5EEAA

Structure of hoxb13-dna(caa) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*TP*TP*GP*TP*GP*TP*TP*TP*TP*AP*TP*TP*GP*GP*GP*TP*
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 62
sequence length 62
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eeaA00
1HLVA 4NDLA 2Y30A 1ITYA 2DA3A 2O8KA 4D7NA 2FX0A 1X2MA 2LD5A 5F0HA 1UMQA 3OSFA 2ECCA 2LLKA 4ABZA 1X2NA 5E3NA 5F27A 4FE7A 1O4XA 1ZTRA 2LKXA 5EDNA 5M3FJ 1Y1WJ 1I3QJ 1BA5A 3NARA 2X48A 1K83J 2MG4A 2XPWA 1FIAA 2HOSA 5C4JJ 1JUMA 3ZQFA 4FCYA 2X6OA 1HDDC 2ID3A 1H8AC 1IDYA 1JGGA 1TWHJ 4M3BA 3LSJA 2COBA 2M34A 2DMNA 3JRAA 1BL0A 4MLOA 2K9SA 3RZOJ 4A3EJ 2HYJA 3ZQIA 2NS7A 1PUFB 4A3JJ 1JJ6C 3NAUA 3ZQHA 1R9TJ 3RQIA 3GTKJ 2Y0SN 1NTCA 5F08A 2XGDA 1OCTC 3RZDJ 3GTMJ 2K40A 4MFEA 3SFIA 4RDUA 2P81A 2JK3A 4IEJA 1I6HJ 2ELKA 3IV5A 3HOXJ 1PUFA 1UHSA 5K7HA 1EF4A 1WGXA 2LTPA 4MO7A 4DW6A 2L7MP 3BTLA 3QPSA 1WCMJ 1RKWA 2TCTA 1JTXA 3PO2J 2KDZA 3JRDA 1IG7A 1IGNA 4A3IJ 1DU6A 5EZGA 3GTJJ 3HGGA 1JUSA 5FKLA 1F43A 1JT0A 1XC5A 5GP9A 1RESA 4W1UA 1U78A 4W97A 2NVXJ 1MBJA 5K7FA 3TP0A 1POGA 2E2HJ 3GTQJ 4A3CJ 1BW5A 1HDPA 5FLVA 2L0KA 2LFBA 5E3MA 4CYCB 3CDLA 2XSDC 3FKIJ 3BG3A 2YU9J 2KT0A 3BTJA 5K7ZA 2EZHA 2AO9A 3WHCA 4AYBN 4CYCA 4D7MA 4QIWN 5FKOA 4A3LJ 3F0CA 2H1KA 1U9OA 2DMPA 5EEAA 4C3IJ 1H89C 3LOCA 1T56A 2YS9A 1ZGWA 2ZB9A 2HQ5A 1Z0XA 4QTRA 2CQQA 1T33A 1X58A 3QPLA 3O8GA 2XGEA 5IOZA 2VI6A 4AUXA 2R5YA 2Y2ZA 1IDZA 5F0CA 2XB0X 5IP6A 1LE8A 3OSGA 3HDDA 3PO3J 4I76A 1WPKA 2XPUA 3WHBA 2RAEA 1VF9A 2DTZA 5E3LA 3BR2A 2WV1A 1IV6A 1AHDP 3S14J 3RKQA 2JN6A 1BJZA 2HXIA 2LY9A 3MN2A 1K61A 1Q1VA 3L1PA 1QVTA 2MW8A 2NS8A 1GDTA 4A3FJ 2JWTA 2B63J 1ZKGA 5EF6A 4AC0A 2HXOA 2CRGA 2XB5A 4UUSA 3UKGA 1JKOC 2DA6A 2R0QC 5M5YJ 2NVTJ 4A3GJ 3B6CA 3HBLA 3BQYA 1GVDA 3DCFA 2HOAA 2E1OA 2LK2A 3BR1A 2JA6J 1Z77A 2DA5A 3GTGJ 2WB1N 1QPIA 4FISA 1HOMA 2G0EA 2R7ZJ 4IHVA 4BBRJ 1ETQA 2Y31A 1IRZA 3G1LA 3MVPA 1ENHA 3Q0UA 5EYRA 4GFBA 2HOTA 3HOYJ 2EZKA 3FK7A 4A3KJ 3HOUJ 2L7FP 2VKVA 1RETA 4X6AJ 1RKTA 1U9NA 2EBIA 1JKPC 5IP9J 3A03A 3HM5A 1B72B 2W48A 3VPRA 3A01B 2QF7A 2I10A 2HI3A 4BY1J 1A6IA 2JA8J 2ID6A 1ETKA 2ME0A 1CQTA 4JX5A 1B72A 5J1UA 3A01A 4BKXA 1TWGJ 4J19A 2IAIA 3H3VK 2DA4A 5C4XJ 3S17J 5FJ8J 3ZQLA 2GBYA 2EZIA 3Q0VA 1F36A 2FD5A 4XIDA 3D1NI 3S1NJ 2JA7J 4M3FA 1ZR2A 4M6VA 2O7OA 3C2BA 2QCOA 4FE4A 2VPRA 2LR8A 3FIWA 1MNMC 3DEWA 4DZJA 2MSYA 2DA1A 4D5CA 5M5WJ 4G12A 4BBSJ 1MSFC 4V2FA 3OIOA 4IHXA 1ETWA 4BY7J 2R93J 4L5EA 1WI3A 1OCPA 2DA2A 2DJNA 3I4MJ 1MBFA 3HOVJ 1MBGA 4V2GA 4A69C 1DU0A 1JKRC 3JRGA 4Y52J 4B4CA 1MBHA 2LP0A 2EQRA 4B3AA 3TW6A 1WH7A 2OPTA 1GT0C 9ANTA 3Q0WA 1ZK8A 3Q3SA 1ETOA 2O9LA 4M3GA 1XG1A 3CQZJ 4A3BJ 1TWCJ 3K7AJ 1P7JA 3BG9A 2H8RA 1TWFJ 2NVYJ 4C3HJ 1JKQC 3W6VA 1HF0A 5M3MJ 2IEKA 5F0FA 3HOWJ 1SANA 5EZHA 3S2HJ 3JRHA 1UG2A 2R5YB 2JA5J 1I50J 3HOZJ 1LE8B 2K9QA 3FISA 1S7EA 2EH3A 1QVUA 3S15J 3TP3A 4B1RA 1MSEC 3BQZA 5IPAA 4M3DA 5FKNA 1GV2A 4HNVA 2D5VA 4X1EA 4Y7NJ 1TC3C 1NK3P 2OF7A 2DMTA 2E19A 2Y9ZA 3E7LA 2PMZN 3G1OA 2AHQA 3PM1A 1LFBA 1Y1VJ 4C2MJ 4UUSB 2FQ4A 5E3OA 1W0UA 3JRBA 4I6ZA 2XGCA 4MFDA 3IH4A 4DYCA 1P7IA 3JREA 4A93J 4MIMA 5HODA 2MGQA 3HB9A 3TW7A 2VKEA 1QRYA 4QSHA 4A3MJ 5BNGA 1LFUP 2ME6A 3BR6A 1ETYA 4JX6A 3LSPA 2LVSA 1ORKA 1VFCA 4JP0A 5GPCA 2X9DA 4DZPA 1ZR4A 2R5ZB 2CUEA 1RPWA 4XK4A 4FTHA 3GTLJ 1FTZA 2K9NA 3S1QJ 1FEXA 3HEFA 2R5ZA 3BR0A 3JR9A 1ETVA 1WH5A 4IHWA 3QQAA 4IHYA 3S16J 3MKLA 1JT6A 1FJLA 1H88C 3SDGA 2HDDA 5IOYA 4RBOA 1APLC 1FTTA 1MH4A 2WAQN 1IJWC 4XRMA 3OOUA 2CUFA 2M0CA 3LSRA 3IH3A 1MBEA 4M3EA 1IC8A 3JRCA 5JLWA 3ZQGA 5EGOB 3O8HA 3TEDA 2R92J 5FKMA 2DMQA 3HGYA 1JUPA 2E2IJ 2JJ7A 1XS9A 5EGOA 5IYBJ 2DA7A 5IYDJ 4JYKA 1G2HA 2DMUA 1MBKA 3JRIA 1U8BA 4C3JJ 3LSGA 1B8IB 2IBDA 3B6AA 3IH2A 3K2AA 4JX4A 4S0HB 1ZQ3P 1AKHB 3S1MJ 3GTOJ 5DTDA 3SJMA 2FJ1A 5M5XJ 1B8IA 2JMWA 2VUMJ 3BR3A 5J1RA 2M9HA 2M8GX 3FK6A 1AKHA 3JRFA 1OFCX 3S1RJ 1JJ8C 1A5JA 1GUUA 2XRLA 4UUTA 1E3OC 2DN0A 5C3EJ 2N8GA 1VI0A 3G1MA 1FIPA 1TWAJ 4XRSA 1D5YA 3H0GJ 5IYCJ 4LOCA 4EEFG 5FKKA 2TRTA 4XICA 2L7ZA 1JTYA 1YRNB 2CJJA 2XPVA 2EZLA 3BT9A 3BTIA 1GV5A 5GPAA 4D5FA 1SFOJ 2E2JJ 5IP7J 1NK2P 1W0TA 1MH3A 2YUSA 3S2DJ 2NOGA 1YRNA 2ECBA 3I4NJ 5J1YA 3ZOBA 2Y9YA 3M3YJ 5F1JA 3GBGA 1VNDA 5DS9A 1ETXA 5EG0B 3BTCA 2GM4A 1IUFA 5F04A 3A02A 3HKZN 2CQXA 2NVQJ 5FLMJ 5J3LA 5EG0A 2CU7A 1AU7A 3GTPJ 4DYQA 5C44J 2L9RA 3BG5A 2M2EA 4DYRA 3M4OJ 3LNQA 2GLOA 4XRSG 3CMYA 5JLXA 3BR5A 1RR7A 4A3DJ 3CCYA 3ZQCA 1BW6A 4BXXJ 1HCRA 1OJLA
chains in the Genus database with same CATH superfamily
4NDLA 2HVSA 2H1LA 4BJ6C 5F0HA 1J2XA 4YIRX 1WJCA 2CW0F 1FSHA 3IHUA 3OSFA 1FLIA 2DBBA 2LLKA 5CVUA 2NRAC 1ZARA 2YSRA 2EFOA 3QODA 1X1CA 5DYMA 3PNTA 1MJAA 1F1ZA 4RM2A 5M3FJ 1I3QJ 3NARA 2XPWA 3ZGKA 4YG2F 4AU7A 3ABKH 3EDPA 4Y15A 2IJLA 4YIIA 1YTYA 3O2PE 4LLGF 4E7HA 2GIVA 3U2RA 1BBYA 5C4JJ 1O7LA 3HPGA 3VB2A 5IY5H 2PG4A 2PI0A 4XSZF 1HDDC 3JSPA 4PGHA 2ZJ2A 3R6SA 2X6YA 1IDYA 1JGGA 2HQRA 5LLQA 4M3BA 4KMFA 4HOBA 1IO2A 2Z2SB 4KYWA 1ZH5A 4CCOA 1ZG1A 2M34A 4O5VA 2DMNA 4LMYA 3JRAA 4AIJA 3CF2A 2F5EA 4MLOA 3SQNA 4E6KG 3RZOJ 3ZQIA 3KYLA 2ZO4A 3PNVA 1OYYA 2D45A 4MTEA 1PUFB 2WY8Q 4ANJA 2VC1A 3H5RA 3RQIA 5LHGA 1MD0A 4J01A 2XGDA 3J80K 2K40A 4MFEA 5EJCA 2NNYA 4UXNA 2ELKA 2O6GE 1U8RA 2Q2EA 3MCZA 1EF4A 4A5MA 2CUZA 4MO7A 4KT5C 1WCMJ 4Q47A 1GXPA 2IS4A 3MKYB 4PJLA 2IGMA 1OYIA 3JRDA 3HPHA 3DKXA 3I56I 1SMTA 4UVAA 3U1DA 1R4NB 1F43A 5DDGA 2CV1A 1PYVA 5DM7F 4CXFA 3HL2A 3QU3A 2CMPA 4EMSA 4W97A 2NVXJ 1MBJA 1PUEE 3N4MA 4O6JA 4XN3A 2E2HJ 2XROA 4CUGA 2DDBA 4UB8C 2R7SA 3JAMK 2L0KA 2LFBA 1ZHFA 2AXLA 3BC8A 3CDLA 4CDGA 3S32A 2LREA 2ZXWH 1O3TA 2HQNA 1K78B 1YIJI 5F6FA 2EZHA 3IRRA 2AO9A 1UAAA 2STWA 5FLXZ 4PFPA 3WHCA 4CYCA 5K5RA 4A3LJ 5J8CA 2PMZA 4ENMA 1KU7A 4TV7A 1T0FA 3AL0C 4C3IJ 1H89C 4LIUA 1T56A 4UNOA 2ZB9A 5EEHA 5JHFA 5FFZA 2EIMH 5E18F 5CQGA 2ZC2A 2BXYA 1R49A 3DTEA 4HAMA 1W36C 1KQ0A 5JR3A 2WAEA 2O3FA 4HLXA 1HW5A 3OL4A 2JUCA 1D1BA 4FETA 5F0CA 5IP6A 4ETSA 2P7VB 3FXOA 1USTA 4N9IA 1BI0A 1IV6A 4XKVA 1O3QA 2HXIA 2RKHA 1K61A 1MW7A 1I27A 4YFKF 2BY2A 1ON1A 5LD2C 4DNCA 4DGWB 4UHTA 2NS8A 2RREA 1TT0A 2LRDA 1T08B 3O6BB 4WCGA 3U9GA 4A3FJ 4EM2A 2JRMA 1ZKGA 2M30A 1ZRCA 4AC0A 1TL8A 2QA4I 4ZDPA 2R0QC 5M5YJ 1W5TA 4KISA 3B6CA 5CVVA 4WF2A 4E7ZA 3RJPA 2XVCA 2E1OA 2IP2A 3ZCOA 2QKMB 1WHUA 2HTSA 2P7CB 2H09A 4A6EA 2VJ5A 1QPIA 4XOPA 1P4WA 5L3DA 1K6OA 3BY6A 4IHVA 4OINF 4B47A 2DODA 2BY3A 2P4WA 1KU2A 5E17F 2JUGA 3COAC 2HOTA 4G7HF 3FK7A 2CH0A 1RUOA 2BY0A 3V7CA 1RKTA 3EYYA 4MHGA 4NC8A 2V4JC 3HIFA 2GXAA 2JTVA 1L0OC 3HM5A 2A3SA 2HR3A 3KZZA 3LSHA 3VPRA 3OYGA 3KEYA 3H9QA 4L5IA 2BV6A 2I10A 3HTSB 4BXFA 1BJAA 2Q2EB 3GMEA 5CYVA 1GLNA 2ME0A 1CQTA 4JX5A 3CP8A 3LAPA 3A01A 4BKXA 1TWGJ 3S3NA 1RRJA 3I0TA 1WKMA 3S17J 3TOBA 4L9VA 1BI1A 2GAUA 2EZIA 2QSGX 5FGMA 2FD5A 4CCNA 3D1NI 3IWFA 2QWWA 5E8GA 3MMYB 2K9LA 2FUG2 2UZKA 1ZR2A 4ENKA 2L4MA 2VPRA 2LR8A 1MNMC 4DZJA 5D5WB 2X1CA 4UV8A 3GEZA 5ERIA 4D5CA 2A5WA 2XAJA 4J00A 3OIQA 3GO5A 4IHXA 2GIZA 3OYAA 2R92J 4CCLA 2R93J 2IGNA 2QYOA 1OCPA 1I39A 2ZFWA 3CTAA 3OWTA 3VOEA 4M6YA 2WY7Q 4V2GA 2VL8A 1T8IA 4A69C 3IP4B 4Y52J 3JRGA 1QHGA 3FXQA 2HYFA 3BROA 4B3AA 4AVZA 1IUYA 3B73A 2JVHA 9ANTA 2NYXA 1ZK8A 3KE2A 2FBHA 2QQ8A 2BY1A 4MTDA 2M3AA 2X51A 4M3GA 2X85A 3CJQB 5E20A 2LY1A 4BE0A 2HZTA 3K7AJ 2H8RA 1MMSA 2ZXHA 1TWFJ 3GFMA 1UELB 4C3HJ 3WG9A 3W6VA 2E1MB 4EQQA 2ICWG 5M3MJ 1REPC 3HOWJ 1D5VA 2PEXA 5GAGJ 4U88A 2C6YA 5EZHA 3S2HJ 2RVCA 3I54A 1UG2A 4ZYAA 3M8EA 1I50J 1FNNA 2DI3A 1N75A 1Z67A 3RI4A 4OIPF 1X1PA 2K9QA 3FISA 2EH3A 4RLFA 3WG7H 4KIGA 2V79A 5HLTA 3EUHC 3BQZA 1FMVA 1D0ZA 2CW8A 1R4MB 2AQFA 1IN7A 4NC6A 1V55H 2O03A 2KL4A 1TC3C 2MABA 2K27A 3BJAA 3SZPA 1NK3P 2P0WA 1UB9A 2EFQA 3RSNA 2AHQA 1VZ0A 1BOBA 5DCFA 1E0EA 3ZMUA 2IS1A 1UHWA 2OBPA 2RGVA 1Y6IA 1OR7C 2KRCA 1X4OA 3W3CA 4RB3C 4RAFA 2BGCA 4MFDA 1K4SA 4M71A 1B1BA 2UUZA 1IW7F 1OCZH 3PIPF 3K4NA 4OOIA 1MIJA 3GZ6A 4LGWA 2XUBA 4II3A 4EGZA 5ED4A 3IUOA 2VT3A 3QYFA 1N78A 5BS6A 4A3MJ 3ZN1A 2EFNA 1YJNI 1HKTA 5L3FA 1P4AA 5A2QK 1ZELA 1W5SA 5HDKA 1VFCA 2X9DA 1ZR4A 1Z05A 4BAYA 1X1AA 2DU9A 3VODA 4LLNA 2CUEA 1ZRDA 2RNGA 3ML6A 3VSLA 3S1QJ 2IW5A 3LQRA 3BR0A 3DLAA 1FOYA 2JSCA 4IHWA 3S16J 4UVBA 1JT6A 2COMA 4Y33A 3SDGA 3ZXSA 4IO9F 3W6JB 4I7HA 4XMYA 1KQ8A 3FMSA 2HU9A 5E8IA 3OOUA 4EVIA 3LSRA 3K6GA 2XIGA 3IH3A 3WGIA 3HG9A 4A5NA 2X0LA 1IC8A 2P5LC 3JRCA 4V19K 2A5YB 5JLWA 3TEDA 4H4KC 4HYEA 2FF4A 1T95A 1XGMA 2DOFA 1VQ6I 4P5OA 2EV6A 4GDFA 2CG4A 1JUPA 2E2IJ 2JJ7A 3F9KA 4YEJA 2V6CA 4DOZA 1RZ4A 1ZGAA 1XS9A 2P6TA 2BXZA 3NQOA 3HSEA 3WODF 3E6DA 4ESBA 4DJAA 3BG7A 3ABLH 5CJ9A 1WRJA 3DU5A 3LSGA 1B8IB 4R79A 3R4KA 2IBDA 2RQQA 3B6AA 5BOXA 3IH2A 3TO7A 3K2AA 1ERDA 2QUFA 1PVEA 2X6XA 1WJFA 5DTDA 3G71I 1F4KA 3ZPLA 