5EEAA

Structure of hoxb13-dna(caa) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*TP*TP*GP*TP*GP*TP*TP*TP*TP*AP*TP*TP*GP*GP*GP*TP*
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 62
sequence length 62
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eeaA00
3ZQCA 3S15J 5FKOA 5JLWA 3JR9A 4A3DJ 1JUPA 2DA5A 3ZOBA 1ZKGA 2R5YA 5IOZA 4A3LJ 3S16J 3Q0VA 1VNDA 4FISA 1HF0A 5EG0B 2KT0A 4C3HJ 5FJ8J 2EZIA 3HOXJ 1IGNA 5F0CA 1HDPA 4I76A 2ECCA 2DMUA 2LKXA 3GTPJ 2DA2A 1U9NA 2CUFA 2DJNA 3HBLA 3FIWA 2XRLA 4AUXA 5HODA 5K7ZA 4JP0A 3JRFA 2JA7J 1YRNA 2P81A 4DZPA 3S17J 1XC5A 2XPWA 3NAUA 4RBOA 3B6AA 2FJ1A 2JA8J 1X2NA 3JREA 4G12A 1TWHJ 5E3NA 4QIWN 5J1UA 2D5VA 3ZQIA 4L5EA 3JRGA 3BTLA 1UHSA 1PUFA 3PM1A 1WGXA 4M3GA 4BBSJ 3TEDA 1YRNB 2MW8A 2E1OA 2WAQN 3BTIA 2QF7A 2L9RA 1DU6A 1FJLA 1B8IA 2DA3A 4XICA 4MFEA 2EZHA 2XSDC 2CU7A 2VPRA 1LFUP 1LE8A 1RKTA 3HOYJ 1XS9A 1PUFB 2XGDA 1Q1VA 4C3IJ 5J1YA 3FKIJ 1FTTA 1ETWA 1B8IB 3I4NJ 5F08A 4S0HB 4IHWA 1LE8B 3LSPA 5J3LA 2ZB9A 2MG4A 4W97A 5F27A 4BBRJ 2YS9A 2NVXJ 3FK7A 2YUSA 1NK2P 2WB1N 1UG2A 2NS8A 2MGQA 3E7LA 1QRYA 5EEAA 1MBEA 4A3BJ 5EGOA 2ID3A 2DMQA 4FTHA 1HLVA 4JX4A 4Y7NJ 3JRBA 1AHDP 1BA5A 2IBDA 2DMTA 3Q3SA 1ZQ3P 1H89C 4AC0A 1HOMA 2AO9A 1JTXA 3HDDA 5EZHA 3HOWJ 3ZQLA 1U9OA 1NK3P 5J1RA 5EGOB 1IJWC 3GTLJ 2LFBA 2XPUA 5E3LA 3BR6A 2NS7A 4V2FA 1ZR2A 5C3EJ 4A3FJ 1FIAA 1VI0A 4XRSA 1ETOA 1WPKA 4QTRA 1ORKA 3BG3A 3BR3A 3DCFA 3W6VA 1IRZA 2XB5A 4A3MJ 2EZLA 1JTYA 3HEFA 3TW7A 5K7HA 3RZDJ 4FCYA 1DU0A 1BW6A 1U78A 4DYCA 4JYKA 4D7NA 2XGCA 2Y9YA 1ENHA 4B1RA 4XRMA 2HOSA 1GT0C 1D5YA 2M34A 1WI3A 2IEKA 4A69C 2LK2A 2JN6A 4W1UA 1POGA 1IG7A 1EF4A 3B6CA 4NDLA 3S1QJ 5IYBJ 1ZR4A 4D5FA 2ME6A 1AU7A 3BG9A 1ETVA 3F0CA 4XIDA 4M3FA 4FE4A 2LD5A 1W0UA 1HDDC 1F43A 2HI3A 3O8GA 5GPCA 1B72A 2Y31A 1I3QJ 3LNQA 4M3BA 2CQQA 1MSEC 1JT6A 2DA4A 2G0EA 3RKQA 5GP9A 2GBYA 5EZGA 2FX0A 3OSFA 4Y52J 3IV5A 1FTZA 3O8HA 2H1KA 2CUEA 1TWCJ 2E19A 1B72B 5FKLA 2R5YB 2FD5A 3GTGJ 2VUMJ 2DA7A 5M5YJ 3BR5A 3MVPA 4CYCA 3BQZA 3TP0A 2Y0SN 2TRTA 2CQXA 1WH7A 1WCMJ 2VKVA 1VFCA 2O9LA 1I50J 4X6AJ 1P7IA 3SJMA 4GFBA 2L7MP 3S14J 1T56A 5IP6A 4CYCB 4MO7A 3RZOJ 1GUUA 3GTQJ 3A03A 4M6VA 3M3YJ 2Y30A 4X1EA 2COBA 9ANTA 4DYRA 3HGYA 3BR2A 4EEFG 3BTJA 2LVSA 2NVQJ 5FLMJ 4LOCA 4D5CA 4IEJA 1G2HA 4M3DA 3GTJJ 1IDZA 1W0TA 2EH3A 1Y1VJ 3LOCA 4RDUA 3BQYA 4D7MA 1JKOC 2HXIA 4A3JJ 1ITYA 1T33A 1WH5A 2EBIA 3FISA 5FKNA 1O4XA 4V2GA 1MBKA 1ETXA 3IH4A 5FLVA 3S1NJ 1MBGA 1JUSA 2IAIA 1JGGA 1RETA 5BNGA 3MKLA 1MBHA 1RESA 1TWGJ 5FKKA 2K9QA 3I4MJ 1Y1WJ 3GBGA 1VF9A 5IPAA 1RR7A 2RAEA 3OOUA 4J19A 2L0KA 1SANA 3UKGA 2JMWA 4BKXA 2B63J 1TWFJ 1ZGWA 5DS9A 4A3IJ 1Z77A 1GVDA 3G1LA 3IH3A 1ETYA 5DTDA 2DTZA 2HYJA 1GV2A 2E2IJ 3G1MA 1TWAJ 4UUTA 2AHQA 5F0HA 3JRDA 4IHVA 1MH4A 1MSFC 2CJJA 2DMNA 4ABZA 1JUMA 1JT0A 4C2MJ 3BTCA 2PMZN 2OF7A 4MLOA 3S1RJ 1FEXA 1X2MA 3VPRA 3CQZJ 3Q0WA 3GTMJ 5M3FJ 3M4OJ 1APLC 5F04A 3TP3A 1HCRA 1ETQA 1BW5A 5IP7J 2R0QC 2M8GX 3LSRA 2DN0A 4XRSG 2WV1A 1XG1A 5M5XJ 4UUSA 5C4XJ 2TCTA 3LSJA 1OCTC 3CDLA 3HOVJ 1GDTA 3SDGA 2K40A 2NVYJ 1BL0A 2R92J 1IV6A 2Y9ZA 5C44J 4HNVA 3QPLA 1QVTA 3CCYA 2HOTA 2JWTA 4UUSB 1TC3C 3HB9A 3WHCA 1H8AC 1Z0XA 3NARA 2R5ZA 3SFIA 1E3OC 2JK3A 3QQAA 2O7OA 1MBJA 1GV5A 4FE7A 1F36A 2GM4A 1MBFA 2KDZA 1CQTA 3DEWA 5IP9J 5EDNA 2R5ZB 1AKHA 5GPAA 1ETKA 2K9SA 5EF6A 2M0CA 2W48A 5C4JJ 3JRCA 1K83J 1LFBA 2LY9A 2O8KA 3LSGA 2OPTA 1AKHB 5IYCJ 3CMYA 3A01A 3K2AA 3A02A 2N8GA 2VI6A 4BXXJ 4A3EJ 3S1MJ 4A3GJ 4DZJA 3JRIA 5IOYA 2X9DA 3BT9A 1JKRC 4DW6A 3HGGA 3WHBA 2XGEA 3A01B 3OIOA 3RQIA 2LTPA 2L7FP 1OFCX 4QSHA 1MH3A 2EQRA 3IH2A 4JX6A 1JJ8C 3ZQGA 5F0FA 2E2JJ 3HKZN 4B4CA 2EZKA 4B3AA 2GLOA 5FKMA 3ZQHA 2HDDA 5IYDJ 2L7ZA 4MFDA 1MNMC 5E3OA 2DMPA 4XK4A 3TW6A 1RKWA 1ZTRA 3JRAA 1P7JA 4BY7J 3FK6A 2H8RA 2R93J 3H0GJ 5M5WJ 5EYRA 2X48A 2XPVA 2Y2ZA 3H3VK 3HOZJ 1JKPC 2HOAA 1SFOJ 3G1OA 1FIPA 3PO2J 3D1NI 2LP0A 3S2HJ 3MN2A 5K7FA 2HXOA 5M3MJ 5F1JA 3PO3J 4IHYA 2MSYA 3Q0UA 3HM5A 1IDYA 1A5JA 1OJLA 2YU9J 1R9TJ 2CRGA 1IC8A 4A93J 3GTKJ 4I6ZA 1A6IA 3C2BA 1QPIA 4M3EA 2JA6J 2NVTJ 1OCPA 4A3CJ 4IHXA 2ME0A 2ECBA 1JKQC 2FQ4A 4C3JJ 3BR0A 3ZQFA 1H88C 3HOUJ 3BR1A 1IUFA 2JJ7A 3JRHA 1U8BA 2M9HA 5E3MA 3BG5A 3L1PA 1S7EA 1X58A 4MIMA 3QPSA 1JJ6C 2LR8A 4BY1J 4DYQA 1RPWA 3GTOJ 2K9NA 2X6OA 2DA1A 2I10A 3OSGA 1QVUA 2M2EA 1NTCA 1K61A 2JA5J 2LLKA 2E2HJ 1I6HJ 1BJZA 2NOGA 2VKEA 2ELKA 1ZK8A 3K7AJ 1UMQA 2ID6A 4AYBN 3S2DJ 2XB0X 4JX5A 2HQ5A 5JLXA 2R7ZJ 5EG0A 4A3KJ 2DA6A 2QCOA
chains in the Genus database with same CATH superfamily
1HKSA 3SQNA 3M1EA 4NBQA 1XSVA 5AIPA 5JLWA 4IX7A 2HFHA 4B09A 2DFEA 1D3YA 1HW1A 4OIQF 1ZKGA 1K6OA 1UAAA 3JAMZ 1W7PB 2F5DA 1S6LA 4E7HA 5CJ9A 1HF0A 4IRIA 1U5TA 3WE2A 2VPLA 2VOPA 2KT0A 2E1CA 2XAQA 3SZPA 1J59A 3EUAA 1IGNA 2QM3A 2FEZA 3NRVA 5ICGA 4F52A 4RM3A 2LKXA 4Q48A 1VTNC 2XAJA 2ICWG 3GCMA 2BY2A 4BQQA 2EFWA 2EFQA 2V7FA 1BI0A 3ASNH 2W25A 3P9CA 2ZXIA 3RYPA 2VC0A 2PJRA 2UXNA 4JP0A 3JRFA 3ZR8X 4BE2A 3KP7A 2PJPA 1O57A 1XC5A 3AL0B 2XPWA 2FJ1A 3OL3A 2JA8J 1I3AA 2CW7A 4H0EA 4CH7A 1TWHJ 3R0AA 3K4CA 4GYGA 2W82A 1VQOI 1BR1A 2V9PA 4E4HA 5J1UA 1D8JA 3K4NA 1XGMA 3GFLA 1ON2A 2L4MA 1PUFA 3MZ8A 4BBSJ 3H9JA 3K0LA 2D1VA 2MLKA 5DCMB 4O3MA 2MW8A 3R4KA 2E1OA 4ZZLA 4KFCA 1K79A 2L9RA 3CMMA 4EGYA 2EZHA 1RKTA 2K3FA 2L9NA 5HNFA 2UUZA 2Q1ZB 4C2UA 2BE5F 1Q1VA 2QQAA 4HSRA 4YFKF 1FTTA 1IZ1A 4BUPA 3HSFA 3X2QH 3I4NJ 5JR3A 2R7WA 1MZBA 2W84A 4EVIA 3K4LA 1WJDA 2NVXJ 1YJWI 3KLNA 3N97A 3HRMA 1BJAA 4L9TA 2ZC2A 5DD4A 5DM6F 1HKTA 1DPRA 4A3BJ 2MA3A 1OKRA 2DDBA 4WXHA 3CMAI 2RQQA 3FXRA 4Y7NJ 4C9YA 3JRBA 1R22A 1ONVA 2E36A 3TDUC 1AHDP 2X51A 4ESBA 1Z6RA 2DCEA 4XKCA 3CCEI 1H89C 5D6EA 2AO9A 1TTYA 1JTXA 3P7NA 4AIDA 5EZHA 3HOWJ 4B8XA 4Y17A 1XMKA 5EGOB 4IXAA 3CLQA 5J4YA 1RC9A 3E97A 1SEUA 1IJWC 1GVJA 2HQAA 3BR6A 2EV6A 3KE2A 5LHGA 3LSTA 1MNEA 4A3FJ 1FIAA 2EV0A 1FT9A 1VI0A 4XRSA 1ORKA 5LHIA 3BR3A 3DCFA 3H3ZA 4EMSA 3JTGA 3OYDA 2XB5A 3O6BB 3HEFA 3KEYA 4HSTA 2VQCA 3RZDJ 2X6XA 2L9VA 1BW6A 1P4AA 1TBXA 3ZMSA 3ABMH 2EWNA 3ESWB 2BW3A 4UHTA 1ENHA 4RAYA 5H6RA 5DDGA 3E6BA 4A69C 1IRFA 1MJBA 2LK2A 4HDUA 1LKXA 2JN6A 4W1UA 1POGA 2XV4S 2K9LA 2VQLA 2HNHA 4KJZA 4XLEA 4BNCA 3GF2A 4NDLA 4PJNA 2VQGA 2HDWA 2EFOA 4V19K 5IT9K 3CDIA 2W7NA 1F43A 4XLCA 3FXOA 1B72A 1KU3A 2Y31A 3AG2H 1D1CA 1I3QJ 1W5TA 4M3BA 2ESHA 1V5GA 1JT6A 3ECOA 4IL6C 3OMYA 3RKQA 1R1VA 4E70A 2GBYA 4YRVA 4PJLA 3E1SA 1HA8A 2V6EA 2LKPA 3I59B 2H1KA 1H0MA 1S7OA 3D5RC 2VJ5A 2R5YB 3CCLI 2FQ3A 3CJRB 1USTA 3KLOA 3GZ6A 2J5PA 4RAZA 1BC7C 1Z05A 2DA7A 4MQVA 4LIVA 1FBQA 3BR5A 3CUQA 3KX2A 2E35A 3KETA 4E7KA 4ENMA 2TRTA 2CQXA 2DJIA 4PK4A 4EM1A 3WTYC 4KYWA 5ICCA 1I50J 1WJBA 1YJ9I 3G73A 1Y8QB 1H9GA 3T0YA 4X6AJ 2XC7A 3QYEA 1T56A 1BI1A 2F5FA 1QQIA 2BHZA 2KPMA 5K5QA 3LSIA 3RZOJ 2OC6A 1QHGA 1I6XA 1I39A 2VXZA 3A03A 2WAQA 3M3YJ 3QRFF 4X1EA 4L0ZB 3OS0A 3WTUC 3HGYA 4Q47A 3DWLE 4OIPF 3BR2A 3FBIB 4R79A 4D5CA 4M3DA 3GTJJ 5KAIC 4P9FA 3BG7A 3OS1A 4BL0B 2RNGA 3DU6A 4ESJA 2XAFA 3VYUB 4ENNA 2IA1A 4EM0B 2HXIA 4A3JJ 3CF5F 1ZHFA 1ETXA 5FLVA 4HRIA 3FXMA 1OMIA 2XF5A 1XN7A 2O03A 2R4GA 3A0HC 1JGGA 2WB1A 1RETA 2R3SA 3FMSA 2F5EA 2QKLB 2OCEA 3DKXA 2K27A 3I71A 5FKKA 1YJNI 1DQUA 1MMAA 4EQQA 4J19A 3OOUA 1SANA 4NC6A 3BDDA 4MTEA 5ICFA 2EILH 1W7PD 4MQ9F 4NQWA 2IA0A 3H36A 2H1LA 1ZGWA 2M5WA 4XKBA 5DS9A 2R7UA 1ACIA 1Z77A 3BG6A 1GVDA 3C7JA 4QPQA 1AWCA 3WGGA 1AOYA 3D0SA 3G1LA 1ETYA 3IH3A 3W2AA 1D0ZA 2DAOA 2DTZA 3OWTA 5LEKA 1CF7B 4UUTA 2AHQA 2F5VA 2MBFA 3TO6A 1FSEA 5F0HA 3JRDA 4IQJA 3MMYB 3DTKA 4ABZA 1G6NA 4MTDA 2DK8A 3LSKA 2DK5A 4Q4ZF 3BTCA 3CUQC 4MLOA 1FEXA 4DOZA 2Z16A 4PFPA 1IRGA 1R5GA 3OYIA 2V1UA 4A6DA 1WVRA 3OYNA 1PP8F 2VJIA 4YIFA 5HOOA 3RIRA 1MMGA 4ZYHA 1ETQA 3K4MA 1MDMB 5K5RA 3HRSA 2M8GX 4ITVA 3TO7A 2VLAA 2CQNA 2FMYA 4XRSG 2HS5A 4DJAA 2LC2A 3QU6A 2TCTA 2A07F 3LSJA 1MD0A 4KICA 5D8KB 5KHDA 3Q5FA 1LPQA 1EKEA 1R5ID 3HPGA 4HYEA 2R92J 4IZZA 2Y9ZA 4U88A 4HNVA 3BJOA 1QVTA 4GGGA 5J40A 5EEGA 3ZPLA 2MFZA 3NARA 2QSFX 3L2CA 3E5XA 3OYBA 1E2XA 2JK3A 5E18F 3RKXA 1O7LA 1XMAA 2O7OA 4XLFA 2IW5A 1X3WB 2H09A 1F36A 2DOEA 4Z6YA 4XSXF 4YIIA 1WWXA 1MBFA 1ZRFA 2XAUA 1FOKA 1SD7A 1BIAA 3DLAA 3KFWX 3JTHA 4YFXF 1AKHA 2RN7A 2Y0SA 4IOAF 4KA4A 2ZFUA 2M87A 2F6CA 5LGNA 2V26A 3GMEA 3F8NA 3WU1B 1X3UA 5GADJ 2QWWA 4U7DA 2O8KA 3M07A 3LSGA 4MGRA 1ODDA 1L0OC 2UV1A 1JE8A 3DPUA 1KQ8A 3VWBA 2QENA 4OU0A 4BDZA 4Y33A 2AXTC 2ZCWA 3HL2A 1DP7P 3S93A 2GZWA 1YX3A 3L2WA 1KU7A 5CLSA 5IOYA 3BT9A 2FSWA 1S5LC 2I5UA 4DW6A 2JSPA 3G71I 4A5NA 2LBFB 2HKXA 2YX7A 1LDJA 3M8EA 3A01B 2FMLA 3OIOA 1UB9A 2XRNA 3CF2A 3I3LA 3GLXA 2L7FP 4KT6A 5FB2A 1XPXA 2WA0A 4N9HA 1MH3A 3HOSA 1S8NA 3LQRA 3ZQGA 2CUJA 2E2JJ 4EJOA 2IS6A 3WTZA 4B4CA 1Z3XA 4B3AA 1ZELA 4OAZA 4D0PA 5HLHA 2WV0A 5FKMA 2HWVA 