5EEAA

Structure of hoxb13-dna(caa) complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*TP*TP*GP*TP*GP*TP*TP*TP*TP*AP*TP*TP*GP*GP*GP*TP*
publication title Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 62
sequence length 62
chains with identical sequence B, G, J
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5eeaA00
4XK4A 1MH4A 1TWCJ 4X1EA 2TCTA 1Z0XA 5EGOB 4M3GA 1XS9A 1I50J 2R93J 2LKXA 3HGYA 3BR5A 1IDYA 2FJ1A 5GP9A 4MIMA 3JRIA 3JREA 2E2HJ 1BJZA 2LTPA 1LE8B 4AUXA 1JTYA 2CUFA 4JX5A 4FE4A 2W48A 5FLMJ 3S1RJ 1ZGWA 2O9LA 4XRSA 1T56A 1O4XA 1VF9A 2M34A 1TWHJ 2IEKA 1B72B 3Q0UA 5F0HA 2XPWA 3BTJA 3G1MA 2GLOA 5M5YJ 5IP9J 1D5YA 2Y2ZA 2R5ZA 1NK2P 1GVDA 2L7FP 3L1PA 3GTMJ 1ETOA 2FQ4A 1IDZA 2DTZA 2NS7A 3NARA 1ORKA 2KT0A 2VKEA 3RKQA 1EF4A 2XGDA 4W97A 3S2HJ 1WI3A 3JRHA 5E3LA 2M9HA 2XPUA 2I10A 3JRCA 3TP0A 3PO3J 1BA5A 3K2AA 4EEFG 2NVYJ 1WH7A 1ZQ3P 4Y52J 2ID6A 3JRBA 3CDLA 1RPWA 1F36A 1X2NA 2DJNA 4MFDA 2M0CA 3PM1A 3HOUJ 2JJ7A 2VUMJ 2WAQN 5IP6A 1ENHA 3ZOBA 5IOYA 4FISA 2E2IJ 4M3FA 3H0GJ 3D1NI 4B4CA 1DU0A 2DA3A 4GFBA 3UKGA 1Y1VJ 3HEFA 4IHXA 3GTQJ 3BR1A 1IGNA 4A3DJ 3I4MJ 2JA8J 3HOWJ 3HB9A 2XGCA 5DTDA 1JKPC 1WCMJ 3S16J 1JTXA 3BT9A 2MW8A 3DEWA 1YRNB 1XC5A 3I4NJ 3S15J 1RR7A 5GPAA 3G1OA 4UUSA 2ID3A 2N8GA 5EZHA 4FTHA 2JA5J 4RBOA 4Y7NJ 2L0KA 5J1UA 2LY9A 1OCTC 1VNDA 3LOCA 3MKLA 4IEJA 5JLXA 3LSGA 4CYCB 2JWTA 4A3CJ 2XPVA 1WPKA 2H8RA 3H3VK 4A3MJ 3ZQLA 2O8KA 2M2EA 5C4JJ 2TRTA 3S2DJ 3O8HA 1W0TA 4A3BJ 1U9OA 2KDZA 5IYDJ 2YS9A 1Q1VA 2VPRA 3BG5A 2FD5A 2XB5A 2CQQA 1GDTA 2DN0A 4IHWA 2X6OA 3IH2A 1LFUP 4B3AA 3A01B 1JJ8C 4MLOA 2HOTA 1BW5A 1WH5A 1ZK8A 2DA6A 5E3NA 4NDLA 2CQXA 2X48A 1U8BA 4B1RA 1AHDP 2XRLA 3S14J 4BXXJ 1MBKA 3FK7A 2R92J 1P7JA 1B8IA 1MSFC 3S17J 3ZQHA 1X58A 2DA4A 2K9NA 4A3KJ 1LFBA 2HI3A 3TP3A 2GM4A 1ETKA 4A3JJ 1ETVA 1UHSA 2LR8A 5EF6A 2R5YB 5J1RA 5M3MJ 3QQAA 1ZR4A 1POGA 4A3EJ 2HQ5A 1NK3P 3BQYA 3FK6A 1JUPA 1TWAJ 3ZQFA 3FIWA 1H88C 5EGOA 5C3EJ 3A03A 1MH3A 4V2GA 5F1JA 5K7ZA 1TWFJ 2P81A 1HDDC 3O8GA 1LE8A 3NAUA 1X2MA 5F0CA 3SDGA 2Y31A 3LSJA 1MBGA 5FLVA 2HOAA 3MVPA 3BG9A 4DW6A 2WV1A 3QPLA 4QSHA 1H8AC 1B72A 3BR3A 2JK3A 2IBDA 1JKOC 2CUEA 3F0CA 1JT6A 1K83J 1PUFB 1MBEA 2EZIA 1JGGA 1F43A 5E3MA 4V2FA 3OOUA 1IUFA 2DA5A 1S7EA 1Y1WJ 2GBYA 3B6AA 4ABZA 3BG3A 1G2HA 1A5JA 1BL0A 2R0QC 1QVUA 1CQTA 3IH3A 2CJJA 2CU7A 3RQIA 2HYJA 4L5EA 1MNMC 2HDDA 1AKHB 2FX0A 4UUTA 1APLC 5IYCJ 1HOMA 4AC0A 1IC8A 3S1QJ 5C4XJ 2COBA 3DCFA 2Y30A 1QPIA 4DYCA 5J1YA 2QCOA 1GV2A 1GT0C 1IJWC 3ZQCA 2OF7A 1RKTA 3GBGA 4G12A 1IV6A 2L9RA 3LSPA 1MBFA 4M3DA 4JX4A 2DMPA 4I6ZA 4BBRJ 1ITYA 5BNGA 3B6CA 2E19A 5EYRA 3E7LA 5FKNA 3HGGA 2RAEA 2E2JJ 4FCYA 4BKXA 5EG0B 3HOZJ 1IRZA 3TW6A 5F04A 2PMZN 5K7FA 2AO9A 5EZGA 4XRMA 3OSGA 3S1MJ 2EZLA 1P7IA 4A3LJ 2X9DA 3Q0WA 3ZQIA 4A3IJ 1FIPA 2JMWA 2WB1N 5IYBJ 3OSFA 2DA1A 1FIAA 2DMTA 5E3OA 3CMYA 4XICA 1VI0A 1YRNA 1TWGJ 4QIWN 1ZR2A 3HOXJ 2LK2A 2Y9ZA 4AYBN 3BTLA 1HLVA 1VFCA 1JKQC 1UG2A 1B8IB 1ZTRA 1DU6A 2IAIA 3C2BA 2DMNA 1QVTA 3BTIA 4A69C 5FKOA 4XRSG 3Q0VA 4CYCA 2DMUA 2R5ZB 4XIDA 1JKRC 4FE7A 5HODA 3CCYA 1JT0A 1HDPA 1MBJA 5C44J 3S1NJ 1GUUA 3WHBA 2VKVA 5GPCA 1NTCA 3VPRA 1RETA 4BY1J 2NVTJ 4W1UA 1H89C 3MN2A 1JUMA 4C2MJ 1FTZA 2NS8A 1R9TJ 3M4OJ 5IOZA 4J19A 2ME0A 2E1OA 1RESA 4DYRA 1Z77A 3G1LA 3A01A 1FJLA 5JLWA 3JR9A 2HXOA 4MFEA 2MSYA 5M5WJ 5IPAA 2L7ZA 1AU7A 5K7HA 5M3FJ 3QPSA 1A6IA 3A02A 1UMQA 2JA6J 1HCRA 3PO2J 3BTCA 3ZQGA 5J3LA 3OIOA 2QF7A 5FJ8J 3W6VA 2EZHA 2XSDC 4HNVA 3GTKJ 4IHYA 4M3EA 2EQRA 1GV5A 2CRGA 2B63J 3GTOJ 2R5YA 3IV5A 3GTPJ 5IP7J 2G0EA 3JRAA 5F08A 2OPTA 4DYQA 4JX6A 2ECCA 3GTLJ 2K9SA 1TC3C 1JUSA 2LLKA 3K7AJ 5EDNA 5FKKA 1OJLA 3FKIJ 4D5FA 1U9NA 2ZB9A 2LFBA 4JP0A 5DS9A 4A3FJ 2DA7A 3HKZN 3FISA 2EZKA 1E3OC 3RZDJ 2LVSA 1IG7A 4I76A 2K9QA 2XB0X 2VI6A 2AHQA 2NVQJ 1ETXA 1T33A 2NOGA 4DZJA 2M8GX 4C3JJ 4UUSB 2EH3A 3HBLA 3WHCA 3LSRA 2JA7J 2EBIA 2O7OA 1QRYA 4MO7A 5F27A 2MG4A 1ETQA 3HOVJ 1RKWA 2YUSA 4D7MA 1PUFA 1SANA 2MGQA 3HDDA 1ZKGA 4X6AJ 4M6VA 1SFOJ 2HOSA 2R7ZJ 2YU9J 4RDUA 4C3HJ 4S0HB 2LD5A 3RZOJ 1ETWA 5FKMA 3TW7A 4QTRA 1AKHA 1MSEC 1ETYA 1I6HJ 2HXIA 5FKLA 2Y9YA 3GTJJ 3GTGJ 2D5VA 2ECBA 9ANTA 1HF0A 2XGEA 4JYKA 3SJMA 3IH4A 1K61A 5EEAA 4A3GJ 4IHVA 3CQZJ 3M3YJ 3SFIA 3TEDA 1OCPA 1XG1A 2LP0A 3HOYJ 1WGXA 4C3IJ 3BR2A 4A93J 4M3BA 4D5CA 5M5XJ 3HM5A 3LNQA 3JRFA 1U78A 1FEXA 2DMQA 1MBHA 1FTTA 2Y0SN 1JJ6C 3JRGA 3Q3SA 2DA2A 2ELKA 5F0FA 1W0UA 4BY7J 4BBSJ 2JN6A 2H1KA 5EG0A 1I3QJ 2ME6A 2L7MP 1OFCX 2K40A 4DZPA 3JRDA 3BR0A 4LOCA 3BR6A 1BW6A 2NVXJ 3BQZA 4D7NA
chains in the Genus database with same CATH superfamily
4XK4A 1PP8F 2TCTA 3NEUA 1WRJA 5EGOB 2R93J 1X3WB 1IW7F 3FKJA 4IRHA 1IDYA 3K4MA 3K1MA 2M30A 1Y0UA 4HW0A 2DYSH 2CFOA 3OYDA 1FBQA 4PJMA 2LH9A 1SAXA 3OR2C 4BU2A 3MKYB 3IL2A 5KAFC 2W48A 3LL7A 5FLMJ 3S1RJ 2O9LA 1IV8A 1UHWA 5H6QA 1OMIA 1TWHJ 4HEA2 4PCQA 1S7AA 1J0RA 2L9VA 1UG0A 2GLOA 1KU3A 2Y2ZA 1TT0A 4MEYF 1Z7UA 3WE3A 1NG7A 3L1PA 4A6EA 1TQIA 2V9PA 2E1MC 3F23A 4GYIA 4HA8A 1S5LC 2DTZA 1E3PA 2NS7A 4HG2A 3DKWA 1ORKA 4XR6A 1TW3A 2M7BA 1EF4A 1EH8A 1VQKI 4W97A 4H0EA 4JBAA 4OINF 1J09A 3OY9A 4RM3A 3O6BB 3OR1C 3KYDB 2VJ4A 2J5PA 3K2AA 3LA2A 5CJ9A 3LSHA 3ZMTA 3EQLF 4OIOF 4EJTA 1D1CA 4F55A 1RPWA 2OCEA 1F36A 3GFJA 1X2NA 3RDIA 3QODA 1S8NA 5JVTA 2VT2A 1VQMI 3PM1A 2NAZA 2V6CA 3HZJA 1UB9A 3WGGA 2WAQN 4RA2A 4HDVA 4YIIA 4PJJA 3DPLC 3ABMH 3Q9SA 2R7XA 3HRUA 3LA3A 2O6GE 2V1XA 1ZG5A 1ENHA 2QKMB 1BI0A 1B1BA 1EV7A 3BROA 1Z9CA 3REOA 1I39A 1WQ2A 3WG9A 3CDHA 2F5DA 4BL0B 4OAYA 1FWZA 1Z05A 3CJRB 3I0TA 3TOBA 3BC8A 4BHCA 2DA3A 2X51A 1J75A 1ZG3A 2IT0A 3ABKH 4IHXA 3GTQJ 4WCGA 5HVQC 3H36A 1RUNA 2BY0A 1K6YA 3HYIA 3CC7I 2JA8J 1J5YA 3HOWJ 1U5TA 2XGCA 1NH3A 2HKXA 5DUKA 5B1AH 4F91B 2ZJRF 2MW8A 5BPIA 2BGCA 1YRNB 4XN3A 4A12A 2FXAA 1T0FC 5GPAA 4GO1A 3KYCB 3VEPA 5DEQA 4HNUA 2NRAC 1BI2A 3WGHA 4HF1A 2ID3A 2PLYA 3S32A 3K69A 2Y48A 1R1VA 3VYRB 1VQNI 5J1UA 2LY9A 2KP6A 3VYTB 5J6XA 2XPVA 5DD4A 3CCVI 2P4WA 4PGGA 3CCJI 1XGNA 1IN6A 3HRSA 3QYBA 2O0YA 3H35A 1SD4A 3ZQLA 2M2EA 5C4JJ 4HF2A 2TRTA 2QYOA 3KCCA 2MLKA 3FBIB 4C2UA 4Y33A 3LAJA 4A3BJ 1W7PB 2KDZA 1W1WE 4KT5C 2YS9A 2FD5A 2JPCA 1RUOA 2DN0A 4XKBA 4KN7X 3A01B 2HOTA 3EUHA 2M5WA 1MMDA 5EEHA 3WTYC 5E1WA 1GXQA 3JW4A 4QPOA 3OS1A 4M9ZA 3CLQA 2RREA 2CQXA 2X48A 4ESFA 1JHHA 2DFFA 5ICEA 3U9GA 2PMHA 2RKHA 1AHDP 3ONQA 3S14J 1S29A 2X6XA 2XROA 2R92J 2EFQA 3KP2A 1IRFA 3T8RA 3ZQHA 1D3YA 2DA4A 2K9NA 3BPVA 1LFBA 3TP3A 3G2BA 2QQAA 3GZ6A 4ZDPA 1ETVA 2LR8A 1E0EA 2A5WA 3DKXA 3FXUA 2X85A 5J1RA 1OCRH 3ZMVA 2M3AA 2EV5A 1POGA 5AONA 5H2FC 4A3EJ 2VBWA 2DPUA 3VFZA 2GOXB 2W4SA 3IC7A 2A61A 2FBHA 4IL6C 1RIOH 1H88C 3M1CA 5J8CA 5C3EJ 1BN5A 3A03A 3T1BA 1MMAA 1MH3A 5F1JA 3S93A 1QHGA 3HC7A 3COAC 1MIJA 1TWFJ 4WXCA 2XUBA 3O8GA 1KZHA 3NAUA 1X2MA 4BDZA 3RQ4A 4ZH4F 3F21A 3SQNA 5F64A 5L3DA 1CF7A 1TLHB 4HSRA 1YLFA 2XF7A 3ABUA 2CWEA 5CPRB 2IBDA 2CW0F 2KISA 4WF2A 4UY8I 2BVMA 4YIFA 3OWTA 1SMYF 3EYYA 1IUYA 2LYCA 4YG2F 1JT6A 2WAEA 1EKEA 1RZ4A 3ZN0A 5JHUA 1G3TA 3OYJA 1B4AA 3OOUA 3TO9A 4PK4A 1PVEA 4PJ0C 3BG3A 2UXNA 1A5JA 3OMYA 2R0QC 1CQTA 2LRDA 2OBPA 2WAFA 4UVCA 3IH3A 5A2QZ 4BJ5C 3WTTC 2ZMEB 1JE8A 5FGMA 2HDDA 3TQNA 4UUTA 4ON0A 2WB1A 3PQKA 1SC7A 1APLC 1HW5A 1YS6A 2NYXA 3TO6A 2YX7A 2GIZA 3K10A 4NC7A 4ZZLA 2OTJI 1MNDA 3QOEA 2YX4A 3F6VA 1HSTA 1D0XA 3EETA 2ZXJA 1USSA 1DPUA 3GBGA 3FM3A 3K1PA 2L9RA 2GIVA 2MBFA 4JX4A 2DMPA 2ADUA 2B0LA 4XOPA 1EH7A 5FO5A 2H6CA 1JHFA 1X1BA 3KP7A 1IRGA 2K5CA 4ZYGA 2ZFWA 3E7LA 5TJJA 3HRMA 1X1PA 4J00A 1E17A 1IZ1A 3R0JA 1ZG1A 2F4IA 4JQFA 2PEXA 3I59B 4AIHA 2TDXA 1FOWA 3E6MA 1T38A 5EZGA 2EZLA 4A3IJ 3ERMA 4ZYAA 5IYBJ 2JMWA 3OSFA 1KU2A 2DA1A 5CVRA 1FIAA 2KQRA 2NNNA 5E3OA 2FBIA 3CMYA 5D5VB 2UV1A 4V19K 2B9SA 1E2XA 4QIWN 3Q9VA 2LK2A 3ZXSA 2A3SA 4A5NA 1HLVA 1JKQC 2J5OA 5CVJA 3ISPA 3PNTA 5FLXZ 4XKCA 1FPQA 2A68F 4UHTA 4BE0A 4L9JA 4XRSG 3Q0VA 2HTJA 5B3SH 4EV0A 1XSXA 2GQQA 5BMZA 3AG4H 3S1NJ 1GUUA 2PJRA 2PBIA 1S9HA 1NTCA 2H94A 1EJ9A 1SAUA 2NVTJ 1GLNA 4W1UA 1YITI 3DF8A 1H89C 3R6SA 3OOPA 2OTLI 4HX8A 2NS8A 3M4OJ 1A6QA 4CCLA 3TO7A 2R7UA 5ICCA 4N4OB 5L3EA 3ZQ7A 4G6QA 1O3SA 1LVAA 1PP7U 3SZPA 3F8CA 3AAFA 2AS5F 2KRHA 3JR9A 2I5UA 2GXAA 3E6CC 2G7HA 5M5WJ 5IPAA 1T0FA 4MHGA 3CF2A 1OYWA 1IN5A 1TP4A 1W5CC 2FUG2 1XX5A 3GZNB 3QPSA 3A02A 3WTXC 1UMQA 2WAQA 1HCRA 2JA6J 2L01A 3HHGA 3CMEI 1N25A 2DO7A 5GAHJ 4UB6C 5J3LA 3MZHA 3OIOA 4RGSA 2GA1A 2QF7A 4FETA 1A36A 2EZHA 1SMTA 3W6VA 4ZDOA 4HNVA 2PX9A 2RVCA 2W25A 3L00A 1D8KA 1Y39A 1BR4A 1Y0NA 2EQRA 2JZYA 2CRGA 4KYWA 2EINH 3JRAA 3FM5A 5HNFA 2CV0A 2EV0A 5LGTA 4KJZA 2XIGA 2KL4A 4D5FA 1U9NA 2Z1DA 4JP0A 2DA7A 2WWYA 2IGNA 3KZZA 4WWCA 3FISA 2W84A 2E71A 2LVSA 3DP7A 1IG7A 1ZREA 3L2RA 