1HQCA 2HPIA 3SJMA 2FJ1A 2ESHA 3BR3A 4OMZA 1ON2A 2M1BA 3OYEA 5ILVA 1R58A 3RIRA 2KPMA 1NHAA 1LQ1A 1RI7A 2A61A 1EKEA 3WU2C 1KQ9A 2CW7A 1FOKA 3GX4X 1GHCA 2HKOA 2MA3A 3OYLA 1GVJA 1D5YA 2LF8A 5IYCJ 1R00A 2FNAA 3OR2C 4LOCA 1UHMA 2EA4A 1YITI 1FYMA 3CO6C 1VQPI 1BN5A 4NB5A 1QA6A 1TP4A 1OPCA 3H0DA 1YRNB 2FNPA 3BPXA 2EZLA 3OS0A 5J47A 1WQ2A 1JHFA 1NK2P 2TDXA 1W0TA 3WTZA 3S2DJ 3SXYA 3A0HC 1R1TA 5TRDA 3ZOBA 3M3YJ 5F1JA 4OWRB 3BWGA 2LSOA 3QOEA 5BMZA 1VQMI 3CCMI 2NXNB 2GM4A 2F4MB 4XL9A 4PJNA 5F04A 2NVQJ 3BCBA 4HW0A 1LFPA 2V7FA 3CLQA 5C44J 2OZ6A 1B9NA 3OYKA 3FXLA 1PDNC 2M2EA 4OIRF 3PL8A 4QLCU 4MQ9F 3KIOA 4DYRA 5FD6A 3P9KA 2DOEA 5HVQC 2WA0A 3F8FA 5FB2A 4IL6C 3BR5A 2CFXA 2XDVA 3ZMDA 3ZQCA 2Y69H 1OJLA 4G8XA 1HLVA 2DJIA 2Y30A 4H0EA 2XV4S 5D4RA 3ABMH 2CQKA 3KP2A 4D7NA 1X2MA 1TT5B 1IXCA 1UMQA 1W7PD 3SYTA 3Q9VA 2A05A 4FE7A 4L9NA 4IXAA 4KICA 2KLOA 2M87A 4U0VA 3GYHX 4XKBA 2LKXA 1YIOA 1ZN2A 5EDNA 1Y1WJ 2A07F 2R7XA 3UNGC 1H9GA 3LSMA 3KCCA 2HOSA 1IV8A 1QZYA 4HDUA 1JUMA 4I09A 4BS9A 5GTIC 1FMWA 3K70D 5DD4A 1FBUA 5JFRA 2JPBA 3R61A 4OAZA 3L2WA 4A0ZA 4HNTA 2VBWA 5TGTA 1AA7A 2Y75A 4I0AA 5EEGA 3J7YJ 2JPCA 2HYJA 2NS7A 1OKRA 3DWLE 3MD2A 3A2KA 3GW2A 4A3JJ 3GTKJ 1UCRA 2Y0SN 1NTCA 3RZDJ 4NQWB 3E0JB 3I9V2 2P81A 2JK3A 4IEJA 1PUFA 2B7EA 3G3ZA 3MFKA 4FASD 4HF1A 1LPQA 2VQCA 3KP5A 3KZYA 2L7MP 3RDIA 1WJAA 2I5UA 4LJZF 1JE8A 1JTXA 3PO2J 2KDZA 1IG7A 4LFUA 3CESA 1A36A 2DFIA 2E35A 2V1DA 3ZMSA 2WADA 2ZSIB 5FKLA 1VQ9I 1FOXA 3CJTB 5HNHA 1JT0A 4A0XA 4EM0B 5E1WA 3I53A 1BI2A 1RESA 4W1UA 5K7FA 4RAGA 2HGCA 3EYIA 4XLPF 4O3MA 4IF4A 4X0GA 4KIBA 1O57A 2AXTC 4F91B 4S05A 1RIOH 4LG0B 4A3CJ 5FLVA 5J4VA 4GYGA 4ZYDA 3ABTA 3FKIJ 3BG3A 2E71A 3VYRB 2R7WA 3BTJA 3K9TA 2XF6A 2LYCA 4HX4A 1A31A 3TDUC 4N0BA 3ZQ7A 5ICGA 3P7NA 5L3EA 3WU1B 4QIWN 2VE9A 1I5ZA 2QKLB 1ZG5A 1U9OA 1BOAA 1BR4A 4BJTA 2BW3A 1K78A 2BZTA 1YJWI 1XSDA 4NC7A 4CGZA 3FKJA 1S72I 3J80Z 1XTAA 1ZGWA 1SAXA 2HQ5A 2MD0A 3A0BC 4XLEA 3AG2H 1Q1HA 4BE2A 4D9JA 2V26A 3WGGA 2PJPA 1ULYA 3M07A 3KZIC 1Z3YA 2PBIA 4PSWA 2XC7A 4CHUA 1KZHA 5HDGA 3OYHA 1ZLKA 4G9YA 4AUXA 2Y2ZA 1FBQA 1LE8A 2KDOA 1OMIA 2DYSH 2UXNA 3GLLA 3K4CA 4WXHA 2XKPA 2HVRA 3F8MA 2KIMA 4DBQA 3WHBA 2RAEA 2DTZA 2V1XA 5D5VB 1Y8RB 1AHDP 5H2FC 3S14J 2Z3YA 1C0WA 3K1MA 4GCVA 3MN2A 3SZGA 1QVTA 2M7AA 2MW8A 2M4KA 3JSOA 1LUJB 1KU3A 3B02A 3FXKA 5EF6A 1YOVB 2HXOA 2VXZA 1LVKA 1G3WA 4UUSA 3F72A 3UKGA 3QAHA 3I59B 3QPHA 4IVNA 1ONVA 4A0YA 3L2RA 3DCFA 1XGOA 5FD5A 3BR1A 3AL0B 5L3GA 1S5LC 3WTSC 3J81K 1Z77A 1EH6A 1P6RA 4M72A 2WB1N 2CV2A 2VJJA 3IAS2 1U5TC 4FISA 2IA0A 3TMOA 2W7NA 1Y8QB 3WE2A 1RNLA 3CCJI 4Y4RA 3I5UA 4U87A 2PJRB 3MVPA 2BEOA 3HOYJ 1MDMA 2VQHA 5JVGF 1YW9A 2L7FP 2VKVA 1WSUA 3REOA 1OCCH 1RETA 4PUSA 4AM3A 4PFOA 3W6KB 2ELJA 2MC4A 1B72B 1P9QC 3CCUI 2QF7A 1G8XA 4LIVA 2BHYA 2HI3A 4B3XA 1A6IA 3OYBA 2NAZA 2JA8J 3HSFA 4JOMA 1RUNA 3QU6A 3BOQA 1CGPA 1G3SA 2KMUA 4ZJZA 1HW1A 1Z3XA 2KJCA 1LVAA 4MEYF 2KKOA 1IRXA 1SFUA 4BQQA 1XGNA 5D4SA 2O7OA 4YRVA 1FP1D 4CH7A 2LH9A 3N05A 3D5SC 2DA1A 1DUXC 1VQKI 3DP7A 1S7AA 3RYRA 5M5WJ 1R1VA 1XD7A 2LKPA 2MC3A 2DDAA 2R4GA 3K0LA 3OIOA 4BBSJ 1XMXA 3CMMA 3S2WA 1HW2A 3KYDB 2L4AA 2O8XA 2YU3A 5BPDA 1MBFA 3NEUA 4Q4ZF 3ESWB 1SVLA 2XHKA 4AWXB 4E7SA 1DU0A 1JKRC 3DLLF 3RKWA 2BW3B 2QENA 2LP0A 5B5EC 2Q1ZB 3PQKA 3TW6A 1K79A 2K3PA 1YX3A 4JBAA 2M8EA 2R7TA 1ETOA 3CCVI 4I01A 2PMHA 4RAYA 5JHUA 4EJTA 1B4AA 4A3BJ 1TWCJ 1P7JA 3T8RA 4RGXA 3HKZA 2ISYA 1X3WB 2IEKA 1QGPA 3TL4X 4G6TB 4JK1X 1HXDA 4IRHA 4M9XA 1CF7B 3GFIA 5K1YA 1TNTA 3CUQC 4EGYA 3EUAA 3FMRA 4IRIA 1YE9A 2HZDA 3HOZJ 4ITVA 1LE8B 2CYYA 5FO5A 3T0YA 3TP3A 4IHTA 2HYGD 2L5QA 3E5UA 3MWMA 4UB6C 4IOAF 1GV2A 4HNVA 3L2QA 4X1EA 1MGTA 3FMQA 2IPQX 4XRFA 1N77A 4DBRA 3V8LA 2JZYA 3E7LA 4Y13A 2B0LA 3E6BA 3ECHA 4WXDA 3V8JA 3PM1A 1LFBA 4C2MJ 4UUSB 4D1QA 3G4SI 2M4GA 3MKZA 3JRBA 5D5UB 4I6ZA 3L09A 2EFPA 2ZFUA 5GAEJ 1P2FA 5D6FA 3X2QH 2A6HF 2KJBA 2H27A 4DYCA 2EIKH 1P7IA 3M9AA 3ZMVA 3DFGA 2E60A 3ONQA 3UR3C 2H6BA 3JREA 5HODA 2MGQA 3HB9A 1VQ7I 3F8CA 4QWQA 4RA2A 3K4KA 1SAUA 2ETHA 1LFUP 1Z6TA 3DKWA 2Q0OA 3BR6A 2QQAA 2KQRA 1ETYA 4JX6A 3LSPA 1W7PB 1MDMB 2LVSA 3ROUA 3F21A 1F9NA 3CDHA 5KK1A 5GPCA 4DZPA 2QSFX 2R5ZB 2D1VA 1MNDA 3OL3A 2E7XA 2V6EA 5L3BA 2MH9A 3GTLJ 4FTHA 2WWYA 1FTZA 1QO0D 5CLSA 1G3YA 3LSIA 4HBLA 4FX4A 1BI3A 3GZNB 3F8BA 1H88C 4LK0F 3ERMA 2ZMEA 5IOYA 1QPMA 2GA1A 1VQOI 4RBOA 5JI6A 3EUKL 3KLOA 4G7OF 1FTTA 1FBSA 3I55I 4RM3A 2CUFA 3ZQQA 2M0CA 1WJBA 2PX9A 3WTTC 1FP2A 1QBJA 2B9SA 1I3AA 3ZQGA 5EGOB 1FX7A 1OQYA 3J7ZI 4HEA2 4RMNA 3E3VA 1IRGA 2HFHA 3HRTA 5IYBJ 2PMUA 2EFWA 5A2QZ 4XLFA 2VC0A 2E1CA 2GWRA 1G2HA 3GLXA 1MBKA 2E5NA 1U8BA 4B48A 2HDCA 1S3JA 1XSVA 2OJED 3CJRB 1YS7A 1AWCA 1X1DA 1LNWA 1ZG3A 3O3KA 4G6DA 4S0HB 1ZQ3P 3GTOJ 3E5QA 1ACIA 4ASNA 2EB7A 3R0AA 1B8IA 1B6AA 1J7KA 2M9HA 2W85A 1ZLJA 3LL7A 3WGHA 5DUKA 3FK6A 1N25A 2R7DA 1FOWA 2W25A 3V8KA 3S1RJ 1JJ8C 1A5JA 4CCMA 3FX3A 3FBIB 2P6SA 4N4NB 5C3EJ 3TKYA 1OCRH 3HRSA 4U0YA 3TBIA 4MEXF 1EH8A 1MKMA 2Z5UA 3H0GJ 1L3LA 1Z21A 2RDPA 3C1DA 4HQEA 1VQ5I 2TRTA 3QYBA 4LITA 3M8FA 4WWCA 2R7QA 5LRSA 2XAQA 4XICA 2OCCH 1IAWA 2CJJA 1JI8A 3CZ6A 3BTIA 4LB6B 1XMKA 3CF5F 1SFOJ 2E2JJ 5AIQA 2YUSA 3SHFA 1YRNA 2ECBA 2LNBA 2VN2A 5J1YA 3GXOA 3BPVA 1D1AA 1VNDA 1XN7A 5EG0B 3BTCA 2R7FA 1TW2A 3KFWX 5FLMJ 1AU7A 2CFOA 3GTPJ 2O5RA 3ZRGA 4BYYA 2DAOA 3Q5FA 3SFZA 5B1AH 1I1GA 1R36A 4I02A 3C18A 2D1HA 4OIQF 4XR6A 3CMYA 3SEZA 1EJ9A 2G9WA 2ISZA 1RR7A 3MZHA 3CCYA 3ASNH 2OA4A 1BW6A 1UFMA 2HNHA 3KYCB 5J4YA 3LA3A 3OYJA 1LB2A 1HCRA 4I2OA 4XLNF 1ITYA 4ENJA 2O8KA 1OLTA 2BVMA 3VSKA 5K5OA 1MNEA 1XCBA 3AAFA 3OYFA 1J0RA 2RV8A 5AONA 1IN5A 1MMAA 2BHZA 3MZ8A 1M1EB 4CO8A 3CCQI 2ECCA 4ABZA 3ISPA 4M9ZA 5F27A 5E3NA 1BIAA 2GOXB 2ZMEB 1W36D 1BA5A 2MG4A 2LC2A 3IKVA 3S3MA 1H9TA 1SD7A 5ICEA 3WTXC 4KDPA 4AVPA 1YW7A 4HG2A 3TDZC 2KFDA 3DEEA 3ZQFA 2VBXA 3K1NA 4U0WA 5HS7A 2HKXA 4BDYA 2VODA 1E3HA 2X6OA 4ZC3A 1O3SA 2ID3A 3EPZA 3PUFA 1H8AC 1VQNI 1T0FC 2QQBA 3CC4I 3CMEI 3QP5A 2ELHA 5CKTA 2W00A 1SD5A 3CDIA 4IQJA 4DIQA 3BLYA 4A3EJ 5KAFC 5HLGA 3ZQHA 3C7JA 1R9TJ 4N9HA 4CCJA 3RKYA 3FWEA 3MKWB 2X1DA 2W4SA 2E1MC 3ZP5A 3GTMJ 1BR1A 3SFIA 3WTVC 1MMGA 4Z6YA 3WTWC 2XAFA 3GUDA 4JQFA 3IV5A 3HOXJ 5L3CA 5K7HA 1DGWY 1WGXA 2LTPA 3N97A 4DW6A 3BTLA 4OMYA 4NQWA 1RKWA 3L2UA 2FRHA 2M5WA 2CV0A 3RKXA 1T6SA 4M9SA 1YI2I 3RYPA 1IGNA 1DDNA 2NOJB 5J40A 4A3IJ 4F55A 3FHZA 5EZGA 5D5XB 4YFNF 3HGGA 1JUSA 4XKCA 1TQMA 3H9GA 4C2UA 3IKTA 1Y0NA 1U78A 4ON0A 3DXJF 4ZDLA 4ZYGA 5TJJA 3LAJA 3GTQJ 4BQAA 3OYMA 1HDPA 1IN6A 5E3MA 3M8JA 4B43A 2YU9J 2KT0A 3IC7A 4CZZA 2O0YA 3W2WA 4LG0A 1FSEA 4AYBN 2LG4A 2QBYB 5FKOA 2ZSHB 3BCAA 3IAM2 2H1KA 3HUGB 1IN8A 1B9MA 2L9VA 2QZ8A 1T38A 2DMPA 4KNYA 2BVLA 3DTKA 4IHSA 3DPTA 5LBQA 1Z0XA 3LMMA 4QTRA 2YPRA 2CQQA 2HTJA 3BZCA 2XGEA 3A1YA 3V7SA 1E2XA 1BC7C 3HJEA 2L9NA 5IOZA 2K5CA 2GXGA 3H3ZA 2JT1A 2R5YA 1D0XA 1IDZA 1VQ4I 2XSJC 2Z33A 1WI9A 2DYRH 4G94A 2HOEA 3CCLI 3OSGA 3RPQA 4I76A 1WPKA 4E4HA 3PO3J 2CUJA 3H92A 1KYZA 1VF9A 5KCMA 1SVMA 3RKQA 4CCKA 2JN6A 1TQPA 3EQLF 2VKDA 4XONA 4ZTFA 1GDTA 3OYIA 3G2BA 4HNUA 2ZJQF 1D8JA 4BH9A 2JWTA 2P5VA 3QWLA 2QLZA 2XB5A 2AQEA 3A4CA 2NVTJ 5DD8A 1YHQI 3DF8A 3RPUD 3OYDA 3BQYA 1SC7A 2VONA 2F4IA 3CO7C 1QZZA 2DA5A 3OY9A 2QM3A 3OS2A 3I59A 3OR1C 2G0EA 3VDXA 2R7ZJ 3EETA 1WFXA 1XGSA 5FFXA 2FU4A 4QPQA 1IRZA 1ENHA 4EJOA 4EV0A 4GFBA 1KYWA 1X4PA 2EZKA 4XNFA 1TQIA 3HOUJ 2BBYA 1V5GA 3BZ6A 5DCMB 2PJRA 4X6AJ 4RGUA 1LDDA 1U9NA 2CO5A 1Z6RA 2EBIA 3FXMA 4RB2C 2W48A 1V5EA 4HRIA 4KIFA 3ZN0A 2EIJH 2QQ9A 4BY1J 3F6VA 3GFLA 2ID6A 3PIOF 1A6QA 1B72A 1XMAA 4ESFA 4EJVA 3MQ0A 4J19A 2IAIA 2P5KA 3QYEA 2DA4A 1OCOH 4KMUX 1ZREA 1E17A 2X6WA 2K86A 5FJ8J 3ZQLA 2LF7A 2GBYA 1XPXA 4XIDA 3J7AY 3P5JA 1W5CC 1YQAA 3GCMA 2A6TA 1R1UA 3S1NJ 2G7UA 1HA8A 2W57A 3AG1H 3GZ5A 4YELA 4M6VA 4XQFA 3C2BA 4FE4A 2XKOA 3J81Z 1UJ8A 3FIWA 3DEWA 4FT8A 4HLYA 4NBQA 2V9PA 2F48A 1MSFC 4KN4X 1S6LA 1U5TB 4AYBA 2EJRA 2OTJI 4BY7J 4HF0A 2F2EA 2H8WA 3H35A 1WI3A 4L5EA 2DJNA 3FXUA 1YYVA 3BJ6A 3HOVJ 4MGRA 3I64A 1Y56A 4Q48A 4B4CA 1MBHA 2EQRA 4M6XA 3HHHA 4L9TA 2OPTA 2JQ7A 1DQUA 3Q0WA 1D1CA 2O9LA 4GO1A 2ADUA 1X19A 2V9KA 1WJEA 4ENNA 4I98B 4UY8I 1IXSB 3QPTA 4OIOF 3KETA 4BXUA 5B3SH 4BDZA 1STZA 4GGGA 4Y17A 1U2WA 2W24A 1LKXA 3LSTA 1YS6A 1JKQC 2L01A 2PLYA 5GADJ 5F0FA 1LDKB 1R5HA 3R0JA 2R5YB 4AIKA 2JA5J 3SZTA 2L7KA 4F92B 4RAZA 2NNNA 2BE5F 1S7EA 1S29A 1QVUA 3H9JA 1I1SA 1CF7A 3S15J 5DV5A 1FZPB 5D8LB 1MSEC 3S3OA 3GWZA 2KIUA 3V42A 5IPAA 4BEHB 3K4BA 3ZR8X 3VYSB 1J09A 1D8KA 3FDYA 4LD5A 2OF7A 1TTYA 2DMTA 2RN7A 2Y9ZA 2GQQA 4M74A 2PMZN 3W2AA 1T98A 3MZYA 4XKWA 2W84A 5DUIA 5E3OA 1W0UA 5FRNA 1V3FA 1Z7UA 3C2GA 3KLNA 4KA4A 2V9VA 5ICFA 4G7ZF 2VJIA 3H3UA 3T1BA 4A93J 3NWSA 3ULQB 5GAHJ 3QOPA 