1TL8A 2GLOA 3PSIA 3S32A 5B1BH 2L7ZA 4E7ZA 5E3OA 2DMPA 3L2QA 4XK4A 4WXCA 5D5XB 2FBIA 3EUHC 3PNVA 4BDYA 3C2HA 3JRAA 5D5VB 2XF7A 5CVIA 2L5QA 5CYVA 5F64A 1LJ9A 2W00A 3JW4A 3VOEA 4LD5A 2X48A 2XPVA 4YELA 4CXFA 1JKPC 5J8FA 1SFOJ 3RQ4A 2IXSA 1S29A 2GXGA 2W85A 2VB6A 3MN2A 3DU5A 5K7FA 4ZYGA 4XL9A 1WJCA 2HXOA 4MEYF 4ON0A 2QUFA 3SXYA 1B9NA 1T95A 5E8IA 5E79C 1QZEA 2K02A 3E5UA 3Q0UA 1PVEA 2PQ8A 2PMZA 4LB6B 1IDYA 2D1HA 1SVMA 1OJLA 2YU9J 3L00A 3RPQA 1YS7A 2DQRA 4ETSA 4EJVA 4G7ZF 1HBXG 3KYCB 1V5FA 3GTKJ 4GDFA 4A5MA 4CCLA 1QPIA 3G2BA 5TGTA 3KP4A 2JA6J 2NVTJ 2STWA 3KZIC 1ZLKA 3HSEA 3ZQQA 3BR0A 2VC1A 5JHFA 1H88C 1MMNA 1VQ9I 3GW2A 4HG2A 3RI4A 4MIMA 2M4KA 3QPSA 4L5JA 1JJ6C 1IN6A 3GFMA 3REOA 4Y13A 2KQRA 1W36C 2K9NA 4O6JA 3S3NA 3UR3C 5CQEA 3SHFA 3K70C 3DLLF 1TW2A 5JVGF 2JA5J 4UNOA 1R36A 2XKPA 2A69F 3K7AJ 3E6DA 2L7KA 2ID6A 2K4BA 3FXJA 4AYBN 3S2DJ 3CESA 4JX5A 1JXSA 4N4NB 1XDUA 3HHHA 2KMUA 3J7ZI 2L2OA 3MZYA 3OYCA 4XLNF 5FKOA 3JR9A 1IO2A 3EETA 2HYFA 1P2FA 1JGSA 1G3YA 1UJ8A 3T8TA 1QBJA 2BXZA 1KONA 4I02A 3FBNB 2GOXB 3Q0VA 4QWQA 4R8HA 1VNDA 4BEHB 3VFZA 2RDPA 5EG0B 3H5RA 5D5WB 2P5VA 2M8EA 4C3HJ 5FJ8J 2HDCA 4NB5A 1ON1A 5LRRA 5F0CA 5ILSA 3Q9SA 5LGTA 2A61A 1R00A 4C2TA 1DDNA 2F48A 3M8FA 1U9NA 2CUFA 2DJNA 2V1NA 3KPHA 1MMSA 2OTJI 3OYJA 4AUXA 2KL4A 2A5YB 5HODA 1U5TB 3EQLF 5FGMA 1YFHA 4RLQA 2R7FA 2P81A 4DZPA 3S17J 2P6TA 1X2NA 3IHUA 1UHMA 1HW2A 5HDGA 1IN4A 3ZQIA 3AG4H 3SEQA 3JRGA 4AD9A 2PJRB 1WGXA 4M3GA 2WWYA 2CV2A 1Z6TA 4HX4A 2BHYA 4RM2A 3COAC 2OAZA 2KIUA 2PN6A 4RB2C 4ZJZA 1DU6A 2EFNA 1B8IA 4M6XA 1FJLA 4RGXA 3KP6A 1K7AA 5CVUA 2CU7A 2VPRA 1LE8A 2BXYA 1HC8A 1ZRCA 3TDZC 4DQ2A 1T0FA 1XS9A 2KRHA 2F2EA 3F72A 5DEQA 1PUFB 2P6SA 3P9IA 1I1GA 5J1YA 3CC4I 1STZA 1ETWA 3QOEA 4YG2F 1N25A 4IHWA 1MJAA 2OZ6A 5J3LA 2MG4A 2ZXWH 2QSGX 1T2KA 1J7KA 2HTSA 2K85A 1XX5A 3FK7A 2IGMA 1K78A 1NK2P 3KZYA 2NS8A 4GXOA 4UVAA 5DV5A 4KIFA 4M6YA 1U8RA 3E7LA 1QRYA 3HOTA 4HX8A 1A31A 1ZRDA 2VJ4A 3BY6A 4HEA2 5E1XA 2HQNA 2M7BA 5CKTA 4FTHA 1HLVA 1ZLJA 4JX4A 1XCBA 1DP3A 2JVHA 3QODA 4WK8F 3IKTA 2F4OB 2DMTA 3HPHA 1ZQ3P 2COMA 4IVNA 2VODA 4AU7A 4BJTA 3S3OA 4OIOF 2VXDA 5A2QZ 5B1AH 2WTEA 4N4OB 4V2FA 5C3EJ 3L2VA 3VODA 4NHJA 1ETOA 3HYIA 1DPUA 1R6RA 3GUDA 3RKWA 1IRZA 3TW7A 5K7HA 3J7AO 1DU0A 1R4MB 1Z21A 1U78A 3W6JB 4HDVA 4DYCA 4JYKA 1EH8A 4D7NA 3MKWB 4BS9A 3LL7A 3GEZA 3MWMA 2GIVA 4F93B 1N78A 5K1YA 1GT0C 3BWGA 1USSA 1ZGJA 3OY9A 2IEKA 2ZSIB 1IG7A 1EF4A 3K69A 2EPFA 3VYSB 3CJNA 5IYBJ 2PI0A 3O2PE 1WI9A 2BW3B 1VQMI 3CC2I 3CD6I 1AU7A 3BG9A 1FBUA 3F0CA 4XIDA 4LGWA 1T0FC 3ML6A 1HDDC 3V7CA 2HI3A 3CCMI 1WSUA 3G4SI 4I0BA 2TDXA 3BJ6A 2DA4A 2G0EA 3ZRGA 2M3AA 1BR2A 4HW0A 3OSFA 1NG6A 3IV5A 1FTZA 5TRDA 2GOMA 3O8HA 4FETA 4RA2A 3RKYA 1B72B 4B3XA 4DBQA 5HS8A 5FKLA 4BE1A 2FD5A 3S2WA 2CG4A 4L9JA 1RNLA 1WZ2A 1FC3A 3HRUA 3HXLA 5E1ZB 4AVZA 4S04A 1SFUA 2KRCA 4HQEA 1SMTA 3BQZA 4O5VA 4CGZA 1EA3A 5CVRA 1XD7A 3PIPF 3F3XA 1Q1HA 1WCMJ 2ETHA 2VKVA 2O8XA 4I09A 2VJJA 5BMZA 2V4JC 4M72A 4HZFA 3SZGA 2Z99A 2BYVE 3GXOA 3MEXA 1P7IA 3IRRA 4CICA 3S14J 3CUQB 4ZDPA 4BH9A 4CZCA 1J09A 2ELHA 3HTUA 3VYTB 3GVAA 1VQ4I 2E34A 4UUVA 1ZARA 4EEFG 3GWZA 2B9SA 2LVSA 3I9V2 1PJRA 1G8XA 4HQMA 5FLMJ 4I0AA 3J80K 4IEJA 1GXPA 1IDZA 1IN8A 1W0TA 3A2KA 1EJ9A 1Y1VJ 3IP4B 1S72I 4E6KG 2CV1A 3FM3A 2OTLI 2XSJC 1OCOH 4RB0A 1QZZA 3CLOA 1SAXA 4LG0A 1JUSA 5GTHC 3CUOA 4RS8A 1Z67A 2QQBA 2Y69H 1D0YA 5BNGA 1HXDA 1ZG3A 5HS9A 1XSXA 1FBSA 1RESA 2NRAC 4CCKA 2KZVA 4CO8A 3ZMVA 3GBGA 4NUBA 3ZMDA 2RAEA 1G3WA 3BZKA 5TJJA 4JBAA 2RV8A 1E3PA 2ZXJA 4UB8C 2B63J 3ROUA 1NHAA 3H1CA 4A3IJ 1VQ7I 2O5RA 3AKZA 4U0VA 2OBPA 3ZCOA 3O3KA 4PJMA 4U7BA 2E2IJ 1BOAA 4RB3C 1IV8A 3CP8A 1OLTA 4L5IA 5ILUA 3I64A 1MSFC 3R60A 2CJJA 1YX5A 3K1PA 4WCGA 1ZYRF 3QWLA 4NQWB 1JT0A 1ZREA 4C2MJ 1TW3A 3AG1H 2QSHX 1N75A 4II3A 3V8JA 4D1QA 3S1RJ 2NVUB 5JHUA 3D5LA 1X2MA 3VPRA 3W6KB 1H9TA 3CCUI 3WU2C 2VIXA 3K4BA 2K4JA 4BQNA 4IRHA 2HOEA 2FBHA 2KIFA 1HCRA 4LJZF 2NYXA 2IT0A 1BW5A 2R0QC 1ZH5A 3IKVA 5M5XJ 4BAYA 5C4XJ 5IT9Z 2LNBA 1QO0D 1U2WA 1Z7LA 1OCTC 5D8LB 2QQ9A 1BM9A 1GDTA 2KP6A 3IC7A 2EK5A 1BI3A 2CYYA 2FXAA 2PEXA 5C44J 5FD6A 2XAGA 3CCYA 3TKYA 2FNPA 4G6QA 3HB9A 3WTSC 2C6YA 2HTJA 1EV7A 5ILVA 2R5ZA 3P9KA 4XM3A 2DYRH 5HVQC 1RUOA 3FXUA 1E3OC 3FM5A 3LAPA 1VZ0A 2F4IA 2DPUA 4HV6A 1YTYA 2P5KA 4FE7A 1TT0A 1NH3A 1YE9A 2GM4A 4LG3A 3QP6A 2AQEA 1T08B 2KDZA 4FHTA 1TZLA 3OL4A 4IOCF 4YIRX 1FYKA 2P7VB 2VKDA 4M74A 2ZJ2A 4OAYA 1D1BA 5GPAA 2E7WA 2L4AA 1SC7A 1P4XA 3F8BA 5C4JJ 1K83J 4ZH4F 4AM3A 2QKMB 2OPTA 1AKHB 2A3SA 2X1EA 1WQ2A 1Z9CA 3A02A 5L3CA 2N8GA 2VI6A 2XIGA 2E1MB 4CA0A 2KIQA 2MH9A 5LGUA 4A3EJ 4XSZF 2DOFA 2JTVA 4UVBA 4A3GJ 1X1PA 4DZJA 5ICEA 2DT7B 3V8KA 2XGEA 1XTAA 3BOQA 2FNAA 2D45A 3N05A 3I54A 2CFOA 5F0FA 2B0LA 1S3JA 4BQOA 3GFIA 3NWSA 3ZQHA 3KP3A 1HSJA 2HDDA 2OCCH 3V7RA 3H5AA 3BZ6A 3TW6A 2PMUA 1FWZA 5D5UB 3KYLA 1P7JA 2BOLA 4CHUA 2H8RA 2R93J 5M5WJ 4I99C 1MNDA 2GXBA 5KNLA 3H3VK 2HQRA 4Y3OA 2Y75A 4XR6A 3ZMZA 2CS3A 1LDKB 3G1OA 3PQKA 3EYIA 1BOBA 3PO2J 3D1NI 2IGOA 2EV5A 3FZVA 4OMZA 2OV7A 2IPQX 2DXIA 3LQQA 4XKWA 5F1JA 5K5OA 4F55A 2ZJRF 3LWFA 1L3LA 2DPDA 1FMVA 3U1DA 3I58A 3TBIA 4M9XA 2E7XA 1IC8A 3HTSB 4P1WA 1M1EB 4A93J 3AL0C 2CUZA 1A6IA 3C2BA 2R7DA 3WTTC 4HOBA 2AS5F 4A3CJ 4IHXA 2HZDA 2FQ4A 1IUYA 1J75A 1FOXA 2STTA 1IUFA 2JJ7A 3JRHA 1U8BA 5E3MA 2UWMA 4AIHA 2EA2A 4BY1J 3EUHA 3PNTA 1RPWA 1DGRM 3QAHA 4GRIA 1V4RA 4D9JA 1YIOA 5LEJA 1BI2A 3NQOA 2M2EA 1NTCA 1K61A 2FUG2 2JVGA 2NOGA 4RGSA 3VSLA 2VKEA 2ELKA 2X85A 1TT5B 3KEOA 5AIQA 2FOWA 2XB0X 2R7ZJ 3EUKL 3U1KA 4C3JJ 5KAFC 2CW0F 4IHTA 1VQ6I 4ZTJA 3E0JB 2V79A 5B5EC 3H3UA 3L09A 1JUPA 5KVRA 1KQ0A 2DA5A 3ZOBA 4EJWA 1OCZH 3BJAA 1W1WE 2X6WA 2R5YA 4L18B 2ELJA 4E7LA 4IJAA 3S16J 4A3LJ 4HF1A 5GAEJ 1MW7A 2IS4A 3WU0A 2ISZA 2BBYA 2ZNZA 2KZGA 3J7AY 3MD2A 4I76A 5E1WA 1LNWA 4UV9A 5BS6A 1HW5A 3GTPJ 2DA2A 2XKOA 4NNJA 4G9YA 4A12A 4MHGA 1FX7A 3ZGKA 1UFMA 3FIWA 2XRLA 4Z2YA 3MKYB 2O6GE 2GQQA 2RNJA 1WJAA 3GLLA 3MQ0A 1MIJA 1YRNA 2E5ZA 3QPTA 5JI6A 1BN5A 5LFAA 4LLLA 2ZMEA 3NAUA 3B6AA 2KLOA 3K1MA 3V4GA 3K9TA 2D5VA 4DGWB 3SFZA 3CO7C 5E17F 4U0YA 4F91B 4IHSA 3CZ6A 3PM1A 5FFZA 3K2ZA 4FASD 2WAQN 4OWRB 1QZYA 4H4KC 3BTIA 3F21A 2QF7A 3TGNA 3CCQI 2DA3A 4I01A 1KQ9A 1Y56A 2XSDC 1LFUP 3HOYJ 2DT6A 5LBQA 4ZC3A 2QLZA 1OYYA 2Z5UA 3ISPA 3U9GA 3FMQA 1MJ9A 2QZ8A 1IRXA 3ECHA 2CV0A 1B8IB 4PGGA 3AAFA 2MYSA 4S0HB 1LE8B 2ZB9A 3GZ5A 4EJUA 4W97A 5F27A 3VEPA 1VQPI 4BBRJ 3WTVC 2RGVA 2YS9A 3WG7H 3HUGA 2YUSA 1YW9A 3DBRB 2WB1N 1UG2A 1X1BA 1YOVB 2MGQA 4BHBA 3Q9VA 2ISYA 1MBEA 5EEAA 4EJTA 2KKOA 2ID3A 2JRTA 3IWZA 5HLTA 3I4PA 3OV8A 4L9VA 2RVCA 1BA5A 3SZTA 2IBDA 3DBLB 1K78B 5J6XA 3FXKA 4AC0A 1XGOA 1HOMA 2QBYA 4UV8A 2A6TA 1U9OA 2R7QA 3PUFA 4WWCA 1FYLA 1NK3P 3QOPA 2XASA 3GTLJ 2LFBA 3ZP5A 4LK1F 5L3BA 5E3LA 5DD8A 4AIKA 1G3SA 4M71A 1SMYF 2QGUA 4QTRA 5FLXK 4JK1X 3W6VA 3IRQA 2HYGD 2LDUA 5GTIC 4A3MJ 4ZYDA 1RI7A 1JTYA 3V7SA 2DT5A 4FCYA 1KYZA 2ZMEC 3W3CA 2M0MA 5H6QA 1UELB 2HKOA 3FXQA 2KIMA 5D6FA 2VQHA 2BV6A 1N77A 2ZO4A 2VT2A 4XRMA 1WI3A 2V1DA 2H6BA 5LLQA 4CCOA 1PYVA 2HU9A 1K6YA 2DW4A 1X1AA 2K3PA 3WGIA 4CCNA 4PDKA 3S1QJ 2W1OA 1ZR4A 2HR3A 4D5FA 4GCVA 3U21A 1ETVA 2VL8A 4M3FA 1QNTA 2LD5A 1E0EA 2Z1DA 2CGPA 3O8GA 3DPLC 2VONA 1E3HA 2YR2A 3LNQA 1O3QA 1OISA 2CQQA 2L9SA 1MSEC 1REPC 1WFXA 2VN2A 4J01A 3KZZA 3KYDB 1OCRH 5EZGA 2VBYA 2FX0A 5BPDA 3PL8A 3K4JA 3SYTA 5HNHA 3C18A 2XDVA 2E19A 2VOOA 3QPHA 1VQ8I 3GTGJ 3FKJA 2CWEA 5M5YJ 4FX4A 4KUMA 3MVPA 3A4CA 3EYYA 5EEHA 2Y0SN 3TP0A 4CYCA 2Z33A 2LF7A 1J2XA 3QYBA 4CDGA 2NNYA 1RR8C 3OYGA 1VFCA 2X6YA 2Z3YA 2WADA 4Q5SF 4XN3A 3SJMA 4GFBA 2QEXI 1YS6A 2EIMH 4RGUA 5IP6A 1IW7F 3OR1C 2LBFA 3B02A 2E1NA 1G4DA 4BHCA 3DTEA 4M6VA 1D8KA 2LSOA 2Y30A 3HHGA 3NEUA 3HKZA 2D2WA 2G7HA 5IY5H 3BTJA 1O3SA 2NVQJ 4LOCA 3DTIA 1G2HA 2BVMA 2CH0A 1O7FA 1QA6A 3LOCA 4WF2A 4RDUA 4XLAA 4KMFA 1D1AA 3WE3A 2A68F 3BQYA 1FY7A 4UXNA 2DFHA 4D7MA 4IKFA 4A2UA 3DXJF 1ITYA 2DDAA 1WH5A 4S05A 4V2GA 2DTRA 1JHHA 4HPQA 3IH4A 3BROA 1X19A 4CCMA 2OD5A 1MBGA 4G6TB 4WXDA 2FF4A 3CO6C 2LF8A 2L3DA 3R61A 1WRJA 1LFPA 2VE8A 2M7AA 3MKLA 3ABTA 1TWGJ 4PSXA 2R7TA 1VF9A 3RJPA 2GA2A 4G94A 4RAGA 3HC7A 5L3DA 3F6OA 5F6FA 1ZG5A 2L0KA 2IVMA 2JA2A 4LG0B 2UXXA 2XF6A 4MNUA 1TWFJ 1XB4A 5DTDA 2K9MA 2P8TA 1E17A 1GV2A 3TL4X 3TO9A 2M45A 5HLGA 4LLNA 5DUKA 1TWAJ 5ERIA 3CCVI 4HF2A 1MH4A 4IHVA 4HF0A 1X1DA 4BXFA 1IAWA 3RSNA 2PMZN 2OF7A 2LH9A 3BPXA 5L3GA 5LRSA 3L7WA 3Q0WA 3GTMJ 1R7JA 4HA8A 3CC7I 3M4OJ 3SEZA 4DIQA 5TISC 5F04A 4KMUX 3OYHA 2JZYA 3HSRA 4EM2A 4KNYA 2E5NA 2EA4A 3P5JA 2P0WA 2OU2A 3E5QA 4RAFA 1XG1A 3K6GA 1J0RA 1EH7A 4UUSA 1GHCA 1X1CA 3N4MA 2V9VA 1DGWY 3S8PA 3SDGA 1B59A 2NVYJ 2NNNA 3KP2A 2QA4I 1B4AA 5L3EA 1R49A 1IV6A 1BL0A 1FP1D 4NC7A 1FOYA 