2FU4A 1FP1D 2VI6A 1Z3YA 2DXIA 1T33A 1O3QA 3IWFA 4UUSB 2IGMA 3JSPA 3M8FA 4KIGA 3RKYA 4B47A 2VPLA 5DD8A 2JA7J 4MO7A 1MKMA 4I7HA 5F27A 2HR3A 2P7CB 2E1MB 2F5EA 1V5GA 4D7MA 4D7NA 4EGYA 3PFYA 1P92A 4UXNA 5DCMA 4RAYA 2Y0MA 4NBQA 4X6AJ 2MC3A 4RM2A 4LG3A 1YJ9I 4XLHA 3QPHA 5LD2C 4XNFA 1E3HA 1AOYA 4D9JA 5FD6A 1I6HJ 3KP5A 2E34A 3GTJJ 3GTGJ 2DFIA 1R5HA 3X2QH 1YTYA 3ZQQA 2XGEA 3GX4X 1Z21A 3IH4A 5EEAA 2RQPA 3ZPLA 4IHVA 3MAJA 4AU7A 2M4GA 3DTEA 2X6WA 2E1NA 1MMSA 4XKVA 1ULYA 2VT3A 4ESBA 4RAGA 4M3BA 3AL0C 4A93J 2LOOA 4NQWB 3JRFA 1B59A 1XSDA 2JVHA 4RB0A 1QHHD 2MLGA 4E7LA 3ECHA 1QQIA 4I98B 1O3RA 1FEXA 1SVMA 2L4AA 1BOAA 3DEUA 4DQ2A 3A0BC 1MZBA 2PQ8A 3JTGA 4CGZA 3Q3SA 3CF5F 1XMXA 2W00A 1VQPI 5FRNA 3DLAA 1BJAA 1EH6A 4E7HA 2H1KA 4AIJA 2ME6A 4BEHB 4CYDA 5LHGA 3BR0A 3CCEI 4LOCA 1BW6A 2O03A 2NVXJ 3BQZA 4O6JA 5DYMA 5L3BA 3BG6A 3JAMZ 1R22A 3P5JA 4P9FA 4EM1A 1XS9A 3HSFA 1I50J 4R1HA 3HGYA 2K85A 4LG0B 5GP9A 3W2WA 4R79A 3JRIA 3JREA 2LSOA 3LFKA 1BJZA 3WTVC 1Z67A 2ICWG 4AUXA 1HC8A 2XKPA 3O2PE 1K79A 1OLTA 2HYFA 2DT7B 3K4BA 1VF9A 5LLQA 1Q1HA 1U2WA 5F0HA 2XPWA 2MD0A 4G8XA 2Q0OA 1QZYA 1Z6RA 3QU6A 5CVVA 4DNCA 4E7ZA 3U21A 5IP9J 1D5YA 2GWRA 2LREA 1ZRCA 3GTMJ 2FA5A 1V54H 2ESNA 1WJDA 1YIOA 2R7WA 2WTEA 1LKXA 1VQ6I 1IDZA 4EJVA 4F92B 2R3SA 4RLQA 2VKEA 4AWXB 3K2ZA 1BC7C 1HSJA 4XSXF 1WI9A 2XGDA 2XDVA 3EUKL 4U87A 3JRHA 1QO0D 5E3LA 3KETA 2XPUA 2K3PA 2F5VA 4ENNA 4EEFG 3F72A 2ELHA 3RYPA 3EUHC 1N75A 4H4KC 1DQUA 2FOWA 2DJNA 1V4RA 2VL8A 3OYNA 2DOEA 4I09A 2BE5F 5IP6A 3LSMA 4HBLA 3ZOBA 2ZC2A 3DBRB 1W36D 1YQAA 4GYGA 3D1NI 4B4CA 1DU0A 1DP7P 4GFBA 3UKGA 3HEFA 1LDDA 2BY2A 3BR1A 2A6TA 2W7NA 4Q48A 3BJAA 1R5GA 5ILSA 1XTAA 2JA2A 3FXLA 5D5XB 2OD5A 1G6NA 5DTDA 3E1SA 1I6XA 3S3MA 1WCMJ 4F3QA 3ZMSA 5J4VA 3S16J 1JTXA 3J7AO 2HZDA 3DEWA 4XRFA 2YR2A 3EYIA 2QBYB 2L5QA 1O57A 1GVJA 3RPUA 3G1OA 4ZYEA 4XMYA 4LD5A 2LC2A 1Y6IA 2N8GA 1XGMA 2DCEA 3MD2A 2L0KA 4AVPA 4KITB 3RPQA 1G3YA 3KYLA 1XSVA 3LSGA 3CUQA 2M87A 5BQTA 2JWTA 4A3CJ 2V9KA 3L2QA 1H9TA 2H8RA 2PI0A 1LJ9A 4CZZA 1V3FA 1DUXC 3CP2A 5K5QA 4MTEA 3E6BA 4BDYA 3RIRA 3S2DJ 4XLNF 3HHHA 2XF5A 3L2VA 2Z99A 1W0TA 4BE1A 3OYFA 1C0WA 2CQQA 1W36C 1A31A 3GW2A 4NB5A 2FBKA 2X6OA 1P6RA 3KZYA 3WTZA 4B3AA 5IT3A 1BW5A 4UB8C 2CW7A 2WADA 4IQ4A 2R7QA 2K3FA 2DFEA 2QSHX 2R7SA 1R71A 3V7CA 4GGGA 3SXYA 3E5UA 1U8BA 4II2A 5B5EC 3GVAA 2STTA 1MBKA 3PSIA 3RYRA 2R4GA 1P7JA 2KJBA 5K1YA 4XM3A 1WJ5A 3BP8A 4N4NB 2EB7A 5HDGA 4CCKA 3S17J 1X58A 3PUFA 3S8PA 3G73A 1V5FA 4L0ZB 4A3JJ 4CZCA 4NC8A 3QP6A 3LA7A 2R5YB 4HQMA 2ISZA 3QQAA 2OC6A 4NUBA 4HF0A 3HIFA 2GZWA 1NK3P 2O61A 3FK6A 1DGWY 1JUPA 4RS8A 3ZRGA 2VE9A 1T8IA 3BG7A 3FIWA 4UV8A 4E70A 2FEZA 1YW9A 5DDGA 1EA3A 4G7OF 2QSFX 3IWZA 1X1DA 5K7ZA 2P81A 4Y17A 2OAZA 2ZXWH 3PSFA 1LE8A 2KFDA 2OZ6A 2BY3A 3KE2A 2GAUA 4E4HA 1T6SA 3BG9A 2FNPA 5L3FA 2W57A 2D2WA 3QPLA 1H8AC 1B72A 3C7JA 4ZDLA 4ENMA 3J7ZI 2JK3A 3SEZA 4MGRA 1STZA 2AQEA 2P7VB 1JKOC 4HPQA 2UZKA 1DDNA 2HKOA 5DM6F 4ASNA 2DK5A 1HKSA 3F0CA 4IOCF 3DTKA 1PUFB 2EZIA 2PG4A 4YFNF 4V2FA 3L2UA 2DA5A 1S7EA 4LMYA 4ABZA 3P9CA 4U0YA 4CUGA 1J9IA 2H1LA 5A2QK 2Z33A 5F6FA 2HYJA 2IGOA 1Y8RB 2KHMA 4L5EA 1MNMC 2Q2EB 1U6GA 2BVLA 2LY2A 1T39A 1P4WA 3HUGA 4A0ZA 1LEAA 2K02A 2EFPA 1IC8A 1P4AA 5AIPA 2COBA 1WZ2A 3U2RA 3DCFA 2Y30A 5KNLA 1QPIA 1MMNA 5J1YA 5E1XA 5DCFA 4EATA 1ZGJA 3E0JB 4IRGA 4G12A 5HS7A 4G7ZF 3LSPA 4RAZA 2VC1A 4I6ZA 3VYUB 3WGIA 5TGTA 3OL3A 1YJWI 3B6CA 3ZMDA 2QZ8A 2A05A 2E19A 1WWXA 3MZ8A 5FKNA 1ZLKA 1R00A 3HGGA 5AIQA 1D0ZA 2KRFA 4B48A 2DQLA 4FCYA 4BKXA 3HOZJ 1IRZA 2PMZN 4GRIA 2CMPA 5CQEA 3G71I 3ZMZA 3M7GA 1WJCA 1SEUA 4XRMA 4HQEA 3S1MJ 4A3LJ 1P7IA 2X9DA 2DDAA 3VODA 4OIRF 5JFRA 4YFXF 1VI0A 6PAXA 1U0JA 1S72I 4BS9A 3HOXJ 2M4KA 2Y9ZA 3I55I 1X4OA 2EPFA 4AYBN 3OYLA 3E5QA 5TISC 3ESWB 1YW8A 3I5UA 1ZTRA 5FLXK 1RR8C 1RNLA 3DPTA 1BR1A 4OAZA 4A69C 2VQHA 4M72A 2CH0A 5FKOA 5ICFA 4CYCA 2EFWA 3FXRA 4ZC3A 5BPDA 2HPMA 1FYKA 4G94A 1FT9A 2MYSA 1D1AA 3EDPA 2UUZA 2L9NA 1JT0A 3BLYA 5C44J 4L9TA 5GPCA 3VPRA 1RETA 2HU9A 1NG6A 3IKVA 1BOBA 4BQAA 1XPXA 1R9TJ 4M74A 1Z77A 3F9KA 3G1LA 5D5UB 2H27A 2PJPA 4HX7A 2AQFA 5IY5H 2JPBA 1MJAA 3J81K 4RGXA 4R8HA 1AU7A 2K4JA 3I4PA 2DBBA 1F4KA 3AL0B 2VQCA 2R7VA 1A04A 4BQQA 4K2EA 3M07A 1JGSA 5FJ8J 1TTYA 3GTKJ 2OV7A 4MQVA 3IP4B 4Y15A 5HDNA 4IHYA 2DOAA 5FD5A 2JTVA 1YS7A 5IT9K 1YI2I 4IHSA 1ODDA 3GTPJ 4Q4ZF 3GTOJ 3AFHA 1VZ0A 2EFNA 4JX6A 4KA4A 3GTLJ 3JSOA 3K7AJ 3SHFA 1ACIA 3GZ5A 1Z6TA 2VJJA 3BPXA 2MABA 1U5TB 3HKZN 4HSTA 5ILUA 2KDOA 3KP3A 1FC3A 2AHQA 2Y69H 2NVQJ 2NOGA 4EM0B 2V1UA 5FB2A 3IRQA 2QA4I 4C3JJ 1HQCA 1BR2A 1X1CA 2YPRA 3HBLA 4NNJA 3FXJA 4RAFA 3L09A 4F7ZA 2E1CA 2EBIA 4YIRX 3CZ6A 1T2KA 4CHUA 4I2OA 1ETQA 4BNCA 1RKWA 3OYGA 2YUSA 1SANA 2XGXA 3NRVA 4A6DA 1T08B 4BACA 4M6VA 2QENA 2KIMA 3FXOA 4C9YA 2XC7A 1SFOJ 2R7ZJ 4I0BA 1CGPA 2YU9J 2RNJA 4C3HJ 4S0HB 4KUMA 1KGSA 1ETWA 2GXGA 3A0HC 5D8KB 4QTRA 1AKHA 4YELA 1MSEC 1K4SA 3I71A 5FKLA 3BCBA 4EGZA 2Z2SB 3RPUD 4BAYA 9ANTA 1D0YA 2AXTC 1ZN2A 3OYCA 3SJMA 4Z6YA 2XF6A 4DGWB 3G4SI 1XN7A 1AWCA 2LP0A 4FT8A 2XAQA 2EV6A 5LRRA 1WGXA 2LBFA 2IRFG 3UR3C 3NWSA 1IAWA 3I53A 1P4XA 4QPQA 3KEQA 4XKWA 3D0SA 4I01A 3W2VA 1TBXA 2WA0A 2A6HF 3SDBA 1MBHA 2X1DA 1P9QC 1R58A 2Y0SN 3DBHB 3JRGA 3K6GA 3W6JB 3H0DA 3MZYA 4BY7J 2JN6A 5EG0A 5LGNA 2ISYA 2P5LC 2HVRA 4IQJA 1SD7A 5LRSA 5E18F 1UAAA 1YG2A 3HJEA 4DOZA 3H9QA 3BR6A 5GADJ 5E79C 5HOOA 1FY7A 3JAMK 4O3MA 1WFXA 1MH4A 1TWCJ 4X1EA 2A07F 4M3GA 5JR3A 1K4TA 3GXOA 2LKXA 2RC4A 3BR5A 1R23A 2FJ1A 3KLOA 1QZZA 4HDUA 1MDMA 4MIMA 2E2HJ 2ZBKA 4GCVA 1FBUA 3KIOA 2DK8A 1JTYA 4GXOA 4B09A 2HWVA 1DP3A 2M0MA 2NOJB 4JX5A 4FE4A 1YX5A 4FASD 3P9IA 3U1KA 2F48A 4XRSA 1VQOI 1T56A 1CF7B 1MGTA 4I99C 2IEKA 5DM7F 3G1MA 2WC2A 1FYMA 2MD5A 2R5ZA 1W7PD 1UELB 1NK2P 1LNWA 3KLNA 4Z2YA 1KU7A 4KMUX 2M45A 2XSJC 3DBLB 3ERED 4YFKF 1Y8QB 3CUQC 3DKYA 3CCMI 1WVRA 3FWEA 5HS8A 4RB2C 4KISA 3LAPA 1QA6A 1KYZA 3J7YJ 3MCZA 3QOPA 4HYEA 4M9SA 2EIJH 2V1NA 4FX0A 4BGDA 3RKQA 4XN0A 2RQQA 3ROUA 2H6BA 4EJOA 3QYEA 2X4HA 1T98A 3TL4X 3VSKA 4U7BA 4P96A 2M9HA 1L0OC 3BZKA 3JRCA 2G9WA 4TV7A 1OR7A 2NVYJ 1WH7A 3JRBA 1TT5B 4B8XA 4ETSA 3CDLA 2V6EA 3PIPF 1SFKA 2L7KA 3IAM2 4MFDA 1O7FA 2JUGA 1OCZH 2M0CA 3HOUJ 3QWLA 1VQ7I 4I02A 3SYTA 2JRTA 4U88A 2STWA 1VQ8I 2E5ZA 4KDPA 2ELJA 1OYYA 2Y75A 1IN4A 3R4KA 2MA3A 3V7SA 1YJNI 2CS3A 3RSNA 2JT1A 1NHAA 1LDJA 2LKSA 4FISA 4XBFA 4BH9A 1DGRM 3H0GJ 2D1HA 5J40A 4ZJZA 2IA1A 3V8LA 3PJRA 1TQPA 1IGNA 4A3DJ 5KK1A 3D5LA 3T8TA 3GFIA 1BBYA 2V4JC 2FRHA 3A2KA 3LSKA 1JKPC 1IXRC 2WY8Q 5KCMA 3CCLI 3FXQA 1FBSA 4Q5SF 1XC5A 5LHIA 3CD6I 1RR7A 5CVIA 1UZCA 5H6RA 2IA0A 3J80Z 5GTIC 3N97A 1F1ZA 4KIFA 4FTHA 5TRDA 3DEEA 4Y7NJ 3AKZA 1ZHFA 3PFIA 1VNDA 2EJRA 2IW5A 4M6XA 1I3AA 1X3ZB 4IEJA 3K70D 4QLCU 2VXZA 3C1DA 3K1NA 3IHUA 3VOEA 5ICGA 3K4JA 1GHCA 4IJAA 4LK0F 2DI3A 5E1ZB 3S2WA 3CCRI 2FMLA 4A3MJ 3UNGC 1D5VA 2VLAA 2PJRB 3C2HA 3FF5A 2L54A 1YYVA 3FMRA 2IS2A 2A5YB 1U9OA 2DLLA 4L5IA 2A69F 1Q1VA 2VPRA 3BG5A 1JXSA 1ZELA 2ZSHB 4BUPA 1GDTA 1K7AA 4AD9A 4IHWA 1LUJB 4NHJA 2IJLA 3RCOA 4G6DA 4MLOA 2XVCA 5JI6A 1X4PA 3C18A 2VONA 1ZK8A 4M71A 5B1BH 1R4NB 3WTWC 2QM3A 4IRIA 3WU2C 1R49A 2L3DA 2M7AA 4P9UA 3VWBA 4WXDA 4B1RA 5FFXA 2XRLA 2VQLA 2QGUA 3VB2A 4CICA 5CKTA 3I58A 1M1EB 2QUFA 2VOOA 1HW2A 4CH7A 4A3KJ 2FQ3A 2GM4A 2G7UA 1ETKA 3W6KB 1LDKB 1UHSA 2HDWA 1LFPA 2FF4A 5EF6A 4HAMA 2QVOA 5HNHA 3GYHX 1OQYA 1ZR4A 5JVGF 3K9TA 3QPTA 3K70C 1SFXA 4UNOA 2VBXA 3BQYA 4L9NA 3WE2A 1HW1A 1TWAJ 1K78A 3CJNA 2HQAA 4ZTJA 5EGOA 2ZO4A 4NC6A 4C30A 2CYYA 4PZJA 4U0VA 2DU9A 4FQGA 1PJRA 3RTRA 2F6CA 3VDXA 3ZCOA 3PQJA 4HOBA 2Y31A 2MC4A 3OIQA 2JSCA 1J2XA 5D5WB 5FLVA 2HOAA 3MVPA 1IXSB 4PUSA 1DPRA 3N05A 1Z3XA 2XAUA 4QSHA 1R6RA 1IN8A 1ZAOA 5D6EA 3DU6A 1XMAA 2GOMA 4M9XA 3VYSB 1QPMA 1UHMA 3CCQI 1ZARA 4J01A 3BWGA 2YU3A 3FXKA 1ZH5A 2CUEA 3FHNA 3CDIA 4FHTA 2WV0A 1K83J 1ZRDA 3SZGA 2DDBA 1JGGA 5D8LB 1F43A 4HRIA 5E3MA 1WKMA 5DCMB 1IUFA 2LMDA 5L3CA 1BL0A 2OQRA 1QVUA 3I56I 3I3LA 3F8NA 4L0YB 3F8FA 3M8EA 1XCBA 2CJJA 2CSOA 3RQIA 4PFOA 1B9NA 1ZYRF 2JQ7A 2FX0A 3MKWB 4EM2A 3S3NA 5K5RA 3CC4I 3ZGKA 1I1GA 1G4DA 4XORA 5IYCJ 1HOMA 2IS4A 1Z7LA 2Z3YA 5LEKA 4AC0A 1R36A 1FMVA 3S1QJ 2JUCA 4IZZA 3CMMA 3H9GA 4DYCA 4ZZDA 2QCOA 5LEJA 2QLZA 4EMSA 3ZQCA 2R7TA 4HV5A 1USTA 5LHHA 4P5OA 1IV6A 1MBFA 1Y56A 3G3ZA 5LFAA 1IO2A 3PIOF 1W5SA 1ITYA 2DT6A 4UUVA 2KKOA 3CLOA 4WXHA 1SFUA 2BOLA 4IX7A 1ZRFA 2DW4A 2O8XA 2RAEA 3IKTA 1VQ4I 4KIBA 4F52A 3ABLH 4OMYA 2QQ8A 3F22A 1WHUA 1WJFA 5K7FA 3BZCA 4LLGF 4B3XA 1TW2A 3ZQIA 1YW7A 2WB1N 2NS0A 3GLXA 1SVLA 3FDYA 3NWTA 2W1OA 1R1UA 1YRNA 4XOTA 3KFWX 2Z16A 2KIQA 4RGRA 3FMQA 2H8WA 2CUZA 2IAIA 4LLLA 3GO5A 1WSUA 2V7FA 3D5SC 3QU3A 1LPQA 2DMUA 4CSWA 