3TW7A 2HVQA 2JRTA 3HSRA 2VKEA 4HDVA 3LA7A 2ME6A 3DPUA 5KAIC 2DK8A 1TW3A 2ZKZA 1A35A 4P9FA 3S8PA 2V1UA 3IL2A 4BL0B 3HC7A 2DPUA 3CUQB 1Z91A 3K4JA 1HKSA 2IRFG 2Y0SA 1W7PA 3PFIA 4L9JA 1VQLI 1WJ5A 2K9NA 5H20A 3RPUA 1FEXA 3HEFA 2R5ZA 4QPOA 2VOPA 3JR9A 1ETVA 3MEXA 1SEUA 1B59A 1LDJA 3QQAA 3MKLA 3PJRA 4IHYA 4PJ0C 3D0SA 1PP8F 1HKQA 2HDDA 2NVUB 2IGKA 4MNUA 3EUHA 1WJDA 4R8HA 1APLC 1MH4A 2MD5A 2WAQN 4FX0A 3VWBA 3JW4A 1J59A 1MZBA 1MBEA 4M3EA 2JSPA 4UV9A 1TZLA 3Q9SA 2EINH 2K4JA 1GXQA 2WBMA 1HBXG 3GFJA 3HGYA 2R7VA 1XB4A 5DEQA 4BQOA 4HZFA 1OR7A 1FWZA 1KU9A 1OYWA 2VB6A 5EGOA 4ESJA 2DA7A 1G4DA 1BC8C 1FPQA 2ZXJA 4JYKA 2KISA 2DMUA 4BNCA 1V4RA 1VTNC 1D3YA 1UZCA 3S1MJ 3WTYC 1AKHB 4ZYHA 4WK8F 5J8FA 3L9FA 4BGDA 2F5CA 2JMWA 5KHDA 2KIQA 2VBZA 1H0MA 1VQ8I 2R7RA 4HF2A 4KITB 2HS5A 4A2UA 1OFCX 2ZXIA 1HC8A 4LLLA 2YX4A 1FYKA 4B09A 1GUUA 1TLHB 2XRLA 2OAZA 5E1ZB 4BE1A 4RB1A 1LEAA 1VI0A 2QGUA 1F5TA 3TQNA 5HLIA 2UXXA 2GZWA 3WTUC 3L2CA 1ZRFA 4XRSA 3CC7I 3F6OA 2Y0MA 2A6EF 4ZYEA 4P9UA 3DBLB 4RGSA 1K6YA 3CCRI 5CVRA 4EEFG 1QZEA 2VASA 4BJ5C 4BHBA 4BU2A 1P92A 1GV5A 2ZCWA 4D5FA 3HOSA 3LFKA 2J5PA 2ACJA 5ILSA 4BACA 1MH3A 2ESNA 4ZTJA 3I4NJ 4XM3A 4KFCA 1ZAOA 2K3FA 3GBGA 3P9IA 3KPHA 4KJZA 1ETXA 5DS9A 4IZZA 4C9YA 3GF2A 2M7BA 5H6QA 2MLGA 3KEOA 2RC4A 4IPAA 2KZGA 3A02A 1R6RA 2WB1A 3CC2I 3H5AA 5J3LA 5EG0A 2ZBKA 2GA2A 2FEZA 4DYQA 3BG5A 2G7HA 4Z2YA 3P9CA 5D8KB 1MMNA 2P8TA 3FZVA 4RS8A 2GLOA 5JLXA 1ODDA 1SMYF 5TISC 4BXXJ 3DQVC 2DA3A 3BJOA 1FT9A 1V54H 2FMYA 2FX0A 2LD5A 4U7BA 3KP7A 3G73A 2L54A 2R7OA 2KRFA 3H5NA 2JVGA 2OCEA 1X2NA 2WTEA 2DQRA 1O4XA 1IZ1A 1SFXA 1ZTRA 1YLFA 2EA2A 2WAQA 1KA8A 2K85A 3H36A 2X48A 2OQRA 1K83J 2V1NA 1DGRM 3KP6A 3PSFA 3QRFF 3SDBA 5LRRA 1T39A 1LEBA 1FIAA 4YFXF 3V4GA 2E36A 3E6MA 3KP4A 4PCQA 1U6GA 5LGUA 4FCYA 1O7FA 3CCSI 2FMLA 1XCVA 2DPDA 1IXRC 2FBKA 3DU6A 1SD4A 1Z9CA 1TWHJ 2R7UA 5E79C 3OYCA 3LSJA 2COBA 2FE3A 5IT9Z 4P96A 3PUBA 5FLXK 2GXBA 1YW8A 3M1EA 3ZMTA 1BL0A 2K9SA 2LMDA 3HYIA 5J6XA 3G6EI 2RNJA 1KGSA 2HEOA 2CQ7A 1JJ6C 3NAUA 3T5XA 4B44A 2IXSA 5F08A 1OCTC 1WWXA 4RDUA 1I6HJ 1SFKA 2D2WA 5LGTA 1UHSA 2J5OA 5HLHA 5HNFA 5GTHC 4LG3A 5CVIA 2K02A 3QPSA 3NWTA 2TCTA 4XBFA 5E1XA 2E1NA 2KIFA 3FM3A 3HTUA 4A6DA 2ZNYA 2HPMA 1DU6A 3GTJJ 3H1CA 3K4MA 5LEJA 4MQVA 1DPRA 1XC5A 5GP9A 1R5ID 3ABUA 3TP0A 1POGA 1BW5A 4CYCB 3RQ4A 2XSDC 4UUVA 4ZZDA 3JCUC 4ZDOA 2VKHA 5K7ZA 4HA8A 1EV7A 2DTRA 3LA2A 1NH3A 3I4PA 4D7MA 2DQLA 4HSRA 2CWEA 3LFUA 3F0CA 2HQAA 3E1SA 3FF5A 4XLHA 3E5XA 2AS5F 3GVAA 5EEAA 5K5QA 2IA2A 3LOCA 2QBYA 2YS9A 2VBYA 3BG6A 3HUGA 5HOOA 2PQ8A 2F4OB 3KEQA 2RQPA 3M7GA 1T33A 1EA3A 1X58A 3QPLA 4PJMA 4CZCA 3ERED 3O8GA 1R7JA 5FROA 4E7IA 2W1OA 4UVCA 5CQEA 3V7RA 3F23A 1BR2A 2CQNA 3OIPA 2MFZA 4CYDA 4WXCA 1JXSA 2VI6A 2PFBA 2BYVE 2MH2A 4F7ZA 5FRMA 3CJNA 3AG3H 2XB0X 4AIDA 5IT9K 3DBHB 1X3ZB 3HDDA 2DFFA 5H6RA 3K1PA 2XPUA 4FQGA 3LSKA 1FY7A 3K70C 3HOTA 5E3LA 3BR2A 2WV1A 2CS3A 4EATA 3E6CC 2Y48A 2VPLA 1BJZA 2LY9A 2OC6A 3TO6A 2F5DA 1Q1VA 3L1PA 2VIXA 4K2EA 1JGSA 2DFHA 1YG2A 3AKZA 3OS1A 4NUBA 4IOCF 4CICA 4GRIA 3PQJA 2L02A 2WV0A 3FM5A 5DM6F 3F3XA 2B63J 2CRGA 2IA1A 1JKOC 2DA6A 4A3GJ 3HBLA 1GVDA 4AD9A 1MMDA 2HOAA 2LK2A 1AOYA 2JA6J 3PSIA 2STTA 4S04A 1S7OA 2LBFA 2QEXI 3IWZA 3GTGJ 2UWMA 1HOMA 4FHTA 2Z16A 4M73A 1LJ9A 4BBRJ 1ETQA 2ZNZA 1S8NA 1EH7A 2Y31A 4L5JA 2IVMA 2IS6A 3G1LA 2XAUA 3Q0UA 4Q5SF 5EYRA 4F52A 2DLLA 4PSXA 3QP6A 3C3WA 4A3KJ 3F8NA 2VLAA 1U3EM 1Z1DA 2E5ZA 1JKPC 2OUMA 5IP9J 3A03A 2WC2A 1T2KA 1X1BA 5LHHA 3A01B 1RC9A 2EK5A 2KHMA 3DBRB 4NHJA 2KRHA 5DCMA 4XOTA 1V5FA 4L0ZB 1G3TA 1ETKA 1DPUA 4IKFA 1USSA 5J1UA 4XLCA 4RLQA 1X3UA 2FOWA 3HZJA 3H3VK 1UG0A 3CP2A 2Z9OA 1FYLA 5C4XJ 2IS2A 4XLAA 1JHHA 3Q0VA 1XDUA 2FXAA 1F36A 2VJ4A 1R5GA 3DTIA 3HRMA 4EJWA 2HWVA 2JA7J 1R23A 4E7JA 1OISA 4M3FA 3TOAA 2QCOA 4AIHA 5KVRA 3AG4H 2XAGA 2A69F 2MSYA 4Y3OA 3ASOH 1E3PA 1IRFA 4G12A 4V2FA 2EV5A 3OMYA 1ETWA 4RB0A 4R1HA 5CPRB 2L2OA 4B8XA 2DA2A 3I4MJ 2L3DA 5HS8A 4U7DA 3FXRA 1MBGA 1U5TA 2VQGA 4KN7X 4PZJA 4I0BA 5HDNA 2XAHA 2OU2A 4HV5A 3DPLC 2XF5A 4L0YB 2FSWA 1DP3A 1WH7A 1GT0C 4GYIA 3Q3SA 2F5FA 3KX2A 4C2TA 1YFHA 4E7KA 1XG1A 3CQZJ 2LKSA 2L9SA 3CD6I 4CSWA 2OD5A 3BG9A 4F3QA 2ZJPF 3HRUA 2F6CA 2NVYJ 3K4LA 3MAJA 2EPFA 1HF0A 2F5VA 2WAFA 3DEUA 3C2HA 3PNYA 1Z7LA 1SANA 2E34A 2O61A 4PK4A 2DK5A 3JRHA 4D0PA 4YIFA 3ELKA 3J7AO 2EILH 4DQ2A 4HV6A 2ZMEC 3OYNA 4B1RA 2QSHX 1G59A 2NS0A 4PJJA 4M3DA 5FKNA 2K4BA 3L00A 3KP3A 3BZKA 2D5VA 3VYUB 1IF1A 2KZVA 1QNTA 4Y7NJ 1R22A 1YJ9I 2YR2A 2E19A 4HX7A 4BEHA 3G1OA 1Y1VJ 5HS9A 2FQ4A 3CUOA 2DXIA 4PGGA 3VYTB 3M1CA 4BUPA 3ZMZA 2XGCA 4P1WA 2Z99A 4IX7A 3TGNA 2LBFB 1MJBA 1I6XA 1WVRA 4OU0A 2X1EA 3IH4A 3VFZA 1J5YA 1W1WE 1Y0UA 2UV1A 2OTLI 4I99C 4MIMA 5CVJA 3AFHA 2W82A 2QVOA 4ZZLA 1QRYA 4QSHA 5BNGA 3D5RC 3U21A 3L7WA 2K7LA 1SFEA 3RCOA 5BQTA 1TNSA 2VOOA 4E7LA 5LFAA 2ZJRF 2A68F 3FBNB 3I58A 1ORKA 1NG6A 2MLKA 4GXOA 4JP0A 3U1KA 1QU3A 2E7WA 3CLOA 5JVTA 5KNLA 1R71A 3BDDA 2LOOA 1RPWA 5ILUA 4XK4A 4RGRA 4C30A 4A12A 2X4HA 3K10A 3CMAI 4HPQA 3CUQA 2OZUA 4HSTA 1XSXA 1HSTA 1WH5A 2CGPA 1ZGJA 2EWNA 1U0JA 1IN4A 4II2A 1FJLA 2DO7A 3OV8A 2DCEA 1BM9A 2EV0A 3E97A 5B1BH 3K2ZA 3S93A 2LDUA 1IJWC 3DKYA 4XRMA 4EJUA 4L18B 2K9MA 2FQ3A 1HSJA 4BQNA 3JTGA 1PP7U 3F22A 2VXDA 4ZH4F 3O8HA 3T8TA 2VT2A 2IGOA 2DMQA 2FOKA 4XSXF 5FKMA 4EM1A 1D0YA 2M0MA 2M45A 3IRQA 3I3LA 5F1RA 2XF7A 5LHIA 1FC3A 4NNJA 2DOAA 3I71A 1K4TA 4WX9A 5IYDJ 3BP8A 5F64A 3ECOA 4N4OB 3SEQA 3JRIA 4C3JJ 2DT5A 3HXLA 3K69A 1PJRA 2LY2A 2XRNA 4LK1F 1XDSA 4JX4A 1WZ2A 4IQ4A 2VE8A 2R3SA 3WE3A 3WU0A 5M5XJ 2VUMJ 5J1RA 2H94A 3W2VA 3L2VA 1S9HA 4IRGA 1QQIA 2M8GX 2YX7A 1AKHA 6PAXA 4BHPA 3JRFA 4PDKA 5LGNA 2IT0A 4XN0A 1J9IA 1QHHD 4UUTA 3RTRA 5IT3A 2DN0A 4IJAA 4CA0A 1E3OC 3R60A 1A04A 2N8GA 2GOMA 3G1MA 1ZYRF 3DV8A 1FIPA 3HHGA 2KP6A 1K7AA 1TWAJ 4HQMA 4LB5A 1YO5C 5ICCA 3TO9A 5BPIA 4KUMA 3NRVA 3OOPA 2VQLA 1TBXA 3FHNA 3D5LA 2JA2A 2DW4A 5FKKA 3FXJA 4E70A 4OAYA 1SD6A 1W4MA 2Z1DA 1KONA 2MBFA 2Q8KA 2L7ZA 2XASA 1JTYA 1G6NA 5B66C 2XPVA 2DT7B 3BT9A 5GPAA 1DP7P 4F93B 1O3RA 4G6QA 5IP7J 4P55A 2OV7A 1P4XA 2PN6A 2BOLA 2XGXA 2H6CA 2FA5A 2NOGA 2Y9YA 1SVOA 1YX5A 3JTHA 2I8DA 3PFYA 3VEPA 1IUFA 3LQQA 2DFEA 1Y39A 1BIBA 3HKZN 2CQXA 1J75A 2OQGA 1RR8C 4BHCA 2DT6A 2CU7A 4HX8A 3LWFA 2FBIA 2L9RA 4KT6A 2HDWA 3CCEI 5D6EA 1NG7A 1MJ9A 3M4OJ 2MYSA 3LNQA 1XX5A 2CSOA 4XORA 4XRSG 3JAMZ 5AIPA 4A3DJ 5LEKA
chains in the Genus database with same CATH topology
1HLVA 4NDLA 2Y30A 1ITYA 2DA3A 2O8KA 4D7NA 2FX0A 1X2MA 2LD5A 5F0HA 1UMQA 3OSFA 2ECCA 2LLKA 4ABZA 1X2NA 5E3NA 5F27A 4FE7A 1O4XA 1ZTRA 2LKXA 5EDNA 5M3FJ 1Y1WJ 1I3QJ 1BA5A 3NARA 2X48A 1K83J 2MG4A 2XPWA 1FIAA 2HOSA 5C4JJ 1JUMA 3ZQFA 4FCYA 2X6OA 1HDDC 2ID3A 1H8AC 1IDYA 1JGGA 1TWHJ 4M3BA 3LSJA 2COBA 2M34A 2DMNA 3JRAA 1BL0A 4MLOA 2K9SA 3RZOJ 4A3EJ 2HYJA 3ZQIA 2NS7A 1PUFB 4A3JJ 1JJ6C 3NAUA 3ZQHA 1R9TJ 3RQIA 3GTKJ 2Y0SN 1NTCA 5F08A 2XGDA 1OCTC 3RZDJ 3GTMJ 2K40A 4MFEA 3SFIA 4RDUA 2P81A 2JK3A 4IEJA 1I6HJ 2ELKA 3IV5A 3HOXJ 1PUFA 1UHSA 5K7HA 1EF4A 1WGXA 2LTPA 4MO7A 4DW6A 2L7MP 3BTLA 3QPSA 1WCMJ 1RKWA 2TCTA 1JTXA 3PO2J 2KDZA 3JRDA 1IG7A 1IGNA 4A3IJ 1DU6A 5EZGA 3GTJJ 3HGGA 1JUSA 5FKLA 1F43A 1JT0A 1XC5A 5GP9A 1RESA 4W1UA 1U78A 4W97A 2NVXJ 1MBJA 5K7FA 3TP0A 1POGA 2E2HJ 3GTQJ 4A3CJ 1BW5A 1HDPA 5FLVA 2L0KA 2LFBA 5E3MA 4CYCB 3CDLA 2XSDC 3FKIJ 3BG3A 2YU9J 2KT0A 3BTJA 5K7ZA 2EZHA 2AO9A 3WHCA 4AYBN 4CYCA 4D7MA 4QIWN 5FKOA 4A3LJ 3F0CA 2H1KA 1U9OA 2DMPA 5EEAA 4C3IJ 1H89C 3LOCA 1T56A 2YS9A 1ZGWA 2ZB9A 2HQ5A 1Z0XA 4QTRA 2CQQA 1T33A 1X58A 3QPLA 3O8GA 2XGEA 5IOZA 2VI6A 4AUXA 2R5YA 2Y2ZA 1IDZA 5F0CA 2XB0X 5IP6A 1LE8A 3OSGA 3HDDA 3PO3J 4I76A 1WPKA 2XPUA 3WHBA 2RAEA 1VF9A 2DTZA 5E3LA 3BR2A 2WV1A 1IV6A 1AHDP 3S14J 3RKQA 2JN6A 1BJZA 2HXIA 2LY9A 3MN2A 1K61A 1Q1VA 3L1PA 1QVTA 2MW8A 2NS8A 1GDTA 4A3FJ 2JWTA 2B63J 1ZKGA 5EF6A 4AC0A 2HXOA 2CRGA 2XB5A 4UUSA 3UKGA 1JKOC 2DA6A 2R0QC 5M5YJ 2NVTJ 4A3GJ 3B6CA 3HBLA 3BQYA 1GVDA 3DCFA 2HOAA 2E1OA 2LK2A 3BR1A 2JA6J 1Z77A 2DA5A 3GTGJ 2WB1N 1QPIA 4FISA 1HOMA 2G0EA 2R7ZJ 4IHVA 4BBRJ 1ETQA 2Y31A 1IRZA 3G1LA 3MVPA 1ENHA 3Q0UA 5EYRA 4GFBA 2HOTA 3HOYJ 2EZKA 3FK7A 4A3KJ 3HOUJ 2L7FP 2VKVA 1RETA 4X6AJ 1RKTA 1U9NA 2EBIA 1JKPC 5IP9J 3A03A 3HM5A 1B72B 2W48A 3VPRA 3A01B 2QF7A 2I10A 2HI3A 4BY1J 1A6IA 2JA8J 2ID6A 1ETKA 2ME0A 1CQTA 4JX5A 1B72A 5J1UA 3A01A 4BKXA 1TWGJ 4J19A 2IAIA 3H3VK 2DA4A 5C4XJ 3S17J 5FJ8J 3ZQLA 2GBYA 2EZIA 3Q0VA 1F36A 2FD5A 4XIDA 3D1NI 3S1NJ 2JA7J 4M3FA 1ZR2A 4M6VA 2O7OA 3C2BA 2QCOA 4FE4A 2VPRA 2LR8A 3FIWA 1MNMC 3DEWA 4DZJA 2MSYA 2DA1A 4D5CA 5M5WJ 4G12A 4BBSJ 1MSFC 4V2FA 3OIOA 4IHXA 1ETWA 4BY7J 2R93J 4L5EA 1WI3A 1OCPA 2DA2A 2DJNA 3I4MJ 1MBFA 3HOVJ 1MBGA 4V2GA 4A69C 1DU0A 1JKRC 3JRGA 4Y52J 4B4CA 