3QPLA 2HOTA 2IS1A 4KDPA 2HVRA 3I56I 1Z3YA 2JWTA 1TC3C 3BZCA 1ZAOA 1K4TA 1H8AC 2MD5A 2DODA 5DYMA 5FFXA 3SFIA 3QQAA 1GV5A 2X0LA 2L02A 1UG0A 1YITI 1YIJI 2KFDA 5J8CA 1XGNA 3GZNB 5DM7F 3DEWA 1D5VA 1Y6IA 5EDNA 2R5ZB 2ZJQF 5CPRB 3JAMK 2HVQA 1SVLA 4OIRF 4X0GA 4XN0A 4CSWA 1BR4A 4PJ0C 2K5CA 2M0CA 2W48A 1S9HA 3A1YA 4Y4RA 5GAGJ 2H27A 3HZJA 3C1DA 4U0WA 4BQAA 3PJRA 2IGKA 5IYCJ 2V9KA 2FBKA 1MGTA 2WY7Q 3K2AA 1YQAA 3FX3A 4AIJA 3OS2A 4UY8I 3CDHA 2R7RA 4BXXJ 3ABLH 3BC8A 3J80Z 3S1MJ 1ZG1A 3OR2C 3OYAA 2X9DA 4XORA 4A6EA 3I53A 1P92A 3ZN0A 5FRNA 2ZBKA 3WHBA 1U6GA 3RQIA 2H94A 4XRFA 3DFGA 2LTPA 2DFIA 3ABKH 3AG3H 4G7HF 1T39A 1OFCX 2DO7A 2QVOA 3IUOA 4QSHA 3IH2A 4RGRA 1WHUA 4CCJA 1PP7U 3MFKA 2DOAA 3HKZN 2PFBA 3FWEA 1BC8C 2OZUA 1KYWA 4AWXB 1T8IA 2BY0A 2MABA 1IF1A 2JUCA 2NXNB 3R6SA 5KK1A 1KU9A 5IYDJ 2VASA 4ESFA 1W5CC 2EJRA 1KA8A 3T8RA 1YO5C 3KIOA 2DBBA 4A0YA 3RPUD 2F5CA 2FU4A 1XDSA 2ZNYA 1OYIA 5CVVA 4OINF 2LOOA 2R7VA 2O3FA 4OOIA 4BY7J 3CCSI 3OIPA 1K4SA 3DP7A 4K2EA 3HOZJ 5JFRA 2X1DA 2HOAA 1YYVA 1P6RA 3ELKA 1FIPA 2Q2EA 4KISA 1ERDA 2BY1A 5M3MJ 2LREA 4CZZA 1XMXA 4IHYA 2CQ7A 2MSYA 3H0DA 3HM5A 3OYFA 1MMDA 1LVKA 1ULYA 1LEBA 1A5JA 2CRGA 1U5TC 4FT8A 3PNYA 3WGHA 3NWTA 1W5SA 4II2A 5FRMA 4QLCU 1XGSA 3C2GA 3C3WA 1LVAA 4HV5A 1JKQC 2PG4A 2BGCA 1YHQI 2MD0A 1OCCH 3ZQFA 4LFUA 2DLLA 3BR1A 1LQ1A 3BG5A 3IAS2 3GYHX 4EV0A 1TQMA 1S7EA 3I5UA 3ZMTA 1X58A 3BCBA 4C30A 2VT3A 3L9FA 2FOKA 3F9KA 4DYQA 4YFNF 5J47A 3JCUC 1JI8A 1B9MA 5HDKA 2LY2A 2ZJPF 2Z9OA 2DA1A 4GO1A 2A5WA 2LLKA 2E2HJ 1I6HJ 1BJZA 5D4SA 2VBXA 3ABUA 1FOWA 1FP2A 1LUJB 1W7PA 1UMQA 3CMEI 1RIOH 3L2UA 4F92B 1BIBA 1RZ4A 2EB7A 3JSOA 2HQ5A 2Q8KA 3I55I 1R1UA 5JLXA 4P5OA 3ZN1A 4A3KJ 2DA6A 5E8GA 3ZQCA 5H20A 3S15J 1X3ZB 2CO5A 2V1XA 4XONA 4RLFA 4BHPA 2DU9A 5D4RA 2UZKA 4A3DJ 4P9UA 1B6AA 3OYEA 3H9QA 5IOZA 3MAJA 2RKHA 3WG9A 3GX4X 2PMHA 4FISA 2G7UA 3LMMA 4IPAA 5H2FC 1T38A 5J4VA 3J81Z 2EZIA 3HOXJ 1R4NB 4XOPA 3J81K 1D0XA 1HDPA 3LFUA 2AQFA 1IXSB 2DMUA 2ECCA 3ULQB 3HG9A 3TOAA 1P4WA 3M7GA 3HBLA 2JQ7A 4Y15A 3MKZA 3PQJA 2BEOA 3DKWA 3OYKA 2O61A 5K7ZA 2JA7J 1A6QA 5DCMA 1PDNC 4RBOA 3JREA 4G12A 4BJ5C 5E3NA 4CUGA 4QIWN 3V42A 1UZCA 2XVCA 3BP8A 4L5EA 6PAXA 5FD5A 3BTLA 1F1ZA 2M30A 1UHSA 1YG2A 2A05A 2KJBA 2GAUA 3TEDA 2FA5A 1YRNB 1QHHD 1YLFA 2ZMEB 3OYMA 4ASNA 2WC2A 4PCQA 4XICA 2ZSHB 4MFEA 3E3VA 4IQ4A 1GXQA 3R0JA 2H8WA 3CCRI 2B7EA 3FDYA 4LB5A 1OYWA 2JPCA 4HNUA 5HLIA 1IN5A 3FHNA 2XGDA 2IA2A 3M9AA 4C3IJ 2OQGA 2RC4A 2HEOA 3FKIJ 4E7SA 2JPBA 5L3FA 2HPIA 2DYSH 2EFPA 5F08A 5BQTA 1QU3A 2MC4A 4BXUA 3LSPA 5FROA 2JUGA 3TOBA 2Y0MA 2CW8A 3WTXC 2KDOA 2EINH 2I8DA 2V6CA 1R1TA 1V55H 1ZN2A 4XLPF 1BBYA 1KGSA 5EGOA 3BCAA 2DMQA 1W4MA 2W4SA 1SD4A 2FE3A 1P9QC 1V3FA 2DQLA 1O3TA 2CFXA 2BY3A 3HUGB 3Q3SA 4HNTA 4XLHA 1SFXA 2Z2SB 4XBFA 3RDIA 2QQ8A 1Y8RB 1QPMA 3HDDA 3IL2A 3ZQLA 2YPRA 5J1RA 4KIGA 1AA7A 2O0YA 5LD2C 2XPUA 3OOPA 2LRDA 2W24A 4ANJA 2NS7A 1YW8A 1ZR2A 2WAEA 1FNNA 4B43A 2VKHA 1WPKA 1SFKA 4A0XA 2QBYB 3BG3A 4R1HA 2P4WA 3RTRA 1F5TA 2GA1A 2HPMA 2FRHA 2EZLA 3E6MA 4KN4X 4FX0A 3AFHA 2YSRA 2E71A 2R7OA 3HIFA 2ACJA 2XGCA 2Y9YA 4DBRA 3F6VA 4B1RA 1QGPA 2HOSA 2P7CB 3BPVA 1D5YA 4XNFA 3DEUA 2M34A 5KCMA 4J00A 1Z1DA 3LA2A 3F22A 1T6SA 5B66C 3GO5A 3B6CA 3VSKA 1VQ5I 2IGNA 3I0TA 4HLYA 2K7LA 4AYBA 4UB6C 1Y39A 4L0YB 2ME6A 5HDNA 4XOTA 4BYYA 1WKMA 1I5ZA 1Z91A 4FE4A 2OA4A 4E7IA 1W0UA 3I59A 4LLGF 3G3ZA 5GPCA 3EPZA 5BOXA 4OMYA 2ZFWA 2E60A 3U2RA 1SFEA 3ZQ7A 2IP2A 4TV7A 5GP9A 2IS2A 3CJQB 3M1CA 4Y52J 5JVTA 2PLYA 3LFKA 1S7AA 1X4PA 2CUEA 1TWCJ 2YU3A 4PZJA 1KZHA 3S3MA 4JOMA 1R58A 3V8LA 1A35A 2VUMJ 2W57A 4LK0F 4YEJA 4CYDA 5CVJA 4P96A 4G7OF 1WH7A 2F4MB 1FZPB 2PBIA 2O9LA 2MH2A 1TNSA 4N9IA 1R71A 3ERED 4E7JA 2XAHA 2L7MP 3QP5A 4XKVA 3DEEA 1X4OA 5F1RA 4CYCB 4MO7A 4BE0A 2OUMA 4EGZA 1GUUA 1YW7A 3GTQJ 1RUNA 1OR7A 2COBA 2JSCA 4B44A 4DYRA 4BGDA 5IT3A 9ANTA 2X4HA 4ZYAA 5GAHJ 3JSPA 2IRFG 5CQGA 2EH3A 3H9GA 1SVOA 2WY8Q 1NG7A 4L9NA 3LAJA 1R5HA 2DI3A 3WTWC 1JKOC 2VBWA 3MCZA 3PFYA 2EIJH 1T33A 2EBIA 5FKNA 3FISA 1ZGAA 1O4XA 2A6EF 2NS0A 1MBKA 1VQLI 1KU2A 3H5NA 3TMOA 3VDXA 2A6HF 2VE9A 3S1NJ 1U3EM 3VYRB 3ONQA 3QU3A 1IXCA 2IAIA 1GLNA 2L01A 4MEXF 3RYRA 1VQKI 2EIKH 2LMDA 1SD6A 1G59A 2ESNA 2LKSA 1MBHA 3H35A 3SDBA 4ENJA 1J9IA 2LY1A 2K9QA 3I4MJ 1Y1WJ 1XSDA 5IPAA 1RR7A 1CF7A 1WJFA 4G6DA 1TP4A 3DBHB 3UKGA 1O3RA 2JMWA 4BKXA 4RMNA 3TQNA 2JT1A 3B73A 3G6EI 1TLHB 3HJEA 4PSWA 4M9SA 3W2WA 2DFFA 2RQPA 2HYJA 4F7ZA 3DV8A 2CSOA 3G1MA 1LB2A 1FLIA 2MLGA 2JRMA 4M9ZA 1IN7A 4JQFA 1F9NA 2NOJB 2DMNA 3F8CA 1DUXC 1JUMA 3K4KA 5FLXZ 5ED4A 3CJTB 3DQVC 3J7YJ 1MDMA 2GXAA 4EATA 4DNCA 2HGCA 3K10A 4BU2A 3CQZJ 5M3FJ 2E1MC 3F8FA 1APLC 4QPOA 4LIUA 4M73A 1SAUA 5AONA 2L54A 2GIZA 3TP3A 3ZXSA 2XHKA 5IP7J 1VQNI 2VBZA 3UNGC 1G3TA 4PGHA 2DN0A 3LSRA 1V5EA 2WV1A 2OJED 1OR7C 4FQGA 3FXLA 3CDLA 1W36D 3HOVJ 2K40A 2XUBA 3DPTA 3K70D 2HVSA 2M1BA 1Y0NA 4LITA 4BJ6C 1RRJA 1F4KA 2YX4A 3F8MA 3PFIA 2BZTA 2X1CA 4UUSB 4ENKA 4HAMA 3WHCA 1Z0XA 1LDDA 3L2RA 1CGPA 1HKQA 1Y0UA 4ZTFA 1TNTA 2ADUA 3LA3A 2ZKZA 4KT5C 4PJJA 5DCFA 1MBJA 1V54H 2PX9A 4B48A 4ZZDA 2MC3A 1CQTA 5IP9J 3M8JA 4GYIA 4ZDLA 4I2OA 1Z7UA 4RB1A 3KP5A 1ETKA 2K9SA 5EF6A 3EDPA 3IWFA 3OIQA 3JRCA 1LFBA 4UVCA 3PUBA 3W2VA 2LY9A 2M4GA 3CMYA 3DF8A 3OYLA 3A01A 1XCVA 4LMYA 4KN7X 2AXLA 2LYCA 3ZMUA 1FYMA 1I1SA 4AVPA 2P5LC 3D5SC 2ZXHA 3QYFA 4ZYEA 3JRIA 2Y48A 1HQCA 1FSHA 3T1BA 2Q0OA 1JKRC 2G9WA 4XMYA 3HGGA 2KRFA 1C0WA 1UCRA 1IXRC 2XGXA 4B47A 4G8XA 2K86A 3KCCA 2EQRA 4JX6A 2KISA 3LSHA 1JJ8C 2BVLA 3CP2A 1YI2I 2KHMA 3CTAA 1HSTA 1WJ5A 2EZKA 4I98B 4U87A 3DKYA 3GFJA 4ZDOA 4MFDA 5LHHA 1MNMC 3HRTA 2WBMA 4A0ZA 5B3SH 1RKWA 1ZTRA 1I27A 4KIBA 3FK6A 4IO9F 1JHFA 3H0GJ 4HBLA 1B1BA 5EYRA 2Y2ZA 1PUEE 1TQPA 3PIOF 5FO5A 1OPCA 1FMWA 4HX7A 2KJCA 2LP0A 2XROA 3S2HJ 1SD5A 3K1NA 1WJEA 3IAM2 5DUIA 3PO3J 2J5OA 3WODF 1TQIA 1J5YA 1EH6A 2R7SA 1T98A 1MKMA 2H6CA 3KEQA 2LG4A 2Q2EB 2HZTA 1R9TJ 5BPIA 3MZHA 3FHZA 2QYOA 4I6ZA 4P55A 5A2QK 3VB2A 4M3EA 3H92A 5EJCA 2RREA 1OCPA 5HS7A 2ME0A 2ECBA 3LA7A 3ERMA 2R7XA 1U0JA 3FMRA 2OQRA 3HOUJ 1A04A 4KITB 2M9HA 4F3QA 3L1PA 4PUSA 3LSMA 4PFOA 2LR8A 4IF4A 3T5XA 1R23A 3F23A 3CCJI 2CMPA 4XQFA 3GTOJ 1UHWA 4N0BA 4HLXA 2X6OA 4I7HA 4IRGA 2I10A 3OSGA 3RPUA 1QVUA 2IJLA 3E6CC 2WAFA 4WX9A 3RCOA 1FPQA 3ASOH 4NC8A 1OQYA 1ZK8A 3BLYA 4BACA 2NAZA 1LEAA 2GWRA 5E20A 4BEHA 3FF5A 5EG0A 3PSFA 3A0BC 1A36A 2CQKA 2QCOA
chains in the Genus database with same CATH topology
3ZQCA 3S15J 5FKOA 5JLWA 3JR9A 4A3DJ 1JUPA 2DA5A 3ZOBA 1ZKGA 2R5YA 5IOZA 4A3LJ 3S16J 3Q0VA 1VNDA 4FISA 1HF0A 5EG0B 2KT0A 4C3HJ 5FJ8J 2EZIA 3HOXJ 1IGNA 5F0CA 1HDPA 4I76A 2ECCA 2DMUA 2LKXA 3GTPJ 2DA2A 1U9NA 2CUFA 2DJNA 3HBLA 3FIWA 2XRLA 4AUXA 5HODA 5K7ZA 4JP0A 3JRFA 2JA7J 1YRNA 2P81A 4DZPA 3S17J 1XC5A 2XPWA 3NAUA 4RBOA 3B6AA 2FJ1A 2JA8J 1X2NA 3JREA 4G12A 1TWHJ 5E3NA 4QIWN 5J1UA 2D5VA 3ZQIA 4L5EA 3JRGA 3BTLA 1UHSA 1PUFA 3PM1A 1WGXA 4M3GA 4BBSJ 3TEDA 1YRNB 2MW8A 2E1OA 2WAQN 3BTIA 2QF7A 2L9RA 1DU6A 1FJLA 1B8IA 2DA3A 4XICA 4MFEA 2EZHA 2XSDC 2CU7A 2VPRA 1LFUP 1LE8A 1RKTA 3HOYJ 1XS9A 1PUFB 2XGDA 1Q1VA 4C3IJ 5J1YA 3FKIJ 1FTTA 1ETWA 1B8IB 3I4NJ 5F08A 4S0HB 4IHWA 1LE8B 3LSPA 5J3LA 2ZB9A 2MG4A 4W97A 5F27A 4BBRJ 2YS9A 2NVXJ 3FK7A 2YUSA 1NK2P 2WB1N 1UG2A 2NS8A 2MGQA 3E7LA 1QRYA 5EEAA 1MBEA 4A3BJ 5EGOA 2ID3A 2DMQA 4FTHA 1HLVA 4JX4A 4Y7NJ 3JRBA 1AHDP 1BA5A 2IBDA 2DMTA 3Q3SA 1ZQ3P 1H89C 4AC0A 1HOMA 2AO9A 1JTXA 3HDDA 5EZHA 3HOWJ 3ZQLA 1U9OA 1NK3P 5J1RA 5EGOB 1IJWC 3GTLJ 2LFBA 2XPUA 5E3LA 3BR6A 2NS7A 4V2FA 1ZR2A 5C3EJ 4A3FJ 1FIAA 1VI0A 4XRSA 1ETOA 1WPKA 4QTRA 1ORKA 3BG3A 3BR3A 3DCFA 3W6VA 1IRZA 2XB5A 4A3MJ 2EZLA 1JTYA 3HEFA 3TW7A 5K7HA 3RZDJ 4FCYA 1DU0A 1BW6A 1U78A 4DYCA 4JYKA 4D7NA 2XGCA 2Y9YA 1ENHA 4B1RA 4XRMA 2HOSA 1GT0C 1D5YA 2M34A 1WI3A 2IEKA 4A69C 2LK2A 2JN6A 4W1UA 1POGA 1IG7A 1EF4A 3B6CA 4NDLA 3S1QJ 5IYBJ 1ZR4A 4D5FA 2ME6A 1AU7A 3BG9A 1ETVA 3F0CA 4XIDA 4M3FA 4FE4A 2LD5A 1W0UA 1HDDC 1F43A 2HI3A 3O8GA 5GPCA 1B72A 2Y31A 1I3QJ 3LNQA 4M3BA 2CQQA 1MSEC 1JT6A 2DA4A 2G0EA 3RKQA 5GP9A 2GBYA 5EZGA 2FX0A 3OSFA 4Y52J 3IV5A 1FTZA 3O8HA 2H1KA 2CUEA 1TWCJ 2E19A 1B72B 5FKLA 2R5YB 2FD5A 3GTGJ 2VUMJ 2DA7A 5M5YJ 3BR5A 3MVPA 4CYCA 3BQZA 3TP0A 2Y0SN 2TRTA 2CQXA 1WH7A 1WCMJ 2VKVA 1VFCA 2O9LA 1I50J 4X6AJ 1P7IA 3SJMA 4GFBA 2L7MP 3S14J 1T56A 5IP6A 4CYCB 4MO7A 3RZOJ 1GUUA 3GTQJ 3A03A 4M6VA 3M3YJ 2Y30A 4X1EA 2COBA 9ANTA 4DYRA 3HGYA 3BR2A 4EEFG 3BTJA 2LVSA 2NVQJ 5FLMJ 4LOCA 4D5CA 4IEJA 1G2HA 4M3DA 3GTJJ 1IDZA 1W0TA 2EH3A 1Y1VJ 3LOCA 4RDUA 3BQYA 4D7MA 1JKOC 2HXIA 4A3JJ 1ITYA 1T33A 1WH5A 2EBIA 3FISA 5FKNA 1O4XA 4V2GA 1MBKA 1ETXA 3IH4A 5FLVA 3S1NJ 1MBGA 1JUSA 2IAIA 1JGGA 1RETA 5BNGA 3MKLA 1MBHA 1RESA 1TWGJ 5FKKA 2K9QA 3I4MJ 1Y1WJ 3GBGA 1VF9A 