2DQRA 1G8XA 3IRRA 1YO5C 4XIDA 2HDCA 3E97A 4XONA 5E8GA 3FZVA 4ENJA 1JKRC 4MNUA 3HOTA 4E7IA 5HODA 3CCYA 3M8JA 1XB4A 4L9VA 4F93B 4CO8A 5BS6A 2OJED 2V1DA 3OYAA 2HQRA 3CCUI 2XAGA 4BY1J 2XHKA 4N9HA 1W7PA 4OIQF 1JUMA 1O7LA 1IRXA 3OIPA 3K4KA 1UJ8A 4C2MJ 1FTZA 4LLNA 5IOZA 4J19A 2ME0A 4IVNA 5CVUA 2E1OA 1MJ9A 5HLTA 5J4YA 2P6SA 3A01A 4M6YA 2E36A 2FOKA 1BI3A 3A4CA 2MSYA 4GDFA 4KNYA 5J47A 1F9NA 4A2UA 2ZJ2A 4I0AA 2L7ZA 2E7WA 2CGPA 4LB6B 5M3FJ 3GCMA 2KRCA 1A6IA 3PO2J 3CMAI 3ZQGA 4CA0A 2VKDA 5BOXA 4ITVA 2XSDC 2X6YA 1H9GA 4EQQA 2CQKA 1FX7A 4LJZF 2BZTA 4PFPA 2G0EA 5F08A 2OPTA 4RLFA 1OCOH 4DYQA 1JI8A 2KPMA 2ECCA 2HVQA 1QBJA 4L18B 1JUSA 1QZEA 1MMGA 4IO9F 3CP8A 3BDDA 3K0LA 5FKKA 2BHYA 5EDNA 3ZP5A 2LKPA 1FP2A 4BHPA 2LFBA 1REPC 3WU0A 2LG4A 5DS9A 4A3FJ 3LWFA 1K6OA 2L02A 2R7DA 2QSGX 2EFOA 1E3OC 1J7KA 2RGVA 4I76A 3L9FA 3ELKA 2K9QA 2XB0X 4II3A 4A0YA 2ZNZA 1HBXG 1ETXA 4DZJA 2M8GX 2OCCH 3CCSI 3WHCA 5E17F 5DV5A 4PDKA 4AIDA 2VOPA 3OL4A 2O7OA 4FX4A 2H09A 2L2OA 2ZFUA 3HTUA 1YX3A 2MG4A 3GUDA 3CUQB 1G3SA 3ZMUA 3CO6C 1LB2A 5E8IA 2VODA 3HDDA 1FOKA 2EIKH 2Z5UA 1ZKGA 2IVMA 1IF1A 1H0MA 1G59A 2R7FA 1ERDA 3FXMA 2X1CA 2E7XA 3RKWA 2HOSA 5FRMA 3DXJF 3L2CA 1IXCA 4KT6A 4RDUA 3V42A 1BIBA 4KICA 2HPIA 4AIKA 2ZMEA 5FKMA 3BCAA 2HVSA 2HEOA 2HXIA 1WJAA 2K27A 5HLIA 2D5VA 2K86A 2M8EA 1HF0A 1KA8A 2CG4A 4KFCA 4OOIA 5HS9A 4BYYA 4ANJA 2HYGD 3CQZJ 2HZTA 3FHZA 1OR7C 3SFIA 3TEDA 1ON2A 1XG1A 3FMSA 3HOYJ 1R1TA 3ZR8X 1PYVA 2BXYA 5M5XJ 4LB5A 2X0LA 2ZSIB 3HM5A 4C2TA 3ABTA 4BQOA 1KQ8A 1ZGAA 2KMUA 3L7WA 1N77A 2DMQA 1SVOA 4BHBA 1FTTA 1JJ6C 2ESHA 5EJCA 4BJTA 2DA2A 3JCUC 1W0UA 1D8JA 3DV8A 3C3WA 2DPDA 2QWWA 3ULQB 3I59A 1IN7A 1OFCX 1TNTA 2K40A 3H5NA 4DZPA 3JRDA 1MD0A 2VKHA 3ZN1A 4HNTA 4AM3A 4LK1F 2ZXHA 4UVBA 4LFUA 2QQBA 1Z0XA 2HNHA 4WX9A 3F8BA 4L5JA 1UCRA 2EIMH 2PFBA 1FZPB 3LQRA 4ESJA 4P1WA 4QWQA 1LEBA 3K4LA 5DUIA 1B6AA 4P55A 2LTPA 1LE8B 2UXXA 1WJBA 2CUFA 2HGCA 4M73A 1ZGWA 4HLXA 4D0PA 1O4XA 2M34A 4X0GA 3V8KA 2DYRH 1VQ5I 4RB3C 3Q0UA 1B72B 3TOAA 4B44A 3BTJA 2NNYA 1MW7A 5M5YJ 3D5RC 1N78A 1GVDA 2L7FP 4B43A 1ETOA 1TZLA 2FQ4A 2RNGA 3OS0A 3B02A 3HOSA 4IHTA 4XLFA 2HTSA 2NXNB 2CQ7A 3NARA 2IS1A 2KT0A 1ONVA 2ZNYA 2VBZA 4HLYA 1KU9A 4DBRA 4Y3OA 4XSZF 3S2HJ 3EUAA 3P7NA 1WI3A 3A1YA 1FOXA 2VB6A 2I10A 3TP0A 3PO3J 1BA5A 4Y52J 3HUGB 1ZQ3P 2ID6A 2XRNA 2YSRA 2F5FA 1R4MB 3OV8A 3FX3A 2PMUA 1MNEA 2ZXIA 2M1BA 3R0AA 2COMA 3H3UA 2LF8A 4OIPF 5ERIA 2JJ7A 2VUMJ 4BJ6C 5CQGA 3R60A 1BC8C 4IKFA 3L2WA 1YIJI 3HG9A 2FMYA 2OQGA 4IPAA 3IUOA 3TGNA 5IOYA 4YRVA 2LDUA 2E2IJ 4BXUA 4M3FA 1OISA 4XLAA 2GXBA 3E3VA 1Y1VJ 2CW8A 2RV8A 4IOAF 3PNYA 2Z9OA 2OU2A 1O3TA 2K4BA 1FSEA 2WBMA 1XMKA 3I4MJ 2ETHA 3HSEA 3MKZA 2KZGA 3HB9A 4EJWA 3WTUC 4BQNA 1OCCH 3DQVC 3BT9A 3RI4A 1OYIA 3K4CA 3I4NJ 2BEOA 1FYLA 1ON1A 3S15J 2JRMA 3J80K 1X19A 2BV6A 4UUSA 5EZHA 3TDZC 2JA5J 4RBOA 2PN6A 5E20A 2BBYA 5KAIC 3WG7H 1OCTC 4S04A 2D45A 3LOCA 1YE9A 3MKLA 5JLXA 4CYCB 4PGHA 2IXSA 2UWMA 5ED4A 2O3FA 1WPKA 1PDNC 1B9MA 3H3VK 3OYHA 2VN2A 3BJOA 3E6DA 5LBQA 2O8KA 2QEXI 3O8HA 2IS6A 2KIFA 1T95A 1V55H 3LSTA 1ZLJA 5IYDJ 3FBNB 2XB5A 4RB1A 1FMWA 3IH2A 1LFUP 1JJ8C 2F2EA 4E7SA 3N4MA 3BY6A 1WH5A 3WU1B 3LMMA 2DA6A 1KQ0A 4HX4A 3OYKA 1SFEA 2DJIA 3I54A 2MH9A 2ZCWA 5E3NA 4NDLA 4XL9A 3H5RA 1S6LA 5F1RA 1QNTA 2CQNA 2F5CA 2K9LA 3JTHA 4BXXJ 2VJIA 1QU3A 2OZUA 3FK7A 3NQOA 4NQWA 1B8IA 1MSFC 3O3KA 3ML6A 4N9IA 1D1BA 4N0BA 4HV6A 1KYWA 3BZ6A 2P5VA 2HI3A 3AG2H 3K4NA 2K9MA 4DIQA 2BYVE 4DBQA 5L3GA 1R7JA 5M3MJ 5GTHC 2L9SA 2DAOA 2FSWA 2GA2A 2HQ5A 4KMFA 4BEHA 2P6TA 5CLSA 3H3ZA 2FE3A 5FROA 3ASOH 3ZQFA 3KPHA 2E35A 3KZIC 1W4MA 2ACJA 3HSRA 1FOYA 4PJLA 3LFUA 4XLPF 2QKLB 3MWMA 4V2GA 4LG0A 3T5XA 2D1VA 3J81Z 2JVGA 4A5MA 1HDDC 5F0CA 3SDGA 3GFMA 4UV9A 3P9KA 3LSJA 2VC0A 3G6EI 1MBGA 3CJTB 2WY7Q 4A0XA 4RMNA 4DW6A 3DLLF 2WV1A 2EILH 2HQNA 3AG3H 2W85A 3BR3A 3H5AA 3DFGA 4ZYHA 3OYBA 2E60A 1VTNC 4U0WA 1RRJA 2ZKZA 2F4MB 3KP6A 5IT9Z 1LQ1A 2VXDA 3PUBA 5J8FA 5D4SA 2LNBA 1MBEA 4G9YA 3CO7C 2VQGA 3BJ6A 2E5NA 4RGUA 1U8RA 3WTSC 1Y1WJ 2GBYA 3B6AA 1J59A 3F6OA 1G2HA 2PMZA 3HXLA 2BW3A 2VJ5A 3DU5A 3SZTA 1BIAA 1P2FA 2KIUA 3U1DA 2CU7A 4CCOA 5HDKA 1AKHB 2XASA 2Q8KA 4XLCA 2IA2A 2DODA 2O5RA 4AVZA 4S05A 2IP2A 4EVIA 1MJBA 5K5OA 2IGKA 1A35A 5C4XJ 3CTAA 3KX2A 1FSHA 1AA7A 4AYBA 4LIVA 4UVAA 1GV2A 4CXFA 4LIUA 1GT0C 3MEXA 1TQMA 1IJWC 2OF7A 2V26A 2LBFB 1RKTA 1WJEA 2RDPA 4M3DA 4BBRJ 3OYMA 5BNGA 1W5TA 1VQLI 2MH2A 3VSLA 2R7RA 5EYRA 2BY1A 2F4OB 3QAHA 2MFZA 2HFHA 4IXAA 1OPCA 3H92A 5HLHA 2E2JJ 3KEOA 1YOVB 3LQQA 5KVRA 5EG0B 3TW6A 5F04A 4Y13A 2ZJQF 3V8JA 2CV2A 2AO9A 3OSGA 5FFZA 3J7AY 3Q0WA 1FIPA 3OS2A 1SD5A 2DMTA 1X3UA 2DTRA 1SD6A 1XD7A 4XICA 3H9JA 2I8DA 1TWGJ 2B7EA 1MDMB 2QBYA 4U7DA 1ZR2A 2A6EF 3QYFA 3RJPA 1HKTA 1HKQA 3SFZA 1Z1DA 4CCJA 3BTLA 1VFCA 1UG2A 1B8IB 2DT5A 1DU6A 3MMYB 1XDSA 4OWRB 3C2BA 2DMNA 1QVTA 3BTIA 4ZTFA 2VBYA 4OMZA 3HPHA 3I64A 3W3CA 2CO5A 2R5ZB 1F5TA 2V79A 2XAJA 1RI7A 4FE7A 4E7KA 1U3EM 1BM9A 3M1EA 1XGOA 3T0YA 1HDPA 1MBJA 3F8MA 2L4MA 3WHBA 2VKVA 2BHZA 3HPGA 3GEZA 4CCNA 2P0WA 4XQFA 4XLEA 3MN2A 2X1EA 4E7JA 1X1AA 3V4GA 1U5TC 4Q47A 1BI1A 1RESA 2KJCA 3W2AA 4DYRA 1UFMA 3TBIA 1FJLA 4MEXF 3HTSB 2NVUB 3BOQA 2LY1A 1HXDA 2ZMEC 3HKZA 2HS5A 5JLWA 3ECOA 4ENKA 2DFHA 3C2GA 2HXOA 4MFEA 4YEJA 3OYEA 1YHQI 3GFLA 3MFKA 5K7HA 3WODF 4D1QA 4HZFA 3DTIA 5JHFA 3M9AA 4JOMA 3BTCA 1S3JA 1L3LA 1TL8A 2DOFA 2K7LA 4LITA 1I27A 4M3EA 1TNSA 2KZVA 1Z91A 1GV5A 2VIXA 2B63J 3CESA 3IV5A 2R5YA 2BW3B 5IP7J 3LSIA 5HLGA 3RKXA 3TMOA 2XAFA 2K9SA 3DPUA 4MQ9F 1TC3C 4PSWA 3TDUC 2CUJA 2XAHA 5D4RA 2LLKA 1RC9A 3TKYA 2BXZA 3IAS2 1OJLA 2HOEA 1HA8A 3FKIJ 1G3WA 2VE8A 2EA4A 2ZB9A 3GWZA 1I5ZA 3GLLA 4CDGA 2EZKA 2JSPA 2KLOA 4OU0A 3RZDJ 2OUMA 1XGSA 1XDUA 2ZJPF 1S7OA 3V7RA 1GXPA 2R7OA 2EWNA 3KEYA 1KONA 3GF2A 3SEQA 1R5ID 2EH3A 4MTDA 1XCVA 3LSRA 4IF4A 4JK1X 3R61A 2EA2A 1QRYA 2FNAA 1VQ9I 3ASNH 4E6KG 5GAGJ 5CYVA 2P5KA 3HOVJ 3B73A 1PUFA 1PUEE 2P8TA 5B66C 5D6FA 5ILVA 1QGPA 2MGQA 4G6TB 2EK5A 2LF7A 2Y0SA 4WK8F 5KHDA 2XKOA 3MQ0A 3EPZA 2C6YA 5EEGA 3HL2A 2OA4A 1V5EA 4PSXA 3CC2I 2XV4S 5LGUA 1I1SA 1FNNA 3AG1H 2LD5A 3RZOJ 3TW7A 2W82A 2CFXA 1YFHA 2Q2EA 1ETYA 2RN7A 1LVKA 3I9V2 2Y9YA 4PJNA 3E5XA 4CCMA 2ECBA 4ZYDA 4JYKA 1OKRA 3QRFF 3CJQB 1K61A 4A3GJ 4BE2A 4DJAA 3QP5A 3M3YJ 3PL8A 4O5VA 3S3OA 2AXLA 1OCPA 3H1CA 2IPQX 4C3IJ 3BR2A 3CUOA 4BXFA 4D5CA 1FLIA 1KQ9A 3OYIA 3HRTA 3LNQA 1U78A 3KP4A 3PNVA 3F3XA 4G7HF 4EJUA 5H20A 2ELKA 5F0FA 2V9VA 5GAEJ 4LGWA 4BBSJ 2QQ9A 1I3QJ 4Y4RA 2L7MP 3GMEA 2Q1ZB 2CV1A 2VASA 4KN4X 3DWLE 2W24A 3Q5FA 1K78B
chains in the Genus database with same CATH topology
4XK4A 1MH4A 1TWCJ 4X1EA 2TCTA 1Z0XA 5EGOB 4M3GA 1XS9A 1I50J 2R93J 2LKXA 3HGYA 3BR5A 1IDYA 2FJ1A 5GP9A 4MIMA 3JRIA 3JREA 2E2HJ 1BJZA 2LTPA 1LE8B 4AUXA 1JTYA 2CUFA 4JX5A 4FE4A 2W48A 5FLMJ 3S1RJ 1ZGWA 2O9LA 4XRSA 1T56A 1O4XA 1VF9A 2M34A 1TWHJ 2IEKA 1B72B 3Q0UA 5F0HA 2XPWA 3BTJA 3G1MA 2GLOA 5M5YJ 5IP9J 1D5YA 2Y2ZA 2R5ZA 1NK2P 1GVDA 2L7FP 3L1PA 3GTMJ 1ETOA 2FQ4A 1IDZA 2DTZA 2NS7A 3NARA 1ORKA 2KT0A 2VKEA 3RKQA 1EF4A 2XGDA 4W97A 3S2HJ 1WI3A 3JRHA 5E3LA 2M9HA 2XPUA 2I10A 3JRCA 3TP0A 3PO3J 1BA5A 3K2AA 4EEFG 2NVYJ 1WH7A 1ZQ3P 4Y52J 2ID6A 3JRBA 3CDLA 1RPWA 1F36A 1X2NA 2DJNA 4MFDA 2M0CA 3PM1A 3HOUJ 2JJ7A 2VUMJ 2WAQN 5IP6A 1ENHA 3ZOBA 5IOYA 4FISA 2E2IJ 4M3FA 3H0GJ 3D1NI 4B4CA 1DU0A 2DA3A 4GFBA 3UKGA 1Y1VJ 3HEFA 4IHXA 3GTQJ 3BR1A 1IGNA 4A3DJ 3I4MJ 2JA8J 3HOWJ 3HB9A 2XGCA 5DTDA 1JKPC 1WCMJ 3S16J 1JTXA 3BT9A 2MW8A 3DEWA 1YRNB 1XC5A 3I4NJ 3S15J 1RR7A 5GPAA 3G1OA 4UUSA 2ID3A 2N8GA 5EZHA 4FTHA 2JA5J 4RBOA 4Y7NJ 2L0KA 5J1UA 2LY9A 1OCTC 1VNDA 3LOCA 3MKLA 4IEJA 5JLXA 3LSGA 4CYCB 2JWTA 4A3CJ 2XPVA 1WPKA 2H8RA 3H3VK 4A3MJ 3ZQLA 2O8KA 2M2EA 5C4JJ 2TRTA 3S2DJ 3O8HA 1W0TA 4A3BJ 1U9OA 2KDZA 5IYDJ 2YS9A 1Q1VA 2VPRA 3BG5A 2FD5A 2XB5A 2CQQA 1GDTA 2DN0A 4IHWA 2X6OA 3IH2A 1LFUP 4B3AA 3A01B 1JJ8C 4MLOA 2HOTA 1BW5A 1WH5A 1ZK8A 2DA6A 5E3NA 4NDLA 2CQXA 2X48A 1U8BA 4B1RA 1AHDP 2XRLA 3S14J 4BXXJ 1MBKA 3FK7A 2R92J 1P7JA 1B8IA 1MSFC 3S17J 3ZQHA 1X58A 2DA4A 2K9NA 4A3KJ 1LFBA 2HI3A 3TP3A 2GM4A 1ETKA 4A3JJ 1ETVA 1UHSA 2LR8A 5EF6A 2R5YB 5J1RA 5M3MJ 3QQAA 1ZR4A 1POGA 4A3EJ 2HQ5A 1NK3P 3BQYA 3FK6A 1JUPA 1TWAJ 3ZQFA 3FIWA 1H88C 5EGOA 5C3EJ 3A03A 1MH3A 4V2GA 5F1JA 5K7ZA 1TWFJ 2P81A 1HDDC 3O8GA 1LE8A 3NAUA 1X2MA 5F0CA 3SDGA 2Y31A 3LSJA 1MBGA 5FLVA 2HOAA 3MVPA 3BG9A 4DW6A 2WV1A 3QPLA 4QSHA 1H8AC 1B72A 3BR3A 2JK3A 2IBDA 1JKOC 2CUEA 3F0CA 1JT6A 1K83J 1PUFB 1MBEA 2EZIA 1JGGA 1F43A 5E3MA 4V2FA 3OOUA 1IUFA 2DA5A 1S7EA 1Y1WJ 2GBYA 3B6AA 4ABZA 3BG3A 1G2HA 1A5JA 1BL0A 2R0QC 1QVUA 1CQTA 3IH3A 2CJJA 2CU7A 3RQIA 2HYJA 4L5EA 1MNMC 2HDDA 1AKHB 2FX0A 4UUTA 1APLC 5IYCJ 