1MBHA 2LP0A 2EQRA 4B3AA 3TW6A 1WH7A 2OPTA 1GT0C 9ANTA 3Q0WA 1ZK8A 3Q3SA 1ETOA 2O9LA 4M3GA 1XG1A 3CQZJ 4A3BJ 1TWCJ 3K7AJ 1P7JA 3BG9A 2H8RA 1TWFJ 2NVYJ 4C3HJ 1JKQC 3W6VA 1HF0A 5M3MJ 2IEKA 5F0FA 3HOWJ 1SANA 5EZHA 3S2HJ 3JRHA 1UG2A 2R5YB 2JA5J 1I50J 3HOZJ 1LE8B 2K9QA 3FISA 1S7EA 2EH3A 1QVUA 3S15J 3TP3A 4B1RA 1MSEC 3BQZA 5IPAA 4M3DA 5FKNA 1GV2A 4HNVA 2D5VA 4X1EA 4Y7NJ 1TC3C 1NK3P 2OF7A 2DMTA 2E19A 2Y9ZA 3E7LA 2PMZN 3G1OA 2AHQA 3PM1A 1LFBA 1Y1VJ 4C2MJ 4UUSB 2FQ4A 5E3OA 1W0UA 3JRBA 4I6ZA 2XGCA 4MFDA 3IH4A 4DYCA 1P7IA 3JREA 4A93J 4MIMA 5HODA 2MGQA 3HB9A 3TW7A 2VKEA 1QRYA 4QSHA 4A3MJ 5BNGA 1LFUP 2ME6A 3BR6A 1ETYA 4JX6A 3LSPA 2LVSA 1ORKA 1VFCA 4JP0A 5GPCA 2X9DA 4DZPA 1ZR4A 2R5ZB 2CUEA 1RPWA 4XK4A 4FTHA 3GTLJ 1FTZA 2K9NA 3S1QJ 1FEXA 3HEFA 2R5ZA 3BR0A 3JR9A 1ETVA 1WH5A 4IHWA 3QQAA 4IHYA 3S16J 3MKLA 1JT6A 1FJLA 1H88C 3SDGA 2HDDA 5IOYA 4RBOA 1APLC 1FTTA 1MH4A 2WAQN 1IJWC 4XRMA 3OOUA 2CUFA 2M0CA 3LSRA 3IH3A 1MBEA 4M3EA 1IC8A 3JRCA 5JLWA 3ZQGA 5EGOB 3O8HA 3TEDA 2R92J 5FKMA 2DMQA 3HGYA 1JUPA 2E2IJ 2JJ7A 1XS9A 5EGOA 5IYBJ 2DA7A 5IYDJ 4JYKA 1G2HA 2DMUA 1MBKA 3JRIA 1U8BA 4C3JJ 3LSGA 1B8IB 2IBDA 3B6AA 3IH2A 3K2AA 4JX4A 4S0HB 1ZQ3P 1AKHB 3S1MJ 3GTOJ 5DTDA 3SJMA 2FJ1A 5M5XJ 1B8IA 2JMWA 2VUMJ 3BR3A 5J1RA 2M9HA 2M8GX 3FK6A 1AKHA 3JRFA 1OFCX 3S1RJ 1JJ8C 1A5JA 1GUUA 2XRLA 4UUTA 1E3OC 2DN0A 5C3EJ 2N8GA 1VI0A 3G1MA 1FIPA 1TWAJ 4XRSA 1D5YA 3H0GJ 5IYCJ 4LOCA 4EEFG 5FKKA 2TRTA 4XICA 2L7ZA 1JTYA 1YRNB 2CJJA 2XPVA 2EZLA 3BT9A 3BTIA 1GV5A 5GPAA 4D5FA 1SFOJ 2E2JJ 5IP7J 1NK2P 1W0TA 1MH3A 2YUSA 3S2DJ 2NOGA 1YRNA 2ECBA 3I4NJ 5J1YA 3ZOBA 2Y9YA 3M3YJ 5F1JA 3GBGA 1VNDA 5DS9A 1ETXA 5EG0B 3BTCA 2GM4A 1IUFA 5F04A 3A02A 3HKZN 2CQXA 2NVQJ 5FLMJ 5J3LA 5EG0A 2CU7A 1AU7A 3GTPJ 4DYQA 5C44J 2L9RA 3BG5A 2M2EA 4DYRA 3M4OJ 3LNQA 2GLOA 4XRSG 3CMYA 5JLXA 3BR5A 1RR7A 4A3DJ 3CCYA 3ZQCA 1BW6A 4BXXJ 1HCRA 1OJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLV A;  4NDL A;  2Y30 A;  1ITY A;  2DA3 A;  2O8K A;  4D7N A;  2FX0 A;  1X2M A;  2LD5 A;  5F0H A;  1UMQ A;  3OSF A;  2ECC A;  2LLK A;  4ABZ A;  1X2N A;  5E3N A;  5F27 A;  4FE7 A;  1O4X A;  1ZTR A;  2LKX A;  5EDN A;  5M3F J;  1Y1W J;  1I3Q J;  1BA5 A;  3NAR A;  2X48 A;  1K83 J;  2MG4 A;  2XPW A;  1FIA A;  2HOS A;  5C4J J;  1JUM A;  3ZQF A;  4FCY A;  2X6O A;  1HDD C;  2ID3 A;  1H8A C;  1IDY A;  1JGG A;  1TWH J;  4M3B A;  3LSJ A;  2COB A;  2M34 A;  2DMN A;  3JRA A;  1BL0 A;  4MLO A;  2K9S A;  3RZO J;  4A3E J;  2HYJ A;  3ZQI A;  2NS7 A;  1PUF B;  4A3J J;  1JJ6 C;  3NAU A;  3ZQH A;  1R9T J;  3RQI A;  3GTK J;  2Y0S N;  1NTC A;  5F08 A;  2XGD A;  1OCT C;  3RZD J;  3GTM J;  2K40 A;  4MFE A;  3SFI A;  4RDU A;  2P81 A;  2JK3 A;  4IEJ A;  1I6H J;  2ELK A;  3IV5 A;  3HOX J;  1PUF A;  1UHS A;  5K7H A;  1EF4 A;  1WGX A;  2LTP A;  4MO7 A;  4DW6 A;  2L7M P;  3BTL A;  3QPS A;  1WCM J;  1RKW A;  2TCT A;  1JTX A;  3PO2 J;  2KDZ A;  3JRD A;  1IG7 A;  1IGN A;  4A3I J;  1DU6 A;  5EZG A;  3GTJ J;  3HGG A;  1JUS A;  5FKL A;  1F43 A;  1JT0 A;  1XC5 A;  5GP9 A;  1RES A;  4W1U A;  1U78 A;  4W97 A;  2NVX J;  1MBJ A;  5K7F A;  3TP0 A;  1POG A;  2E2H J;  3GTQ J;  4A3C J;  1BW5 A;  1HDP A;  5FLV A;  2L0K A;  2LFB A;  5E3M A;  4CYC B;  3CDL A;  2XSD C;  3FKI J;  3BG3 A;  2YU9 J;  2KT0 A;  3BTJ A;  5K7Z A;  2EZH A;  2AO9 A;  3WHC A;  4AYB N;  4CYC A;  4D7M A;  4QIW N;  5FKO A;  4A3L J;  3F0C A;  2H1K A;  1U9O A;  2DMP A;  5EEA A;  4C3I J;  1H89 C;  3LOC A;  1T56 A;  2YS9 A;  1ZGW A;  2ZB9 A;  2HQ5 A;  1Z0X A;  4QTR A;  2CQQ A;  1T33 A;  1X58 A;  3QPL A;  3O8G A;  2XGE A;  5IOZ A;  2VI6 A;  4AUX A;  2R5Y A;  2Y2Z A;  1IDZ A;  5F0C A;  2XB0 X;  5IP6 A;  1LE8 A;  3OSG A;  3HDD A;  3PO3 J;  4I76 A;  1WPK A;  2XPU A;  3WHB A;  2RAE A;  1VF9 A;  2DTZ A;  5E3L A;  3BR2 A;  2WV1 A;  1IV6 A;  1AHD P;  3S14 J;  3RKQ A;  2JN6 A;  1BJZ A;  2HXI A;  2LY9 A;  3MN2 A;  1K61 A;  1Q1V A;  3L1P A;  1QVT A;  2MW8 A;  2NS8 A;  1GDT A;  4A3F J;  2JWT A;  2B63 J;  1ZKG A;  5EF6 A;  4AC0 A;  2HXO A;  2CRG A;  2XB5 A;  4UUS A;  3UKG A;  1JKO C;  2DA6 A;  2R0Q C;  5M5Y J;  2NVT J;  4A3G J;  3B6C A;  3HBL A;  3BQY A;  1GVD A;  3DCF A;  2HOA A;  2E1O A;  2LK2 A;  3BR1 A;  2JA6 J;  1Z77 A;  2DA5 A;  3GTG J;  2WB1 N;  1QPI A;  4FIS A;  1HOM A;  2G0E A;  2R7Z J;  4IHV A;  4BBR J;  1ETQ A;  2Y31 A;  1IRZ A;  3G1L A;  3MVP A;  1ENH A;  3Q0U A;  5EYR A;  4GFB A;  2HOT A;  3HOY J;  2EZK A;  3FK7 A;  4A3K J;  3HOU J;  2L7F P;  2VKV A;  1RET A;  4X6A J;  1RKT A;  1U9N A;  2EBI A;  1JKP C;  5IP9 J;  3A03 A;  3HM5 A;  1B72 B;  2W48 A;  3VPR A;  3A01 B;  2QF7 A;  2I10 A;  2HI3 A;  4BY1 J;  1A6I A;  2JA8 J;  2ID6 A;  1ETK A;  2ME0 A;  1CQT A;  4JX5 A;  1B72 A;  5J1U A;  3A01 A;  4BKX A;  1TWG J;  4J19 A;  2IAI A;  3H3V K;  2DA4 A;  5C4X J;  3S17 J;  5FJ8 J;  3ZQL A;  2GBY A;  2EZI A;  3Q0V A;  1F36 A;  2FD5 A;  4XID A;  3D1N I;  3S1N J;  2JA7 J;  4M3F A;  1ZR2 A;  4M6V A;  2O7O A;  3C2B A;  2QCO A;  4FE4 A;  2VPR A;  2LR8 A;  3FIW A;  1MNM C;  3DEW A;  4DZJ A;  2MSY A;  2DA1 A;  4D5C A;  5M5W J;  4G12 A;  4BBS J;  1MSF C;  4V2F A;  3OIO A;  4IHX A;  1ETW A;  4BY7 J;  2R93 J;  4L5E A;  1WI3 A;  1OCP A;  2DA2 A;  2DJN A;  3I4M J;  1MBF A;  3HOV J;  1MBG A;  4V2G A;  4A69 C;  1DU0 A;  1JKR C;  3JRG A;  4Y52 J;  4B4C A;  1MBH A;  2LP0 A;  2EQR A;  4B3A A;  3TW6 A;  1WH7 A;  2OPT A;  1GT0 C;  9ANT A;  3Q0W A;  1ZK8 A;  3Q3S A;  1ETO A;  2O9L A;  4M3G A;  1XG1 A;  3CQZ J;  4A3B J;  1TWC J;  3K7A J;  1P7J A;  3BG9 A;  2H8R A;  1TWF J;  2NVY J;  4C3H J;  1JKQ C;  3W6V A;  1HF0 A;  5M3M J;  2IEK A;  5F0F A;  3HOW J;  1SAN A;  5EZH A;  3S2H J;  3JRH A;  1UG2 A;  2R5Y B;  2JA5 J;  1I50 J;  3HOZ J;  1LE8 B;  2K9Q A;  3FIS A;  1S7E A;  2EH3 A;  1QVU A;  3S15 J;  3TP3 A;  4B1R A;  1MSE C;  3BQZ A;  5IPA A;  4M3D A;  5FKN A;  1GV2 A;  4HNV A;  2D5V A;  4X1E A;  4Y7N J;  1TC3 C;  1NK3 P;  2OF7 A;  2DMT A;  2E19 A;  2Y9Z A;  3E7L A;  2PMZ N;  3G1O A;  2AHQ A;  3PM1 A;  1LFB A;  1Y1V J;  4C2M J;  4UUS B;  2FQ4 A;  5E3O A;  1W0U A;  3JRB A;  4I6Z A;  2XGC A;  4MFD A;  3IH4 A;  4DYC A;  1P7I A;  3JRE A;  4A93 J;  4MIM A;  5HOD A;  2MGQ A;  3HB9 A;  3TW7 A;  2VKE A;  1QRY A;  4QSH A;  4A3M J;  5BNG A;  1LFU P;  2ME6 A;  3BR6 A;  1ETY A;  4JX6 A;  3LSP A;  2LVS A;  1ORK A;  1VFC A;  4JP0 A;  5GPC A;  2X9D A;  4DZP A;  1ZR4 A;  2R5Z B;  2CUE A;  1RPW A;  4XK4 A;  4FTH A;  3GTL J;  1FTZ A;  2K9N A;  3S1Q J;  1FEX A;  3HEF A;  2R5Z A;  3BR0 A;  3JR9 A;  1ETV A;  1WH5 A;  4IHW A;  3QQA A;  4IHY A;  3S16 J;  3MKL A;  1JT6 A;  1FJL A;  1H88 C;  3SDG A;  2HDD A;  5IOY A;  4RBO A;  1APL C;  1FTT A;  1MH4 A;  2WAQ N;  1IJW C;  4XRM A;  3OOU A;  2CUF A;  2M0C A;  3LSR A;  3IH3 A;  1MBE A;  4M3E A;  1IC8 A;  3JRC A;  5JLW A;  3ZQG A;  5EGO B;  3O8H A;  3TED A;  2R92 J;  5FKM A;  2DMQ A;  3HGY A;  1JUP A;  2E2I J;  2JJ7 A;  1XS9 A;  5EGO A;  5IYB J;  2DA7 A;  5IYD J;  4JYK A;  1G2H A;  2DMU A;  1MBK A;  3JRI A;  1U8B A;  4C3J J;  3LSG A;  1B8I B;  2IBD A;  3B6A A;  3IH2 A;  3K2A A;  4JX4 A;  4S0H B;  1ZQ3 P;  1AKH B;  3S1M J;  3GTO J;  5DTD A;  3SJM A;  2FJ1 A;  5M5X J;  1B8I A;  2JMW A;  2VUM J;  3BR3 A;  5J1R A;  2M9H A;  2M8G X;  3FK6 A;  1AKH A;  3JRF A;  1OFC X;  3S1R J;  1JJ8 C;  1A5J A;  1GUU A;  2XRL A;  4UUT A;  1E3O C;  2DN0 A;  5C3E J;  2N8G A;  1VI0 A;  3G1M A;  1FIP A;  1TWA J;  4XRS A;  1D5Y A;  3H0G J;  5IYC J;  4LOC A;  4EEF G;  5FKK A;  2TRT A;  4XIC A;  2L7Z A;  1JTY A;  1YRN B;  2CJJ A;  2XPV A;  2EZL A;  3BT9 A;  3BTI A;  1GV5 A;  5GPA A;  4D5F A;  1SFO J;  2E2J J;  5IP7 J;  1NK2 P;  1W0T A;  1MH3 A;  2YUS A;  3S2D J;  2NOG A;  1YRN A;  2ECB A;  3I4N J;  5J1Y A;  3ZOB A;  2Y9Y A;  3M3Y J;  5F1J A;  3GBG A;  1VND A;  5DS9 A;  1ETX A;  5EG0 B;  3BTC A;  2GM4 A;  1IUF A;  5F04 A;  3A02 A;  3HKZ N;  2CQX A;  2NVQ J;  5FLM J;  5J3L A;  5EG0 A;  2CU7 A;  1AU7 A;  3GTP J;  4DYQ A;  5C44 J;  2L9R A;  3BG5 A;  2M2E A;  4DYR A;  3M4O J;  3LNQ A;  2GLO A;  4XRS G;  3CMY A;  5JLX A;  3BR5 A;  1RR7 A;  4A3D J;  3CCY A;  3ZQC A;  1BW6 A;  4BXX J;  1HCR A;  1OJL A; 
#chains in the Genus database with same CATH topology