5IPAA 1RR7A 2RAEA 3OOUA 4J19A 2L0KA 1SANA 3UKGA 2JMWA 4BKXA 2B63J 1TWFJ 1ZGWA 5DS9A 4A3IJ 1Z77A 1GVDA 3G1LA 3IH3A 1ETYA 5DTDA 2DTZA 2HYJA 1GV2A 2E2IJ 3G1MA 1TWAJ 4UUTA 2AHQA 5F0HA 3JRDA 4IHVA 1MH4A 1MSFC 2CJJA 2DMNA 4ABZA 1JUMA 1JT0A 4C2MJ 3BTCA 2PMZN 2OF7A 4MLOA 3S1RJ 1FEXA 1X2MA 3VPRA 3CQZJ 3Q0WA 3GTMJ 5M3FJ 3M4OJ 1APLC 5F04A 3TP3A 1HCRA 1ETQA 1BW5A 5IP7J 2R0QC 2M8GX 3LSRA 2DN0A 4XRSG 2WV1A 1XG1A 5M5XJ 4UUSA 5C4XJ 2TCTA 3LSJA 1OCTC 3CDLA 3HOVJ 1GDTA 3SDGA 2K40A 2NVYJ 1BL0A 2R92J 1IV6A 2Y9ZA 5C44J 4HNVA 3QPLA 1QVTA 3CCYA 2HOTA 2JWTA 4UUSB 1TC3C 3HB9A 3WHCA 1H8AC 1Z0XA 3NARA 2R5ZA 3SFIA 1E3OC 2JK3A 3QQAA 2O7OA 1MBJA 1GV5A 4FE7A 1F36A 2GM4A 1MBFA 2KDZA 1CQTA 3DEWA 5IP9J 5EDNA 2R5ZB 1AKHA 5GPAA 1ETKA 2K9SA 5EF6A 2M0CA 2W48A 5C4JJ 3JRCA 1K83J 1LFBA 2LY9A 2O8KA 3LSGA 2OPTA 1AKHB 5IYCJ 3CMYA 3A01A 3K2AA 3A02A 2N8GA 2VI6A 4BXXJ 4A3EJ 3S1MJ 4A3GJ 4DZJA 3JRIA 5IOYA 2X9DA 3BT9A 1JKRC 4DW6A 3HGGA 3WHBA 2XGEA 3A01B 3OIOA 3RQIA 2LTPA 2L7FP 1OFCX 4QSHA 1MH3A 2EQRA 3IH2A 4JX6A 1JJ8C 3ZQGA 5F0FA 2E2JJ 3HKZN 4B4CA 2EZKA 4B3AA 2GLOA 5FKMA 3ZQHA 2HDDA 5IYDJ 2L7ZA 4MFDA 1MNMC 5E3OA 2DMPA 4XK4A 3TW6A 1RKWA 1ZTRA 3JRAA 1P7JA 4BY7J 3FK6A 2H8RA 2R93J 3H0GJ 5M5WJ 5EYRA 2X48A 2XPVA 2Y2ZA 3H3VK 3HOZJ 1JKPC 2HOAA 1SFOJ 3G1OA 1FIPA 3PO2J 3D1NI 2LP0A 3S2HJ 3MN2A 5K7FA 2HXOA 5M3MJ 5F1JA 3PO3J 4IHYA 2MSYA 3Q0UA 3HM5A 1IDYA 1A5JA 1OJLA 2YU9J 1R9TJ 2CRGA 1IC8A 4A93J 3GTKJ 4I6ZA 1A6IA 3C2BA 1QPIA 4M3EA 2JA6J 2NVTJ 1OCPA 4A3CJ 4IHXA 2ME0A 2ECBA 1JKQC 2FQ4A 4C3JJ 3BR0A 3ZQFA 1H88C 3HOUJ 3BR1A 1IUFA 2JJ7A 3JRHA 1U8BA 2M9HA 5E3MA 3BG5A 3L1PA 1S7EA 1X58A 4MIMA 3QPSA 1JJ6C 2LR8A 4BY1J 4DYQA 1RPWA 3GTOJ 2K9NA 2X6OA 2DA1A 2I10A 3OSGA 1QVUA 2M2EA 1NTCA 1K61A 2JA5J 2LLKA 2E2HJ 1I6HJ 1BJZA 2NOGA 2VKEA 2ELKA 1ZK8A 3K7AJ 1UMQA 2ID6A 4AYBN 3S2DJ 2XB0X 4JX5A 2HQ5A 5JLXA 2R7ZJ 5EG0A 4A3KJ 2DA6A 2QCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQC A;  3S15 J;  5FKO A;  5JLW A;  3JR9 A;  4A3D J;  1JUP A;  2DA5 A;  3ZOB A;  1ZKG A;  2R5Y A;  5IOZ A;  4A3L J;  3S16 J;  3Q0V A;  1VND A;  4FIS A;  1HF0 A;  5EG0 B;  2KT0 A;  4C3H J;  5FJ8 J;  2EZI A;  3HOX J;  1IGN A;  5F0C A;  1HDP A;  4I76 A;  2ECC A;  2DMU A;  2LKX A;  3GTP J;  2DA2 A;  1U9N A;  2CUF A;  2DJN A;  3HBL A;  3FIW A;  2XRL A;  4AUX A;  5HOD A;  5K7Z A;  4JP0 A;  3JRF A;  2JA7 J;  1YRN A;  2P81 A;  4DZP A;  3S17 J;  1XC5 A;  2XPW A;  3NAU A;  4RBO A;  3B6A A;  2FJ1 A;  2JA8 J;  1X2N A;  3JRE A;  4G12 A;  1TWH J;  5E3N A;  4QIW N;  5J1U A;  2D5V A;  3ZQI A;  4L5E A;  3JRG A;  3BTL A;  1UHS A;  1PUF A;  3PM1 A;  1WGX A;  4M3G A;  4BBS J;  3TED A;  1YRN B;  2MW8 A;  2E1O A;  2WAQ N;  3BTI A;  2QF7 A;  2L9R A;  1DU6 A;  1FJL A;  1B8I A;  2DA3 A;  4XIC A;  4MFE A;  2EZH A;  2XSD C;  2CU7 A;  2VPR A;  1LFU P;  1LE8 A;  1RKT A;  3HOY J;  1XS9 A;  1PUF B;  2XGD A;  1Q1V A;  4C3I J;  5J1Y A;  3FKI J;  1FTT A;  1ETW A;  1B8I B;  3I4N J;  5F08 A;  4S0H B;  4IHW A;  1LE8 B;  3LSP A;  5J3L A;  2ZB9 A;  2MG4 A;  4W97 A;  5F27 A;  4BBR J;  2YS9 A;  2NVX J;  3FK7 A;  2YUS A;  1NK2 P;  2WB1 N;  1UG2 A;  2NS8 A;  2MGQ A;  3E7L A;  1QRY A;  5EEA A;  1MBE A;  4A3B J;  5EGO A;  2ID3 A;  2DMQ A;  4FTH A;  1HLV A;  4JX4 A;  4Y7N J;  3JRB A;  1AHD P;  1BA5 A;  2IBD A;  2DMT A;  3Q3S A;  1ZQ3 P;  1H89 C;  4AC0 A;  1HOM A;  2AO9 A;  1JTX A;  3HDD A;  5EZH A;  3HOW J;  3ZQL A;  1U9O A;  1NK3 P;  5J1R A;  5EGO B;  1IJW C;  3GTL J;  2LFB A;  2XPU A;  5E3L A;  3BR6 A;  2NS7 A;  4V2F A;  1ZR2 A;  5C3E J;  4A3F J;  1FIA A;  1VI0 A;  4XRS A;  1ETO A;  1WPK A;  4QTR A;  1ORK A;  3BG3 A;  3BR3 A;  3DCF A;  3W6V A;  1IRZ A;  2XB5 A;  4A3M J;  2EZL A;  1JTY A;  3HEF A;  3TW7 A;  5K7H A;  3RZD J;  4FCY A;  1DU0 A;  1BW6 A;  1U78 A;  4DYC A;  4JYK A;  4D7N A;  2XGC A;  2Y9Y A;  1ENH A;  4B1R A;  4XRM A;  2HOS A;  1GT0 C;  1D5Y A;  2M34 A;  1WI3 A;  2IEK A;  4A69 C;  2LK2 A;  2JN6 A;  4W1U A;  1POG A;  1IG7 A;  1EF4 A;  3B6C A;  4NDL A;  3S1Q J;  5IYB J;  1ZR4 A;  4D5F A;  2ME6 A;  1AU7 A;  3BG9 A;  1ETV A;  3F0C A;  4XID A;  4M3F A;  4FE4 A;  2LD5 A;  1W0U A;  1HDD C;  1F43 A;  2HI3 A;  3O8G A;  5GPC A;  1B72 A;  2Y31 A;  1I3Q J;  3LNQ A;  4M3B A;  2CQQ A;  1MSE C;  1JT6 A;  2DA4 A;  2G0E A;  3RKQ A;  5GP9 A;  2GBY A;  5EZG A;  2FX0 A;  3OSF A;  4Y52 J;  3IV5 A;  1FTZ A;  3O8H A;  2H1K A;  2CUE A;  1TWC J;  2E19 A;  1B72 B;  5FKL A;  2R5Y B;  2FD5 A;  3GTG J;  2VUM J;  2DA7 A;  5M5Y J;  3BR5 A;  3MVP A;  4CYC A;  3BQZ A;  3TP0 A;  2Y0S N;  2TRT A;  2CQX A;  1WH7 A;  1WCM J;  2VKV A;  1VFC A;  2O9L A;  1I50 J;  4X6A J;  1P7I A;  3SJM A;  4GFB A;  2L7M P;  3S14 J;  1T56 A;  5IP6 A;  4CYC B;  4MO7 A;  3RZO J;  1GUU A;  3GTQ J;  3A03 A;  4M6V A;  3M3Y J;  2Y30 A;  4X1E A;  2COB A;  9ANT A;  4DYR A;  3HGY A;  3BR2 A;  4EEF G;  3BTJ A;  2LVS A;  2NVQ J;  5FLM J;  4LOC A;  4D5C A;  4IEJ A;  1G2H A;  4M3D A;  3GTJ J;  1IDZ A;  1W0T A;  2EH3 A;  1Y1V J;  3LOC A;  4RDU A;  3BQY A;  4D7M A;  1JKO C;  2HXI A;  4A3J J;  1ITY A;  1T33 A;  1WH5 A;  2EBI A;  3FIS A;  5FKN A;  1O4X A;  4V2G A;  1MBK A;  1ETX A;  3IH4 A;  5FLV A;  3S1N J;  1MBG A;  1JUS A;  2IAI A;  1JGG A;  1RET A;  5BNG A;  3MKL A;  1MBH A;  1RES A;  1TWG J;  5FKK A;  2K9Q A;  3I4M J;  1Y1W J;  3GBG A;  1VF9 A;  5IPA A;  1RR7 A;  2RAE A;  3OOU A;  4J19 A;  2L0K A;  1SAN A;  3UKG A;  2JMW A;  4BKX A;  2B63 J;  1TWF J;  1ZGW A;  5DS9 A;  4A3I J;  1Z77 A;  1GVD A;  3G1L A;  3IH3 A;  1ETY A;  5DTD A;  2DTZ A;  2HYJ A;  1GV2 A;  2E2I J;  3G1M A;  1TWA J;  4UUT A;  2AHQ A;  5F0H A;  3JRD A;  4IHV A;  1MH4 A;  1MSF C;  2CJJ A;  2DMN A;  4ABZ A;  1JUM A;  1JT0 A;  4C2M J;  3BTC A;  2PMZ N;  2OF7 A;  4MLO A;  3S1R J;  1FEX A;  1X2M A;  3VPR A;  3CQZ J;  3Q0W A;  3GTM J;  5M3F J;  3M4O J;  1APL C;  5F04 A;  3TP3 A;  1HCR A;  1ETQ A;  1BW5 A;  5IP7 J;  2R0Q C;  2M8G X;  3LSR A;  2DN0 A;  4XRS G;  2WV1 A;  1XG1 A;  5M5X J;  4UUS A;  5C4X J;  2TCT A;  3LSJ A;  1OCT C;  3CDL A;  3HOV J;  1GDT A;  3SDG A;  2K40 A;  2NVY J;  1BL0 A;  2R92 J;  1IV6 A;  2Y9Z A;  5C44 J;  4HNV A;  3QPL A;  1QVT A;  3CCY A;  2HOT A;  2JWT A;  4UUS B;  1TC3 C;  3HB9 A;  3WHC A;  1H8A C;  1Z0X A;  3NAR A;  2R5Z A;  3SFI A;  1E3O C;  2JK3 A;  3QQA A;  2O7O A;  1MBJ A;  1GV5 A;  4FE7 A;  1F36 A;  2GM4 A;  1MBF A;  2KDZ A;  1CQT A;  3DEW A;  5IP9 J;  5EDN A;  2R5Z B;  1AKH A;  5GPA A;  1ETK A;  2K9S A;  5EF6 A;  2M0C A;  2W48 A;  5C4J J;  3JRC A;  1K83 J;  1LFB A;  2LY9 A;  2O8K A;  3LSG A;  2OPT A;  1AKH B;  5IYC J;  3CMY A;  3A01 A;  3K2A A;  3A02 A;  2N8G A;  2VI6 A;  4BXX J;  4A3E J;  3S1M J;  4A3G J;  4DZJ A;  3JRI A;  5IOY A;  2X9D A;  3BT9 A;  1JKR C;  4DW6 A;  3HGG A;  3WHB A;  2XGE A;  3A01 B;  3OIO A;  3RQI A;  2LTP A;  2L7F P;  1OFC X;  4QSH A;  1MH3 A;  2EQR A;  3IH2 A;  4JX6 A;  1JJ8 C;  3ZQG A;  5F0F A;  2E2J J;  3HKZ N;  4B4C A;  2EZK A;  4B3A A;  2GLO A;  5FKM A;  3ZQH A;  2HDD A;  5IYD J;  2L7Z A;  4MFD A;  1MNM C;  5E3O A;  2DMP A;  4XK4 A;  3TW6 A;  1RKW A;  1ZTR A;  3JRA A;  1P7J A;  4BY7 J;  3FK6 A;  2H8R A;  2R93 J;  3H0G J;  5M5W J;  5EYR A;  2X48 A;  2XPV A;  2Y2Z A;  3H3V K;  3HOZ J;  1JKP C;  2HOA A;  1SFO J;  3G1O A;  1FIP A;  3PO2 J;  3D1N I;  2LP0 A;  3S2H J;  3MN2 A;  5K7F A;  2HXO A;  5M3M J;  5F1J A;  3PO3 J;  4IHY A;  2MSY A;  3Q0U A;  3HM5 A;  1IDY A;  1A5J A;  1OJL A;  2YU9 J;  1R9T J;  2CRG A;  1IC8 A;  4A93 J;  3GTK J;  4I6Z A;  1A6I A;  3C2B A;  1QPI A;  4M3E A;  2JA6 J;  2NVT J;  1OCP A;  4A3C J;  4IHX A;  2ME0 A;  2ECB A;  1JKQ C;  2FQ4 A;  4C3J J;  3BR0 A;  3ZQF A;  1H88 C;  3HOU J;  3BR1 A;  1IUF A;  2JJ7 A;  3JRH A;  1U8B A;  2M9H A;  5E3M A;  3BG5 A;  3L1P A;  1S7E A;  1X58 A;  4MIM A;  3QPS A;  1JJ6 C;  2LR8 A;  4BY1 J;  4DYQ A;  1RPW A;  3GTO J;  2K9N A;  2X6O A;  2DA1 A;  2I10 A;  3OSG A;  1QVU A;  2M2E A;  1NTC A;  1K61 A;  2JA5 J;  2LLK A;  2E2H J;  1I6H J;  1BJZ A;  2NOG A;  2VKE A;  2ELK A;  1ZK8 A;  3K7A J;  1UMQ A;  2ID6 A;  4AYB N;  3S2D J;  2XB0 X;  4JX5 A;  2HQ5 A;  5JLX A;  2R7Z J;  5EG0 A;  4A3K J;  2DA6 A;  2QCO A; 
#chains in the Genus database with same CATH topology
