGC 4Z1MA 2VF5X 1U7OA 4CLOA 3L0BA 1A5AB 3RSFA 1JEJA 3PFIA 3D3EA 4C20A 4FX5A 2BN4A 2C2MA 3C98A 1C0PA 4MTCA 4U2KA 3W2FA 1YT5A 4MVYA 4O2BF 4RF4A 1OB2A 3AP3A 3H5RA 2I33A 1NNUA 2W8ZA 4GQAA 4WX2B 3O26A 3NUGA 4ZQIA 4L9WA 4EPWA 4JELA 4I5IA 3LVBA 3ECCA 3ZI7A 4Q1AA 4OI2A 3VU3A 2BTOA 4DAEA 4LX8A 4HAWA 3SD7A 4BV9A 2QW8A 2Z8YM 1OXKB 2FRVA 3B6JA 1JG6A 4QXOA 1E0AA 2PS0A 2I6QA 4FFBA 1N5DA 3LY9A 4KR0A 4FX2A 4CL2A 1LTHR 3DO6A 2PUJA 2YWHA 3H17A 3OA2A 4QECA 5I47A 1MC4A 2B82A 3HZHA 3OPYB 1A96A 2OUIA 2HK7A 5TGZA 2V6GA 1X87A 1XRSB 4KN8A 1KETA 1GSHA 4YJ2B 3DMTA 1XF9A 1OX6A 4HEQA 1II9A 2HREA 1HQYE 3M89A 4M0PA 4AMBA 3GEPA 3NHRA 4C0LA 5EZ6B 1DIBA 1IHDA 2FX3A 3UG6A 1Z5WA 2C83A 5FFFA 1KMNA 2X2OA 4FILA 3HEMA 2X4LA 1RYEA 1ZQ1A 3R6GA 3HNPA 5ENVA 2IV3A 1RI2A 4IRMA 3SQNA 5C4GB 2F62A 4WKNA 4DWOA 1NDUA 1ML3A 3BMOA 3NC0C 3WXBA 4CG1A 2COKA 1NN0A 4Z0NA 4PO8A 1JFSA 1RYZA 2N75A 1EESA 1CJBA 2QN3A 4MJLA 4V3BA 4KZKA 2VAPA 2JAPA 1L7VC 1LPPA 3UJCA 2NV0A 5EKSA 2P79A 4RKQA 3TOCA 4Y6SA 3IHLA 1WRBA 3A1DA 3MK31 3OURA 1PVOA 2FHPA 5EXTA 3SKYA 1FCJA 3DFZA 1B8OA 4WLVA 2I7XA 5B1YA 4KYTA 3AKCA 5DIZA 4MW0A 3NEJA 1J5XA 5JCPA 3BWXA 1Z82A 2Q1YA 3OHSX 3TZLA 2DBVO 4DLUA 2ZRFA 3ZIAD 1XA0A 3AG5A 4BASA 4Q4AB 3TW8A 4FWIB 2KM1A 4TRJA 3TR6A 2PKQP 4IQGA 3UWOA 4KWEA 4F5WA 3RVPA 4CU5A 4D0RA 1C5KA 1WEKA 2BBSA 2YJGA 1K3TA 3WHIA 3BWEA 3GRYA 2CNBA 1R74A 1DP4A 2BEJA 2FK8A 1QLHA 2PZJA 3RR2A 3BFVA 1V39A 3Q8LA 1ISRA 1NZDA 3G3EA 2PFKA 1NKVA 3PHHA 2WHQA 4DZRA 5KOHB 4GDFA 5DYNA 4DQ0A 5I4IA 5BUCA 3EF0A 3SC4A 1JKMA 1KYWA 2L19A 3R9KA 3RIEA 1NF3A 3AR6A 2C3MA 2ET6A 4J29A 4PFJA 3ZD8A 3OAAA 2AGVA 2QENA 3KXLA 4U7TB 1UWVA 3LQFA 3F97A 1U9IA 1FW8A 1VG9B 1VLHA 2H1CA 3A0RB 2Y68A 