1HOMA 4AC0A 1IC8A 3S1QJ 5C4XJ 2COBA 3DCFA 2Y30A 1QPIA 4DYCA 5J1YA 2QCOA 1GV2A 1GT0C 1IJWC 3ZQCA 2OF7A 1RKTA 3GBGA 4G12A 1IV6A 2L9RA 3LSPA 1MBFA 4M3DA 4JX4A 2DMPA 4I6ZA 4BBRJ 1ITYA 5BNGA 3B6CA 2E19A 5EYRA 3E7LA 5FKNA 3HGGA 2RAEA 2E2JJ 4FCYA 4BKXA 5EG0B 3HOZJ 1IRZA 3TW6A 5F04A 2PMZN 5K7FA 2AO9A 5EZGA 4XRMA 3OSGA 3S1MJ 2EZLA 1P7IA 4A3LJ 2X9DA 3Q0WA 3ZQIA 4A3IJ 1FIPA 2JMWA 2WB1N 5IYBJ 3OSFA 2DA1A 1FIAA 2DMTA 5E3OA 3CMYA 4XICA 1VI0A 1YRNA 1TWGJ 4QIWN 1ZR2A 3HOXJ 2LK2A 2Y9ZA 4AYBN 3BTLA 1HLVA 1VFCA 1JKQC 1UG2A 1B8IB 1ZTRA 1DU6A 2IAIA 3C2BA 2DMNA 1QVTA 3BTIA 4A69C 5FKOA 4XRSG 3Q0VA 4CYCA 2DMUA 2R5ZB 4XIDA 1JKRC 4FE7A 5HODA 3CCYA 1JT0A 1HDPA 1MBJA 5C44J 3S1NJ 1GUUA 3WHBA 2VKVA 5GPCA 1NTCA 3VPRA 1RETA 4BY1J 2NVTJ 4W1UA 1H89C 3MN2A 1JUMA 4C2MJ 1FTZA 2NS8A 1R9TJ 3M4OJ 5IOZA 4J19A 2ME0A 2E1OA 1RESA 4DYRA 1Z77A 3G1LA 3A01A 1FJLA 5JLWA 3JR9A 2HXOA 4MFEA 2MSYA 5M5WJ 5IPAA 2L7ZA 1AU7A 5K7HA 5M3FJ 3QPSA 1A6IA 3A02A 1UMQA 2JA6J 1HCRA 3PO2J 3BTCA 3ZQGA 5J3LA 3OIOA 2QF7A 5FJ8J 3W6VA 2EZHA 2XSDC 4HNVA 3GTKJ 4IHYA 4M3EA 2EQRA 1GV5A 2CRGA 2B63J 3GTOJ 2R5YA 3IV5A 3GTPJ 5IP7J 2G0EA 3JRAA 5F08A 2OPTA 4DYQA 4JX6A 2ECCA 3GTLJ 2K9SA 1TC3C 1JUSA 2LLKA 3K7AJ 5EDNA 5FKKA 1OJLA 3FKIJ 4D5FA 1U9NA 2ZB9A 2LFBA 4JP0A 5DS9A 4A3FJ 2DA7A 3HKZN 3FISA 2EZKA 1E3OC 3RZDJ 2LVSA 1IG7A 4I76A 2K9QA 2XB0X 2VI6A 2AHQA 2NVQJ 1ETXA 1T33A 2NOGA 4DZJA 2M8GX 4C3JJ 4UUSB 2EH3A 3HBLA 3WHCA 3LSRA 2JA7J 2EBIA 2O7OA 1QRYA 4MO7A 5F27A 2MG4A 1ETQA 3HOVJ 1RKWA 2YUSA 4D7MA 1PUFA 1SANA 2MGQA 3HDDA 1ZKGA 4X6AJ 4M6VA 1SFOJ 2HOSA 2R7ZJ 2YU9J 4RDUA 4C3HJ 4S0HB 2LD5A 3RZOJ 1ETWA 5FKMA 3TW7A 4QTRA 1AKHA 1MSEC 1ETYA 1I6HJ 2HXIA 5FKLA 2Y9YA 3GTJJ 3GTGJ 2D5VA 2ECBA 9ANTA 1HF0A 2XGEA 4JYKA 3SJMA 3IH4A 1K61A 5EEAA 4A3GJ 4IHVA 3CQZJ 3M3YJ 3SFIA 3TEDA 1OCPA 1XG1A 2LP0A 3HOYJ 1WGXA 4C3IJ 3BR2A 4A93J 4M3BA 4D5CA 5M5XJ 3HM5A 3LNQA 3JRFA 1U78A 1FEXA 2DMQA 1MBHA 1FTTA 2Y0SN 1JJ6C 3JRGA 3Q3SA 2DA2A 2ELKA 5F0FA 1W0UA 4BY7J 4BBSJ 2JN6A 2H1KA 5EG0A 1I3QJ 2ME6A 2L7MP 1OFCX 2K40A 4DZPA 3JRDA 3BR0A 4LOCA 3BR6A 1BW6A 2NVXJ 3BQZA 4D7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  1MH4 A;  1TWC J;  4X1E A;  2TCT A;  1Z0X A;  5EGO B;  4M3G A;  1XS9 A;  1I50 J;  2R93 J;  2LKX A;  3HGY A;  3BR5 A;  1IDY A;  2FJ1 A;  5GP9 A;  4MIM A;  3JRI A;  3JRE A;  2E2H J;  1BJZ A;  2LTP A;  1LE8 B;  4AUX A;  1JTY A;  2CUF A;  4JX5 A;  4FE4 A;  2W48 A;  5FLM J;  3S1R J;  1ZGW A;  2O9L A;  4XRS A;  1T56 A;  1O4X A;  1VF9 A;  2M34 A;  1TWH J;  2IEK A;  1B72 B;  3Q0U A;  5F0H A;  2XPW A;  3BTJ A;  3G1M A;  2GLO A;  5M5Y J;  5IP9 J;  1D5Y A;  2Y2Z A;  2R5Z A;  1NK2 P;  1GVD A;  2L7F P;  3L1P A;  3GTM J;  1ETO A;  2FQ4 A;  1IDZ A;  2DTZ A;  2NS7 A;  3NAR A;  1ORK A;  2KT0 A;  2VKE A;  3RKQ A;  1EF4 A;  2XGD A;  4W97 A;  3S2H J;  1WI3 A;  3JRH A;  5E3L A;  2M9H A;  2XPU A;  2I10 A;  3JRC A;  3TP0 A;  3PO3 J;  1BA5 A;  3K2A A;  4EEF G;  2NVY J;  1WH7 A;  1ZQ3 P;  4Y52 J;  2ID6 A;  3JRB A;  3CDL A;  1RPW A;  1F36 A;  1X2N A;  2DJN A;  4MFD A;  2M0C A;  3PM1 A;  3HOU J;  2JJ7 A;  2VUM J;  2WAQ N;  5IP6 A;  1ENH A;  3ZOB A;  5IOY A;  4FIS A;  2E2I J;  4M3F A;  3H0G J;  3D1N I;  4B4C A;  1DU0 A;  2DA3 A;  4GFB A;  3UKG A;  1Y1V J;  3HEF A;  4IHX A;  3GTQ J;  3BR1 A;  1IGN A;  4A3D J;  3I4M J;  2JA8 J;  3HOW J;  3HB9 A;  2XGC A;  5DTD A;  1JKP C;  1WCM J;  3S16 J;  1JTX A;  3BT9 A;  2MW8 A;  3DEW A;  1YRN B;  1XC5 A;  3I4N J;  3S15 J;  1RR7 A;  5GPA A;  3G1O A;  4UUS A;  2ID3 A;  2N8G A;  5EZH A;  4FTH A;  2JA5 J;  4RBO A;  4Y7N J;  2L0K A;  5J1U A;  2LY9 A;  1OCT C;  1VND A;  3LOC A;  3MKL A;  4IEJ A;  5JLX A;  3LSG A;  4CYC B;  2JWT A;  4A3C J;  2XPV A;  1WPK A;  2H8R A;  3H3V K;  4A3M J;  3ZQL A;  2O8K A;  2M2E A;  5C4J J;  2TRT A;  3S2D J;  3O8H A;  1W0T A;  4A3B J;  1U9O A;  2KDZ A;  5IYD J;  2YS9 A;  1Q1V A;  2VPR A;  3BG5 A;  2FD5 A;  2XB5 A;  2CQQ A;  1GDT A;  2DN0 A;  4IHW A;  2X6O A;  3IH2 A;  1LFU P;  4B3A A;  3A01 B;  1JJ8 C;  4MLO A;  2HOT A;  1BW5 A;  1WH5 A;  1ZK8 A;  2DA6 A;  5E3N A;  4NDL A;  2CQX A;  2X48 A;  1U8B A;  4B1R A;  1AHD P;  2XRL A;  3S14 J;  4BXX J;  1MBK A;  3FK7 A;  2R92 J;  1P7J A;  1B8I A;  1MSF C;  3S17 J;  3ZQH A;  1X58 A;  2DA4 A;  2K9N A;  4A3K J;  1LFB A;  2HI3 A;  3TP3 A;  2GM4 A;  1ETK A;  4A3J J;  1ETV A;  1UHS A;  2LR8 A;  5EF6 A;  2R5Y B;  5J1R A;  5M3M J;  3QQA A;  1ZR4 A;  1POG A;  4A3E J;  2HQ5 A;  1NK3 P;  3BQY A;  3FK6 A;  1JUP A;  1TWA J;  3ZQF A;  3FIW A;  1H88 C;  5EGO A;  5C3E J;  3A03 A;  1MH3 A;  4V2G A;  5F1J A;  5K7Z A;  1TWF J;  2P81 A;  1HDD C;  3O8G A;  1LE8 A;  3NAU A;  1X2M A;  5F0C A;  3SDG A;  2Y31 A;  3LSJ A;  1MBG A;  5FLV A;  2HOA A;  3MVP A;  3BG9 A;  4DW6 A;  2WV1 A;  3QPL A;  4QSH A;  1H8A C;  1B72 A;  3BR3 A;  2JK3 A;  2IBD A;  1JKO C;  2CUE A;  3F0C A;  1JT6 A;  1K83 J;  1PUF B;  1MBE A;  2EZI A;  1JGG A;  1F43 A;  5E3M A;  4V2F A;  3OOU A;  1IUF A;  2DA5 A;  1S7E A;  1Y1W J;  2GBY A;  3B6A A;  4ABZ A;  3BG3 A;  1G2H A;  1A5J A;  1BL0 A;  2R0Q C;  1QVU A;  1CQT A;  3IH3 A;  2CJJ A;  2CU7 A;  3RQI A;  2HYJ A;  4L5E A;  1MNM C;  2HDD A;  1AKH B;  2FX0 A;  4UUT A;  1APL C;  5IYC J;  1HOM A;  4AC0 A;  1IC8 A;  3S1Q J;  5C4X J;  2COB A;  3DCF A;  2Y30 A;  1QPI A;  4DYC A;  5J1Y A;  2QCO A;  1GV2 A;  1GT0 C;  1IJW C;  3ZQC A;  2OF7 A;  1RKT A;  3GBG A;  4G12 A;  1IV6 A;  2L9R A;  3LSP A;  1MBF A;  4M3D A;  4JX4 A;  2DMP A;  4I6Z A;  4BBR J;  1ITY A;  5BNG A;  3B6C A;  2E19 A;  5EYR A;  3E7L A;  5FKN A;  3HGG A;  2RAE A;  2E2J J;  4FCY A;  4BKX A;  5EG0 B;  3HOZ J;  1IRZ A;  3TW6 A;  5F04 A;  2PMZ N;  5K7F A;  2AO9 A;  5EZG A;  4XRM A;  3OSG A;  3S1M J;  2EZL A;  1P7I A;  4A3L J;  2X9D A;  3Q0W A;  3ZQI A;  4A3I J;  1FIP A;  2JMW A;  2WB1 N;  5IYB J;  3OSF A;  2DA1 A;  1FIA A;  2DMT A;  5E3O A;  3CMY A;  4XIC A;  1VI0 A;  1YRN A;  1TWG J;  4QIW N;  1ZR2 A;  3HOX J;  2LK2 A;  2Y9Z A;  4AYB N;  3BTL A;  1HLV A;  1VFC A;  1JKQ C;  1UG2 A;  1B8I B;  1ZTR A;  1DU6 A;  2IAI A;  3C2B A;  2DMN A;  1QVT A;  3BTI A;  4A69 C;  5FKO A;  4XRS G;  3Q0V A;  4CYC A;  2DMU A;  2R5Z B;  4XID A;  1JKR C;  4FE7 A;  5HOD A;  3CCY A;  1JT0 A;  1HDP A;  1MBJ A;  5C44 J;  3S1N J;  1GUU A;  3WHB A;  2VKV A;  5GPC A;  1NTC A;  3VPR A;  1RET A;  4BY1 J;  2NVT J;  4W1U A;  1H89 C;  3MN2 A;  1JUM A;  4C2M J;  1FTZ A;  2NS8 A;  1R9T J;  3M4O J;  5IOZ A;  4J19 A;  2ME0 A;  2E1O A;  1RES A;  4DYR A;  1Z77 A;  3G1L A;  3A01 A;  1FJL A;  5JLW A;  3JR9 A;  2HXO A;  4MFE A;  2MSY A;  5M5W J;  5IPA A;  2L7Z A;  1AU7 A;  5K7H A;  5M3F J;  3QPS A;  1A6I A;  3A02 A;  1UMQ A;  2JA6 J;  1HCR A;  3PO2 J;  3BTC A;  3ZQG A;  5J3L A;  3OIO A;  2QF7 A;  5FJ8 J;  3W6V A;  2EZH A;  2XSD C;  4HNV A;  3GTK J;  4IHY A;  4M3E A;  2EQR A;  1GV5 A;  2CRG A;  2B63 J;  3GTO J;  2R5Y A;  3IV5 A;  3GTP J;  5IP7 J;  2G0E A;  3JRA A;  5F08 A;  2OPT A;  4DYQ A;  4JX6 A;  2ECC A;  3GTL J;  2K9S A;  1TC3 C;  1JUS A;  2LLK A;  3K7A J;  5EDN A;  5FKK A;  1OJL A;  3FKI J;  4D5F A;  1U9N A;  2ZB9 A;  2LFB A;  4JP0 A;  5DS9 A;  4A3F J;  2DA7 A;  3HKZ N;  3FIS A;  2EZK A;  1E3O C;  3RZD J;  2LVS A;  1IG7 A;  4I76 A;  2K9Q A;  2XB0 X;  2VI6 A;  2AHQ A;  2NVQ J;  1ETX A;  1T33 A;  2NOG A;  4DZJ A;  2M8G X;  4C3J J;  4UUS B;  2EH3 A;  3HBL A;  3WHC A;  3LSR A;  2JA7 J;  2EBI A;  2O7O A;  1QRY A;  4MO7 A;  5F27 A;  2MG4 A;  1ETQ A;  3HOV J;  1RKW A;  2YUS A;  4D7M A;  1PUF A;  1SAN A;  2MGQ A;  3HDD A;  1ZKG A;  4X6A J;  4M6V A;  1SFO J;  2HOS A;  2R7Z J;  2YU9 J;  4RDU A;  4C3H J;  4S0H B;  2LD5 A;  3RZO J;  1ETW A;  5FKM A;  3TW7 A;  4QTR A;  1AKH A;  1MSE C;  1ETY A;  1I6H J;  2HXI A;  5FKL A;  2Y9Y A;  3GTJ J;  3GTG J;  2D5V A;  2ECB A;  9ANT A;  1HF0 A;  2XGE A;  4JYK A;  3SJM A;  3IH4 A;  1K61 A;  5EEA A;  4A3G J;  4IHV A;  3CQZ J;  3M3Y J;  3SFI A;  3TED A;  1OCP A;  1XG1 A;  2LP0 A;  3HOY J;  1WGX A;  4C3I J;  3BR2 A;  4A93 J;  4M3B A;  4D5C A;  5M5X J;  3HM5 A;  3LNQ A;  3JRF A;  1U78 A;  1FEX A;  2DMQ A;  1MBH A;  1FTT A;  2Y0S N;  1JJ6 C;  3JRG A;  3Q3S A;  2DA2 A;  2ELK A;  5F0F A;  1W0U A;  4BY7 J;  4BBS J;  2JN6 A;  2H1K A;  5EG0 A;  1I3Q J;  2ME6 A;  2L7M P;  1OFC X;  2K40 A;  4DZP A;  3JRD A;  3BR0 A;  4LOC A;  3BR6 A;  1BW6 A;  2NVX J;  3BQZ A;  4D7N A; 
#chains in the Genus database with same CATH topology