 4NDL A;  2HVS A;  2H1L A;  4BJ6 C;  5F0H A;  1J2X A;  4YIR X;  1WJC A;  2CW0 F;  1FSH A;  3IHU A;  3OSF A;  1FLI A;  2DBB A;  2LLK A;  5CVU A;  2NRA C;  1ZAR A;  2YSR A;  2EFO A;  3QOD A;  1X1C A;  5DYM A;  3PNT A;  1MJA A;  1F1Z A;  4RM2 A;  5M3F J;  1I3Q J;  3NAR A;  2XPW A;  3ZGK A;  4YG2 F;  4AU7 A;  3ABK H;  3EDP A;  4Y15 A;  2IJL A;  4YII A;  1YTY A;  3O2P E;  4LLG F;  4E7H A;  2GIV A;  3U2R A;  1BBY A;  5C4J J;  1O7L A;  3HPG A;  3VB2 A;  5IY5 H;  2PG4 A;  2PI0 A;  4XSZ F;  1HDD C;  3JSP A;  4PGH A;  2ZJ2 A;  3R6S A;  2X6Y A;  1IDY A;  1JGG A;  2HQR A;  5LLQ A;  4M3B A;  4KMF A;  4HOB A;  1IO2 A;  2Z2S B;  4KYW A;  1ZH5 A;  4CCO A;  1ZG1 A;  2M34 A;  4O5V A;  2DMN A;  4LMY A;  3JRA A;  4AIJ A;  3CF2 A;  2F5E A;  4MLO A;  3SQN A;  4E6K G;  3RZO J;  3ZQI A;  3KYL A;  2ZO4 A;  3PNV A;  1OYY A;  2D45 A;  4MTE A;  1PUF B;  2WY8 Q;  4ANJ A;  2VC1 A;  3H5R A;  3RQI A;  5LHG A;  1MD0 A;  4J01 A;  2XGD A;  3J80 K;  2K40 A;  4MFE A;  5EJC A;  2NNY A;  4UXN A;  2ELK A;  2O6G E;  1U8R A;  2Q2E A;  3MCZ A;  1EF4 A;  4A5M A;  2CUZ A;  4MO7 A;  4KT5 C;  1WCM J;  4Q47 A;  1GXP A;  2IS4 A;  3MKY B;  4PJL A;  2IGM A;  1OYI A;  3JRD A;  3HPH A;  3DKX A;  3I56 I;  1SMT A;  4UVA A;  3U1D A;  1R4N B;  1F43 A;  5DDG A;  2CV1 A;  1PYV A;  5DM7 F;  4CXF A;  3HL2 A;  3QU3 A;  2CMP A;  4EMS A;  4W97 A;  2NVX J;  1MBJ A;  1PUE E;  3N4M A;  4O6J A;  4XN3 A;  2E2H J;  2XRO A;  4CUG A;  2DDB A;  4UB8 C;  2R7S A;  3JAM K;  2L0K A;  2LFB A;  1ZHF A;  2AXL A;  3BC8 A;  3CDL A;  4CDG A;  3S32 A;  2LRE A;  2ZXW H;  1O3T A;  2HQN A;  1K78 B;  1YIJ I;  5F6F A;  2EZH A;  3IRR A;  2AO9 A;  1UAA A;  2STW A;  5FLX Z;  4PFP A;  3WHC A;  4CYC A;  5K5R A;  4A3L J;  5J8C A;  2PMZ A;  4ENM A;  1KU7 A;  4TV7 A;  1T0F A;  3AL0 C;  4C3I J;  1H89 C;  4LIU A;  1T56 A;  4UNO A;  2ZB9 A;  5EEH A;  5JHF A;  5FFZ A;  2EIM H;  5E18 F;  5CQG A;  2ZC2 A;  2BXY A;  1R49 A;  3DTE A;  4HAM A;  1W36 C;  1KQ0 A;  5JR3 A;  2WAE A;  2O3F A;  4HLX A;  1HW5 A;  3OL4 A;  2JUC A;  1D1B A;  4FET A;  5F0C A;  5IP6 A;  4ETS A;  2P7V B;  3FXO A;  1UST A;  4N9I A;  1BI0 A;  1IV6 A;  4XKV A;  1O3Q A;  2HXI A;  2RKH A;  1K61 A;  1MW7 A;  1I27 A;  4YFK F;  2BY2 A;  1ON1 A;  5LD2 C;  4DNC A;  4DGW B;  4UHT A;  2NS8 A;  2RRE A;  1TT0 A;  2LRD A;  1T08 B;  3O6B B;  4WCG A;  3U9G A;  4A3F J;  4EM2 A;  2JRM A;  1ZKG A;  2M30 A;  1ZRC A;  4AC0 A;  1TL8 A;  2QA4 I;  4ZDP A;  2R0Q C;  5M5Y J;  1W5T A;  4KIS A;  3B6C A;  5CVV A;  4WF2 A;  4E7Z A;  3RJP A;  2XVC A;  2E1O A;  2IP2 A;  3ZCO A;  2QKM B;  1WHU A;  2HTS A;  2P7C B;  2H09 A;  4A6E A;  2VJ5 A;  1QPI A;  4XOP A;  1P4W A;  5L3D A;  1K6O A;  3BY6 A;  4IHV A;  4OIN F;  4B47 A;  2DOD A;  2BY3 A;  2P4W A;  1KU2 A;  5E17 F;  2JUG A;  3COA C;  2HOT A;  4G7H F;  3FK7 A;  2CH0 A;  1RUO A;  2BY0 A;  3V7C A;  1RKT A;  3EYY A;  4MHG A;  4NC8 A;  2V4J C;  3HIF A;  2GXA A;  2JTV A;  1L0O C;  3HM5 A;  2A3S A;  2HR3 A;  3KZZ A;  3LSH A;  3VPR A;  3OYG A;  3KEY A;  3H9Q A;  4L5I A;  2BV6 A;  2I10 A;  3HTS B;  4BXF A;  1BJA A;  2Q2E B;  3GME A;  5CYV A;  1GLN A;  2ME0 A;  1CQT A;  4JX5 A;  3CP8 A;  3LAP A;  3A01 A;  4BKX A;  1TWG J;  3S3N A;  1RRJ A;  3I0T A;  1WKM A;  3S17 J;  3TOB A;  4L9V A;  1BI1 A;  2GAU A;  2EZI A;  2QSG X;  5FGM A;  2FD5 A;  4CCN A;  3D1N I;  3IWF A;  2QWW A;  5E8G A;  3MMY B;  2K9L A;  2FUG 2;  2UZK A;  1ZR2 A;  4ENK A;  2L4M A;  2VPR A;  2LR8 A;  1MNM C;  4DZJ A;  5D5W B;  2X1C A;  4UV8 A;  3GEZ A;  5ERI A;  4D5C A;  2A5W A;  2XAJ A;  4J00 A;  3OIQ A;  3GO5 A;  4IHX A;  2GIZ A;  3OYA A;  2R92 J;  4CCL A;  2R93 J;  2IGN A;  2QYO A;  1OCP A;  1I39 A;  2ZFW A;  3CTA A;  3OWT A;  3VOE A;  4M6Y A;  2WY7 Q;  4V2G A;  2VL8 A;  1T8I A;  4A69 C;  3IP4 B;  4Y52 J;  3JRG A;  1QHG A;  3FXQ A;  2HYF A;  3BRO A;  4B3A A;  4AVZ A;  1IUY A;  3B73 A;  2JVH A;  9ANT A;  2NYX A;  1ZK8 A;  3KE2 A;  2FBH A;  2QQ8 A;  2BY1 A;  4MTD A;  2M3A A;  2X51 A;  4M3G A;  2X85 A;  3CJQ B;  5E20 A;  2LY1 A;  4BE0 A;  2HZT A;  3K7A J;  2H8R A;  1MMS A;  2ZXH A;  1TWF J;  3GFM A;  1UEL B;  4C3H J;  3WG9 A;  3W6V A;  2E1M B;  4EQQ A;  2ICW G;  5M3M J;  1REP C;  3HOW J;  1D5V A;  2PEX A;  5GAG J;  4U88 A;  2C6Y A;  5EZH A;  3S2H J;  2RVC A;  3I54 A;  1UG2 A;  4ZYA A;  3M8E A;  1I50 J;  1FNN A;  2DI3 A;  1N75 A;  1Z67 A;  3RI4 A;  4OIP F;  1X1P A;  2K9Q A;  3FIS A;  2EH3 A;  4RLF A;  3WG7 H;  4KIG A;  2V79 A;  5HLT A;  3EUH C;  3BQZ A;  1FMV A;  1D0Z A;  2CW8 A;  1R4M B;  2AQF A;  1IN7 A;  4NC6 A;  1V55 H;  2O03 A;  2KL4 A;  1TC3 C;  2MAB A;  2K27 A;  3BJA A;  3SZP A;  1NK3 P;  2P0W A;  1UB9 A;  2EFQ A;  3RSN A;  2AHQ A;  1VZ0 A;  1BOB A;  5DCF A;  1E0E A;  3ZMU A;  2IS1 A;  1UHW A;  2OBP A;  2RGV A;  1Y6I A;  1OR7 C;  2KRC A;  1X4O A;  3W3C A;  4RB3 C;  4RAF A;  2BGC A;  4MFD A;  1K4S A;  4M71 A;  1B1B A;  2UUZ A;  1IW7 F;  1OCZ H;  3PIP F;  3K4N A;  4OOI A;  1MIJ A;  3GZ6 A;  4LGW A;  2XUB A;  4II3 A;  4EGZ A;  5ED4 A;  3IUO A;  2VT3 A;  3QYF A;  1N78 A;  5BS6 A;  4A3M J;  3ZN1 A;  2EFN A;  1YJN I;  1HKT A;  5L3F A;  1P4A A;  5A2Q K;  1ZEL A;  1W5S A;  5HDK A;  1VFC A;  2X9D A;  1ZR4 A;  1Z05 A;  4BAY A;  1X1A A;  2DU9 A;  3VOD A;  4LLN A;  2CUE A;  1ZRD A;  2RNG A;  3ML6 A;  3VSL A;  3S1Q J;  2IW5 A;  3LQR A;  3BR0 A;  3DLA A;  1FOY A;  2JSC A;  4IHW A;  3S16 J;  4UVB A;  1JT6 A;  2COM A;  4Y33 A;  3SDG A;  3ZXS A;  4IO9 F;  3W6J B;  4I7H A;  4XMY A;  1KQ8 A;  3FMS A;  2HU9 A;  5E8I A;  3OOU A;  4EVI A;  3LSR A;  3K6G A;  2XIG A;  3IH3 A;  3WGI A;  3HG9 A;  4A5N A;  2X0L A;  1IC8 A;  2P5L C;  3JRC A;  4V19 K;  2A5Y B;  5JLW A;  3TED A;  4H4K C;  4HYE A;  2FF4 A;  1T95 A;  1XGM A;  2DOF A;  1VQ6 I;  4P5O A;  2EV6 A;  4GDF A;  2CG4 A;  1JUP A;  2E2I J;  2JJ7 A;  3F9K A;  4YEJ A;  2V6C A;  4DOZ A;  1RZ4 A;  1ZGA A;  1XS9 A;  2P6T A;  2BXZ A;  3NQO A;  3HSE A;  3WOD F;  3E6D A;  4ESB A;  4DJA A;  3BG7 A;  3ABL H;  5CJ9 A;  1WRJ A;  3DU5 A;  3LSG A;  1B8I B;  4R79 A;  3R4K A;  2IBD A;  2RQQ A;  3B6A A;  5BOX A;  3IH2 A;  3TO7 A;  3K2A A;  1ERD A;  2QUF A;  1PVE A;  2X6X A;  1WJF A;  5DTD A;  3G71 I;  1F4K A;  3ZPL A;  1HQC A;  2HPI A;  3SJM A;  2FJ1 A;  2ESH A;  3BR3 A;  4OMZ A;  1ON2 A;  2M1B A;  3OYE A;  5ILV A;  1R58 A;  3RIR A;  2KPM A;  1NHA A;  1LQ1 A;  1RI7 A;  2A61 A;  1EKE A;  3WU2 C;  1KQ9 A;  2CW7 A;  1FOK A;  3GX4 X;  1GHC A;  2HKO A;  2MA3 A;  3OYL A;  1GVJ A;  1D5Y A;  2LF8 A;  5IYC J;  1R00 A;  2FNA A;  3OR2 C;  4LOC A;  1UHM A;  2EA4 A;  1YIT I;  1FYM A;  3CO6 C;  1VQP I;  1BN5 A;  4NB5 A;  1QA6 A;  1TP4 A;  1OPC A;  3H0D A;  1YRN B;  2FNP A;  3BPX A;  2EZL A;  3OS0 A;  5J47 A;  1WQ2 A;  1JHF A;  1NK2 P;  2TDX A;  1W0T A;  3WTZ A;  3S2D J;  3SXY A;  3A0H C;  1R1T A;  5TRD A;  3ZOB A;  3M3Y J;  5F1J A;  4OWR B;  3BWG A;  2LSO A;  3QOE A;  5BMZ A;  1VQM I;  3CCM I;  2NXN B;  2GM4 A;  2F4M B;  4XL9 A;  4PJN A;  5F04 A;  2NVQ J;  3BCB A;  4HW0 A;  1LFP A;  2V7F A;  3CLQ A;  5C44 J;  2OZ6 A;  1B9N A;  3OYK A;  3FXL A;  1PDN C;  2M2E A;  4OIR F;  3PL8 A;  4QLC U;  4MQ9 F;  3KIO A;  4DYR A;  5FD6 A;  3P9K A;  2DOE A;  5HVQ C;  2WA0 A;  3F8F A;  5FB2 A;  4IL6 C;  3BR5 A;  2CFX A;  2XDV A;  3ZMD A;  3ZQC A;  2Y69 H;  1OJL A;  4G8X A;  1HLV A;  2DJI A;  2Y30 A;  4H0E A;  2XV4 S;  5D4R A;  3ABM H;  2CQK A;  3KP2 A;  4D7N A;  1X2M A;  1TT5 B;  1IXC A;  1UMQ A;  1W7P D;  3SYT A;  3Q9V A;  2A05 A;  4FE7 A;  4L9N A;  4IXA A;  4KIC A;  2KLO A;  2M87 A;  4U0V A;  3GYH X;  4XKB A;  2LKX A;  1YIO A;  1ZN2 A;  5EDN A;  1Y1W J;  2A07 F;  2R7X A;  3UNG C;  1H9G A;  3LSM A;  3KCC A;  2HOS A;  1IV8 A;  1QZY A;  4HDU A;  1JUM A;  4I09 A;  4BS9 A;  5GTI C;  1FMW A;  3K70 D;  5DD4 A;  1FBU A;  5JFR A;  2JPB A;  3R61 A;  4OAZ A;  3L2W A;  4A0Z A;  4HNT A;  2VBW A;  5TGT A;  1AA7 A;  2Y75 A;  4I0A A;  5EEG A;  3J7Y J;  2JPC A;  2HYJ A;  2NS7 A;  1OKR A;  3DWL E;  3MD2 A;  3A2K A;  3GW2 A;  4A3J J;  3GTK J;  1UCR A;  2Y0S N;  1NTC A;  3RZD J;  4NQW B;  3E0J B;  3I9V 2;  2P81 A;  2JK3 A;  4IEJ A;  1PUF A;  2B7E A;  3G3Z A;  3MFK A;  4FAS D;  4HF1 A;  1LPQ A;  2VQC A;  3KP5 A;  3KZY A;  2L7M P;  3RDI A;  1WJA A;  2I5U A;  4LJZ F;  1JE8 A;  1JTX A;  3PO2 J;  2KDZ A;  1IG7 A;  4LFU A;  3CES A;  1A36 A;  2DFI A;  2E35 A;  2V1D A;  3ZMS A;  2WAD A;  2ZSI B;  5FKL A;  1VQ9 I;  1FOX A;  3CJT B;  5HNH A;  1JT0 A;  4A0X A;  4EM0 B;  5E1W A;  3I53 A;  1BI2 A;  1RES A;  4W1U A;  5K7F A;  4RAG A;  2HGC A;  3EYI A;  4XLP F;  4O3M A;  4IF4 A;  4X0G A;  4KIB A;  1O57 A;  2AXT C;  4F91 B;  4S05 A;  1RIO H;  4LG0 B;  4A3C J;  5FLV A;  5J4V A;  4GYG A;  4ZYD A;  3ABT A;  3FKI J;  3BG3 A;  2E71 A;  3VYR B;  2R7W A;  3BTJ A;  3K9T A;  2XF6 A;  2LYC A;  4HX4 A;  1A31 A;  3TDU C;  4N0B A;  3ZQ7 A;  5ICG A;  3P7N A;  5L3E A;  3WU1 B;  4QIW N;  2VE9 A;  1I5Z A;  2QKL B;  1ZG5 A;  1U9O A;  1BOA A;  1BR4 A;  4BJT A;  2BW3 A;  1K78 A;  2BZT A;  1YJW I;  1XSD A;  4NC7 A;  4CGZ A;  3FKJ A;  1S72 I;  