 1HKS A;  3SQN A;  3M1E A;  4NBQ A;  1XSV A;  5AIP A;  5JLW A;  4IX7 A;  2HFH A;  4B09 A;  2DFE A;  1D3Y A;  1HW1 A;  4OIQ F;  1ZKG A;  1K6O A;  1UAA A;  3JAM Z;  1W7P B;  2F5D A;  1S6L A;  4E7H A;  5CJ9 A;  1HF0 A;  4IRI A;  1U5T A;  3WE2 A;  2VPL A;  2VOP A;  2KT0 A;  2E1C A;  2XAQ A;  3SZP A;  1J59 A;  3EUA A;  1IGN A;  2QM3 A;  2FEZ A;  3NRV A;  5ICG A;  4F52 A;  4RM3 A;  2LKX A;  4Q48 A;  1VTN C;  2XAJ A;  2ICW G;  3GCM A;  2BY2 A;  4BQQ A;  2EFW A;  2EFQ A;  2V7F A;  1BI0 A;  3ASN H;  2W25 A;  3P9C A;  2ZXI A;  3RYP A;  2VC0 A;  2PJR A;  2UXN A;  4JP0 A;  3JRF A;  3ZR8 X;  4BE2 A;  3KP7 A;  2PJP A;  1O57 A;  1XC5 A;  3AL0 B;  2XPW A;  2FJ1 A;  3OL3 A;  2JA8 J;  1I3A A;  2CW7 A;  4H0E A;  4CH7 A;  1TWH J;  3R0A A;  3K4C A;  4GYG A;  2W82 A;  1VQO I;  1BR1 A;  2V9P A;  4E4H A;  5J1U A;  1D8J A;  3K4N A;  1XGM A;  3GFL A;  1ON2 A;  2L4M A;  1PUF A;  3MZ8 A;  4BBS J;  3H9J A;  3K0L A;  2D1V A;  2MLK A;  5DCM B;  4O3M A;  2MW8 A;  3R4K A;  2E1O A;  4ZZL A;  4KFC A;  1K79 A;  2L9R A;  3CMM A;  4EGY A;  2EZH A;  1RKT A;  2K3F A;  2L9N A;  5HNF A;  2UUZ A;  2Q1Z B;  4C2U A;  2BE5 F;  1Q1V A;  2QQA A;  4HSR A;  4YFK F;  1FTT A;  1IZ1 A;  4BUP A;  3HSF A;  3X2Q H;  3I4N J;  5JR3 A;  2R7W A;  1MZB A;  2W84 A;  4EVI A;  3K4L A;  1WJD A;  2NVX J;  1YJW I;  3KLN A;  3N97 A;  3HRM A;  1BJA A;  4L9T A;  2ZC2 A;  5DD4 A;  5DM6 F;  1HKT A;  1DPR A;  4A3B J;  2MA3 A;  1OKR A;  2DDB A;  4WXH A;  3CMA I;  2RQQ A;  3FXR A;  4Y7N J;  4C9Y A;  3JRB A;  1R22 A;  1ONV A;  2E36 A;  3TDU C;  1AHD P;  2X51 A;  4ESB A;  1Z6R A;  2DCE A;  4XKC A;  3CCE I;  1H89 C;  5D6E A;  2AO9 A;  1TTY A;  1JTX A;  3P7N A;  4AID A;  5EZH A;  3HOW J;  4B8X A;  4Y17 A;  1XMK A;  5EGO B;  4IXA A;  3CLQ A;  5J4Y A;  1RC9 A;  3E97 A;  1SEU A;  1IJW C;  1GVJ A;  2HQA A;  3BR6 A;  2EV6 A;  3KE2 A;  5LHG A;  3LST A;  1MNE A;  4A3F J;  1FIA A;  2EV0 A;  1FT9 A;  1VI0 A;  4XRS A;  1ORK A;  5LHI A;  3BR3 A;  3DCF A;  3H3Z A;  4EMS A;  3JTG A;  3OYD A;  2XB5 A;  3O6B B;  3HEF A;  3KEY A;  4HST A;  2VQC A;  3RZD J;  2X6X A;  2L9V A;  1BW6 A;  1P4A A;  1TBX A;  3ZMS A;  3ABM H;  2EWN A;  3ESW B;  2BW3 A;  4UHT A;  1ENH A;  4RAY A;  5H6R A;  5DDG A;  3E6B A;  4A69 C;  1IRF A;  1MJB A;  2LK2 A;  4HDU A;  1LKX A;  2JN6 A;  4W1U A;  1POG A;  2XV4 S;  2K9L A;  2VQL A;  2HNH A;  4KJZ A;  4XLE A;  4BNC A;  3GF2 A;  4NDL A;  4PJN A;  2VQG A;  2HDW A;  2EFO A;  4V19 K;  5IT9 K;  3CDI A;  2W7N A;  1F43 A;  4XLC A;  3FXO A;  1B72 A;  1KU3 A;  2Y31 A;  3AG2 H;  1D1C A;  1I3Q J;  1W5T A;  4M3B A;  2ESH A;  1V5G A;  1JT6 A;  3ECO A;  4IL6 C;  3OMY A;  3RKQ A;  1R1V A;  4E70 A;  2GBY A;  4YRV A;  4PJL A;  3E1S A;  1HA8 A;  2V6E A;  2LKP A;  3I59 B;  2H1K A;  1H0M A;  1S7O A;  3D5R C;  2VJ5 A;  2R5Y B;  3CCL I;  2FQ3 A;  3CJR B;  1UST A;  3KLO A;  3GZ6 A;  2J5P A;  4RAZ A;  1BC7 C;  1Z05 A;  2DA7 A;  4MQV A;  4LIV A;  1FBQ A;  3BR5 A;  3CUQ A;  3KX2 A;  2E35 A;  3KET A;  4E7K A;  4ENM A;  2TRT A;  2CQX A;  2DJI A;  4PK4 A;  4EM1 A;  3WTY C;  4KYW A;  5ICC A;  1I50 J;  1WJB A;  1YJ9 I;  3G73 A;  1Y8Q B;  1H9G A;  3T0Y A;  4X6A J;  2XC7 A;  3QYE A;  1T56 A;  1BI1 A;  2F5F A;  1QQI A;  2BHZ A;  2KPM A;  5K5Q A;  3LSI A;  3RZO J;  2OC6 A;  1QHG A;  1I6X A;  1I39 A;  2VXZ A;  3A03 A;  2WAQ A;  3M3Y J;  3QRF F;  4X1E A;  4L0Z B;  3OS0 A;  3WTU C;  3HGY A;  4Q47 A;  3DWL E;  4OIP F;  3BR2 A;  3FBI B;  4R79 A;  4D5C A;  4M3D A;  3GTJ J;  5KAI C;  4P9F A;  3BG7 A;  3OS1 A;  4BL0 B;  2RNG A;  3DU6 A;  4ESJ A;  2XAF A;  3VYU B;  4ENN A;  2IA1 A;  4EM0 B;  2HXI A;  4A3J J;  3CF5 F;  1ZHF A;  1ETX A;  5FLV A;  4HRI A;  3FXM A;  1OMI A;  2XF5 A;  1XN7 A;  2O03 A;  2R4G A;  3A0H C;  1JGG A;  2WB1 A;  1RET A;  2R3S A;  3FMS A;  2F5E A;  2QKL B;  2OCE A;  3DKX A;  2K27 A;  3I71 A;  5FKK A;  1YJN I;  1DQU A;  1MMA A;  4EQQ A;  4J19 A;  3OOU A;  1SAN A;  4NC6 A;  3BDD A;  4MTE A;  5ICF A;  2EIL H;  1W7P D;  4MQ9 F;  4NQW A;  2IA0 A;  3H36 A;  2H1L A;  1ZGW A;  2M5W A;  4XKB A;  5DS9 A;  2R7U A;  1ACI A;  1Z77 A;  3BG6 A;  1GVD A;  3C7J A;  4QPQ A;  1AWC A;  3WGG A;  1AOY A;  3D0S A;  3G1L A;  1ETY A;  3IH3 A;  3W2A A;  1D0Z A;  2DAO A;  2DTZ A;  3OWT A;  5LEK A;  1CF7 B;  4UUT A;  2AHQ A;  2F5V A;  2MBF A;  3TO6 A;  1FSE A;  5F0H A;  3JRD A;  4IQJ A;  3MMY B;  3DTK A;  4ABZ A;  1G6N A;  4MTD A;  2DK8 A;  3LSK A;  2DK5 A;  4Q4Z F;  3BTC A;  3CUQ C;  4MLO A;  1FEX A;  4DOZ A;  2Z16 A;  4PFP A;  1IRG A;  1R5G A;  3OYI A;  2V1U A;  4A6D A;  1WVR A;  3OYN A;  1PP8 F;  2VJI A;  4YIF A;  5HOO A;  3RIR A;  1MMG A;  4ZYH A;  1ETQ A;  3K4M A;  1MDM B;  5K5R A;  3HRS A;  2M8G X;  4ITV A;  3TO7 A;  2VLA A;  2CQN A;  2FMY A;  4XRS G;  2HS5 A;  4DJA A;  2LC2 A;  3QU6 A;  2TCT A;  2A07 F;  3LSJ A;  1MD0 A;  4KIC A;  5D8K B;  5KHD A;  3Q5F A;  1LPQ A;  1EKE A;  1R5I D;  3HPG A;  4HYE A;  2R92 J;  4IZZ A;  2Y9Z A;  4U88 A;  4HNV A;  3BJO A;  1QVT A;  4GGG A;  5J40 A;  5EEG A;  3ZPL A;  2MFZ A;  3NAR A;  2QSF X;  3L2C A;  3E5X A;  3OYB A;  1E2X A;  2JK3 A;  5E18 F;  3RKX A;  1O7L A;  1XMA A;  2O7O A;  4XLF A;  2IW5 A;  1X3W B;  2H09 A;  1F36 A;  2DOE A;  4Z6Y A;  4XSX F;  4YII A;  1WWX A;  1MBF A;  1ZRF A;  2XAU A;  1FOK A;  1SD7 A;  1BIA A;  3DLA A;  3KFW X;  3JTH A;  4YFX F;  1AKH A;  2RN7 A;  2Y0S A;  4IOA F;  4KA4 A;  2ZFU A;  2M87 A;  2F6C A;  5LGN A;  2V26 A;  3GME A;  3F8N A;  3WU1 B;  1X3U A;  5GAD J;  2QWW A;  4U7D A;  2O8K A;  3M07 A;  3LSG A;  4MGR A;  1ODD A;  1L0O C;  2UV1 A;  1JE8 A;  3DPU A;  1KQ8 A;  3VWB A;  2QEN A;  4OU0 A;  4BDZ A;  4Y33 A;  2AXT C;  2ZCW A;  3HL2 A;  1DP7 P;  3S93 A;  2GZW A;  1YX3 A;  3L2W A;  1KU7 A;  5CLS A;  5IOY A;  3BT9 A;  2FSW A;  1S5L C;  2I5U A;  4DW6 A;  2JSP A;  3G71 I;  4A5N A;  2LBF B;  2HKX A;  2YX7 A;  1LDJ A;  3M8E A;  3A01 B;  2FML A;  3OIO A;  1UB9 A;  2XRN A;  3CF2 A;  3I3L A;  3GLX A;  2L7F P;  4KT6 A;  5FB2 A;  1XPX A;  2WA0 A;  4N9H A;  1MH3 A;  3HOS A;  1S8N A;  3LQR A;  3ZQG A;  2CUJ A;  2E2J J;  4EJO A;  2IS6 A;  3WTZ A;  4B4C A;  1Z3X A;  4B3A A;  1ZEL A;  4OAZ A;  4D0P A;  5HLH A;  2WV0 A;  5FKM A;  2HWV A;  1TL8 A;  2GLO A;  3PSI A;  3S32 A;  5B1B H;  2L7Z A;  4E7Z A;  5E3O A;  2DMP A;  3L2Q A;  4XK4 A;  4WXC A;  5D5X B;  2FBI A;  3EUH C;  3PNV A;  4BDY A;  3C2H A;  3JRA A;  5D5V B;  2XF7 A;  5CVI A;  2L5Q A;  5CYV A;  5F64 A;  1LJ9 A;  2W00 A;  3JW4 A;  3VOE A;  4LD5 A;  2X48 A;  2XPV A;  4YEL A;  4CXF A;  1JKP C;  5J8F A;  1SFO J;  3RQ4 A;  2IXS A;  1S29 A;  2GXG A;  2W85 A;  2VB6 A;  3MN2 A;  3DU5 A;  5K7F A;  4ZYG A;  4XL9 A;  1WJC A;  2HXO A;  4MEY F;  4ON0 A;  2QUF A;  3SXY A;  1B9N A;  1T95 A;  5E8I A;  5E79 C;  1QZE A;  2K02 A;  3E5U A;  3Q0U A;  1PVE A;  2PQ8 A;  2PMZ A;  4LB6 B;  1IDY A;  2D1H A;  1SVM A;  1OJL A;  2YU9 J;  3L00 A;  3RPQ A;  1YS7 A;  2DQR A;  4ETS A;  4EJV A;  4G7Z F;  1HBX G;  3KYC B;  1V5F A;  3GTK J;  4GDF A;  4A5M A;  4CCL A;  1QPI A;  3G2B A;  5TGT A;  3KP4 A;  2JA6 J;  2NVT J;  2STW A;  3KZI C;  1ZLK A;  3HSE A;  3ZQQ A;  3BR0 A;  2VC1 A;  5JHF A;  1H88 C;  1MMN A;  1VQ9 I;  3GW2 A;  4HG2 A;  3RI4 A;  4MIM A;  2M4K A;  3QPS A;  4L5J A;  1JJ6 C;  1IN6 A;  3GFM A;  3REO A;  4Y13 A;  2KQR A;  1W36 C;  2K9N A;  4O6J A;  3S3N A;  3UR3 C;  5CQE A;  3SHF A;  3K70 C;  3DLL F;  1TW2 A;  5JVG F;  2JA5 J;  4UNO A;  1R36 A;  2XKP A;  2A69 F;  3K7A J;  3E6D A;  2L7K A;  2ID6 A;  2K4B A;  3FXJ A;  4AYB N;  3S2D J;  3CES A;  4JX5 A;  1JXS A;  4N4N B;  1XDU A;  3HHH A;  2KMU A;  3J7Z I;  2L2O A;  3MZY A;  3OYC A;  4XLN F;  5FKO A;  3JR9 A;  1IO2 A;  3EET A;  2HYF A;  1P2F A;  1JGS A;  1G3Y A;  1UJ8 A;  3T8T A;  1QBJ A;  2BXZ A;  1KON A;  4I02 A;  3FBN B;  2GOX B;  3Q0V A;  4QWQ A;  4R8H A;  1VND A;  4BEH B;  3VFZ A;  2RDP A;  5EG0 B;  3H5R A;  5D5W B;  2P5V A;  2M8E A;  4C3H J;  5FJ8 J;  2HDC A;  4NB5 A;  1ON1 A;  5LRR A;  5F0C A;  5ILS A;  3Q9S A;  5LGT A;  2A61 A;  1R00 A;  4C2T A;  1DDN A;  2F48 A;  3M8F A;  1U9N A;  2CUF A;  2DJN A;  2V1N A;  3KPH A;  1MMS A;  2OTJ I;  3OYJ A;  4AUX A;  2KL4 A;  2A5Y B;  5HOD A;  1U5T B;  3EQL F;  5FGM A;  1YFH A;  4RLQ A;  2R7F A;  2P81 A;  4DZP A;  3S17 J;  2P6T A;  1X2N A;  3IHU A;  1UHM A;  1HW2 A;  5HDG A;  1IN4 A;  3ZQI A;  3AG4 H;  3SEQ A;  3JRG A;  4AD9 A;  2PJR B;  1WGX A;  4M3G A;  2WWY A;  2CV2 A;  1Z6T A;  4HX4 A;  2BHY A;  4RM2 A;  3COA C;  2OAZ A;  2KIU A;  2PN6 A;  4RB2 C;  4ZJZ A;  1DU6 A;  2EFN A;  1B8I A;  4M6X A;  1FJL A;  4RGX A;  3KP6 A;  1K7A A;  5CVU A;  2CU7 A;  2VPR A;  1LE8 A;  2BXY A;  1HC8 A;  1ZRC A;  3TDZ C;  4DQ2 A;  1T0F A;  1XS9 A;  2KRH A;  2F2E A;  3F72 A;  5DEQ A;  1PUF B;  2P6S A;  3P9I A;  1I1G A;  5J1Y A;  3CC4 I;  1STZ A;  1ETW A;  3QOE A;  4YG2 F;  1N25 A;  4IHW A;  1MJA A;  2OZ6 A;  5J3L A;  2MG4 A;  2ZXW H;  2QSG X;  1T2K A;  1J7K A;  2HTS A;  2K85 A;  1XX5 A;  3FK7 A;  2IGM A;  1K78 A;  1NK2 P;  3KZY A;  2NS8 A;  4GXO A;  4UVA A;  5DV5 A;  4KIF A;  