 4XK4 A;  1PP8 F;  2TCT A;  3NEU A;  1WRJ A;  5EGO B;  2R93 J;  1X3W B;  1IW7 F;  3FKJ A;  4IRH A;  1IDY A;  3K4M A;  3K1M A;  2M30 A;  1Y0U A;  4HW0 A;  2DYS H;  2CFO A;  3OYD A;  1FBQ A;  4PJM A;  2LH9 A;  1SAX A;  3OR2 C;  4BU2 A;  3MKY B;  3IL2 A;  5KAF C;  2W48 A;  3LL7 A;  5FLM J;  3S1R J;  2O9L A;  1IV8 A;  1UHW A;  5H6Q A;  1OMI A;  1TWH J;  4HEA 2;  4PCQ A;  1S7A A;  1J0R A;  2L9V A;  1UG0 A;  2GLO A;  1KU3 A;  2Y2Z A;  1TT0 A;  4MEY F;  1Z7U A;  3WE3 A;  1NG7 A;  3L1P A;  4A6E A;  1TQI A;  2V9P A;  2E1M C;  3F23 A;  4GYI A;  4HA8 A;  1S5L C;  2DTZ A;  1E3P A;  2NS7 A;  4HG2 A;  3DKW A;  1ORK A;  4XR6 A;  1TW3 A;  2M7B A;  1EF4 A;  1EH8 A;  1VQK I;  4W97 A;  4H0E A;  4JBA A;  4OIN F;  1J09 A;  3OY9 A;  4RM3 A;  3O6B B;  3OR1 C;  3KYD B;  2VJ4 A;  2J5P A;  3K2A A;  3LA2 A;  5CJ9 A;  3LSH A;  3ZMT A;  3EQL F;  4OIO F;  4EJT A;  1D1C A;  4F55 A;  1RPW A;  2OCE A;  1F36 A;  3GFJ A;  1X2N A;  3RDI A;  3QOD A;  1S8N A;  5JVT A;  2VT2 A;  1VQM I;  3PM1 A;  2NAZ A;  2V6C A;  3HZJ A;  1UB9 A;  3WGG A;  2WAQ N;  4RA2 A;  4HDV A;  4YII A;  4PJJ A;  3DPL C;  3ABM H;  3Q9S A;  2R7X A;  3HRU A;  3LA3 A;  2O6G E;  2V1X A;  1ZG5 A;  1ENH A;  2QKM B;  1BI0 A;  1B1B A;  1EV7 A;  3BRO A;  1Z9C A;  3REO A;  1I39 A;  1WQ2 A;  3WG9 A;  3CDH A;  2F5D A;  4BL0 B;  4OAY A;  1FWZ A;  1Z05 A;  3CJR B;  3I0T A;  3TOB A;  3BC8 A;  4BHC A;  2DA3 A;  2X51 A;  1J75 A;  1ZG3 A;  2IT0 A;  3ABK H;  4IHX A;  3GTQ J;  4WCG A;  5HVQ C;  3H36 A;  1RUN A;  2BY0 A;  1K6Y A;  3HYI A;  3CC7 I;  2JA8 J;  1J5Y A;  3HOW J;  1U5T A;  2XGC A;  1NH3 A;  2HKX A;  5DUK A;  5B1A H;  4F91 B;  2ZJR F;  2MW8 A;  5BPI A;  2BGC A;  1YRN B;  4XN3 A;  4A12 A;  2FXA A;  1T0F C;  5GPA A;  4GO1 A;  3KYC B;  3VEP A;  5DEQ A;  4HNU A;  2NRA C;  1BI2 A;  3WGH A;  4HF1 A;  2ID3 A;  2PLY A;  3S32 A;  3K69 A;  2Y48 A;  1R1V A;  3VYR B;  1VQN I;  5J1U A;  2LY9 A;  2KP6 A;  3VYT B;  5J6X A;  2XPV A;  5DD4 A;  3CCV I;  2P4W A;  4PGG A;  3CCJ I;  1XGN A;  1IN6 A;  3HRS A;  3QYB A;  2O0Y A;  3H35 A;  1SD4 A;  3ZQL A;  2M2E A;  5C4J J;  4HF2 A;  2TRT A;  2QYO A;  3KCC A;  2MLK A;  3FBI B;  4C2U A;  4Y33 A;  3LAJ A;  4A3B J;  1W7P B;  2KDZ A;  1W1W E;  4KT5 C;  2YS9 A;  2FD5 A;  2JPC A;  1RUO A;  2DN0 A;  4XKB A;  4KN7 X;  3A01 B;  2HOT A;  3EUH A;  2M5W A;  1MMD A;  5EEH A;  3WTY C;  5E1W A;  1GXQ A;  3JW4 A;  4QPO A;  3OS1 A;  4M9Z A;  3CLQ A;  2RRE A;  2CQX A;  2X48 A;  4ESF A;  1JHH A;  2DFF A;  5ICE A;  3U9G A;  2PMH A;  2RKH A;  1AHD P;  3ONQ A;  3S14 J;  1S29 A;  2X6X A;  2XRO A;  2R92 J;  2EFQ A;  3KP2 A;  1IRF A;  3T8R A;  3ZQH A;  1D3Y A;  2DA4 A;  2K9N A;  3BPV A;  1LFB A;  3TP3 A;  3G2B A;  2QQA A;  3GZ6 A;  4ZDP A;  1ETV A;  2LR8 A;  1E0E A;  2A5W A;  3DKX A;  3FXU A;  2X85 A;  5J1R A;  1OCR H;  3ZMV A;  2M3A A;  2EV5 A;  1POG A;  5AON A;  5H2F C;  4A3E J;  2VBW A;  2DPU A;  3VFZ A;  2GOX B;  2W4S A;  3IC7 A;  2A61 A;  2FBH A;  4IL6 C;  1RIO H;  1H88 C;  3M1C A;  5J8C A;  5C3E J;  1BN5 A;  3A03 A;  3T1B A;  1MMA A;  1MH3 A;  5F1J A;  3S93 A;  1QHG A;  3HC7 A;  3COA C;  1MIJ A;  1TWF J;  4WXC A;  2XUB A;  3O8G A;  1KZH A;  3NAU A;  1X2M A;  4BDZ A;  3RQ4 A;  4ZH4 F;  3F21 A;  3SQN A;  5F64 A;  5L3D A;  1CF7 A;  1TLH B;  4HSR A;  1YLF A;  2XF7 A;  3ABU A;  2CWE A;  5CPR B;  2IBD A;  2CW0 F;  2KIS A;  4WF2 A;  4UY8 I;  2BVM A;  4YIF A;  3OWT A;  1SMY F;  3EYY A;  1IUY A;  2LYC A;  4YG2 F;  1JT6 A;  2WAE A;  1EKE A;  1RZ4 A;  3ZN0 A;  5JHU A;  1G3T A;  3OYJ A;  1B4A A;  3OOU A;  3TO9 A;  4PK4 A;  1PVE A;  4PJ0 C;  3BG3 A;  2UXN A;  1A5J A;  3OMY A;  2R0Q C;  1CQT A;  2LRD A;  2OBP A;  2WAF A;  4UVC A;  3IH3 A;  5A2Q Z;  4BJ5 C;  3WTT C;  2ZME B;  1JE8 A;  5FGM A;  2HDD A;  3TQN A;  4UUT A;  4ON0 A;  2WB1 A;  3PQK A;  1SC7 A;  1APL C;  1HW5 A;  1YS6 A;  2NYX A;  3TO6 A;  2YX7 A;  2GIZ A;  3K10 A;  4NC7 A;  4ZZL A;  2OTJ I;  1MND A;  3QOE A;  2YX4 A;  3F6V A;  1HST A;  1D0X A;  3EET A;  2ZXJ A;  1USS A;  1DPU A;  3GBG A;  3FM3 A;  3K1P A;  2L9R A;  2GIV A;  2MBF A;  4JX4 A;  2DMP A;  2ADU A;  2B0L A;  4XOP A;  1EH7 A;  5FO5 A;  2H6C A;  1JHF A;  1X1B A;  3KP7 A;  1IRG A;  2K5C A;  4ZYG A;  2ZFW A;  3E7L A;  5TJJ A;  3HRM A;  1X1P A;  4J00 A;  1E17 A;  1IZ1 A;  3R0J A;  1ZG1 A;  2F4I A;  4JQF A;  2PEX A;  3I59 B;  4AIH A;  2TDX A;  1FOW A;  3E6M A;  1T38 A;  5EZG A;  2EZL A;  4A3I J;  3ERM A;  4ZYA A;  5IYB J;  2JMW A;  3OSF A;  1KU2 A;  2DA1 A;  5CVR A;  1FIA A;  2KQR A;  2NNN A;  5E3O A;  2FBI A;  3CMY A;  5D5V B;  2UV1 A;  4V19 K;  2B9S A;  1E2X A;  4QIW N;  3Q9V A;  2LK2 A;  3ZXS A;  2A3S A;  4A5N A;  1HLV A;  1JKQ C;  2J5O A;  5CVJ A;  3ISP A;  3PNT A;  5FLX Z;  4XKC A;  1FPQ A;  2A68 F;  4UHT A;  4BE0 A;  4L9J A;  4XRS G;  3Q0V A;  2HTJ A;  5B3S H;  4EV0 A;  1XSX A;  2GQQ A;  5BMZ A;  3AG4 H;  3S1N J;  1GUU A;  2PJR A;  2PBI A;  1S9H A;  1NTC A;  2H94 A;  1EJ9 A;  1SAU A;  2NVT J;  1GLN A;  4W1U A;  1YIT I;  3DF8 A;  1H89 C;  3R6S A;  3OOP A;  2OTL I;  4HX8 A;  2NS8 A;  3M4O J;  1A6Q A;  4CCL A;  3TO7 A;  2R7U A;  5ICC A;  4N4O B;  5L3E A;  3ZQ7 A;  4G6Q A;  1O3S A;  1LVA A;  1PP7 U;  3SZP A;  3F8C A;  3AAF A;  2AS5 F;  2KRH A;  3JR9 A;  2I5U A;  2GXA A;  3E6C C;  2G7H A;  5M5W J;  5IPA A;  1T0F A;  4MHG A;  3CF2 A;  1OYW A;  1IN5 A;  1TP4 A;  1W5C C;  2FUG 2;  1XX5 A;  3GZN B;  3QPS A;  3A02 A;  3WTX C;  1UMQ A;  2WAQ A;  1HCR A;  2JA6 J;  2L01 A;  3HHG A;  3CME I;  1N25 A;  2DO7 A;  5GAH J;  4UB6 C;  5J3L A;  3MZH A;  3OIO A;  4RGS A;  2GA1 A;  2QF7 A;  4FET A;  1A36 A;  2EZH A;  1SMT A;  3W6V A;  4ZDO A;  4HNV A;  2PX9 A;  2RVC A;  2W25 A;  3L00 A;  1D8K A;  1Y39 A;  1BR4 A;  1Y0N A;  2EQR A;  2JZY A;  2CRG A;  4KYW A;  2EIN H;  3JRA A;  3FM5 A;  5HNF A;  2CV0 A;  2EV0 A;  5LGT A;  4KJZ A;  2XIG A;  2KL4 A;  4D5F A;  1U9N A;  2Z1D A;  4JP0 A;  2DA7 A;  2WWY A;  2IGN A;  3KZZ A;  4WWC A;  3FIS A;  2W84 A;  2E71 A;  2LVS A;  3DP7 A;  1IG7 A;  1ZRE A;  3L2R A;  2FU4 A;  1FP1 D;  2VI6 A;  1Z3Y A;  2DXI A;  1T33 A;  1O3Q A;  3IWF A;  4UUS B;  2IGM A;  3JSP A;  3M8F A;  4KIG A;  3RKY A;  4B47 A;  2VPL A;  5DD8 A;  2JA7 J;  4MO7 A;  1MKM A;  4I7H A;  5F27 A;  2HR3 A;  2P7C B;  2E1M B;  2F5E A;  1V5G A;  4D7M A;  4D7N A;  4EGY A;  3PFY A;  1P92 A;  4UXN A;  5DCM A;  4RAY A;  2Y0M A;  4NBQ A;  4X6A J;  2MC3 A;  4RM2 A;  4LG3 A;  1YJ9 I;  4XLH A;  3QPH A;  5LD2 C;  4XNF A;  1E3H A;  1AOY A;  4D9J A;  5FD6 A;  1I6H J;  3KP5 A;  2E34 A;  3GTJ J;  3GTG J;  2DFI A;  1R5H A;  3X2Q H;  1YTY A;  3ZQQ A;  2XGE A;  3GX4 X;  1Z21 A;  3IH4 A;  5EEA A;  2RQP A;  3ZPL A;  4IHV A;  3MAJ A;  4AU7 A;  2M4G A;  3DTE A;  2X6W A;  2E1N A;  1MMS A;  4XKV A;  1ULY A;  2VT3 A;  4ESB A;  4RAG A;  4M3B A;  3AL0 C;  4A93 J;  2LOO A;  4NQW B;  3JRF A;  1B59 A;  1XSD A;  2JVH A;  4RB0 A;  1QHH D;  2MLG A;  4E7L A;  3ECH A;  1QQI A;  4I98 B;  1O3R A;  1FEX A;  1SVM A;  2L4A A;  1BOA A;  3DEU A;  4DQ2 A;  3A0B C;  1MZB A;  2PQ8 A;  3JTG A;  4CGZ A;  3Q3S A;  3CF5 F;  1XMX A;  2W00 A;  1VQP I;  5FRN A;  3DLA A;  1BJA A;  1EH6 A;  4E7H A;  2H1K A;  4AIJ A;  2ME6 A;  4BEH B;  4CYD A;  5LHG A;  3BR0 A;  3CCE I;  4LOC A;  1BW6 A;  2O03 A;  2NVX J;  3BQZ A;  4O6J A;  5DYM A;  5L3B A;  3BG6 A;  3JAM Z;  1R22 A;  3P5J A;  4P9F A;  4EM1 A;  1XS9 A;  3HSF A;  1I50 J;  4R1H A;  3HGY A;  2K85 A;  4LG0 B;  5GP9 A;  3W2W A;  4R79 A;  3JRI A;  3JRE A;  2LSO A;  3LFK A;  1BJZ A;  3WTV C;  1Z67 A;  2ICW G;  4AUX A;  1HC8 A;  2XKP A;  3O2P E;  1K79 A;  1OLT A;  2HYF A;  2DT7 B;  3K4B A;  1VF9 A;  5LLQ A;  1Q1H A;  1U2W A;  5F0H A;  2XPW A;  2MD0 A;  4G8X A;  2Q0O A;  1QZY A;  1Z6R A;  3QU6 A;  5CVV A;  4DNC A;  4E7Z A;  3U21 A;  5IP9 J;  1D5Y A;  2GWR A;  2LRE A;  1ZRC A;  3GTM J;  2FA5 A;  1V54 H;  2ESN A;  1WJD A;  1YIO A;  2R7W A;  2WTE A;  1LKX A;  1VQ6 I;  1IDZ A;  4EJV A;  4F92 B;  2R3S A;  4RLQ A;  2VKE A;  4AWX B;  3K2Z A;  1BC7 C;  1HSJ A;  4XSX F;  1WI9 A;  2XGD A;  2XDV A;  3EUK L;  4U87 A;  3JRH A;  1QO0 D;  5E3L A;  3KET A;  2XPU A;  2K3P A;  2F5V A;  4ENN A;  4EEF G;  3F72 A;  2ELH A;  3RYP A;  3EUH C;  1N75 A;  4H4K C;  1DQU A;  2FOW A;  2DJN A;  1V4R A;  2VL8 A;  3OYN A;  2DOE A;  4I09 A;  2BE5 F;  5IP6 A;  3LSM A;  4HBL A;  3ZOB A;  2ZC2 A;  3DBR B;  1W36 D;  1YQA A;  4GYG A;  3D1N I;  4B4C A;  1DU0 A;  1DP7 P;  4GFB A;  3UKG A;  3HEF A;  1LDD A;  2BY2 A;  3BR1 A;  2A6T A;  2W7N A;  4Q48 A;  3BJA A;  1R5G A;  5ILS A;  1XTA A;  2JA2 A;  3FXL A;  5D5X B;  2OD5 A;  1G6N A;  5DTD A;  3E1S A;  1I6X A;  3S3M A;  1WCM J;  4F3Q A;  3ZMS A;  5J4V A;  3S16 J;  1JTX A;  3J7A O;  2HZD A;  3DEW A;  4XRF A;  2YR2 A;  3EYI A;  2QBY