5FPSA 1W2GA 3DULA 4BDTA 3U5TA 5LQKA 1QHHA 1SHUX 1BS2A 1JQEA 1NNSA 2J4FA 2YHSA 2RHMA 3EAGA 3SM3A 4Q1CA 2G9NA 3ZIUA 4DAOA 4KLRA 2AR7A 4MXDA 4I4TA 1BSVA 1UR5A 2HNKA 3DE7X 3FFTA 4UUQA 3BDIA 3RIHA 2ECPA 2NACA 1QQ5A 4XCVA 2XTNA 1ESCA 3PT9A 4W5HA 2DZDA 4GC9A 1MVNA 2GTIA 4MUEA 3FUWA 3FTDA 1I6MA 4X1IB 4I6EA 3TW4A 1P5JA 1MD9A 2I66A 4Q7LA 1MG0A 4U8HA 1A4RA 1S9HA 3CRQA 3LLCA 3IS3A 3NU1A 4DLSA 4CBVA 4PAQA 2PSFA 3QUCA 3DZ8A 3EFEA 4ZMRA 5C5CA 4HXGA 3UFBA 4EL0A 5C8YB 5FTNA 3IT1A 1J0DA 3NLLA 4CF7A 2B1GA 3G89A 2OLEA 4PNPA 5CDHA 4KKXB 4M87A 4YALA 5IAKA 2P9FA 4F1WA 2R7AA 3U44A 1P0QA 2PWBA 2BPOA 3GJTA 1PX0A 2BMAA 4E33A 1L1FA 3F49S 4EK9A 1G5IA 4FHCA 2ZT7A 4O08A 3V9PA 5JI3E 3EVZA 4BU1A 5L95A 3CEMA 2VYCA 2EFJA 4HP8A 3ILXA 2X8JB 1H2AS 1KHTA 1RPNA 3PPWA 2QN6A 5KTKA 4X6XA 1OXSC 1PKXA 3ZE2B 4DT1B 1HT2E 3AZPA 2G0TA 3JY6A 2PUGA 2H9YA 1QNLA 3ZDYB 3LQRA 4AJ1A 4DCSA 3RVNA 1G18A 5EHXA 2V6IA 1C9EA 2XQVA 4AF7A 2L18A 2ZT5A 3KPYA 3QXJA 3CZ4A 3FOBA 4FLFA 1GXSA 1V1RB 4HJXA 3H1TA 1FF9A 2HMYB 3SICE 4BNHA 3CTMA 4EENA 3A9SA 1G3UA 3MC1A 1A04A 4UEWA 5BOSB 4LSGA 1T6XA 2FZVA 4PQFA 2AHRA 4B3CA 1JFFA 1IAQA 1T3TA 5G3YA 2WJ3A 2IHZA 4JI7B 1CEEA 3AF3A 3CO0S 5AM5A 5GONA 2DAPA 1S8OA 1W5EA 4AIRA 2ZSAA 4PC6A 1P6XA 1SQSA 3D6MA 4NZOA 1TZKA 4EMTA 3MTEA 5A4KA 2CK3A 3HLYA 3KD3A 3A6HA 4V03A 5FO1A 4NRDA 3HYTA 5GMOA 4WBNF 2WVAA 2Z1MA 2HLDA 5JQGF 5NLLA 5JISA 4L2IB 5EYPB 1N1EA 1V48A 5A0FA 2GVDC 2P1DA 1Y5IA 2XA9A 2XX3A 1S3FA 1IM2A 2INGX 2YH2A 4F11A 4ZJYA 2EDCA 2BMVA 2ZRPA 2QX4A 3ZVLA 3QW4B 4S1NA 1JZSA 3W5VA 4EKIA 2H9IA 2ZU6A 3MM4A 4UXIA 3GU3A 1E9CA 3O95A 2WMOB 3G1UA 3PWTA 4BQNA 3UUFA 4D57A 5B12A 2ZAGA 4XUGB 3AUKA 1ZINA 1BKYA 2W6ZA 3CX4A 3OM8A 3CKMA 