4M6Y A;  1U8R A;  3E7L A;  1QRY A;  3HOT A;  4HX8 A;  1A31 A;  1ZRD A;  2VJ4 A;  3BY6 A;  4HEA 2;  5E1X A;  2HQN A;  2M7B A;  5CKT A;  4FTH A;  1HLV A;  1ZLJ A;  4JX4 A;  1XCB A;  1DP3 A;  2JVH A;  3QOD A;  4WK8 F;  3IKT A;  2F4O B;  2DMT A;  3HPH A;  1ZQ3 P;  2COM A;  4IVN A;  2VOD A;  4AU7 A;  4BJT A;  3S3O A;  4OIO F;  2VXD A;  5A2Q Z;  5B1A H;  2WTE A;  4N4O B;  4V2F A;  5C3E J;  3L2V A;  3VOD A;  4NHJ A;  1ETO A;  3HYI A;  1DPU A;  1R6R A;  3GUD A;  3RKW A;  1IRZ A;  3TW7 A;  5K7H A;  3J7A O;  1DU0 A;  1R4M B;  1Z21 A;  1U78 A;  3W6J B;  4HDV A;  4DYC A;  4JYK A;  1EH8 A;  4D7N A;  3MKW B;  4BS9 A;  3LL7 A;  3GEZ A;  3MWM A;  2GIV A;  4F93 B;  1N78 A;  5K1Y A;  1GT0 C;  3BWG A;  1USS A;  1ZGJ A;  3OY9 A;  2IEK A;  2ZSI B;  1IG7 A;  1EF4 A;  3K69 A;  2EPF A;  3VYS B;  3CJN A;  5IYB J;  2PI0 A;  3O2P E;  1WI9 A;  2BW3 B;  1VQM I;  3CC2 I;  3CD6 I;  1AU7 A;  3BG9 A;  1FBU A;  3F0C A;  4XID A;  4LGW A;  1T0F C;  3ML6 A;  1HDD C;  3V7C A;  2HI3 A;  3CCM I;  1WSU A;  3G4S I;  4I0B A;  2TDX A;  3BJ6 A;  2DA4 A;  2G0E A;  3ZRG A;  2M3A A;  1BR2 A;  4HW0 A;  3OSF A;  1NG6 A;  3IV5 A;  1FTZ A;  5TRD A;  2GOM A;  3O8H A;  4FET A;  4RA2 A;  3RKY A;  1B72 B;  4B3X A;  4DBQ A;  5HS8 A;  5FKL A;  4BE1 A;  2FD5 A;  3S2W A;  2CG4 A;  4L9J A;  1RNL A;  1WZ2 A;  1FC3 A;  3HRU A;  3HXL A;  5E1Z B;  4AVZ A;  4S04 A;  1SFU A;  2KRC A;  4HQE A;  1SMT A;  3BQZ A;  4O5V A;  4CGZ A;  1EA3 A;  5CVR A;  1XD7 A;  3PIP F;  3F3X A;  1Q1H A;  1WCM J;  2ETH A;  2VKV A;  2O8X A;  4I09 A;  2VJJ A;  5BMZ A;  2V4J C;  4M72 A;  4HZF A;  3SZG A;  2Z99 A;  2BYV E;  3GXO A;  3MEX A;  1P7I A;  3IRR A;  4CIC A;  3S14 J;  3CUQ B;  4ZDP A;  4BH9 A;  4CZC A;  1J09 A;  2ELH A;  3HTU A;  3VYT B;  3GVA A;  1VQ4 I;  2E34 A;  4UUV A;  1ZAR A;  4EEF G;  3GWZ A;  2B9S A;  2LVS A;  3I9V 2;  1PJR A;  1G8X A;  4HQM A;  5FLM J;  4I0A A;  3J80 K;  4IEJ A;  1GXP A;  1IDZ A;  1IN8 A;  1W0T A;  3A2K A;  1EJ9 A;  1Y1V J;  3IP4 B;  1S72 I;  4E6K G;  2CV1 A;  3FM3 A;  2OTL I;  2XSJ C;  1OCO H;  4RB0 A;  1QZZ A;  3CLO A;  1SAX A;  4LG0 A;  1JUS A;  5GTH C;  3CUO A;  4RS8 A;  1Z67 A;  2QQB A;  2Y69 H;  1D0Y A;  5BNG A;  1HXD A;  1ZG3 A;  5HS9 A;  1XSX A;  1FBS A;  1RES A;  2NRA C;  4CCK A;  2KZV A;  4CO8 A;  3ZMV A;  3GBG A;  4NUB A;  3ZMD A;  2RAE A;  1G3W A;  3BZK A;  5TJJ A;  4JBA A;  2RV8 A;  1E3P A;  2ZXJ A;  4UB8 C;  2B63 J;  3ROU A;  1NHA A;  3H1C A;  4A3I J;  1VQ7 I;  2O5R A;  3AKZ A;  4U0V A;  2OBP A;  3ZCO A;  3O3K A;  4PJM A;  4U7B A;  2E2I J;  1BOA A;  4RB3 C;  1IV8 A;  3CP8 A;  1OLT A;  4L5I A;  5ILU A;  3I64 A;  1MSF C;  3R60 A;  2CJJ A;  1YX5 A;  3K1P A;  4WCG A;  1ZYR F;  3QWL A;  4NQW B;  1JT0 A;  1ZRE A;  4C2M J;  1TW3 A;  3AG1 H;  2QSH X;  1N75 A;  4II3 A;  3V8J A;  4D1Q A;  3S1R J;  2NVU B;  5JHU A;  3D5L A;  1X2M A;  3VPR A;  3W6K B;  1H9T A;  3CCU I;  3WU2 C;  2VIX A;  3K4B A;  2K4J A;  4BQN A;  4IRH A;  2HOE A;  2FBH A;  2KIF A;  1HCR A;  4LJZ F;  2NYX A;  2IT0 A;  1BW5 A;  2R0Q C;  1ZH5 A;  3IKV A;  5M5X J;  4BAY A;  5C4X J;  5IT9 Z;  2LNB A;  1QO0 D;  1U2W A;  1Z7L A;  1OCT C;  5D8L B;  2QQ9 A;  1BM9 A;  1GDT A;  2KP6 A;  3IC7 A;  2EK5 A;  1BI3 A;  2CYY A;  2FXA A;  2PEX A;  5C44 J;  5FD6 A;  2XAG A;  3CCY A;  3TKY A;  2FNP A;  4G6Q A;  3HB9 A;  3WTS C;  2C6Y A;  2HTJ A;  1EV7 A;  5ILV A;  2R5Z A;  3P9K A;  4XM3 A;  2DYR H;  5HVQ C;  1RUO A;  3FXU A;  1E3O C;  3FM5 A;  3LAP A;  1VZ0 A;  2F4I A;  2DPU A;  4HV6 A;  1YTY A;  2P5K A;  4FE7 A;  1TT0 A;  1NH3 A;  1YE9 A;  2GM4 A;  4LG3 A;  3QP6 A;  2AQE A;  1T08 B;  2KDZ A;  4FHT A;  1TZL A;  3OL4 A;  4IOC F;  4YIR X;  1FYK A;  2P7V B;  2VKD A;  4M74 A;  2ZJ2 A;  4OAY A;  1D1B A;  5GPA A;  2E7W A;  2L4A A;  1SC7 A;  1P4X A;  3F8B A;  5C4J J;  1K83 J;  4ZH4 F;  4AM3 A;  2QKM B;  2OPT A;  1AKH B;  2A3S A;  2X1E A;  1WQ2 A;  1Z9C A;  3A02 A;  5L3C A;  2N8G A;  2VI6 A;  2XIG A;  2E1M B;  4CA0 A;  2KIQ A;  2MH9 A;  5LGU A;  4A3E J;  4XSZ F;  2DOF A;  2JTV A;  4UVB A;  4A3G J;  1X1P A;  4DZJ A;  5ICE A;  2DT7 B;  3V8K A;  2XGE A;  1XTA A;  3BOQ A;  2FNA A;  2D45 A;  3N05 A;  3I54 A;  2CFO A;  5F0F A;  2B0L A;  1S3J A;  4BQO A;  3GFI A;  3NWS A;  3ZQH A;  3KP3 A;  1HSJ A;  2HDD A;  2OCC H;  3V7R A;  3H5A A;  3BZ6 A;  3TW6 A;  2PMU A;  1FWZ A;  5D5U B;  3KYL A;  1P7J A;  2BOL A;  4CHU A;  2H8R A;  2R93 J;  5M5W J;  4I99 C;  1MND A;  2GXB A;  5KNL A;  3H3V K;  2HQR A;  4Y3O A;  2Y75 A;  4XR6 A;  3ZMZ A;  2CS3 A;  1LDK B;  3G1O A;  3PQK A;  3EYI A;  1BOB A;  3PO2 J;  3D1N I;  2IGO A;  2EV5 A;  3FZV A;  4OMZ A;  2OV7 A;  2IPQ X;  2DXI A;  3LQQ A;  4XKW A;  5F1J A;  5K5O A;  4F55 A;  2ZJR F;  3LWF A;  1L3L A;  2DPD A;  1FMV A;  3U1D A;  3I58 A;  3TBI A;  4M9X A;  2E7X A;  1IC8 A;  3HTS B;  4P1W A;  1M1E B;  4A93 J;  3AL0 C;  2CUZ A;  1A6I A;  3C2B A;  2R7D A;  3WTT C;  4HOB A;  2AS5 F;  4A3C J;  4IHX A;  2HZD A;  2FQ4 A;  1IUY A;  1J75 A;  1FOX A;  2STT A;  1IUF A;  2JJ7 A;  3JRH A;  1U8B A;  5E3M A;  2UWM A;  4AIH A;  2EA2 A;  4BY1 J;  3EUH A;  3PNT A;  1RPW A;  1DGR M;  3QAH A;  4GRI A;  1V4R A;  4D9J A;  1YIO A;  5LEJ A;  1BI2 A;  3NQO A;  2M2E A;  1NTC A;  1K61 A;  2FUG 2;  2JVG A;  2NOG A;  4RGS A;  3VSL A;  2VKE A;  2ELK A;  2X85 A;  1TT5 B;  3KEO A;  5AIQ A;  2FOW A;  2XB0 X;  2R7Z J;  3EUK L;  3U1K A;  4C3J J;  5KAF C;  2CW0 F;  4IHT A;  1VQ6 I;  4ZTJ A;  3E0J B;  2V79 A;  5B5E C;  3H3U A;  3L09 A;  1JUP A;  5KVR A;  1KQ0 A;  2DA5 A;  3ZOB A;  4EJW A;  1OCZ H;  3BJA A;  1W1W E;  2X6W A;  2R5Y A;  4L18 B;  2ELJ A;  4E7L A;  4IJA A;  3S16 J;  4A3L J;  4HF1 A;  5GAE J;  1MW7 A;  2IS4 A;  3WU0 A;  2ISZ A;  2BBY A;  2ZNZ A;  2KZG A;  3J7A Y;  3MD2 A;  4I76 A;  5E1W A;  1LNW A;  4UV9 A;  5BS6 A;  1HW5 A;  3GTP J;  2DA2 A;  2XKO A;  4NNJ A;  4G9Y A;  4A12 A;  4MHG A;  1FX7 A;  3ZGK A;  1UFM A;  3FIW A;  2XRL A;  4Z2Y A;  3MKY B;  2O6G E;  2GQQ A;  2RNJ A;  1WJA A;  3GLL A;  3MQ0 A;  1MIJ A;  1YRN A;  2E5Z A;  3QPT A;  5JI6 A;  1BN5 A;  5LFA A;  4LLL A;  2ZME A;  3NAU A;  3B6A A;  2KLO A;  3K1M A;  3V4G A;  3K9T A;  2D5V A;  4DGW B;  3SFZ A;  3CO7 C;  5E17 F;  4U0Y A;  4F91 B;  4IHS A;  3CZ6 A;  3PM1 A;  5FFZ A;  3K2Z A;  4FAS D;  2WAQ N;  4OWR B;  1QZY A;  4H4K C;  3BTI A;  3F21 A;  2QF7 A;  3TGN A;  3CCQ I;  2DA3 A;  4I01 A;  1KQ9 A;  1Y56 A;  2XSD C;  1LFU P;  3HOY J;  2DT6 A;  5LBQ A;  4ZC3 A;  2QLZ A;  1OYY A;  2Z5U A;  3ISP A;  3U9G A;  3FMQ A;  1MJ9 A;  2QZ8 A;  1IRX A;  3ECH A;  2CV0 A;  1B8I B;  4PGG A;  3AAF A;  2MYS A;  4S0H B;  1LE8 B;  2ZB9 A;  3GZ5 A;  4EJU A;  4W97 A;  5F27 A;  3VEP A;  1VQP I;  4BBR J;  3WTV C;  2RGV A;  2YS9 A;  3WG7 H;  3HUG A;  2YUS A;  1YW9 A;  3DBR B;  2WB1 N;  1UG2 A;  1X1B A;  1YOV B;  2MGQ A;  4BHB A;  3Q9V A;  2ISY A;  1MBE A;  5EEA A;  4EJT A;  2KKO A;  2ID3 A;  2JRT A;  3IWZ A;  5HLT A;  3I4P A;  3OV8 A;  4L9V A;  2RVC A;  1BA5 A;  3SZT A;  2IBD A;  3DBL B;  1K78 B;  5J6X A;  3FXK A;  4AC0 A;  1XGO A;  1HOM A;  2QBY A;  4UV8 A;  2A6T A;  1U9O A;  2R7Q A;  3PUF A;  4WWC A;  1FYL A;  1NK3 P;  3QOP A;  2XAS A;  3GTL J;  2LFB A;  3ZP5 A;  4LK1 F;  5L3B A;  5E3L A;  5DD8 A;  4AIK A;  1G3S A;  4M71 A;  1SMY F;  2QGU A;  4QTR A;  5FLX K;  4JK1 X;  3W6V A;  3IRQ A;  2HYG D;  2LDU A;  5GTI C;  4A3M J;  4ZYD A;  1RI7 A;  1JTY A;  3V7S A;  2DT5 A;  4FCY A;  1KYZ A;  2ZME C;  3W3C A;  2M0M A;  5H6Q A;  1UEL B;  2HKO A;  3FXQ A;  2KIM A;  5D6F A;  2VQH A;  2BV6 A;  1N77 A;  2ZO4 A;  2VT2 A;  4XRM A;  1WI3 A;  2V1D A;  2H6B A;  5LLQ A;  4CCO A;  1PYV A;  2HU9 A;  1K6Y A;  2DW4 A;  1X1A A;  2K3P A;  3WGI A;  4CCN A;  4PDK A;  3S1Q J;  2W1O A;  1ZR4 A;  2HR3 A;  4D5F A;  4GCV A;  3U21 A;  1ETV A;  2VL8 A;  4M3F A;  1QNT A;  2LD5 A;  1E0E A;  2Z1D A;  2CGP A;  3O8G A;  3DPL C;  2VON A;  1E3H A;  2YR2 A;  3LNQ A;  1O3Q A;  1OIS A;  2CQQ A;  2L9S A;  1MSE C;  1REP C;  1WFX A;  2VN2 A;  4J01 A;  3KZZ A;  3KYD B;  1OCR H;  5EZG A;  2VBY A;  2FX0 A;  5BPD A;  3PL8 A;  3K4J A;  3SYT A;  5HNH A;  3C18 A;  2XDV A;  2E19 A;  2VOO A;  3QPH A;  1VQ8 I;  3GTG J;  3FKJ A;  2CWE A;  5M5Y J;  4FX4 A;  4KUM A;  3MVP A;  3A4C A;  3EYY A;  5EEH A;  2Y0S N;  3TP0 A;  4CYC A;  2Z33 A;  2LF7 A;  1J2X A;  3QYB A;  4CDG A;  2NNY A;  1RR8 C;  3OYG A;  1VFC A;  2X6Y A;  2Z3Y A;  2WAD A;  4Q5S F;  4XN3 A;  3SJM A;  4GFB A;  2QEX I;  1YS6 A;  2EIM H;  4RGU A;  5IP6 A;  1IW7 F;  3OR1 C;  2LBF A;  3B02 A;  2E1N A;  1G4D A;  4BHC A;  3DTE A;  4M6V A;  1D8K A;  2LSO A;  2Y30 A;  3HHG A;  3NEU A;  3HKZ A;  2D2W A;  2G7H