B;  2L5Q A;  1O57 A;  1GVJ A;  3RPU A;  3G1O A;  4ZYE A;  4XMY A;  4LD5 A;  2LC2 A;  1Y6I A;  2N8G A;  1XGM A;  2DCE A;  3MD2 A;  2L0K A;  4AVP A;  4KIT B;  3RPQ A;  1G3Y A;  3KYL A;  1XSV A;  3LSG A;  3CUQ A;  2M87 A;  5BQT A;  2JWT A;  4A3C J;  2V9K A;  3L2Q A;  1H9T A;  2H8R A;  2PI0 A;  1LJ9 A;  4CZZ A;  1V3F A;  1DUX C;  3CP2 A;  5K5Q A;  4MTE A;  3E6B A;  4BDY A;  3RIR A;  3S2D J;  4XLN F;  3HHH A;  2XF5 A;  3L2V A;  2Z99 A;  1W0T A;  4BE1 A;  3OYF A;  1C0W A;  2CQQ A;  1W36 C;  1A31 A;  3GW2 A;  4NB5 A;  2FBK A;  2X6O A;  1P6R A;  3KZY A;  3WTZ A;  4B3A A;  5IT3 A;  1BW5 A;  4UB8 C;  2CW7 A;  2WAD A;  4IQ4 A;  2R7Q A;  2K3F A;  2DFE A;  2QSH X;  2R7S A;  1R71 A;  3V7C A;  4GGG A;  3SXY A;  3E5U A;  1U8B A;  4II2 A;  5B5E C;  3GVA A;  2STT A;  1MBK A;  3PSI A;  3RYR A;  2R4G A;  1P7J A;  2KJB A;  5K1Y A;  4XM3 A;  1WJ5 A;  3BP8 A;  4N4N B;  2EB7 A;  5HDG A;  4CCK A;  3S17 J;  1X58 A;  3PUF A;  3S8P A;  3G73 A;  1V5F A;  4L0Z B;  4A3J J;  4CZC A;  4NC8 A;  3QP6 A;  3LA7 A;  2R5Y B;  4HQM A;  2ISZ A;  3QQA A;  2OC6 A;  4NUB A;  4HF0 A;  3HIF A;  2GZW A;  1NK3 P;  2O61 A;  3FK6 A;  1DGW Y;  1JUP A;  4RS8 A;  3ZRG A;  2VE9 A;  1T8I A;  3BG7 A;  3FIW A;  4UV8 A;  4E70 A;  2FEZ A;  1YW9 A;  5DDG A;  1EA3 A;  4G7O F;  2QSF X;  3IWZ A;  1X1D A;  5K7Z A;  2P81 A;  4Y17 A;  2OAZ A;  2ZXW H;  3PSF A;  1LE8 A;  2KFD A;  2OZ6 A;  2BY3 A;  3KE2 A;  2GAU A;  4E4H A;  1T6S A;  3BG9 A;  2FNP A;  5L3F A;  2W57 A;  2D2W A;  3QPL A;  1H8A C;  1B72 A;  3C7J A;  4ZDL A;  4ENM A;  3J7Z I;  2JK3 A;  3SEZ A;  4MGR A;  1STZ A;  2AQE A;  2P7V B;  1JKO C;  4HPQ A;  2UZK A;  1DDN A;  2HKO A;  5DM6 F;  4ASN A;  2DK5 A;  1HKS A;  3F0C A;  4IOC F;  3DTK A;  1PUF B;  2EZI A;  2PG4 A;  4YFN F;  4V2F A;  3L2U A;  2DA5 A;  1S7E A;  4LMY A;  4ABZ A;  3P9C A;  4U0Y A;  4CUG A;  1J9I A;  2H1L A;  5A2Q K;  2Z33 A;  5F6F A;  2HYJ A;  2IGO A;  1Y8R B;  2KHM A;  4L5E A;  1MNM C;  2Q2E B;  1U6G A;  2BVL A;  2LY2 A;  1T39 A;  1P4W A;  3HUG A;  4A0Z A;  1LEA A;  2K02 A;  2EFP A;  1IC8 A;  1P4A A;  5AIP A;  2COB A;  1WZ2 A;  3U2R A;  3DCF A;  2Y30 A;  5KNL A;  1QPI A;  1MMN A;  5J1Y A;  5E1X A;  5DCF A;  4EAT A;  1ZGJ A;  3E0J B;  4IRG A;  4G12 A;  5HS7 A;  4G7Z F;  3LSP A;  4RAZ A;  2VC1 A;  4I6Z A;  3VYU B;  3WGI A;  5TGT A;  3OL3 A;  1YJW I;  3B6C A;  3ZMD A;  2QZ8 A;  2A05 A;  2E19 A;  1WWX A;  3MZ8 A;  5FKN A;  1ZLK A;  1R00 A;  3HGG A;  5AIQ A;  1D0Z A;  2KRF A;  4B48 A;  2DQL A;  4FCY A;  4BKX A;  3HOZ J;  1IRZ A;  2PMZ N;  4GRI A;  2CMP A;  5CQE A;  3G71 I;  3ZMZ A;  3M7G A;  1WJC A;  1SEU A;  4XRM A;  4HQE A;  3S1M J;  4A3L J;  1P7I A;  2X9D A;  2DDA A;  3VOD A;  4OIR F;  5JFR A;  4YFX F;  1VI0 A;  6PAX A;  1U0J A;  1S72 I;  4BS9 A;  3HOX J;  2M4K A;  2Y9Z A;  3I55 I;  1X4O A;  2EPF A;  4AYB N;  3OYL A;  3E5Q A;  5TIS C;  3ESW B;  1YW8 A;  3I5U A;  1ZTR A;  5FLX K;  1RR8 C;  1RNL A;  3DPT A;  1BR1 A;  4OAZ A;  4A69 C;  2VQH A;  4M72 A;  2CH0 A;  5FKO A;  5ICF A;  4CYC A;  2EFW A;  3FXR A;  4ZC3 A;  5BPD A;  2HPM A;  1FYK A;  4G94 A;  1FT9 A;  2MYS A;  1D1A A;  3EDP A;  2UUZ A;  2L9N A;  1JT0 A;  3BLY A;  5C44 J;  4L9T A;  5GPC A;  3VPR A;  1RET A;  2HU9 A;  1NG6 A;  3IKV A;  1BOB A;  4BQA A;  1XPX A;  1R9T J;  4M74 A;  1Z77 A;  3F9K A;  3G1L A;  5D5U B;  2H27 A;  2PJP A;  4HX7 A;  2AQF A;  5IY5 H;  2JPB A;  1MJA A;  3J81 K;  4RGX A;  4R8H A;  1AU7 A;  2K4J A;  3I4P A;  2DBB A;  1F4K A;  3AL0 B;  2VQC A;  2R7V A;  1A04 A;  4BQQ A;  4K2E A;  3M07 A;  1JGS A;  5FJ8 J;  1TTY A;  3GTK J;  2OV7 A;  4MQV A;  3IP4 B;  4Y15 A;  5HDN A;  4IHY A;  2DOA A;  5FD5 A;  2JTV A;  1YS7 A;  5IT9 K;  1YI2 I;  4IHS A;  1ODD A;  3GTP J;  4Q4Z F;  3GTO J;  3AFH A;  1VZ0 A;  2EFN A;  4JX6 A;  4KA4 A;  3GTL J;  3JSO A;  3K7A J;  3SHF A;  1ACI A;  3GZ5 A;  1Z6T A;  2VJJ A;  3BPX A;  2MAB A;  1U5T B;  3HKZ N;  4HST A;  5ILU A;  2KDO A;  3KP3 A;  1FC3 A;  2AHQ A;  2Y69 H;  2NVQ J;  2NOG A;  4EM0 B;  2V1U A;  5FB2 A;  3IRQ A;  2QA4 I;  4C3J J;  1HQC A;  1BR2 A;  1X1C A;  2YPR A;  3HBL A;  4NNJ A;  3FXJ A;  4RAF A;  3L09 A;  4F7Z A;  2E1C A;  2EBI A;  4YIR X;  3CZ6 A;  1T2K A;  4CHU A;  4I2O A;  1ETQ A;  4BNC A;  1RKW A;  3OYG A;  2YUS A;  1SAN A;  2XGX A;  3NRV A;  4A6D A;  1T08 B;  4BAC A;  4M6V A;  2QEN A;  2KIM A;  3FXO A;  4C9Y A;  2XC7 A;  1SFO J;  2R7Z J;  4I0B A;  1CGP A;  2YU9 J;  2RNJ A;  4C3H J;  4S0H B;  4KUM A;  1KGS A;  1ETW A;  2GXG A;  3A0H C;  5D8K B;  4QTR A;  1AKH A;  4YEL A;  1MSE C;  1K4S A;  3I71 A;  5FKL A;  3BCB A;  4EGZ A;  2Z2S B;  3RPU D;  4BAY A;  9ANT A;  1D0Y A;  2AXT C;  1ZN2 A;  3OYC A;  3SJM A;  4Z6Y A;  2XF6 A;  4DGW B;  3G4S I;  1XN7 A;  1AWC A;  2LP0 A;  4FT8 A;  2XAQ A;  2EV6 A;  5LRR A;  1WGX A;  2LBF A;  2IRF G;  3UR3 C;  3NWS A;  1IAW A;  3I53 A;  1P4X A;  4QPQ A;  3KEQ A;  4XKW A;  3D0S A;  4I01 A;  3W2V A;  1TBX A;  2WA0 A;  2A6H F;  3SDB A;  1MBH A;  2X1D A;  1P9Q C;  1R58 A;  2Y0S N;  3DBH B;  3JRG A;  3K6G A;  3W6J B;  3H0D A;  3MZY A;  4BY7 J;  2JN6 A;  5EG0 A;  5LGN A;  2ISY A;  2P5L C;  2HVR A;  4IQJ A;  1SD7 A;  5LRS A;  5E18 F;  1UAA A;  1YG2 A;  3HJE A;  4DOZ A;  3H9Q A;  3BR6 A;  5GAD J;  5E79 C;  5HOO A;  1FY7 A;  3JAM K;  4O3M A;  1WFX A;  1MH4 A;  1TWC J;  4X1E A;  2A07 F;  4M3G A;  5JR3 A;  1K4T A;  3GXO A;  2LKX A;  2RC4 A;  3BR5 A;  1R23 A;  2FJ1 A;  3KLO A;  1QZZ A;  4HDU A;  1MDM A;  4MIM A;  2E2H J;  2ZBK A;  4GCV A;  1FBU A;  3KIO A;  2DK8 A;  1JTY A;  4GXO A;  4B09 A;  2HWV A;  1DP3 A;  2M0M A;  2NOJ B;  4JX5 A;  4FE4 A;  1YX5 A;  4FAS D;  3P9I A;  3U1K A;  2F48 A;  4XRS A;  1VQO I;  1T56 A;  1CF7 B;  1MGT A;  4I99 C;  2IEK A;  5DM7 F;  3G1M A;  2WC2 A;  1FYM A;  2MD5 A;  2R5Z A;  1W7P D;  1UEL B;  1NK2 P;  1LNW A;  3KLN A;  4Z2Y A;  1KU7 A;  4KMU X;  2M45 A;  2XSJ C;  3DBL B;  3ERE D;  4YFK F;  1Y8Q B;  3CUQ C;  3DKY A;  3CCM I;  1WVR A;  3FWE A;  5HS8 A;  4RB2 C;  4KIS A;  3LAP A;  1QA6 A;  1KYZ A;  3J7Y J;  3MCZ A;  3QOP A;  4HYE A;  4M9S A;  2EIJ H;  2V1N A;  4FX0 A;  4BGD A;  3RKQ A;  4XN0 A;  2RQQ A;  3ROU A;  2H6B A;  4EJO A;  3QYE A;  2X4H A;  1T98 A;  3TL4 X;  3VSK A;  4U7B A;  4P96 A;  2M9H A;  1L0O C;  3BZK A;  3JRC A;  2G9W A;  4TV7 A;  1OR7 A;  2NVY J;  1WH7 A;  3JRB A;  1TT5 B;  4B8X A;  4ETS A;  3CDL A;  2V6E A;  3PIP F;  1SFK A;  2L7K A;  3IAM 2;  4MFD A;  1O7F A;  2JUG A;  1OCZ H;  2M0C A;  3HOU J;  3QWL A;  1VQ7 I;  4I02 A;  3SYT A;  2JRT A;  4U88 A;  2STW A;  1VQ8 I;  2E5Z A;  4KDP A;  2ELJ A;  1OYY A;  2Y75 A;  1IN4 A;  3R4K A;  2MA3 A;  3V7S A;  1YJN I;  2CS3 A;  3RSN A;  2JT1 A;  1NHA A;  1LDJ A;  2LKS A;  4FIS A;  4XBF A;  4BH9 A;  1DGR M;  3H0G J;  2D1H A;  5J40 A;  4ZJZ A;  2IA1 A;  3V8L A;  3PJR A;  1TQP A;  1IGN A;  4A3D J;  5KK1 A;  3D5L A;  3T8T A;  3GFI A;  1BBY A;  2V4J C;  2FRH A;  3A2K A;  3LSK A;  1JKP C;  1IXR C;  2WY8 Q;  5KCM A;  3CCL I;  3FXQ A;  1FBS A;  4Q5S F;  1XC5 A;  5LHI A;  3CD6 I;  1RR7 A;  5CVI A;  1UZC A;  5H6R A;  2IA0 A;  3J80 Z;  5GTI C;  3N97 A;  1F1Z A;  4KIF A;  4FTH A;  5TRD A;  3DEE A;  4Y7N J;  3AKZ A;  1ZHF A;  3PFI A;  1VND A;  2EJR A;  2IW5 A;  4M6X A;  1I3A A;  1X3Z B;  4IEJ A;  3K70 D;  4QLC U;  2VXZ A;  3C1D A;  3K1N A;  3IHU A;  3VOE A;  5ICG A;  3K4J A;  1GHC A;  4IJA A;  4LK0 F;  2DI3 A;  5E1Z B;  3S2W A;  3CCR I;  2FML A;  4A3M J;  3UNG C;  1D5V A;  2VLA A;  2PJR B;  3C2H A;  3FF5 A;  2L54 A;  1YYV A;  3FMR A;  2IS2 A;  2A5Y B;  1U9O A;  2DLL A;  4L5I A;  2A69 F;  1Q1V A;  2VPR A;  3BG5 A;  1JXS A;  1ZEL A;  2ZSH B;  4BUP A;  1GDT A;  1K7A A;  4AD9 A;  4IHW A;  1LUJ B;  4NHJ A;  2IJL A;  3RCO A;  4G6D A;  4MLO A;  2XVC A;  5JI6 A;  1X4P A;  3C18 A;  2VON A;  1ZK8 A;  4M71 A;  5B1B H;  1R4N B;  3WTW C;  2QM3 A;  4IRI A;  3WU2 C;  1R49 A;  2L3D A;  2M7A A;  4P9U A;  3VWB A;  4WXD A;  4B1R A;  5FFX A;  2XRL A;  2VQL A;  2QGU A;  3VB2 A;  4CIC A;  5CKT A;  3I58 A;  1M1E B;  2QUF A;  2VOO A;  1HW2 A;  4CH7 A;  4A3K J;  2FQ3 A;  2GM4 A;  2G7U A;  1ETK A;  3W6K B;  1LDK B;  1UHS A;  2HDW A;  1LFP A;  2FF4 A;  5EF6 A;  4HAM A;  2QVO A;  5HNH A;  3GYH X;  1OQY A;  1ZR4 A;  5JVG F;  3K9T A;  3QPT A;  3K70 C;  1SFX A;  4UNO A;  2VBX A;  3BQY A;  4L9N A;  3WE2 A;  1HW1 A;  1TWA J;  1K78 A;  3CJN A;  2HQA A;  4ZTJ A;  5EGO A;  2ZO4 A;  4NC6 A;  4C30 A;  2CYY A;  4PZJ A;  4U0V A;  2DU9 A;  4FQG A;  1PJR A;  3RTR A;  2F6C A;  3VDX A;  3ZCO A;  3PQJ A;  4HOB A;  2Y31 A;  2MC4 A;  3OIQ A;  2JSC A;  1J2X A;  5D5W