3J80 Z;  1XTA A;  1ZGW A;  1SAX A;  2HQ5 A;  2MD0 A;  3A0B C;  4XLE A;  3AG2 H;  1Q1H A;  4BE2 A;  4D9J A;  2V26 A;  3WGG A;  2PJP A;  1ULY A;  3M07 A;  3KZI C;  1Z3Y A;  2PBI A;  4PSW A;  2XC7 A;  4CHU A;  1KZH A;  5HDG A;  3OYH A;  1ZLK A;  4G9Y A;  4AUX A;  2Y2Z A;  1FBQ A;  1LE8 A;  2KDO A;  1OMI A;  2DYS H;  2UXN A;  3GLL A;  3K4C A;  4WXH A;  2XKP A;  2HVR A;  3F8M A;  2KIM A;  4DBQ A;  3WHB A;  2RAE A;  2DTZ A;  2V1X A;  5D5V B;  1Y8R B;  1AHD P;  5H2F C;  3S14 J;  2Z3Y A;  1C0W A;  3K1M A;  4GCV A;  3MN2 A;  3SZG A;  1QVT A;  2M7A A;  2MW8 A;  2M4K A;  3JSO A;  1LUJ B;  1KU3 A;  3B02 A;  3FXK A;  5EF6 A;  1YOV B;  2HXO A;  2VXZ A;  1LVK A;  1G3W A;  4UUS A;  3F72 A;  3UKG A;  3QAH A;  3I59 B;  3QPH A;  4IVN A;  1ONV A;  4A0Y A;  3L2R A;  3DCF A;  1XGO A;  5FD5 A;  3BR1 A;  3AL0 B;  5L3G A;  1S5L C;  3WTS C;  3J81 K;  1Z77 A;  1EH6 A;  1P6R A;  4M72 A;  2WB1 N;  2CV2 A;  2VJJ A;  3IAS 2;  1U5T C;  4FIS A;  2IA0 A;  3TMO A;  2W7N A;  1Y8Q B;  3WE2 A;  1RNL A;  3CCJ I;  4Y4R A;  3I5U A;  4U87 A;  2PJR B;  3MVP A;  2BEO A;  3HOY J;  1MDM A;  2VQH A;  5JVG F;  1YW9 A;  2L7F P;  2VKV A;  1WSU A;  3REO A;  1OCC H;  1RET A;  4PUS A;  4AM3 A;  4PFO A;  3W6K B;  2ELJ A;  2MC4 A;  1B72 B;  1P9Q C;  3CCU I;  2QF7 A;  1G8X A;  4LIV A;  2BHY A;  2HI3 A;  4B3X A;  1A6I A;  3OYB A;  2NAZ A;  2JA8 J;  3HSF A;  4JOM A;  1RUN A;  3QU6 A;  3BOQ A;  1CGP A;  1G3S A;  2KMU A;  4ZJZ A;  1HW1 A;  1Z3X A;  2KJC A;  1LVA A;  4MEY F;  2KKO A;  1IRX A;  1SFU A;  4BQQ A;  1XGN A;  5D4S A;  2O7O A;  4YRV A;  1FP1 D;  4CH7 A;  2LH9 A;  3N05 A;  3D5S C;  2DA1 A;  1DUX C;  1VQK I;  3DP7 A;  1S7A A;  3RYR A;  5M5W J;  1R1V A;  1XD7 A;  2LKP A;  2MC3 A;  2DDA A;  2R4G A;  3K0L A;  3OIO A;  4BBS J;  1XMX A;  3CMM A;  3S2W A;  1HW2 A;  3KYD B;  2L4A A;  2O8X A;  2YU3 A;  5BPD A;  1MBF A;  3NEU A;  4Q4Z F;  3ESW B;  1SVL A;  2XHK A;  4AWX B;  4E7S A;  1DU0 A;  1JKR C;  3DLL F;  3RKW A;  2BW3 B;  2QEN A;  2LP0 A;  5B5E C;  2Q1Z B;  3PQK A;  3TW6 A;  1K79 A;  2K3P A;  1YX3 A;  4JBA A;  2M8E A;  2R7T A;  1ETO A;  3CCV I;  4I01 A;  2PMH A;  4RAY A;  5JHU A;  4EJT A;  1B4A A;  4A3B J;  1TWC J;  1P7J A;  3T8R A;  4RGX A;  3HKZ A;  2ISY A;  1X3W B;  2IEK A;  1QGP A;  3TL4 X;  4G6T B;  4JK1 X;  1HXD A;  4IRH A;  4M9X A;  1CF7 B;  3GFI A;  5K1Y A;  1TNT A;  3CUQ C;  4EGY A;  3EUA A;  3FMR A;  4IRI A;  1YE9 A;  2HZD A;  3HOZ J;  4ITV A;  1LE8 B;  2CYY A;  5FO5 A;  3T0Y A;  3TP3 A;  4IHT A;  2HYG D;  2L5Q A;  3E5U A;  3MWM A;  4UB6 C;  4IOA F;  1GV2 A;  4HNV A;  3L2Q A;  4X1E A;  1MGT A;  3FMQ A;  2IPQ X;  4XRF A;  1N77 A;  4DBR A;  3V8L A;  2JZY A;  3E7L A;  4Y13 A;  2B0L A;  3E6B A;  3ECH A;  4WXD A;  3V8J A;  3PM1 A;  1LFB A;  4C2M J;  4UUS B;  4D1Q A;  3G4S I;  2M4G A;  3MKZ A;  3JRB A;  5D5U B;  4I6Z A;  3L09 A;  2EFP A;  2ZFU A;  5GAE J;  1P2F A;  5D6F A;  3X2Q H;  2A6H F;  2KJB A;  2H27 A;  4DYC A;  2EIK H;  1P7I A;  3M9A A;  3ZMV A;  3DFG A;  2E60 A;  3ONQ A;  3UR3 C;  2H6B A;  3JRE A;  5HOD A;  2MGQ A;  3HB9 A;  1VQ7 I;  3F8C A;  4QWQ A;  4RA2 A;  3K4K A;  1SAU A;  2ETH A;  1LFU P;  1Z6T A;  3DKW A;  2Q0O A;  3BR6 A;  2QQA A;  2KQR A;  1ETY A;  4JX6 A;  3LSP A;  1W7P B;  1MDM B;  2LVS A;  3ROU A;  3F21 A;  1F9N A;  3CDH A;  5KK1 A;  5GPC A;  4DZP A;  2QSF X;  2R5Z B;  2D1V A;  1MND A;  3OL3 A;  2E7X A;  2V6E A;  5L3B A;  2MH9 A;  3GTL J;  4FTH A;  2WWY A;  1FTZ A;  1QO0 D;  5CLS A;  1G3Y A;  3LSI A;  4HBL A;  4FX4 A;  1BI3 A;  3GZN B;  3F8B A;  1H88 C;  4LK0 F;  3ERM A;  2ZME A;  5IOY A;  1QPM A;  2GA1 A;  1VQO I;  4RBO A;  5JI6 A;  3EUK L;  3KLO A;  4G7O F;  1FTT A;  1FBS A;  3I55 I;  4RM3 A;  2CUF A;  3ZQQ A;  2M0C A;  1WJB A;  2PX9 A;  3WTT C;  1FP2 A;  1QBJ A;  2B9S A;  1I3A A;  3ZQG A;  5EGO B;  1FX7 A;  1OQY A;  3J7Z I;  4HEA 2;  4RMN A;  3E3V A;  1IRG A;  2HFH A;  3HRT A;  5IYB J;  2PMU A;  2EFW A;  5A2Q Z;  4XLF A;  2VC0 A;  2E1C A;  2GWR A;  1G2H A;  3GLX A;  1MBK A;  2E5N A;  1U8B A;  4B48 A;  2HDC A;  1S3J A;  1XSV A;  2OJE D;  3CJR B;  1YS7 A;  1AWC A;  1X1D A;  1LNW A;  1ZG3 A;  3O3K A;  4G6D A;  4S0H B;  1ZQ3 P;  3GTO J;  3E5Q A;  1ACI A;  4ASN A;  2EB7 A;  3R0A A;  1B8I A;  1B6A A;  1J7K A;  2M9H A;  2W85 A;  1ZLJ A;  3LL7 A;  3WGH A;  5DUK A;  3FK6 A;  1N25 A;  2R7D A;  1FOW A;  2W25 A;  3V8K A;  3S1R J;  1JJ8 C;  1A5J A;  4CCM A;  3FX3 A;  3FBI B;  2P6S A;  4N4N B;  5C3E J;  3TKY A;  1OCR H;  3HRS A;  4U0Y A;  3TBI A;  4MEX F;  1EH8 A;  1MKM A;  2Z5U A;  3H0G J;  1L3L A;  1Z21 A;  2RDP A;  3C1D A;  4HQE A;  1VQ5 I;  2TRT A;  3QYB A;  4LIT A;  3M8F A;  4WWC A;  2R7Q A;  5LRS A;  2XAQ A;  4XIC A;  2OCC H;  1IAW A;  2CJJ A;  1JI8 A;  3CZ6 A;  3BTI A;  4LB6 B;  1XMK A;  3CF5 F;  1SFO J;  2E2J J;  5AIQ A;  2YUS A;  3SHF A;  1YRN A;  2ECB A;  2LNB A;  2VN2 A;  5J1Y A;  3GXO A;  3BPV A;  1D1A A;  1VND A;  1XN7 A;  5EG0 B;  3BTC A;  2R7F A;  1TW2 A;  3KFW X;  5FLM J;  1AU7 A;  2CFO A;  3GTP J;  2O5R A;  3ZRG A;  4BYY A;  2DAO A;  3Q5F A;  3SFZ A;  5B1A H;  1I1G A;  1R36 A;  4I02 A;  3C18 A;  2D1H A;  4OIQ F;  4XR6 A;  3CMY A;  3SEZ A;  1EJ9 A;  2G9W A;  2ISZ A;  1RR7 A;  3MZH A;  3CCY A;  3ASN H;  2OA4 A;  1BW6 A;  1UFM A;  2HNH A;  3KYC B;  5J4Y A;  3LA3 A;  3OYJ A;  1LB2 A;  1HCR A;  4I2O A;  4XLN F;  1ITY A;  4ENJ A;  2O8K A;  1OLT A;  2BVM A;  3VSK A;  5K5O A;  1MNE A;  1XCB A;  3AAF A;  3OYF A;  1J0R A;  2RV8 A;  5AON A;  1IN5 A;  1MMA A;  2BHZ A;  3MZ8 A;  1M1E B;  4CO8 A;  3CCQ I;  2ECC A;  4ABZ A;  3ISP A;  4M9Z A;  5F27 A;  5E3N A;  1BIA A;  2GOX B;  2ZME B;  1W36 D;  1BA5 A;  2MG4 A;  2LC2 A;  3IKV A;  3S3M A;  1H9T A;  1SD7 A;  5ICE A;  3WTX C;  4KDP A;  4AVP A;  1YW7 A;  4HG2 A;  3TDZ C;  2KFD A;  3DEE A;  3ZQF A;  2VBX A;  3K1N A;  4U0W A;  5HS7 A;  2HKX A;  4BDY A;  2VOD A;  1E3H A;  2X6O A;  4ZC3 A;  1O3S A;  2ID3 A;  3EPZ A;  3PUF A;  1H8A C;  1VQN I;  1T0F C;  2QQB A;  3CC4 I;  3CME I;  3QP5 A;  2ELH A;  5CKT A;  2W00 A;  1SD5 A;  3CDI A;  4IQJ A;  4DIQ A;  3BLY A;  4A3E J;  5KAF C;  5HLG A;  3ZQH A;  3C7J A;  1R9T J;  4N9H A;  4CCJ A;  3RKY A;  3FWE A;  3MKW B;  2X1D A;  2W4S A;  2E1M C;  3ZP5 A;  3GTM J;  1BR1 A;  3SFI A;  3WTV C;  1MMG A;  4Z6Y A;  3WTW C;  2XAF A;  3GUD A;  4JQF A;  3IV5 A;  3HOX J;  5L3C A;  5K7H A;  1DGW Y;  1WGX A;  2LTP A;  3N97 A;  4DW6 A;  3BTL A;  4OMY A;  4NQW A;  1RKW A;  3L2U A;  2FRH A;  2M5W A;  2CV0 A;  3RKX A;  1T6S A;  4M9S A;  1YI2 I;  3RYP A;  1IGN A;  1DDN A;  2NOJ B;  5J40 A;  4A3I J;  4F55 A;  3FHZ A;  5EZG A;  5D5X B;  4YFN F;  3HGG A;  1JUS A;  4XKC A;  1TQM A;  3H9G A;  4C2U A;  3IKT A;  1Y0N A;  1U78 A;  4ON0 A;  3DXJ F;  4ZDL A;  4ZYG A;  5TJJ A;  3LAJ A;  3GTQ J;  4BQA A;  3OYM A;  1HDP A;  1IN6 A;  5E3M A;  3M8J A;  4B43 A;  2YU9 J;  2KT0 A;  3IC7 A;  4CZZ A;  2O0Y A;  3W2W A;  4LG0 A;  1FSE A;  4AYB N;  2LG4 A;  2QBY B;  5FKO A;  2ZSH B;  3BCA A;  3IAM 2;  2H1K A;  3HUG B;  1IN8 A;  1B9M A;  2L9V A;  2QZ8 A;  1T38 A;  2DMP A;  4KNY A;  2BVL A;  3DTK A;  4IHS A;  3DPT A;  5LBQ A;  1Z0X A;  3LMM A;  4QTR A;  2YPR A;  2CQQ A;  2HTJ A;  3BZC A;  2XGE A;  3A1Y A;  3V7S A;  1E2X A;  1BC7 C;  3HJE A;  2L9N A;  5IOZ A;  2K5C A;  2GXG A;  3H3Z A;  2JT1 A;  2R5Y A;  1D0X A;  1IDZ A;  1VQ4 I;  2XSJ C;  2Z33 A;  1WI9 A;  2DYR H;  4G94 A;  2HOE A;  3CCL I;  3OSG A;  3RPQ A;  4I76 A;  1WPK A;  4E4H A;  3PO3 J;  2CUJ A;  3H92 A;  1KYZ A;  1VF9 A;  5KCM A;  1SVM A;  3RKQ A;  4CCK A;  2JN6 A;  1TQP A;  3EQL F;  2VKD A;  4XON A;  4ZTF A;  1GDT A;  3OYI A;  3G2B A;  4HNU A;  2ZJQ F;  1D8J A;  4BH9 A;  2JWT A;  2P5V A;  3QWL A;  2QLZ A;  2XB5 A;  2AQE A;  3A4C A;  2NVT J;  5DD8 A;  1YHQ I;  3DF8 A;  3RPU D;  3OYD A;  3BQY A;  1SC7 A;  2VON A;  2F4I A;  3CO7 C;  1QZZ A;  2DA5 A;  3OY9 A;  2QM3 A;  3OS2 A;  3I59 A;  3OR1 C;  2G0E A;  3VDX A;  2R7Z J;  3EET A;  1WFX A;  1XGS A;  5FFX A;  2FU4 A;  4QPQ A;  1IRZ A;  1ENH A;  4EJO A;  4EV0 A;  4GFB A;  1KYW A;  1X4P A;  2EZK A;  4XNF A;  1TQI A;  3HOU J;  2BBY A;  1V5G A;  3BZ6 A;  5DCM B;  2PJR A;  4X6A J;  4RGU A;  1LDD A;  1U9N A;  2CO5 A;  1Z6R A;  2EBI A;  3FXM A;  4RB2 C;  2W48 A;  1V5E A;  4HRI A;  4KIF A;  3ZN0 A;  2EIJ H;  2QQ9 A;  4BY1 J;  3F6V A;  3GFL A;  2ID6 A;  3PIO F;  1A6Q A;  1B72 A;  1XMA A;  4ESF A;  4EJV A;  3MQ0 A;  4J19 A;  2IAI A;  2P5K A;  3QYE A;  2DA4 A;  1OCO H;  4KMU X;  1ZRE A;  1E17 A;  2X6W A;  2K86 A;  5FJ8 J;  3ZQL A;  2LF7 A;  2GBY A;  1XPX A;  4XID A;  3J7A Y;  3P5J A;  1W5C C;  1YQA A;  3GCM A;  2A6T A;  1R1U