A;  5IY5 H;  3BTJ A;  1O3S A;  2NVQ J;  4LOC A;  3DTI A;  1G2H A;  2BVM A;  2CH0 A;  1O7F A;  1QA6 A;  3LOC A;  4WF2 A;  4RDU A;  4XLA A;  4KMF A;  1D1A A;  3WE3 A;  2A68 F;  3BQY A;  1FY7 A;  4UXN A;  2DFH A;  4D7M A;  4IKF A;  4A2U A;  3DXJ F;  1ITY A;  2DDA A;  1WH5 A;  4S05 A;  4V2G A;  2DTR A;  1JHH A;  4HPQ A;  3IH4 A;  3BRO A;  1X19 A;  4CCM A;  2OD5 A;  1MBG A;  4G6T B;  4WXD A;  2FF4 A;  3CO6 C;  2LF8 A;  2L3D A;  3R61 A;  1WRJ A;  1LFP A;  2VE8 A;  2M7A A;  3MKL A;  3ABT A;  1TWG J;  4PSX A;  2R7T A;  1VF9 A;  3RJP A;  2GA2 A;  4G94 A;  4RAG A;  3HC7 A;  5L3D A;  3F6O A;  5F6F A;  1ZG5 A;  2L0K A;  2IVM A;  2JA2 A;  4LG0 B;  2UXX A;  2XF6 A;  4MNU A;  1TWF J;  1XB4 A;  5DTD A;  2K9M A;  2P8T A;  1E17 A;  1GV2 A;  3TL4 X;  3TO9 A;  2M45 A;  5HLG A;  4LLN A;  5DUK A;  1TWA J;  5ERI A;  3CCV I;  4HF2 A;  1MH4 A;  4IHV A;  4HF0 A;  1X1D A;  4BXF A;  1IAW A;  3RSN A;  2PMZ N;  2OF7 A;  2LH9 A;  3BPX A;  5L3G A;  5LRS A;  3L7W A;  3Q0W A;  3GTM J;  1R7J A;  4HA8 A;  3CC7 I;  3M4O J;  3SEZ A;  4DIQ A;  5TIS C;  5F04 A;  4KMU X;  3OYH A;  2JZY A;  3HSR A;  4EM2 A;  4KNY A;  2E5N A;  2EA4 A;  3P5J A;  2P0W A;  2OU2 A;  3E5Q A;  4RAF A;  1XG1 A;  3K6G A;  1J0R A;  1EH7 A;  4UUS A;  1GHC A;  1X1C A;  3N4M A;  2V9V A;  1DGW Y;  3S8P A;  3SDG A;  1B59 A;  2NVY J;  2NNN A;  3KP2 A;  2QA4 I;  1B4A A;  5L3E A;  1R49 A;  1IV6 A;  1BL0 A;  1FP1 D;  4NC7 A;  1FOY A;  3QPL A;  2HOT A;  2IS1 A;  4KDP A;  2HVR A;  3I56 I;  1Z3Y A;  2JWT A;  1TC3 C;  3BZC A;  1ZAO A;  1K4T A;  1H8A C;  2MD5 A;  2DOD A;  5DYM A;  5FFX A;  3SFI A;  3QQA A;  1GV5 A;  2X0L A;  2L02 A;  1UG0 A;  1YIT I;  1YIJ I;  2KFD A;  5J8C A;  1XGN A;  3GZN B;  5DM7 F;  3DEW A;  1D5V A;  1Y6I A;  5EDN A;  2R5Z B;  2ZJQ F;  5CPR B;  3JAM K;  2HVQ A;  1SVL A;  4OIR F;  4X0G A;  4XN0 A;  4CSW A;  1BR4 A;  4PJ0 C;  2K5C A;  2M0C A;  2W48 A;  1S9H A;  3A1Y A;  4Y4R A;  5GAG J;  2H27 A;  3HZJ A;  3C1D A;  4U0W A;  4BQA A;  3PJR A;  2IGK A;  5IYC J;  2V9K A;  2FBK A;  1MGT A;  2WY7 Q;  3K2A A;  1YQA A;  3FX3 A;  4AIJ A;  3OS2 A;  4UY8 I;  3CDH A;  2R7R A;  4BXX J;  3ABL H;  3BC8 A;  3J80 Z;  3S1M J;  1ZG1 A;  3OR2 C;  3OYA A;  2X9D A;  4XOR A;  4A6E A;  3I53 A;  1P92 A;  3ZN0 A;  5FRN A;  2ZBK A;  3WHB A;  1U6G A;  3RQI A;  2H94 A;  4XRF A;  3DFG A;  2LTP A;  2DFI A;  3ABK H;  3AG3 H;  4G7H F;  1T39 A;  1OFC X;  2DO7 A;  2QVO A;  3IUO A;  4QSH A;  3IH2 A;  4RGR A;  1WHU A;  4CCJ A;  1PP7 U;  3MFK A;  2DOA A;  3HKZ N;  2PFB A;  3FWE A;  1BC8 C;  2OZU A;  1KYW A;  4AWX B;  1T8I A;  2BY0 A;  2MAB A;  1IF1 A;  2JUC A;  2NXN B;  3R6S A;  5KK1 A;  1KU9 A;  5IYD J;  2VAS A;  4ESF A;  1W5C C;  2EJR A;  1KA8 A;  3T8R A;  1YO5 C;  3KIO A;  2DBB A;  4A0Y A;  3RPU D;  2F5C A;  2FU4 A;  1XDS A;  2ZNY A;  1OYI A;  5CVV A;  4OIN F;  2LOO A;  2R7V A;  2O3F A;  4OOI A;  4BY7 J;  3CCS I;  3OIP A;  1K4S A;  3DP7 A;  4K2E A;  3HOZ J;  5JFR A;  2X1D A;  2HOA A;  1YYV A;  1P6R A;  3ELK A;  1FIP A;  2Q2E A;  4KIS A;  1ERD A;  2BY1 A;  5M3M J;  2LRE A;  4CZZ A;  1XMX A;  4IHY A;  2CQ7 A;  2MSY A;  3H0D A;  3HM5 A;  3OYF A;  1MMD A;  1LVK A;  1ULY A;  1LEB A;  1A5J A;  2CRG A;  1U5T C;  4FT8 A;  3PNY A;  3WGH A;  3NWT A;  1W5S A;  4II2 A;  5FRM A;  4QLC U;  1XGS A;  3C2G A;  3C3W A;  1LVA A;  4HV5 A;  1JKQ C;  2PG4 A;  2BGC A;  1YHQ I;  2MD0 A;  1OCC H;  3ZQF A;  4LFU A;  2DLL A;  3BR1 A;  1LQ1 A;  3BG5 A;  3IAS 2;  3GYH X;  4EV0 A;  1TQM A;  1S7E A;  3I5U A;  3ZMT A;  1X58 A;  3BCB A;  4C30 A;  2VT3 A;  3L9F A;  2FOK A;  3F9K A;  4DYQ A;  4YFN F;  5J47 A;  3JCU C;  1JI8 A;  1B9M A;  5HDK A;  2LY2 A;  2ZJP F;  2Z9O A;  2DA1 A;  4GO1 A;  2A5W A;  2LLK A;  2E2H J;  1I6H J;  1BJZ A;  5D4S A;  2VBX A;  3ABU A;  1FOW A;  1FP2 A;  1LUJ B;  1W7P A;  1UMQ A;  3CME I;  1RIO H;  3L2U A;  4F92 B;  1BIB A;  1RZ4 A;  2EB7 A;  3JSO A;  2HQ5 A;  2Q8K A;  3I55 I;  1R1U A;  5JLX A;  4P5O A;  3ZN1 A;  4A3K J;  2DA6 A;  5E8G A;  3ZQC A;  5H20 A;  3S15 J;  1X3Z B;  2CO5 A;  2V1X A;  4XON A;  4RLF A;  4BHP A;  2DU9 A;  5D4R A;  2UZK A;  4A3D J;  4P9U A;  1B6A A;  3OYE A;  3H9Q A;  5IOZ A;  3MAJ A;  2RKH A;  3WG9 A;  3GX4 X;  2PMH A;  4FIS A;  2G7U A;  3LMM A;  4IPA A;  5H2F C;  1T38 A;  5J4V A;  3J81 Z;  2EZI A;  3HOX J;  1R4N B;  4XOP A;  3J81 K;  1D0X A;  1HDP A;  3LFU A;  2AQF A;  1IXS B;  2DMU A;  2ECC A;  3ULQ B;  3HG9 A;  3TOA A;  1P4W A;  3M7G A;  3HBL A;  2JQ7 A;  4Y15 A;  3MKZ A;  3PQJ A;  2BEO A;  3DKW A;  3OYK A;  2O61 A;  5K7Z A;  2JA7 J;  1A6Q A;  5DCM A;  1PDN C;  4RBO A;  3JRE A;  4G12 A;  4BJ5 C;  5E3N A;  4CUG A;  4QIW N;  3V42 A;  1UZC A;  2XVC A;  3BP8 A;  4L5E A;  6PAX A;  5FD5 A;  3BTL A;  1F1Z A;  2M30 A;  1UHS A;  1YG2 A;  2A05 A;  2KJB A;  2GAU A;  3TED A;  2FA5 A;  1YRN B;  1QHH D;  1YLF A;  2ZME B;  3OYM A;  4ASN A;  2WC2 A;  4PCQ A;  4XIC A;  2ZSH B;  4MFE A;  3E3V A;  4IQ4 A;  1GXQ A;  3R0J A;  2H8W A;  3CCR I;  2B7E A;  3FDY A;  4LB5 A;  1OYW A;  2JPC A;  4HNU A;  5HLI A;  1IN5 A;  3FHN A;  2XGD A;  2IA2 A;  3M9A A;  4C3I J;  2OQG A;  2RC4 A;  2HEO A;  3FKI J;  4E7S A;  2JPB A;  5L3F A;  2HPI A;  2DYS H;  2EFP A;  5F08 A;  5BQT A;  1QU3 A;  2MC4 A;  4BXU A;  3LSP A;  5FRO A;  2JUG A;  3TOB A;  2Y0M A;  2CW8 A;  3WTX C;  2KDO A;  2EIN H;  2I8D A;  2V6C A;  1R1T A;  1V55 H;  1ZN2 A;  4XLP F;  1BBY A;  1KGS A;  5EGO A;  3BCA A;  2DMQ A;  1W4M A;  2W4S A;  1SD4 A;  2FE3 A;  1P9Q C;  1V3F A;  2DQL A;  1O3T A;  2CFX A;  2BY3 A;  3HUG B;  3Q3S A;  4HNT A;  4XLH A;  1SFX A;  2Z2S B;  4XBF A;  3RDI A;  2QQ8 A;  1Y8R B;  1QPM A;  3HDD A;  3IL2 A;  3ZQL A;  2YPR A;  5J1R A;  4KIG A;  1AA7 A;  2O0Y A;  5LD2 C;  2XPU A;  3OOP A;  2LRD A;  2W24 A;  4ANJ A;  2NS7 A;  1YW8 A;  1ZR2 A;  2WAE A;  1FNN A;  4B43 A;  2VKH A;  1WPK A;  1SFK A;  4A0X A;  2QBY B;  3BG3 A;  4R1H A;  2P4W A;  3RTR A;  1F5T A;  2GA1 A;  2HPM A;  2FRH A;  2EZL A;  3E6M A;  4KN4 X;  4FX0 A;  3AFH A;  2YSR A;  2E71 A;  2R7O A;  3HIF A;  2ACJ A;  2XGC A;  2Y9Y A;  4DBR A;  3F6V A;  4B1R A;  1QGP A;  2HOS A;  2P7C B;  3BPV A;  1D5Y A;  4XNF A;  3DEU A;  2M34 A;  5KCM A;  4J00 A;  1Z1D A;  3LA2 A;  3F22 A;  1T6S A;  5B66 C;  3GO5 A;  3B6C A;  3VSK A;  1VQ5 I;  2IGN A;  3I0T A;  4HLY A;  2K7L A;  4AYB A;  4UB6 C;  1Y39 A;  4L0Y B;  2ME6 A;  5HDN A;  4XOT A;  4BYY A;  1WKM A;  1I5Z A;  1Z91 A;  4FE4 A;  2OA4 A;  4E7I A;  1W0U A;  3I59 A;  4LLG F;  3G3Z A;  5GPC A;  3EPZ A;  5BOX A;  4OMY A;  2ZFW A;  2E60 A;  3U2R A;  1SFE A;  3ZQ7 A;  2IP2 A;  4TV7 A;  5GP9 A;  2IS2 A;  3CJQ B;  3M1C A;  4Y52 J;  5JVT A;  2PLY A;  3LFK A;  1S7A A;  1X4P A;  2CUE A;  1TWC J;  2YU3 A;  4PZJ A;  1KZH A;  3S3M A;  4JOM A;  1R58 A;  3V8L A;  1A35 A;  2VUM J;  2W57 A;  4LK0 F;  4YEJ A;  4CYD A;  5CVJ A;  4P96 A;  4G7O F;  1WH7 A;  2F4M B;  1FZP B;  2PBI A;  2O9L A;  2MH2 A;  1TNS A;  4N9I A;  1R71 A;  3ERE D;  4E7J A;  2XAH A;  2L7M P;  3QP5 A;  4XKV A;  3DEE A;  1X4O A;  5F1R A;  4CYC B;  4MO7 A;  4BE0 A;  2OUM A;  4EGZ A;  1GUU A;  1YW7 A;  3GTQ J;  1RUN A;  1OR7 A;  2COB A;  2JSC A;  4B44 A;  4DYR A;  4BGD A;  5IT3 A;  9ANT A;  2X4H A;  4ZYA A;  5GAH J;  3JSP A;  2IRF G;  5CQG A;  2EH3 A;  3H9G A;  1SVO A;  2WY8 Q;  1NG7 A;  4L9N A;  3LAJ A;  1R5H A;  2DI3 A;  3WTW C;  1JKO C;  2VBW A;  3MCZ A;  3PFY A;  2EIJ H;  1T33 A;  2EBI A;  5FKN A;  3FIS A;  1ZGA A;  1O4X A;  2A6E F;  2NS0 A;  1MBK A;  1VQL I;  1KU2 A;  3H5N A;  3TMO A;  3VDX A;  2A6H F;  2VE9 A;  3S1N J;  1U3E M;  3VYR B;  3ONQ A;  3QU3 A;  1IXC A;  2IAI A;  1GLN A;  2L01 A;  4MEX F;  3RYR A;  1VQK I;  2EIK H;  2LMD A;  1SD6 A;  1G59 A;  2ESN A;  2LKS A;  1MBH A;  3H35 A;  3SDB A;  4ENJ A;  1J9I A;  2LY1 A;  2K9Q A;  3I4M J;  1Y1W J;  1XSD A;  5IPA A;  1RR7 A;  1CF7 A;  1WJF A;  4G6D A;  1TP4 A;  3DBH B;  3UKG A;  1O3R A;  2JMW A;  4BKX A;  4RMN A;  3TQN A;  2JT1 A;  3B73 A;  3G6E I;  1TLH B;  3HJE A;  4PSW A;  4M9S A;  3W2W A;  2DFF A;  2RQP A;  2HYJ A;  4F7Z A;  3DV8 A;  2CSO A;  3G1M A;  1LB2 A;  1FLI A;  2MLG A;  2JRM A;  4M9Z A;  1IN7 A;  4JQF A;  1F9N A;  2NOJ B;  2DMN A;  3F8C A;  1DUX C;  1JUM A;  3K4K A;  5FLX Z;  5ED4 A;  3CJT B;  3DQV C;  3J7Y J;  1MDM A;  2GXA A;  4EAT A;  4DNC A;  2HGC A;  3K10 A;  4BU2 A;  3CQZ J;  5M3F J;  2E1M C;  3F8F A;  1APL C;  4QPO A;  4LIU A;  4M73 A;  1SAU A;  5AON A;  2L54 A;  2GIZ A;  3TP3 A;  3ZXS A;  2XHK A;  5IP7 J;  1VQN I;  2VBZ A;  3UNG C;  1G3T A;  4PGH A;  2DN0 A;  3LSR A;  1V5E A;  2WV1 A;  2OJE D;  1OR7 C;  4FQG A;  3FXL A;  3CDL A;  1W36 