B;  5FLV A;  2HOA A;  3MVP A;  1IXS B;  4PUS A;  1DPR A;  3N05 A;  1Z3X A;  2XAU A;  4QSH A;  1R6R A;  1IN8 A;  1ZAO A;  5D6E A;  3DU6 A;  1XMA A;  2GOM A;  4M9X A;  3VYS B;  1QPM A;  1UHM A;  3CCQ I;  1ZAR A;  4J01 A;  3BWG A;  2YU3 A;  3FXK A;  1ZH5 A;  2CUE A;  3FHN A;  3CDI A;  4FHT A;  2WV0 A;  1K83 J;  1ZRD A;  3SZG A;  2DDB A;  1JGG A;  5D8L B;  1F43 A;  4HRI A;  5E3M A;  1WKM A;  5DCM B;  1IUF A;  2LMD A;  5L3C A;  1BL0 A;  2OQR A;  1QVU A;  3I56 I;  3I3L A;  3F8N A;  4L0Y B;  3F8F A;  3M8E A;  1XCB A;  2CJJ A;  2CSO A;  3RQI A;  4PFO A;  1B9N A;  1ZYR F;  2JQ7 A;  2FX0 A;  3MKW B;  4EM2 A;  3S3N A;  5K5R A;  3CC4 I;  3ZGK A;  1I1G A;  1G4D A;  4XOR A;  5IYC J;  1HOM A;  2IS4 A;  1Z7L A;  2Z3Y A;  5LEK A;  4AC0 A;  1R36 A;  1FMV A;  3S1Q J;  2JUC A;  4IZZ A;  3CMM A;  3H9G A;  4DYC A;  4ZZD A;  2QCO A;  5LEJ A;  2QLZ A;  4EMS A;  3ZQC A;  2R7T A;  4HV5 A;  1UST A;  5LHH A;  4P5O A;  1IV6 A;  1MBF A;  1Y56 A;  3G3Z A;  5LFA A;  1IO2 A;  3PIO F;  1W5S A;  1ITY A;  2DT6 A;  4UUV A;  2KKO A;  3CLO A;  4WXH A;  1SFU A;  2BOL A;  4IX7 A;  1ZRF A;  2DW4 A;  2O8X A;  2RAE A;  3IKT A;  1VQ4 I;  4KIB A;  4F52 A;  3ABL H;  4OMY A;  2QQ8 A;  3F22 A;  1WHU A;  1WJF A;  5K7F A;  3BZC A;  4LLG F;  4B3X A;  1TW2 A;  3ZQI A;  1YW7 A;  2WB1 N;  2NS0 A;  3GLX A;  1SVL A;  3FDY A;  3NWT A;  2W1O A;  1R1U A;  1YRN A;  4XOT A;  3KFW X;  2Z16 A;  2KIQ A;  4RGR A;  3FMQ A;  2H8W A;  2CUZ A;  2IAI A;  4LLL A;  3GO5 A;  1WSU A;  2V7F A;  3D5S C;  3QU3 A;  1LPQ A;  2DMU A;  4CSW A;  2DQR A;  1G8X A;  3IRR A;  1YO5 C;  4XID A;  2HDC A;  3E97 A;  4XON A;  5E8G A;  3FZV A;  4ENJ A;  1JKR C;  4MNU A;  3HOT A;  4E7I A;  5HOD A;  3CCY A;  3M8J A;  1XB4 A;  4L9V A;  4F93 B;  4CO8 A;  5BS6 A;  2OJE D;  2V1D A;  3OYA A;  2HQR A;  3CCU I;  2XAG A;  4BY1 J;  2XHK A;  4N9H A;  1W7P A;  4OIQ F;  1JUM A;  1O7L A;  1IRX A;  3OIP A;  3K4K A;  1UJ8 A;  4C2M J;  1FTZ A;  4LLN A;  5IOZ A;  4J19 A;  2ME0 A;  4IVN A;  5CVU A;  2E1O A;  1MJ9 A;  5HLT A;  5J4Y A;  2P6S A;  3A01 A;  4M6Y A;  2E36 A;  2FOK A;  1BI3 A;  3A4C A;  2MSY A;  4GDF A;  4KNY A;  5J47 A;  1F9N A;  4A2U A;  2ZJ2 A;  4I0A A;  2L7Z A;  2E7W A;  2CGP A;  4LB6 B;  5M3F J;  3GCM A;  2KRC A;  1A6I A;  3PO2 J;  3CMA I;  3ZQG A;  4CA0 A;  2VKD A;  5BOX A;  4ITV A;  2XSD C;  2X6Y A;  1H9G A;  4EQQ A;  2CQK A;  1FX7 A;  4LJZ F;  2BZT A;  4PFP A;  2G0E A;  5F08 A;  2OPT A;  4RLF A;  1OCO H;  4DYQ A;  1JI8 A;  2KPM A;  2ECC A;  2HVQ A;  1QBJ A;  4L18 B;  1JUS A;  1QZE A;  1MMG A;  4IO9 F;  3CP8 A;  3BDD A;  3K0L A;  5FKK A;  2BHY A;  5EDN A;  3ZP5 A;  2LKP A;  1FP2 A;  4BHP A;  2LFB A;  1REP C;  3WU0 A;  2LG4 A;  5DS9 A;  4A3F J;  3LWF A;  1K6O A;  2L02 A;  2R7D A;  2QSG X;  2EFO A;  1E3O C;  1J7K A;  2RGV A;  4I76 A;  3L9F A;  3ELK A;  2K9Q A;  2XB0 X;  4II3 A;  4A0Y A;  2ZNZ A;  1HBX G;  1ETX A;  4DZJ A;  2M8G X;  2OCC H;  3CCS I;  3WHC A;  5E17 F;  5DV5 A;  4PDK A;  4AID A;  2VOP A;  3OL4 A;  2O7O A;  4FX4 A;  2H09 A;  2L2O A;  2ZFU A;  3HTU A;  1YX3 A;  2MG4 A;  3GUD A;  3CUQ B;  1G3S A;  3ZMU A;  3CO6 C;  1LB2 A;  5E8I A;  2VOD A;  3HDD A;  1FOK A;  2EIK H;  2Z5U A;  1ZKG A;  2IVM A;  1IF1 A;  1H0M A;  1G59 A;  2R7F A;  1ERD A;  3FXM A;  2X1C A;  2E7X A;  3RKW A;  2HOS A;  5FRM A;  3DXJ F;  3L2C A;  1IXC A;  4KT6 A;  4RDU A;  3V42 A;  1BIB A;  4KIC A;  2HPI A;  4AIK A;  2ZME A;  5FKM A;  3BCA A;  2HVS A;  2HEO A;  2HXI A;  1WJA A;  2K27 A;  5HLI A;  2D5V A;  2K86 A;  2M8E A;  1HF0 A;  1KA8 A;  2CG4 A;  4KFC A;  4OOI A;  5HS9 A;  4BYY A;  4ANJ A;  2HYG D;  3CQZ J;  2HZT A;  3FHZ A;  1OR7 C;  3SFI A;  3TED A;  1ON2 A;  1XG1 A;  3FMS A;  3HOY J;  1R1T A;  3ZR8 X;  1PYV A;  2BXY A;  5M5X J;  4LB5 A;  2X0L A;  2ZSI B;  3HM5 A;  4C2T A;  3ABT A;  4BQO A;  1KQ8 A;  1ZGA A;  2KMU A;  3L7W A;  1N77 A;  2DMQ A;  1SVO A;  4BHB A;  1FTT A;  1JJ6 C;  2ESH A;  5EJC A;  4BJT A;  2DA2 A;  3JCU C;  1W0U A;  1D8J A;  3DV8 A;  3C3W A;  2DPD A;  2QWW A;  3ULQ B;  3I59 A;  1IN7 A;  1OFC X;  1TNT A;  2K40 A;  3H5N A;  4DZP A;  3JRD A;  1MD0 A;  2VKH A;  3ZN1 A;  4HNT A;  4AM3 A;  4LK1 F;  2ZXH A;  4UVB A;  4LFU A;  2QQB A;  1Z0X A;  2HNH A;  4WX9 A;  3F8B A;  4L5J A;  1UCR A;  2EIM H;  2PFB A;  1FZP B;  3LQR A;  4ESJ A;  4P1W A;  4QWQ A;  1LEB A;  3K4L A;  5DUI A;  1B6A A;  4P55 A;  2LTP A;  1LE8 B;  2UXX A;  1WJB A;  2CUF A;  2HGC A;  4M73 A;  1ZGW A;  4HLX A;  4D0P A;  1O4X A;  2M34 A;  4X0G A;  3V8K A;  2DYR H;  1VQ5 I;  4RB3 C;  3Q0U A;  1B72 B;  3TOA A;  4B44 A;  3BTJ A;  2NNY A;  1MW7 A;  5M5Y J;  3D5R C;  1N78 A;  1GVD A;  2L7F P;  4B43 A;  1ETO A;  1TZL A;  2FQ4 A;  2RNG A;  3OS0 A;  3B02 A;  3HOS A;  4IHT A;  4XLF A;  2HTS A;  2NXN B;  2CQ7 A;  3NAR A;  2IS1 A;  2KT0 A;  1ONV A;  2ZNY A;  2VBZ A;  4HLY A;  1KU9 A;  4DBR A;  4Y3O A;  4XSZ F;  3S2H J;  3EUA A;  3P7N A;  1WI3 A;  3A1Y A;  1FOX A;  2VB6 A;  2I10 A;  3TP0 A;  3PO3 J;  1BA5 A;  4Y52 J;  3HUG B;  1ZQ3 P;  2ID6 A;  2XRN A;  2YSR A;  2F5F A;  1R4M B;  3OV8 A;  3FX3 A;  2PMU A;  1MNE A;  2ZXI A;  2M1B A;  3R0A A;  2COM A;  3H3U A;  2LF8 A;  4OIP F;  5ERI A;  2JJ7 A;  2VUM J;  4BJ6 C;  5CQG A;  3R60 A;  1BC8 C;  4IKF A;  3L2W A;  1YIJ I;  3HG9 A;  2FMY A;  2OQG A;  4IPA A;  3IUO A;  3TGN A;  5IOY A;  4YRV A;  2LDU A;  2E2I J;  4BXU A;  4M3F A;  1OIS A;  4XLA A;  2GXB A;  3E3V A;  1Y1V J;  2CW8 A;  2RV8 A;  4IOA F;  3PNY A;  2Z9O A;  2OU2 A;  1O3T A;  2K4B A;  1FSE A;  2WBM A;  1XMK A;  3I4M J;  2ETH A;  3HSE A;  3MKZ A;  2KZG A;  3HB9 A;  4EJW A;  3WTU C;  4BQN A;  1OCC H;  3DQV C;  3BT9 A;  3RI4 A;  1OYI A;  3K4C A;  3I4N J;  2BEO A;  1FYL A;  1ON1 A;  3S15 J;  2JRM A;  3J80 K;  1X19 A;  2BV6 A;  4UUS A;  5EZH A;  3TDZ C;  2JA5 J;  4RBO A;  2PN6 A;  5E20 A;  2BBY A;  5KAI C;  3WG7 H;  1OCT C;  4S04 A;  2D45 A;  3LOC A;  1YE9 A;  3MKL A;  5JLX A;  4CYC B;  4PGH A;  2IXS A;  2UWM A;  5ED4 A;  2O3F A;  1WPK A;  1PDN C;  1B9M A;  3H3V K;  3OYH A;  2VN2 A;  3BJO A;  3E6D A;  5LBQ A;  2O8K A;  2QEX I;  3O8H A;  2IS6 A;  2KIF A;  1T95 A;  1V55 H;  3LST A;  1ZLJ A;  5IYD J;  3FBN B;  2XB5 A;  4RB1 A;  1FMW A;  3IH2 A;  1LFU P;  1JJ8 C;  2F2E A;  4E7S A;  3N4M A;  3BY6 A;  1WH5 A;  3WU1 B;  3LMM A;  2DA6 A;  1KQ0 A;  4HX4 A;  3OYK A;  1SFE A;  2DJI A;  3I54 A;  2MH9 A;  2ZCW A;  5E3N A;  4NDL A;  4XL9 A;  3H5R A;  1S6L A;  5F1R A;  1QNT A;  2CQN A;  2F5C A;  2K9L A;  3JTH A;  4BXX J;  2VJI A;  1QU3 A;  2OZU A;  3FK7 A;  3NQO A;  4NQW A;  1B8I A;  1MSF C;  3O3K A;  3ML6 A;  4N9I A;  1D1B A;  4N0B A;  4HV6 A;  1KYW A;  3BZ6 A;  2P5V A;  2HI3 A;  3AG2 H;  3K4N A;  2K9M A;  4DIQ A;  2BYV E;  4DBQ A;  5L3G A;  1R7J A;  5M3M J;  5GTH C;  2L9S A;  2DAO A;  2FSW A;  2GA2 A;  2HQ5 A;  4KMF A;  4BEH A;  2P6T A;  5CLS A;  3H3Z A;  2FE3 A;  5FRO A;  3ASO H;  3ZQF A;  3KPH A;  2E35 A;  3KZI C;  1W4M A;  2ACJ A;  3HSR A;  1FOY A;  4PJL A;  3LFU A;  4XLP F;  2QKL B;  3MWM A;  4V2G A;  4LG0 A;  3T5X A;  2D1V A;  3J81 Z;  2JVG A;  4A5M A;  1HDD C;  5F0C A;  3SDG A;  3GFM A;  4UV9 A;  3P9K A;  3LSJ A;  2VC0 A;  3G6E I;  1MBG A;  3CJT B;  2WY7 Q;  4A0X A;  4RMN A;  4DW6 A;  3DLL F;  2WV1 A;  2EIL H;  2HQN A;  3AG3 H;  2W85 A;  3BR3 A;  3H5A A;  3DFG A;  4ZYH A;  3OYB A;  2E60 A;  1VTN C;  4U0W A;  1RRJ A;  2ZKZ A;  2F4M B;  3KP6 A;  5IT9 Z;  1LQ1 A;  2VXD A;  3PUB A;  5J8F A;  5D4S A;  2LNB A;  1MBE A;  4G9Y A;  3CO7 C;  2VQG A;  3BJ6 A;  2E5N A;  4RGU A;  1U8R A;  3WTS C;  1Y1W J;  2GBY A;  3B6A A;  1J59 A;  3F6O A;  1G2H A;  2PMZ A;  3HXL A;  2BW3 A;  2VJ5 A;  3DU5 A;  3SZT A;  1BIA A;  1P2F A;  2KIU A;  3U1D A;  2CU7 A;  4CCO A;  5HDK A;  1AKH B;  2XAS A;  2Q8K A;  4XLC A;  2IA2 A;  2DOD A;  2O5R A;  4AVZ A;  4S05 A;  2IP2 A;  4EVI A;  1MJB A;  5K5O A;  2IGK A;  1A35 A;  5C4X J;  3CTA A;  3KX2 A;  1FSH A;  1AA7 A;  4AYB A;  4LIV A;  4UVA A;  1GV2 A;  4CXF A;  4LIU A;  1GT0 C;  3MEX A;  1TQM A;  1IJW C;  2OF7 A;  2V26 A;  2LBF B;  1RKT A;  1WJE A;  2RDP A;  4M3D A;  4BBR J;  3OYM A;  5BNG A;  1W5T A;  1VQL I;  2MH2 A;  3VSL A;  2R7R A;  5EYR A;  2BY1 A;  2F4O B;  3QAH A;  2MFZ A;  2HFH A;  4IXA A;  1OPC A;  3H92 A;  5HLH A;  2E2J J;  3KEO A;  1YOV B;  3LQQ A;  5KVR A;  5EG0 B;  3TW6 A;  5F04 A;  4Y13 A;  2ZJQ F;  3V8J A;  2CV2 A;  2AO9 A;  3OSG A;  5FFZ A;  3J7A Y;  3Q0W A;  1FIP A;  3OS2 A;  1SD5 A;  2DMT A;  1X3U A;  2DTR A;  1SD6 A;  1XD7 A;  4XIC A;  3H9J A;  2I8D A;  1TWG J;  2B7E A;  1MDM B;  2QBY A;  4U7D A;  1ZR2 