A;  3S1N J;  2G7U A;  1HA8 A;  2W57 A;  3AG1 H;  3GZ5 A;  4YEL A;  4M6V A;  4XQF A;  3C2B A;  4FE4 A;  2XKO A;  3J81 Z;  1UJ8 A;  3FIW A;  3DEW A;  4FT8 A;  4HLY A;  4NBQ A;  2V9P A;  2F48 A;  1MSF C;  4KN4 X;  1S6L A;  1U5T B;  4AYB A;  2EJR A;  2OTJ I;  4BY7 J;  4HF0 A;  2F2E A;  2H8W A;  3H35 A;  1WI3 A;  4L5E A;  2DJN A;  3FXU A;  1YYV A;  3BJ6 A;  3HOV J;  4MGR A;  3I64 A;  1Y56 A;  4Q48 A;  4B4C A;  1MBH A;  2EQR A;  4M6X A;  3HHH A;  4L9T A;  2OPT A;  2JQ7 A;  1DQU A;  3Q0W A;  1D1C A;  2O9L A;  4GO1 A;  2ADU A;  1X19 A;  2V9K A;  1WJE A;  4ENN A;  4I98 B;  4UY8 I;  1IXS B;  3QPT A;  4OIO F;  3KET A;  4BXU A;  5B3S H;  4BDZ A;  1STZ A;  4GGG A;  4Y17 A;  1U2W A;  2W24 A;  1LKX A;  3LST A;  1YS6 A;  1JKQ C;  2L01 A;  2PLY A;  5GAD J;  5F0F A;  1LDK B;  1R5H A;  3R0J A;  2R5Y B;  4AIK A;  2JA5 J;  3SZT A;  2L7K A;  4F92 B;  4RAZ A;  2NNN A;  2BE5 F;  1S7E A;  1S29 A;  1QVU A;  3H9J A;  1I1S A;  1CF7 A;  3S15 J;  5DV5 A;  1FZP B;  5D8L B;  1MSE C;  3S3O A;  3GWZ A;  2KIU A;  3V42 A;  5IPA A;  4BEH B;  3K4B A;  3ZR8 X;  3VYS B;  1J09 A;  1D8K A;  3FDY A;  4LD5 A;  2OF7 A;  1TTY A;  2DMT A;  2RN7 A;  2Y9Z A;  2GQQ A;  4M74 A;  2PMZ N;  3W2A A;  1T98 A;  3MZY A;  4XKW A;  2W84 A;  5DUI A;  5E3O A;  1W0U A;  5FRN A;  1V3F A;  1Z7U A;  3C2G A;  3KLN A;  4KA4 A;  2V9V A;  5ICF A;  4G7Z F;  2VJI A;  3H3U A;  3T1B A;  4A93 J;  3NWS A;  3ULQ B;  5GAH J;  3QOP A;  3TW7 A;  2HVQ A;  2JRT A;  3HSR A;  2VKE A;  4HDV A;  3LA7 A;  2ME6 A;  3DPU A;  5KAI C;  2DK8 A;  1TW3 A;  2ZKZ A;  1A35 A;  4P9F A;  3S8P A;  2V1U A;  3IL2 A;  4BL0 B;  3HC7 A;  2DPU A;  3CUQ B;  1Z91 A;  3K4J A;  1HKS A;  2IRF G;  2Y0S A;  1W7P A;  3PFI A;  4L9J A;  1VQL I;  1WJ5 A;  2K9N A;  5H20 A;  3RPU A;  1FEX A;  3HEF A;  2R5Z A;  4QPO A;  2VOP A;  3JR9 A;  1ETV A;  3MEX A;  1SEU A;  1B59 A;  1LDJ A;  3QQA A;  3MKL A;  3PJR A;  4IHY A;  4PJ0 C;  3D0S A;  1PP8 F;  1HKQ A;  2HDD A;  2NVU B;  2IGK A;  4MNU A;  3EUH A;  1WJD A;  4R8H A;  1APL C;  1MH4 A;  2MD5 A;  2WAQ N;  4FX0 A;  3VWB A;  3JW4 A;  1J59 A;  1MZB A;  1MBE A;  4M3E A;  2JSP A;  4UV9 A;  1TZL A;  3Q9S A;  2EIN H;  2K4J A;  1GXQ A;  2WBM A;  1HBX G;  3GFJ A;  3HGY A;  2R7V A;  1XB4 A;  5DEQ A;  4BQO A;  4HZF A;  1OR7 A;  1FWZ A;  1KU9 A;  1OYW A;  2VB6 A;  5EGO A;  4ESJ A;  2DA7 A;  1G4D A;  1BC8 C;  1FPQ A;  2ZXJ A;  4JYK A;  2KIS A;  2DMU A;  4BNC A;  1V4R A;  1VTN C;  1D3Y A;  1UZC A;  3S1M J;  3WTY C;  1AKH B;  4ZYH A;  4WK8 F;  5J8F A;  3L9F A;  4BGD A;  2F5C A;  2JMW A;  5KHD A;  2KIQ A;  2VBZ A;  1H0M A;  1VQ8 I;  2R7R A;  4HF2 A;  4KIT B;  2HS5 A;  4A2U A;  1OFC X;  2ZXI A;  1HC8 A;  4LLL A;  2YX4 A;  1FYK A;  4B09 A;  1GUU A;  1TLH B;  2XRL A;  2OAZ A;  5E1Z B;  4BE1 A;  4RB1 A;  1LEA A;  1VI0 A;  2QGU A;  1F5T A;  3TQN A;  5HLI A;  2UXX A;  2GZW A;  3WTU C;  3L2C A;  1ZRF A;  4XRS A;  3CC7 I;  3F6O A;  2Y0M A;  2A6E F;  4ZYE A;  4P9U A;  3DBL B;  4RGS A;  1K6Y A;  3CCR I;  5CVR A;  4EEF G;  1QZE A;  2VAS A;  4BJ5 C;  4BHB A;  4BU2 A;  1P92 A;  1GV5 A;  2ZCW A;  4D5F A;  3HOS A;  3LFK A;  2J5P A;  2ACJ A;  5ILS A;  4BAC A;  1MH3 A;  2ESN A;  4ZTJ A;  3I4N J;  4XM3 A;  4KFC A;  1ZAO A;  2K3F A;  3GBG A;  3P9I A;  3KPH A;  4KJZ A;  1ETX A;  5DS9 A;  4IZZ A;  4C9Y A;  3GF2 A;  2M7B A;  5H6Q A;  2MLG A;  3KEO A;  2RC4 A;  4IPA A;  2KZG A;  3A02 A;  1R6R A;  2WB1 A;  3CC2 I;  3H5A A;  5J3L A;  5EG0 A;  2ZBK A;  2GA2 A;  2FEZ A;  4DYQ A;  3BG5 A;  2G7H A;  4Z2Y A;  3P9C A;  5D8K B;  1MMN A;  2P8T A;  3FZV A;  4RS8 A;  2GLO A;  5JLX A;  1ODD A;  1SMY F;  5TIS C;  4BXX J;  3DQV C;  2DA3 A;  3BJO A;  1FT9 A;  1V54 H;  2FMY A;  2FX0 A;  2LD5 A;  4U7B A;  3KP7 A;  3G73 A;  2L54 A;  2R7O A;  2KRF A;  3H5N A;  2JVG A;  2OCE A;  1X2N A;  2WTE A;  2DQR A;  1O4X A;  1IZ1 A;  1SFX A;  1ZTR A;  1YLF A;  2EA2 A;  2WAQ A;  1KA8 A;  2K85 A;  3H36 A;  2X48 A;  2OQR A;  1K83 J;  2V1N A;  1DGR M;  3KP6 A;  3PSF A;  3QRF F;  3SDB A;  5LRR A;  1T39 A;  1LEB A;  1FIA A;  4YFX F;  3V4G A;  2E36 A;  3E6M A;  3KP4 A;  4PCQ A;  1U6G A;  5LGU A;  4FCY A;  1O7F A;  3CCS I;  2FML A;  1XCV A;  2DPD A;  1IXR C;  2FBK A;  3DU6 A;  1SD4 A;  1Z9C A;  1TWH J;  2R7U A;  5E79 C;  3OYC A;  3LSJ A;  2COB A;  2FE3 A;  5IT9 Z;  4P96 A;  3PUB A;  5FLX K;  2GXB A;  1YW8 A;  3M1E A;  3ZMT A;  1BL0 A;  2K9S A;  2LMD A;  3HYI A;  5J6X A;  3G6E I;  2RNJ A;  1KGS A;  2HEO A;  2CQ7 A;  1JJ6 C;  3NAU A;  3T5X A;  4B44 A;  2IXS A;  5F08 A;  1OCT C;  1WWX A;  4RDU A;  1I6H J;  1SFK A;  2D2W A;  5LGT A;  1UHS A;  2J5O A;  5HLH A;  5HNF A;  5GTH C;  4LG3 A;  5CVI A;  2K02 A;  3QPS A;  3NWT A;  2TCT A;  4XBF A;  5E1X A;  2E1N A;  2KIF A;  3FM3 A;  3HTU A;  4A6D A;  2ZNY A;  2HPM A;  1DU6 A;  3GTJ J;  3H1C A;  3K4M A;  5LEJ A;  4MQV A;  1DPR A;  1XC5 A;  5GP9 A;  1R5I D;  3ABU A;  3TP0 A;  1POG A;  1BW5 A;  4CYC B;  3RQ4 A;  2XSD C;  4UUV A;  4ZZD A;  3JCU C;  4ZDO A;  2VKH A;  5K7Z A;  4HA8 A;  1EV7 A;  2DTR A;  3LA2 A;  1NH3 A;  3I4P A;  4D7M A;  2DQL A;  4HSR A;  2CWE A;  3LFU A;  3F0C A;  2HQA A;  3E1S A;  3FF5 A;  4XLH A;  3E5X A;  2AS5 F;  3GVA A;  5EEA A;  5K5Q A;  2IA2 A;  3LOC A;  2QBY A;  2YS9 A;  2VBY A;  3BG6 A;  3HUG A;  5HOO A;  2PQ8 A;  2F4O B;  3KEQ A;  2RQP A;  3M7G A;  1T33 A;  1EA3 A;  1X58 A;  3QPL A;  4PJM A;  4CZC A;  3ERE D;  3O8G A;  1R7J A;  5FRO A;  4E7I A;  2W1O A;  4UVC A;  5CQE A;  3V7R A;  3F23 A;  1BR2 A;  2CQN A;  3OIP A;  2MFZ A;  4CYD A;  4WXC A;  1JXS A;  2VI6 A;  2PFB A;  2BYV E;  2MH2 A;  4F7Z A;  5FRM A;  3CJN A;  3AG3 H;  2XB0 X;  4AID A;  5IT9 K;  3DBH B;  1X3Z B;  3HDD A;  2DFF A;  5H6R A;  3K1P A;  2XPU A;  4FQG A;  3LSK A;  1FY7 A;  3K70 C;  3HOT A;  5E3L A;  3BR2 A;  2WV1 A;  2CS3 A;  4EAT A;  3E6C C;  2Y48 A;  2VPL A;  1BJZ A;  2LY9 A;  2OC6 A;  3TO6 A;  2F5D A;  1Q1V A;  3L1P A;  2VIX A;  4K2E A;  1JGS A;  2DFH A;  1YG2 A;  3AKZ A;  3OS1 A;  4NUB A;  4IOC F;  4CIC A;  4GRI A;  3PQJ A;  2L02 A;  2WV0 A;  3FM5 A;  5DM6 F;  3F3X A;  2B63 J;  2CRG A;  2IA1 A;  1JKO C;  2DA6 A;  4A3G J;  3HBL A;  1GVD A;  4AD9 A;  1MMD A;  2HOA A;  2LK2 A;  1AOY A;  2JA6 J;  3PSI A;  2STT A;  4S04 A;  1S7O A;  2LBF A;  2QEX I;  3IWZ A;  3GTG J;  2UWM A;  1HOM A;  4FHT A;  2Z16 A;  4M73 A;  1LJ9 A;  4BBR J;  1ETQ A;  2ZNZ A;  1S8N A;  1EH7 A;  2Y31 A;  4L5J A;  2IVM A;  2IS6 A;  3G1L A;  2XAU A;  3Q0U A;  4Q5S F;  5EYR A;  4F52 A;  2DLL A;  4PSX A;  3QP6 A;  3C3W A;  4A3K J;  3F8N A;  2VLA A;  1U3E M;  1Z1D A;  2E5Z A;  1JKP C;  2OUM A;  5IP9 J;  3A03 A;  2WC2 A;  1T2K A;  1X1B A;  5LHH A;  3A01 B;  1RC9 A;  2EK5 A;  2KHM A;  3DBR B;  4NHJ A;  2KRH A;  5DCM A;  4XOT A;  1V5F A;  4L0Z B;  1G3T A;  1ETK A;  1DPU A;  4IKF A;  1USS A;  5J1U A;  4XLC A;  4RLQ A;  1X3U A;  2FOW A;  3HZJ A;  3H3V K;  1UG0 A;  3CP2 A;  2Z9O A;  1FYL A;  5C4X J;  2IS2 A;  4XLA A;  1JHH A;  3Q0V A;  1XDU A;  2FXA A;  1F36 A;  2VJ4 A;  1R5G A;  3DTI A;  3HRM A;  4EJW A;  2HWV A;  2JA7 J;  1R23 A;  4E7J A;  1OIS A;  4M3F A;  3TOA A;  2QCO A;  4AIH A;  5KVR A;  3AG4 H;  2XAG A;  2A69 F;  2MSY A;  4Y3O A;  3ASO H;  1E3P A;  1IRF A;  4G12 A;  4V2F A;  2EV5 A;  3OMY A;  1ETW A;  4RB0 A;  4R1H A;  5CPR B;  2L2O A;  4B8X A;  2DA2 A;  3I4M J;  2L3D A;  5HS8 A;  4U7D A;  3FXR A;  1MBG A;  1U5T A;  2VQG A;  4KN7 X;  4PZJ A;  4I0B A;  5HDN A;  2XAH A;  2OU2 A;  4HV5 A;  3DPL C;  2XF5 A;  4L0Y B;  2FSW A;  1DP3 A;  1WH7 A;  1GT0 C;  4GYI A;  3Q3S A;  2F5F A;  3KX2 A;  4C2T A;  1YFH A;  4E7K A;  1XG1 A;  3CQZ J;  2LKS A;  2L9S A;  3CD6 I;  4CSW A;  2OD5 A;  3BG9 A;  4F3Q A;  2ZJP F;  3HRU A;  2F6C A;  2NVY J;  3K4L A;  3MAJ A;  2EPF A;  1HF0 A;  2F5V A;  2WAF A;  3DEU A;  3C2H A;  3PNY A;  1Z7L A;  1SAN A;  2E34 A;  2O61 A;  4PK4 A;  2DK5 A;  3JRH A;  4D0P A;  4YIF A;  3ELK A;  3J7A O;  2EIL H;  4DQ2 A;  4HV6 A;  2ZME C;  3OYN A;  4B1R A;  2QSH X;  1G59 A;  2NS0 A;  4PJJ A;  4M3D A;  5FKN A;  2K4B A;  3L00 A;  3KP3 A;  3BZK A;  2D5V A;  3VYU B;  1IF1 A;  2KZV A;  1QNT A;  4Y7N J;  1R22 A;  1YJ9 I;  2YR2 A;  2E19 A;  4HX7 A;  4BEH A;  3G1O A;  1Y1V J;  5HS9 A;  2FQ4 A;  3CUO A;  2DXI A;  4PGG A;  3VYT B;  3M1C A;  4BUP A;  3ZMZ A;  2XGC A;  4P1W A;  2Z99 A;  4IX7 A;  3TGN A;  2LBF B;  1MJB A;  1I6X A;  1WVR A;  4OU0 A;  2X1E A;  3IH4 A;  3VFZ A;  1J5Y A;  1W1W E;  1Y0U A;  2UV1 A;  2OTL I;  4I99 C;  4MIM A;  5CVJ A;  3AFH A;  2W82 A;  2QVO A;  4ZZL A;  1QRY A;  4QSH A;  5BNG A;  3D5R C;  3U21 A;  3L7W A;  2K7L A;  1SFE A;  3RCO A;  5BQT A;  1TNS A;  2VOO