D;  3HOV J;  2K40 A;  2XUB A;  3DPT A;  3K70 D;  2HVS A;  2M1B A;  1Y0N A;  4LIT A;  4BJ6 C;  1RRJ A;  1F4K A;  2YX4 A;  3F8M A;  3PFI A;  2BZT A;  2X1C A;  4UUS B;  4ENK A;  4HAM A;  3WHC A;  1Z0X A;  1LDD A;  3L2R A;  1CGP A;  1HKQ A;  1Y0U A;  4ZTF A;  1TNT A;  2ADU A;  3LA3 A;  2ZKZ A;  4KT5 C;  4PJJ A;  5DCF A;  1MBJ A;  1V54 H;  2PX9 A;  4B48 A;  4ZZD A;  2MC3 A;  1CQT A;  5IP9 J;  3M8J A;  4GYI A;  4ZDL A;  4I2O A;  1Z7U A;  4RB1 A;  3KP5 A;  1ETK A;  2K9S A;  5EF6 A;  3EDP A;  3IWF A;  3OIQ A;  3JRC A;  1LFB A;  4UVC A;  3PUB A;  3W2V A;  2LY9 A;  2M4G A;  3CMY A;  3DF8 A;  3OYL A;  3A01 A;  1XCV A;  4LMY A;  4KN7 X;  2AXL A;  2LYC A;  3ZMU A;  1FYM A;  1I1S A;  4AVP A;  2P5L C;  3D5S C;  2ZXH A;  3QYF A;  4ZYE A;  3JRI A;  2Y48 A;  1HQC A;  1FSH A;  3T1B A;  2Q0O A;  1JKR C;  2G9W A;  4XMY A;  3HGG A;  2KRF A;  1C0W A;  1UCR A;  1IXR C;  2XGX A;  4B47 A;  4G8X A;  2K86 A;  3KCC A;  2EQR A;  4JX6 A;  2KIS A;  3LSH A;  1JJ8 C;  2BVL A;  3CP2 A;  1YI2 I;  2KHM A;  3CTA A;  1HST A;  1WJ5 A;  2EZK A;  4I98 B;  4U87 A;  3DKY A;  3GFJ A;  4ZDO A;  4MFD A;  5LHH A;  1MNM C;  3HRT A;  2WBM A;  4A0Z A;  5B3S H;  1RKW A;  1ZTR A;  1I27 A;  4KIB A;  3FK6 A;  4IO9 F;  1JHF A;  3H0G J;  4HBL A;  1B1B A;  5EYR A;  2Y2Z A;  1PUE E;  1TQP A;  3PIO F;  5FO5 A;  1OPC A;  1FMW A;  4HX7 A;  2KJC A;  2LP0 A;  2XRO A;  3S2H J;  1SD5 A;  3K1N A;  1WJE A;  3IAM 2;  5DUI A;  3PO3 J;  2J5O A;  3WOD F;  1TQI A;  1J5Y A;  1EH6 A;  2R7S A;  1T98 A;  1MKM A;  2H6C A;  3KEQ A;  2LG4 A;  2Q2E B;  2HZT A;  1R9T J;  5BPI A;  3MZH A;  3FHZ A;  2QYO A;  4I6Z A;  4P55 A;  5A2Q K;  3VB2 A;  4M3E A;  3H92 A;  5EJC A;  2RRE A;  1OCP A;  5HS7 A;  2ME0 A;  2ECB A;  3LA7 A;  3ERM A;  2R7X A;  1U0J A;  3FMR A;  2OQR A;  3HOU J;  1A04 A;  4KIT B;  2M9H A;  4F3Q A;  3L1P A;  4PUS A;  3LSM A;  4PFO A;  2LR8 A;  4IF4 A;  3T5X A;  1R23 A;  3F23 A;  3CCJ I;  2CMP A;  4XQF A;  3GTO J;  1UHW A;  4N0B A;  4HLX A;  2X6O A;  4I7H A;  4IRG A;  2I10 A;  3OSG A;  3RPU A;  1QVU A;  2IJL A;  3E6C C;  2WAF A;  4WX9 A;  3RCO A;  1FPQ A;  3ASO H;  4NC8 A;  1OQY A;  1ZK8 A;  3BLY A;  4BAC A;  2NAZ A;  1LEA A;  2GWR A;  5E20 A;  4BEH A;  3FF5 A;  5EG0 A;  3PSF A;  3A0B C;  1A36 A;  2CQK A;  2QCO A; 
#chains in the Genus database with same CATH homology
 3ZQC A;  3S15 J;  5FKO A;  5JLW A;  3JR9 A;  4A3D J;  1JUP A;  2DA5 A;  3ZOB A;  1ZKG A;  2R5Y A;  5IOZ A;  4A3L J;  3S16 J;  3Q0V A;  1VND A;  4FIS A;  1HF0 A;  5EG0 B;  2KT0 A;  4C3H J;  5FJ8 J;  2EZI A;  3HOX J;  1IGN A;  5F0C A;  1HDP A;  4I76 A;  2ECC A;  2DMU A;  2LKX A;  3GTP J;  2DA2 A;  1U9N A;  2CUF A;  2DJN A;  3HBL A;  3FIW A;  2XRL A;  4AUX A;  5HOD A;  5K7Z A;  4JP0 A;  3JRF A;  2JA7 J;  1YRN A;  2P81 A;  4DZP A;  3S17 J;  1XC5 A;  2XPW A;  3NAU A;  4RBO A;  3B6A A;  2FJ1 A;  2JA8 J;  1X2N A;  3JRE A;  4G12 A;  1TWH J;  5E3N A;  4QIW N;  5J1U A;  2D5V A;  3ZQI A;  4L5E A;  3JRG A;  3BTL A;  1UHS A;  1PUF A;  3PM1 A;  1WGX A;  4M3G A;  4BBS J;  3TED A;  1YRN B;  2MW8 A;  2E1O A;  2WAQ N;  3BTI A;  2QF7 A;  2L9R A;  1DU6 A;  1FJL A;  1B8I A;  2DA3 A;  4XIC A;  4MFE A;  2EZH A;  2XSD C;  2CU7 A;  2VPR A;  1LFU P;  1LE8 A;  1RKT A;  3HOY J;  1XS9 A;  1PUF B;  2XGD A;  1Q1V A;  4C3I J;  5J1Y A;  3FKI J;  1FTT A;  1ETW A;  1B8I B;  3I4N J;  5F08 A;  4S0H B;  4IHW A;  1LE8 B;  3LSP A;  5J3L A;  2ZB9 A;  2MG4 A;  4W97 A;  5F27 A;  4BBR J;  2YS9 A;  2NVX J;  3FK7 A;  2YUS A;  1NK2 P;  2WB1 N;  1UG2 A;  2NS8 A;  2MGQ A;  3E7L A;  1QRY A;  5EEA A;  1MBE A;  4A3B J;  5EGO A;  2ID3 A;  2DMQ A;  4FTH A;  1HLV A;  4JX4 A;  4Y7N J;  3JRB A;  1AHD P;  1BA5 A;  2IBD A;  2DMT A;  3Q3S A;  1ZQ3 P;  1H89 C;  4AC0 A;  1HOM A;  2AO9 A;  1JTX A;  3HDD A;  5EZH A;  3HOW J;  3ZQL A;  1U9O A;  1NK3 P;  5J1R A;  5EGO B;  1IJW C;  3GTL J;  2LFB A;  2XPU A;  5E3L A;  3BR6 A;  2NS7 A;  4V2F A;  1ZR2 A;  5C3E J;  4A3F J;  1FIA A;  1VI0 A;  4XRS A;  1ETO A;  1WPK A;  4QTR A;  1ORK A;  3BG3 A;  3BR3 A;  3DCF A;  3W6V A;  1IRZ A;  2XB5 A;  4A3M J;  2EZL A;  1JTY A;  3HEF A;  3TW7 A;  5K7H A;  3RZD J;  4FCY A;  1DU0 A;  1BW6 A;  1U78 A;  4DYC A;  4JYK A;  4D7N A;  2XGC A;  2Y9Y A;  1ENH A;  4B1R A;  4XRM A;  2HOS A;  1GT0 C;  1D5Y A;  2M34 A;  1WI3 A;  2IEK A;  4A69 C;  2LK2 A;  2JN6 A;  4W1U A;  1POG A;  1IG7 A;  1EF4 A;  3B6C A;  4NDL A;  3S1Q J;  5IYB J;  1ZR4 A;  4D5F A;  2ME6 A;  1AU7 A;  3BG9 A;  1ETV A;  3F0C A;  4XID A;  4M3F A;  4FE4 A;  2LD5 A;  1W0U A;  1HDD C;  1F43 A;  2HI3 A;  3O8G A;  5GPC A;  1B72 A;  2Y31 A;  1I3Q J;  3LNQ A;  4M3B A;  2CQQ A;  1MSE C;  1JT6 A;  2DA4 A;  2G0E A;  3RKQ A;  5GP9 A;  2GBY A;  5EZG A;  2FX0 A;  3OSF A;  4Y52 J;  3IV5 A;  1FTZ A;  3O8H A;  2H1K A;  2CUE A;  1TWC J;  2E19 A;  1B72 B;  5FKL A;  2R5Y B;  2FD5 A;  3GTG J;  2VUM J;  2DA7 A;  5M5Y J;  3BR5 A;  3MVP A;  4CYC A;  3BQZ A;  3TP0 A;  2Y0S N;  2TRT A;  2CQX A;  1WH7 A;  1WCM J;  2VKV A;  1VFC A;  2O9L A;  1I50 J;  4X6A J;  1P7I A;  3SJM A;  4GFB A;  2L7M P;  3S14 J;  1T56 A;  5IP6 A;  4CYC B;  4MO7 A;  3RZO J;  1GUU A;  3GTQ J;  3A03 A;  4M6V A;  3M3Y J;  2Y30 A;  4X1E A;  2COB A;  9ANT A;  4DYR A;  3HGY A;  3BR2 A;  4EEF G;  3BTJ A;  2LVS A;  2NVQ J;  5FLM J;  4LOC A;  4D5C A;  4IEJ A;  1G2H A;  4M3D A;  3GTJ J;  1IDZ A;  1W0T A;  2EH3 A;  1Y1V J;  3LOC A;  4RDU A;  3BQY A;  4D7M A;  1JKO C;  2HXI A;  4A3J J;  1ITY A;  1T33 A;  1WH5 A;  2EBI A;  3FIS A;  5FKN A;  1O4X A;  4V2G A;  1MBK A;  1ETX A;  3IH4 A;  5FLV A;  3S1N J;  1MBG A;  1JUS A;  2IAI A;  1JGG A;  1RET A;  5BNG A;  3MKL A;  1MBH A;  1RES A;  1TWG J;  5FKK A;  2K9Q A;  3I4M J;  1Y1W J;  3GBG A;  1VF9 A;  5IPA A;  1RR7 A;  2RAE A;  3OOU A;  4J19 A;  2L0K A;  1SAN A;  3UKG A;  2JMW A;  4BKX A;  2B63 J;  1TWF J;  1ZGW A;  5DS9 A;  4A3I J;  1Z77 A;  1GVD A;  3G1L A;  3IH3 A;  1ETY A;  5DTD A;  2DTZ A;  2HYJ A;  1GV2 A;  2E2I J;  3G1M A;  1TWA J;  4UUT A;  2AHQ A;  5F0H A;  3JRD A;  4IHV A;  1MH4 A;  1MSF C;  2CJJ A;  2DMN A;  4ABZ A;  1JUM A;  1JT0 A;  4C2M J;  3BTC A;  2PMZ N;  2OF7 A;  4MLO A;  3S1R J;  1FEX A;  1X2M A;  3VPR A;  3CQZ J;  3Q0W A;  3GTM J;  5M3F J;  3M4O J;  1APL C;  5F04 A;  3TP3 A;  1HCR A;  1ETQ A;  1BW5 A;  5IP7 J;  2R0Q C;  2M8G X;  3LSR A;  2DN0 A;  4XRS G;  2WV1 A;  1XG1 A;  5M5X J;  4UUS A;  5C4X J;  2TCT A;  3LSJ A;  1OCT C;  3CDL A;  3HOV J;  1GDT A;  3SDG A;  2K40 A;  2NVY J;  1BL0 A;  2R92 J;  1IV6 A;  2Y9Z A;  5C44 J;  4HNV A;  3QPL A;  1QVT A;  3CCY A;  2HOT A;  2JWT A;  4UUS B;  1TC3 C;  3HB9 A;  3WHC A;  1H8A C;  1Z0X A;  3NAR A;  2R5Z A;  3SFI A;  1E3O C;  2JK3 A;  3QQA A;  2O7O A;  1MBJ A;  1GV5 A;  4FE7 A;  1F36 A;  2GM4 A;  1MBF A;  2KDZ A;  1CQT A;  3DEW A;  5IP9 J;  5EDN A;  2R5Z B;  1AKH A;  5GPA A;  1ETK A;  2K9S A;  5EF6 A;  2M0C A;  2W48 A;  5C4J J;  3JRC A;  1K83 J;  1LFB A;  2LY9 A;  2O8K A;  3LSG A;  2OPT A;  1AKH B;  5IYC J;  3CMY A;  3A01 A;  3K2A A;  3A02 A;  2N8G A;  2VI6 A;  4BXX J;  4A3E J;  3S1M J;  4A3G J;  4DZJ A;  3JRI A;  5IOY A;  2X9D A;  3BT9 A;  1JKR C;  4DW6 A;  3HGG A;  3WHB A;  2XGE A;  3A01 B;  3OIO A;  3RQI A;  2LTP A;  2L7F P;  1OFC X;  4QSH A;  1MH3 A;  2EQR A;  3IH2 A;  4JX6 A;  1JJ8 C;  3ZQG A;  5F0F A;  2E2J J;  3HKZ N;  4B4C A;  2EZK A;  4B3A A;  2GLO A;  5FKM A;  3ZQH A;  2HDD A;  5IYD J;  2L7Z A;  4MFD A;  1MNM C;  5E3O A;  2DMP A;  4XK4 A;  3TW6 A;  1RKW A;  1ZTR A;  3JRA A;  1P7J A;  4BY7 J;  3FK6 A;  2H8R A;  2R93 J;  3H0G J;  5M5W J;  5EYR A;  2X48 A;  2XPV A;  2Y2Z A;  3H3V K;  3HOZ J;  1JKP C;  2HOA A;  1SFO J;  3G1O A;  1FIP A;  3PO2 J;  3D1N I;  2LP0 A;  3S2H J;  3MN2 A;  5K7F A;  2HXO A;  5M3M J;  5F1J A;  3PO3 J;  4IHY A;  2MSY A;  3Q0U A;  3HM5 A;  1IDY A;  1A5J A;  1OJL A;  2YU9 J;  1R9T J;  2CRG A;  1IC8 A;  4A93 J;  3GTK J;  4I6Z A;  1A6I A;  3C2B A;  1QPI A;  4M3E A;  2JA6 J;  2NVT J;  1OCP A;  4A3C J;  4IHX A;  2ME0 A;  2ECB A;  1JKQ C;  2FQ4 A;  4C3J J;  3BR0 A;  3ZQF A;  1H88 C;  3HOU J;  3BR1 A;  1IUF A;  2JJ7 A;  3JRH A;  1U8B A;  2M9H A;  5E3M A;  3BG5 A;  3L1P A;  1S7E A;  1X58 A;  4MIM A;  3QPS A;  1JJ6 C;  2LR8 A;  4BY1 J;  4DYQ A;  1RPW A;  3GTO J;  2K9N A;  2X6O A;  2DA1 A;  2I10 A;  3OSG A;  1QVU A;  2M2E A;  1NTC A;  1K61 A;  2JA5 J;  2LLK A;  2E2H J;  1I6H J;  1BJZ A;  2NOG A;  2VKE A;  2ELK A;  1ZK8 A;  3K7A J;  1UMQ A;  2ID6 A;  4AYB N;  3S2D J;  2XB0 X;  4JX5 A;  2HQ5 A;  5JLX A;  2R7Z J;  5EG0 A;  4A3K J;  2DA6 A;  2QCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...