2IYSA 2EFGA 1I6KA 2XB4A 1FRQA 3M4JA 3PZBA 4MEBA 2YW9A 4UAJA 4BJ5A 2UZ3A 1CQIB 1N0VC 5IG2A 3RAGA 4KXWA 4TLBA 1N6PA 1MIOB 2HNBA 3ND7A 2X7XA 4YRFA 1UC9A 1DJNA 5AMXA 2IY7A 3WHKA 3IA2A 1T9KA 4JKYA 1BHSA 3EFOA 3L84A 5FR1A 5JC8A 3KWJA 4JDPA 2Z4SA 2AC7A 4G4SO 3UV6A 1KVUA 4KVZA 3D8UA 4HHEA 4M1MA 4TV8A 3H84A 4NQRA 1I0LA 3SEAA 4A92A 1AHNA 4DV7B 2PCJA 3BTUA 5K0NA 2UZIR 3C1TA 4B3IA 4CIDA 2ZP1A 3DCYA 4R1QA 3H5WA 4QUIA 3EAQA 5EMMA 2C9BA 3H11A 2IWRA 4DVGA 4EB8A 2JA2A 3QSGA 2J41A 3QU5A 4L9SA 1J20A 3AERB 3SCZA 3Q7IA 4P7FA 1RC8A 2ETVA 4FYXA 4ZICA 5IK2A 3CPSA 4JI1B 3IAM6 3LQQA 1JBKA 1SKYE 2D6FA 3GLKA 5H3CA 1CPYA 4ER7A 4DLBA 2G9VA 1RWKA 4PIVA 3CNNA 4XGIA 1TEVA 5HK8A 3T99A 3TQFA 1HMYA 1UXIA 2AXPA 3TSOA 2WMNB 4KDRA 4PQYA 3SXJA 1X15A 3WWZA 3PFHA 5CYPA 5FI3A 2BE9A 5B36A 3IIEA 3LS2A 2JFOA 1S4QA 1MB4A 3CKKA 1BE0A 4C3UA 2QJFA 2ZPUA 5IFKA 3ZGVA 6ABPA 3TLKA 1I4LD 1C1YA 4MR9A 2RB4A 3Q3VA 2V5AA 1RJ9A 5BV2P 1BXGA 2YN0A 3BBPA 1J7JA 3GJ3A 5FWAA 1XZCA 3ZHYA 4L72A 2BFOA 1AGXA 1JDPA 2OZLA 4JB3A 3SAJA 4CODB 3K70B 2VYFA 4C01A 3L0SA 3QKRA 3OJFA 1XEXB 4DMHA 3I2YX 5JSQA 1YHYA 1AB5A 3LSYA 2K5UA 4UAGA 5AM0A 5JZMA 5ADWA 3PUYA 4IIYA 2A59A 2OVFA 4KU4A 5K3FB 4W5WA 5F7ZA 1PWEA 3AJEA 3S1LA 5LQJA 3ODPA 9GPBA 2N1BA 3TGLA 4RD2A 1OX4B 5DEIA 4RDCA 1C9NA 3R3JA 4DV2B 4PZLA 1V8BA 4JLMA 4OGFA 3NHBA 3ZVKA 4R3UC 1FYFA 2H1FA 3BYZA 3NDIA 4QFCA 2ZJZA 4HRAA 3GFGA 4IJWA 5EIOA 1Q11A 2Q4BA 1P7WA 1BA2A 3DLTA 4G1EB 4KMRA 3H1PA 1T25A 1N2CA 1YVRA 1QR6A 2V7TA 3NRBA 2C2XA 3NWPA 3BIXA 1GNTA 3K9LA 1RP7A 3FJYA 4JJFA 5FOXA 4DZTA 5U9CA 2G4VA 3MWYW 2ST1A 3RUFA 5A4FS 1M0TA 2L17A 2XCUA 4P5EA 1G8HA 2Z57A 2VYVD 4CQLB 1SK9A 4F3TA 2FUKA 1HDZA 1G4AE 2B25A 2HIGA 1DZ3A 2R1TB 