A;  4E7L A;  5LFA A;  2ZJR F;  2A68 F;  3FBN B;  3I58 A;  1ORK A;  1NG6 A;  2MLK A;  4GXO A;  4JP0 A;  3U1K A;  1QU3 A;  2E7W A;  3CLO A;  5JVT A;  5KNL A;  1R71 A;  3BDD A;  2LOO A;  1RPW A;  5ILU A;  4XK4 A;  4RGR A;  4C30 A;  4A12 A;  2X4H A;  3K10 A;  3CMA I;  4HPQ A;  3CUQ A;  2OZU A;  4HST A;  1XSX A;  1HST A;  1WH5 A;  2CGP A;  1ZGJ A;  2EWN A;  1U0J A;  1IN4 A;  4II2 A;  1FJL A;  2DO7 A;  3OV8 A;  2DCE A;  1BM9 A;  2EV0 A;  3E97 A;  5B1B H;  3K2Z A;  3S93 A;  2LDU A;  1IJW C;  3DKY A;  4XRM A;  4EJU A;  4L18 B;  2K9M A;  2FQ3 A;  1HSJ A;  4BQN A;  3JTG A;  1PP7 U;  3F22 A;  2VXD A;  4ZH4 F;  3O8H A;  3T8T A;  2VT2 A;  2IGO A;  2DMQ A;  2FOK A;  4XSX F;  5FKM A;  4EM1 A;  1D0Y A;  2M0M A;  2M45 A;  3IRQ A;  3I3L A;  5F1R A;  2XF7 A;  5LHI A;  1FC3 A;  4NNJ A;  2DOA A;  3I71 A;  1K4T A;  4WX9 A;  5IYD J;  3BP8 A;  5F64 A;  3ECO A;  4N4O B;  3SEQ A;  3JRI A;  4C3J J;  2DT5 A;  3HXL A;  3K69 A;  1PJR A;  2LY2 A;  2XRN A;  4LK1 F;  1XDS A;  4JX4 A;  1WZ2 A;  4IQ4 A;  2VE8 A;  2R3S A;  3WE3 A;  3WU0 A;  5M5X J;  2VUM J;  5J1R A;  2H94 A;  3W2V A;  3L2V A;  1S9H A;  4IRG A;  1QQI A;  2M8G X;  2YX7 A;  1AKH A;  6PAX A;  4BHP A;  3JRF A;  4PDK A;  5LGN A;  2IT0 A;  4XN0 A;  1J9I A;  1QHH D;  4UUT A;  3RTR A;  5IT3 A;  2DN0 A;  4IJA A;  4CA0 A;  1E3O C;  3R60 A;  1A04 A;  2N8G A;  2GOM A;  3G1M A;  1ZYR F;  3DV8 A;  1FIP A;  3HHG A;  2KP6 A;  1K7A A;  1TWA J;  4HQM A;  4LB5 A;  1YO5 C;  5ICC A;  3TO9 A;  5BPI A;  4KUM A;  3NRV A;  3OOP A;  2VQL A;  1TBX A;  3FHN A;  3D5L A;  2JA2 A;  2DW4 A;  5FKK A;  3FXJ A;  4E70 A;  4OAY A;  1SD6 A;  1W4M A;  2Z1D A;  1KON A;  2MBF A;  2Q8K A;  2L7Z A;  2XAS A;  1JTY A;  1G6N A;  5B66 C;  2XPV A;  2DT7 B;  3BT9 A;  5GPA A;  1DP7 P;  4F93 B;  1O3R A;  4G6Q A;  5IP7 J;  4P55 A;  2OV7 A;  1P4X A;  2PN6 A;  2BOL A;  2XGX A;  2H6C A;  2FA5 A;  2NOG A;  2Y9Y A;  1SVO A;  1YX5 A;  3JTH A;  2I8D A;  3PFY A;  3VEP A;  1IUF A;  3LQQ A;  2DFE A;  1Y39 A;  1BIB A;  3HKZ N;  2CQX A;  1J75 A;  2OQG A;  1RR8 C;  4BHC A;  2DT6 A;  2CU7 A;  4HX8 A;  3LWF A;  2FBI A;  2L9R A;  4KT6 A;  2HDW A;  3CCE I;  5D6E A;  1NG7 A;  1MJ9 A;  3M4O J;  2MYS A;  3LNQ A;  1XX5 A;  2CSO A;  4XOR A;  4XRS G;  3JAM Z;  5AIP A;  4A3D J;  5LEK A; 
#chains in the Genus database with same CATH homology
 1HLV A;  4NDL A;  2Y30 A;  1ITY A;  2DA3 A;  2O8K A;  4D7N A;  2FX0 A;  1X2M A;  2LD5 A;  5F0H A;  1UMQ A;  3OSF A;  2ECC A;  2LLK A;  4ABZ A;  1X2N A;  5E3N A;  5F27 A;  4FE7 A;  1O4X A;  1ZTR A;  2LKX A;  5EDN A;  5M3F J;  1Y1W J;  1I3Q J;  1BA5 A;  3NAR A;  2X48 A;  1K83 J;  2MG4 A;  2XPW A;  1FIA A;  2HOS A;  5C4J J;  1JUM A;  3ZQF A;  4FCY A;  2X6O A;  1HDD C;  2ID3 A;  1H8A C;  1IDY A;  1JGG A;  1TWH J;  4M3B A;  3LSJ A;  2COB A;  2M34 A;  2DMN A;  3JRA A;  1BL0 A;  4MLO A;  2K9S A;  3RZO J;  4A3E J;  2HYJ A;  3ZQI A;  2NS7 A;  1PUF B;  4A3J J;  1JJ6 C;  3NAU A;  3ZQH A;  1R9T J;  3RQI A;  3GTK J;  2Y0S N;  1NTC A;  5F08 A;  2XGD A;  1OCT C;  3RZD J;  3GTM J;  2K40 A;  4MFE A;  3SFI A;  4RDU A;  2P81 A;  2JK3 A;  4IEJ A;  1I6H J;  2ELK A;  3IV5 A;  3HOX J;  1PUF A;  1UHS A;  5K7H A;  1EF4 A;  1WGX A;  2LTP A;  4MO7 A;  4DW6 A;  2L7M P;  3BTL A;  3QPS A;  1WCM J;  1RKW A;  2TCT A;  1JTX A;  3PO2 J;  2KDZ A;  3JRD A;  1IG7 A;  1IGN A;  4A3I J;  1DU6 A;  5EZG A;  3GTJ J;  3HGG A;  1JUS A;  5FKL A;  1F43 A;  1JT0 A;  1XC5 A;  5GP9 A;  1RES A;  4W1U A;  1U78 A;  4W97 A;  2NVX J;  1MBJ A;  5K7F A;  3TP0 A;  1POG A;  2E2H J;  3GTQ J;  4A3C J;  1BW5 A;  1HDP A;  5FLV A;  2L0K A;  2LFB A;  5E3M A;  4CYC B;  3CDL A;  2XSD C;  3FKI J;  3BG3 A;  2YU9 J;  2KT0 A;  3BTJ A;  5K7Z A;  2EZH A;  2AO9 A;  3WHC A;  4AYB N;  4CYC A;  4D7M A;  4QIW N;  5FKO A;  4A3L J;  3F0C A;  2H1K A;  1U9O A;  2DMP A;  5EEA A;  4C3I J;  1H89 C;  3LOC A;  1T56 A;  2YS9 A;  1ZGW A;  2ZB9 A;  2HQ5 A;  1Z0X A;  4QTR A;  2CQQ A;  1T33 A;  1X58 A;  3QPL A;  3O8G A;  2XGE A;  5IOZ A;  2VI6 A;  4AUX A;  2R5Y A;  2Y2Z A;  1IDZ A;  5F0C A;  2XB0 X;  5IP6 A;  1LE8 A;  3OSG A;  3HDD A;  3PO3 J;  4I76 A;  1WPK A;  2XPU A;  3WHB A;  2RAE A;  1VF9 A;  2DTZ A;  5E3L A;  3BR2 A;  2WV1 A;  1IV6 A;  1AHD P;  3S14 J;  3RKQ A;  2JN6 A;  1BJZ A;  2HXI A;  2LY9 A;  3MN2 A;  1K61 A;  1Q1V A;  3L1P A;  1QVT A;  2MW8 A;  2NS8 A;  1GDT A;  4A3F J;  2JWT A;  2B63 J;  1ZKG A;  5EF6 A;  4AC0 A;  2HXO A;  2CRG A;  2XB5 A;  4UUS A;  3UKG A;  1JKO C;  2DA6 A;  2R0Q C;  5M5Y J;  2NVT J;  4A3G J;  3B6C A;  3HBL A;  3BQY A;  1GVD A;  3DCF A;  2HOA A;  2E1O A;  2LK2 A;  3BR1 A;  2JA6 J;  1Z77 A;  2DA5 A;  3GTG J;  2WB1 N;  1QPI A;  4FIS A;  1HOM A;  2G0E A;  2R7Z J;  4IHV A;  4BBR J;  1ETQ A;  2Y31 A;  1IRZ A;  3G1L A;  3MVP A;  1ENH A;  3Q0U A;  5EYR A;  4GFB A;  2HOT A;  3HOY J;  2EZK A;  3FK7 A;  4A3K J;  3HOU J;  2L7F P;  2VKV A;  1RET A;  4X6A J;  1RKT A;  1U9N A;  2EBI A;  1JKP C;  5IP9 J;  3A03 A;  3HM5 A;  1B72 B;  2W48 A;  3VPR A;  3A01 B;  2QF7 A;  2I10 A;  2HI3 A;  4BY1 J;  1A6I A;  2JA8 J;  2ID6 A;  1ETK A;  2ME0 A;  1CQT A;  4JX5 A;  1B72 A;  5J1U A;  3A01 A;  4BKX A;  1TWG J;  4J19 A;  2IAI A;  3H3V K;  2DA4 A;  5C4X J;  3S17 J;  5FJ8 J;  3ZQL A;  2GBY A;  2EZI A;  3Q0V A;  1F36 A;  2FD5 A;  4XID A;  3D1N I;  3S1N J;  2JA7 J;  4M3F A;  1ZR2 A;  4M6V A;  2O7O A;  3C2B A;  2QCO A;  4FE4 A;  2VPR A;  2LR8 A;  3FIW A;  1MNM C;  3DEW A;  4DZJ A;  2MSY A;  2DA1 A;  4D5C A;  5M5W J;  4G12 A;  4BBS J;  1MSF C;  4V2F A;  3OIO A;  4IHX A;  1ETW A;  4BY7 J;  2R93 J;  4L5E A;  1WI3 A;  1OCP A;  2DA2 A;  2DJN A;  3I4M J;  1MBF A;  3HOV J;  1MBG A;  4V2G A;  4A69 C;  1DU0 A;  1JKR C;  3JRG A;  4Y52 J;  4B4C A;  1MBH A;  2LP0 A;  2EQR A;  4B3A A;  3TW6 A;  1WH7 A;  2OPT A;  1GT0 C;  9ANT A;  3Q0W A;  1ZK8 A;  3Q3S A;  1ETO A;  2O9L A;  4M3G A;  1XG1 A;  3CQZ J;  4A3B J;  1TWC J;  3K7A J;  1P7J A;  3BG9 A;  2H8R A;  1TWF J;  2NVY J;  4C3H J;  1JKQ C;  3W6V A;  1HF0 A;  5M3M J;  2IEK A;  5F0F A;  3HOW J;  1SAN A;  5EZH A;  3S2H J;  3JRH A;  1UG2 A;  2R5Y B;  2JA5 J;  1I50 J;  3HOZ J;  1LE8 B;  2K9Q A;  3FIS A;  1S7E A;  2EH3 A;  1QVU A;  3S15 J;  3TP3 A;  4B1R A;  1MSE C;  3BQZ A;  5IPA A;  4M3D A;  5FKN A;  1GV2 A;  4HNV A;  2D5V A;  4X1E A;  4Y7N J;  1TC3 C;  1NK3 P;  2OF7 A;  2DMT A;  2E19 A;  2Y9Z A;  3E7L A;  2PMZ N;  3G1O A;  2AHQ A;  3PM1 A;  1LFB A;  1Y1V J;  4C2M J;  4UUS B;  2FQ4 A;  5E3O A;  1W0U A;  3JRB A;  4I6Z A;  2XGC A;  4MFD A;  3IH4 A;  4DYC A;  1P7I A;  3JRE A;  4A93 J;  4MIM A;  5HOD A;  2MGQ A;  3HB9 A;  3TW7 A;  2VKE A;  1QRY A;  4QSH A;  4A3M J;  5BNG A;  1LFU P;  2ME6 A;  3BR6 A;  1ETY A;  4JX6 A;  3LSP A;  2LVS A;  1ORK A;  1VFC A;  4JP0 A;  5GPC A;  2X9D A;  4DZP A;  1ZR4 A;  2R5Z B;  2CUE A;  1RPW A;  4XK4 A;  4FTH A;  3GTL J;  1FTZ A;  2K9N A;  3S1Q J;  1FEX A;  3HEF A;  2R5Z A;  3BR0 A;  3JR9 A;  1ETV A;  1WH5 A;  4IHW A;  3QQA A;  4IHY A;  3S16 J;  3MKL A;  1JT6 A;  1FJL A;  1H88 C;  3SDG A;  2HDD A;  5IOY A;  4RBO A;  1APL C;  1FTT A;  1MH4 A;  2WAQ N;  1IJW C;  4XRM A;  3OOU A;  2CUF A;  2M0C A;  3LSR A;  3IH3 A;  1MBE A;  4M3E A;  1IC8 A;  3JRC A;  5JLW A;  3ZQG A;  5EGO B;  3O8H A;  3TED A;  2R92 J;  5FKM A;  2DMQ A;  3HGY A;  1JUP A;  2E2I J;  2JJ7 A;  1XS9 A;  5EGO A;  5IYB J;  2DA7 A;  5IYD J;  4JYK A;  1G2H A;  2DMU A;  1MBK A;  3JRI A;  1U8B A;  4C3J J;  3LSG A;  1B8I B;  2IBD A;  3B6A A;  3IH2 A;  3K2A A;  4JX4 A;  4S0H B;  1ZQ3 P;  1AKH B;  3S1M J;  3GTO J;  5DTD A;  3SJM A;  2FJ1 A;  5M5X J;  1B8I A;  2JMW A;  2VUM J;  3BR3 A;  5J1R A;  2M9H A;  2M8G X;  3FK6 A;  1AKH A;  3JRF A;  1OFC X;  3S1R J;  1JJ8 C;  1A5J A;  1GUU A;  2XRL A;  4UUT A;  1E3O C;  2DN0 A;  5C3E J;  2N8G A;  1VI0 A;  3G1M A;  1FIP A;  1TWA J;  4XRS A;  1D5Y A;  3H0G J;  5IYC J;  4LOC A;  4EEF G;  5FKK A;  2TRT A;  4XIC A;  2L7Z A;  1JTY A;  1YRN B;  2CJJ A;  2XPV A;  2EZL A;  3BT9 A;  3BTI A;  1GV5 A;  5GPA A;  4D5F A;  1SFO J;  2E2J J;  5IP7 J;  1NK2 P;  1W0T A;  1MH3 A;  2YUS A;  3S2D J;  2NOG A;  1YRN A;  2ECB A;  3I4N J;  5J1Y A;  3ZOB A;  2Y9Y A;  3M3Y J;  5F1J A;  3GBG A;  1VND A;  5DS9 A;  1ETX A;  5EG0 B;  3BTC A;  2GM4 A;  1IUF A;  5F04 A;  3A02 A;  3HKZ N;  2CQX A;  2NVQ J;  5FLM J;  5J3L A;  5EG0 A;  2CU7 A;  1AU7 A;  3GTP J;  4DYQ A;  5C44 J;  2L9R A;  3BG5 A;  2M2E A;  4DYR A;  3M4O J;  3LNQ A;  2GLO A;  4XRS G;  3CMY A;  5JLX A;  3BR5 A;  1RR7 A;  4A3D J;  3CCY A;  3ZQC A;  1BW6 A;  4BXX J;  1HCR A;  1OJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...