3GW8A 4AN1A 3F90A 2NP6A 9MHTA 1QS0A 2Y1FA 2FW1A 3COYA 1IG0A 1GP2A 4URVR 4JXZA 4JQCA 4UUNA 2WC1A 1IL0A 3B9RA 2NZVG 1VRWA 4AAYA 3BZWA 4H3VA 5GZ6A 1UJMA 1S3SA 4IR7A 1KI6A 3I30X 5JR3A 5H59A 3C2QA 3Q3HA 5B3LA 1D7AA 1UXKA 4ROSA 1ZW6A 3Q5GA 4GX5A 5BWBA 1M6NA 5KNCD 1M1UA 4D43A 1NVTA 1JHYA 4R1LA 3H16A 2OOSA 3THWA 1HH4A 2QIPA 5SY6A 2YX1A 4EHHA 2D4AA 4URYR 3OE1A 3OD5A 3PXGA 3OQ6A 3T52A 1RMTA 1WBDA 1VLMA 2AOXA 5KYTA 1GGFA 4FSDA 2CLOB 3B6MA 3GFSA 1A7AA 3QWHA 4X5OA 5CT4A 4DR1B 3JQ9A 1H3EA 1C4KA 4CL0A 1L7PA 4CDMA 1R4AA 3DVQX 4EHNA 3SR3A 1K9SA 1JE0A 1NMQA 2JLUA 1BXZA 1TLLA 3LA8A 3PGJA 1Z6XA 3DMNA 1KYIA 2IRWA 4M9RA 1XF1A 4HYQA 3PE6A 3R3WA 2WSSD 2UDPA 4Y6PA 1F6BA 1GAEO 3HA3A 4ZO7A 2FOIA 3MAAC 2LXNA 2YWGA 3U6KA 5C8DA 2JLSA 1ZM3A 5HE9A 2FEKA 4M49A 1QH8A 2QD4A 4J6EA 2XGGA 3HA7A 4LX0A 4ZQEA 4D4IA 4UOQA 1OZGA 2O3JA 4RTRA 2H85A 5CYFA 2KW5A 3UGTA 4B44A 1Z29A 4AY5A 3R7DA 3VSCA 4BN4A 1Y37A 4IHJA 3GCXA 1W34A 2EKBA 4OQNA 2G09A 2VHTA 3ETNA 1DBRA 4JOSA 1JHPA 4E3WA 1VMIA 3IE0A 3MXTA 1BJTA 2BFAA 3HB4X 1EWRA 4QLOA 3UOAB 6CHYA 4BP9A 4PZAA 1L5HB 1WBJB 1VMEA 2JLWA 2YY6A 4FFPA 3DMPA 3ENWA 2D74A 3R6WA 4PZDA 2CFSA 3MIIA 4F7WA 1ICEA 3CW8X 1G38A 2WUEA 4OXNA 3ROEA 4CTMA 4F6LA 2ERCA 4R3NA 1QH0A 1KP3A 1W19A 4L8FA 5G0SA 5G1OA 2R47A 2C4UA 4R2HA 1ESZA 2C2KA 1OTXA 3NBYC 2LDBA 4ZT3A 4OBXA 3K0BA 2E1PA 4YCLA 4P7KA 1GUDA 3M83A 4WXYB 3TG2A 2P77A 2VDWA 3MYYA 4U7HA 5BQ5A 1KQFA 1KI9A 4DN6A 4ZYXA 2ICAA 3U4DA 2WQ7A 1WUHS 1UC5B 4B3RB 3PFGA 2ADFA 3DFKA 5IXSA 1QP8A 1EFAA 3O8CA 2ZE8A 1NTOA 4O29A 2ZE6A 3GT4A 3QPWA 2ORYA 1XMIA 2NXNA 3P1JA 1XTRA 2BGJA 4RK6A 4FDTA 1ORWA 1SVNA 1ZC3A 3P2EA 1M8KA 1LPSA 3PA6A 5EJ4A 3AYXB 5B1EA 1KEKA 4ESVA 2FUNB 2G83A 1QIIA 4L3OA 2C1ZA 4CKCA 4UUAA 5LB2A 4EI2A 2FMTA 1NBOA 4TMVA 1HQCA 3S2UA 5JEDA 5K0JA 2BONA 3FPHA 3G5MA 1DCTA 5IARA 1HOXA 1UFOA 4TS3A 4IV5A 1P5FA 2YVLA 3QZUA 3PGVA 1TZJA 3QBVA 1TIKA 3D6JA 5DBOA 4WE3A 2NN3C 1GKLA 5EKUA 3SVLA 5HQ3A 1E1NA 2PSSA 1GUZA 1VHLA 2N42A 4AIIA 4WA7A 2V9PA 2H4WA 3OZBA 3L7BA 2CK3D 3FYSA 2D06A 4M60A 1Q7RA 2DY1A 1WXIA 1OLXB 2WF6A 4M0CA 4X3PA 5E1DA 2VZEA 3SZ3A 1SXHA 2ZIUB 1JIXA 1ZQ9A 1GYRA 3BL5A 3ZV6A 4BGUA 5BURA 2JFYA 3K73O 4NENA 3ZIAA 3BE6A 4F21A 3R0IA 1H1DA 4WN9B 1AQJA 4MS4B 4CTOA 2IS2A 3BIFA 1DAEA 4IJVA 2ODAA 4G81A 1V5WA 3REQB 4QT4A 3GRFA 5EJ5A 4LRXA 1XZDA 1IK6A 1G9XA 1A95A 2GJ9A 2FLVA 2SNIE 3BEDA 2QN7A 3JRXA 1UZNA 4OB8A 4UE6A 3CLUC 1BN7A 1R37A 3L1KA 4YI3A 3B82A 2H5LA 3GOQA 3AF6A 5JXWA 3R9XB 4AO8A 1V7QA 1ENYA 3NYQA 4ZFNA 4IIGA 4Q19A 4YRLA 4TV9B 3WTCA 5CPBA 2QX9A 1C14A 3IBFA 3Q3CA 2ANBA 4QVKA 5IFLA 3G68A 2G76A 4PIPA 3DOFA 9LDTA 3MF4A 3LX4A 3OICA 3TZHA 2X4DA 3D7NA 4LBYA 3IPAA 3FM9A 3IAXA 3GJ0A 3D6VA 2H18A 3GARA 2EKZA 3BDAA 1ZHFA 4ZI7F 2WSSA 3OLWA 1KJZA 4L4RA 1EGMB 5TS2A 3DZFA 1W9MA 5T64A 1E5LA 4DR2B 1OH6A 5IKEA 4FFSA 4B5KA 3LL4A 5TJHA 4OH7A 4NCHA 3HU5A 3SNHA 1QLJA 4GLBA 3WB2A 3D7MA 1Q74A 3KJXA 2Q45A 2PX8A 1WY5A 3QUQA 1A8SA 3BQ9A 5TMDA 1J0BA 5F23A 4UM9B 3KBBA 1EINA 2WABA 3RTEA 3ZDQA 4LFBB 3DUWA 2F9LA 5LZ9A 2ZR8A 3VU8A 2CNOA 2DFPA 1QRSA 2HRBA 2FQYA 5EJ9A 1IIRA 1QK3A 2VP9A 1TX4B 1BHO1 2J0EA 2VP2A 4MRMA 2ZS8A 2QM7A 2FPMA 3MA0A 2HPHA 4QPPA 3K0SA 1WBBA 4D26A 1GU1A 3S28A 2X7HA 4BXOA 1ORTA 5KO2A 1A27A 4FXPA 4MUBA 5EIXA 1VL2A 1Y82A 1EK6A 2P3QA 1G9SA 2YC2C 3MGKA 4X60A 4XQGA 4YBZA 3QSYA 1YDGA 3BWBA 1R0XA 4LF6B 1CZUA 5AYVA 1HLDA 1RRVA 2IJGX 2PUHA 4XTRA 4IEFB 1PZGA 4JENA 1ESEA 1Q0P