A;  2A6E F;  3QYF A;  3RJP A;  1HKT A;  1HKQ A;  3SFZ A;  1Z1D A;  4CCJ A;  3BTL A;  1VFC A;  1UG2 A;  1B8I B;  2DT5 A;  1DU6 A;  3MMY B;  1XDS A;  4OWR B;  3C2B A;  2DMN A;  1QVT A;  3BTI A;  4ZTF A;  2VBY A;  4OMZ A;  3HPH A;  3I64 A;  3W3C A;  2CO5 A;  2R5Z B;  1F5T A;  2V79 A;  2XAJ A;  1RI7 A;  4FE7 A;  4E7K A;  1U3E M;  1BM9 A;  3M1E A;  1XGO A;  3T0Y A;  1HDP A;  1MBJ A;  3F8M A;  2L4M A;  3WHB A;  2VKV A;  2BHZ A;  3HPG A;  3GEZ A;  4CCN A;  2P0W A;  4XQF A;  4XLE A;  3MN2 A;  2X1E A;  4E7J A;  1X1A A;  3V4G A;  1U5T C;  4Q47 A;  1BI1 A;  1RES A;  2KJC A;  3W2A A;  4DYR A;  1UFM A;  3TBI A;  1FJL A;  4MEX F;  3HTS B;  2NVU B;  3BOQ A;  2LY1 A;  1HXD A;  2ZME C;  3HKZ A;  2HS5 A;  5JLW A;  3ECO A;  4ENK A;  2DFH A;  3C2G A;  2HXO A;  4MFE A;  4YEJ A;  3OYE A;  1YHQ I;  3GFL A;  3MFK A;  5K7H A;  3WOD F;  4D1Q A;  4HZF A;  3DTI A;  5JHF A;  3M9A A;  4JOM A;  3BTC A;  1S3J A;  1L3L A;  1TL8 A;  2DOF A;  2K7L A;  4LIT A;  1I27 A;  4M3E A;  1TNS A;  2KZV A;  1Z91 A;  1GV5 A;  2VIX A;  2B63 J;  3CES A;  3IV5 A;  2R5Y A;  2BW3 B;  5IP7 J;  3LSI A;  5HLG A;  3RKX A;  3TMO A;  2XAF A;  2K9S A;  3DPU A;  4MQ9 F;  1TC3 C;  4PSW A;  3TDU C;  2CUJ A;  2XAH A;  5D4R A;  2LLK A;  1RC9 A;  3TKY A;  2BXZ A;  3IAS 2;  1OJL A;  2HOE A;  1HA8 A;  3FKI J;  1G3W A;  2VE8 A;  2EA4 A;  2ZB9 A;  3GWZ A;  1I5Z A;  3GLL A;  4CDG A;  2EZK A;  2JSP A;  2KLO A;  4OU0 A;  3RZD J;  2OUM A;  1XGS A;  1XDU A;  2ZJP F;  1S7O A;  3V7R A;  1GXP A;  2R7O A;  2EWN A;  3KEY A;  1KON A;  3GF2 A;  3SEQ A;  1R5I D;  2EH3 A;  4MTD A;  1XCV A;  3LSR A;  4IF4 A;  4JK1 X;  3R61 A;  2EA2 A;  1QRY A;  2FNA A;  1VQ9 I;  3ASN H;  4E6K G;  5GAG J;  5CYV A;  2P5K A;  3HOV J;  3B73 A;  1PUF A;  1PUE E;  2P8T A;  5B66 C;  5D6F A;  5ILV A;  1QGP A;  2MGQ A;  4G6T B;  2EK5 A;  2LF7 A;  2Y0S A;  4WK8 F;  5KHD A;  2XKO A;  3MQ0 A;  3EPZ A;  2C6Y A;  5EEG A;  3HL2 A;  2OA4 A;  1V5E A;  4PSX A;  3CC2 I;  2XV4 S;  5LGU A;  1I1S A;  1FNN A;  3AG1 H;  2LD5 A;  3RZO J;  3TW7 A;  2W82 A;  2CFX A;  1YFH A;  2Q2E A;  1ETY A;  2RN7 A;  1LVK A;  3I9V 2;  2Y9Y A;  4PJN A;  3E5X A;  4CCM A;  2ECB A;  4ZYD A;  4JYK A;  1OKR A;  3QRF F;  3CJQ B;  1K61 A;  4A3G J;  4BE2 A;  4DJA A;  3QP5 A;  3M3Y J;  3PL8 A;  4O5V A;  3S3O A;  2AXL A;  1OCP A;  3H1C A;  2IPQ X;  4C3I J;  3BR2 A;  3CUO A;  4BXF A;  4D5C A;  1FLI A;  1KQ9 A;  3OYI A;  3HRT A;  3LNQ A;  1U78 A;  3KP4 A;  3PNV A;  3F3X A;  4G7H F;  4EJU A;  5H20 A;  2ELK A;  5F0F A;  2V9V A;  5GAE J;  4LGW A;  4BBS J;  2QQ9 A;  1I3Q J;  4Y4R A;  2L7M P;  3GME A;  2Q1Z B;  2CV1 A;  2VAS A;  4KN4 X;  3DWL E;  2W24 A;  3Q5F A;  1K78 B; 
#chains in the Genus database with same CATH homology
 4XK4 A;  1MH4 A;  1TWC J;  4X1E A;  2TCT A;  1Z0X A;  5EGO B;  4M3G A;  1XS9 A;  1I50 J;  2R93 J;  2LKX A;  3HGY A;  3BR5 A;  1IDY A;  2FJ1 A;  5GP9 A;  4MIM A;  3JRI A;  3JRE A;  2E2H J;  1BJZ A;  2LTP A;  1LE8 B;  4AUX A;  1JTY A;  2CUF A;  4JX5 A;  4FE4 A;  2W48 A;  5FLM J;  3S1R J;  1ZGW A;  2O9L A;  4XRS A;  1T56 A;  1O4X A;  1VF9 A;  2M34 A;  1TWH J;  2IEK A;  1B72 B;  3Q0U A;  5F0H A;  2XPW A;  3BTJ A;  3G1M A;  2GLO A;  5M5Y J;  5IP9 J;  1D5Y A;  2Y2Z A;  2R5Z A;  1NK2 P;  1GVD A;  2L7F P;  3L1P A;  3GTM J;  1ETO A;  2FQ4 A;  1IDZ A;  2DTZ A;  2NS7 A;  3NAR A;  1ORK A;  2KT0 A;  2VKE A;  3RKQ A;  1EF4 A;  2XGD A;  4W97 A;  3S2H J;  1WI3 A;  3JRH A;  5E3L A;  2M9H A;  2XPU A;  2I10 A;  3JRC A;  3TP0 A;  3PO3 J;  1BA5 A;  3K2A A;  4EEF G;  2NVY J;  1WH7 A;  1ZQ3 P;  4Y52 J;  2ID6 A;  3JRB A;  3CDL A;  1RPW A;  1F36 A;  1X2N A;  2DJN A;  4MFD A;  2M0C A;  3PM1 A;  3HOU J;  2JJ7 A;  2VUM J;  2WAQ N;  5IP6 A;  1ENH A;  3ZOB A;  5IOY A;  4FIS A;  2E2I J;  4M3F A;  3H0G J;  3D1N I;  4B4C A;  1DU0 A;  2DA3 A;  4GFB A;  3UKG A;  1Y1V J;  3HEF A;  4IHX A;  3GTQ J;  3BR1 A;  1IGN A;  4A3D J;  3I4M J;  2JA8 J;  3HOW J;  3HB9 A;  2XGC A;  5DTD A;  1JKP C;  1WCM J;  3S16 J;  1JTX A;  3BT9 A;  2MW8 A;  3DEW A;  1YRN B;  1XC5 A;  3I4N J;  3S15 J;  1RR7 A;  5GPA A;  3G1O A;  4UUS A;  2ID3 A;  2N8G A;  5EZH A;  4FTH A;  2JA5 J;  4RBO A;  4Y7N J;  2L0K A;  5J1U A;  2LY9 A;  1OCT C;  1VND A;  3LOC A;  3MKL A;  4IEJ A;  5JLX A;  3LSG A;  4CYC B;  2JWT A;  4A3C J;  2XPV A;  1WPK A;  2H8R A;  3H3V K;  4A3M J;  3ZQL A;  2O8K A;  2M2E A;  5C4J J;  2TRT A;  3S2D J;  3O8H A;  1W0T A;  4A3B J;  1U9O A;  2KDZ A;  5IYD J;  2YS9 A;  1Q1V A;  2VPR A;  3BG5 A;  2FD5 A;  2XB5 A;  2CQQ A;  1GDT A;  2DN0 A;  4IHW A;  2X6O A;  3IH2 A;  1LFU P;  4B3A A;  3A01 B;  1JJ8 C;  4MLO A;  2HOT A;  1BW5 A;  1WH5 A;  1ZK8 A;  2DA6 A;  5E3N A;  4NDL A;  2CQX A;  2X48 A;  1U8B A;  4B1R A;  1AHD P;  2XRL A;  3S14 J;  4BXX J;  1MBK A;  3FK7 A;  2R92 J;  1P7J A;  1B8I A;  1MSF C;  3S17 J;  3ZQH A;  1X58 A;  2DA4 A;  2K9N A;  4A3K J;  1LFB A;  2HI3 A;  3TP3 A;  2GM4 A;  1ETK A;  4A3J J;  1ETV A;  1UHS A;  2LR8 A;  5EF6 A;  2R5Y B;  5J1R A;  5M3M J;  3QQA A;  1ZR4 A;  1POG A;  4A3E J;  2HQ5 A;  1NK3 P;  3BQY A;  3FK6 A;  1JUP A;  1TWA J;  3ZQF A;  3FIW A;  1H88 C;  5EGO A;  5C3E J;  3A03 A;  1MH3 A;  4V2G A;  5F1J A;  5K7Z A;  1TWF J;  2P81 A;  1HDD C;  3O8G A;  1LE8 A;  3NAU A;  1X2M A;  5F0C A;  3SDG A;  2Y31 A;  3LSJ A;  1MBG A;  5FLV A;  2HOA A;  3MVP A;  3BG9 A;  4DW6 A;  2WV1 A;  3QPL A;  4QSH A;  1H8A C;  1B72 A;  3BR3 A;  2JK3 A;  2IBD A;  1JKO C;  2CUE A;  3F0C A;  1JT6 A;  1K83 J;  1PUF B;  1MBE A;  2EZI A;  1JGG A;  1F43 A;  5E3M A;  4V2F A;  3OOU A;  1IUF A;  2DA5 A;  1S7E A;  1Y1W J;  2GBY A;  3B6A A;  4ABZ A;  3BG3 A;  1G2H A;  1A5J A;  1BL0 A;  2R0Q C;  1QVU A;  1CQT A;  3IH3 A;  2CJJ A;  2CU7 A;  3RQI A;  2HYJ A;  4L5E A;  1MNM C;  2HDD A;  1AKH B;  2FX0 A;  4UUT A;  1APL C;  5IYC J;  1HOM A;  4AC0 A;  1IC8 A;  3S1Q J;  5C4X J;  2COB A;  3DCF A;  2Y30 A;  1QPI A;  4DYC A;  5J1Y A;  2QCO A;  1GV2 A;  1GT0 C;  1IJW C;  3ZQC A;  2OF7 A;  1RKT A;  3GBG A;  4G12 A;  1IV6 A;  2L9R A;  3LSP A;  1MBF A;  4M3D A;  4JX4 A;  2DMP A;  4I6Z A;  4BBR J;  1ITY A;  5BNG A;  3B6C A;  2E19 A;  5EYR A;  3E7L A;  5FKN A;  3HGG A;  2RAE A;  2E2J J;  4FCY A;  4BKX A;  5EG0 B;  3HOZ J;  1IRZ A;  3TW6 A;  5F04 A;  2PMZ N;  5K7F A;  2AO9 A;  5EZG A;  4XRM A;  3OSG A;  3S1M J;  2EZL A;  1P7I A;  4A3L J;  2X9D A;  3Q0W A;  3ZQI A;  4A3I J;  1FIP A;  2JMW A;  2WB1 N;  5IYB J;  3OSF A;  2DA1 A;  1FIA A;  2DMT A;  5E3O A;  3CMY A;  4XIC A;  1VI0 A;  1YRN A;  1TWG J;  4QIW N;  1ZR2 A;  3HOX J;  2LK2 A;  2Y9Z A;  4AYB N;  3BTL A;  1HLV A;  1VFC A;  1JKQ C;  1UG2 A;  1B8I B;  1ZTR A;  1DU6 A;  2IAI A;  3C2B A;  2DMN A;  1QVT A;  3BTI A;  4A69 C;  5FKO A;  4XRS G;  3Q0V A;  4CYC A;  2DMU A;  2R5Z B;  4XID A;  1JKR C;  4FE7 A;  5HOD A;  3CCY A;  1JT0 A;  1HDP A;  1MBJ A;  5C44 J;  3S1N J;  1GUU A;  3WHB A;  2VKV A;  5GPC A;  1NTC A;  3VPR A;  1RET A;  4BY1 J;  2NVT J;  4W1U A;  1H89 C;  3MN2 A;  1JUM A;  4C2M J;  1FTZ A;  2NS8 A;  1R9T J;  3M4O J;  5IOZ A;  4J19 A;  2ME0 A;  2E1O A;  1RES A;  4DYR A;  1Z77 A;  3G1L A;  3A01 A;  1FJL A;  5JLW A;  3JR9 A;  2HXO A;  4MFE A;  2MSY A;  5M5W J;  5IPA A;  2L7Z A;  1AU7 A;  5K7H A;  5M3F J;  3QPS A;  1A6I A;  3A02 A;  1UMQ A;  2JA6 J;  1HCR A;  3PO2 J;  3BTC A;  3ZQG A;  5J3L A;  3OIO A;  2QF7 A;  5FJ8 J;  3W6V A;  2EZH A;  2XSD C;  4HNV A;  3GTK J;  4IHY A;  4M3E A;  2EQR A;  1GV5 A;  2CRG A;  2B63 J;  3GTO J;  2R5Y A;  3IV5 A;  3GTP J;  5IP7 J;  2G0E A;  3JRA A;  5F08 A;  2OPT A;  4DYQ A;  4JX6 A;  2ECC A;  3GTL J;  2K9S A;  1TC3 C;  1JUS A;  2LLK A;  3K7A J;  5EDN A;  5FKK A;  1OJL A;  3FKI J;  4D5F A;  1U9N A;  2ZB9 A;  2LFB A;  4JP0 A;  5DS9 A;  4A3F J;  2DA7 A;  3HKZ N;  3FIS A;  2EZK A;  1E3O C;  3RZD J;  2LVS A;  1IG7 A;  4I76 A;  2K9Q A;  2XB0 X;  2VI6 A;  2AHQ A;  2NVQ J;  1ETX A;  1T33 A;  2NOG A;  4DZJ A;  2M8G X;  4C3J J;  4UUS B;  2EH3 A;  3HBL A;  3WHC A;  3LSR A;  2JA7 J;  2EBI A;  2O7O A;  1QRY A;  4MO7 A;  5F27 A;  2MG4 A;  1ETQ A;  3HOV J;  1RKW A;  2YUS A;  4D7M A;  1PUF A;  1SAN A;  2MGQ A;  3HDD A;  1ZKG A;  4X6A J;  4M6V A;  1SFO J;  2HOS A;  2R7Z J;  2YU9 J;  4RDU A;  4C3H J;  4S0H B;  2LD5 A;  3RZO J;  1ETW A;  5FKM A;  3TW7 A;  4QTR A;  1AKH A;  1MSE C;  1ETY A;  1I6H J;  2HXI A;  5FKL A;  2Y9Y A;  3GTJ J;  3GTG J;  2D5V A;  2ECB A;  9ANT A;  1HF0 A;  2XGE A;  4JYK A;  3SJM A;  3IH4 A;  1K61 A;  5EEA A;  4A3G J;  4IHV A;  3CQZ J;  3M3Y J;  3SFI A;  3TED A;  1OCP A;  1XG1 A;  2LP0 A;  3HOY J;  1WGX A;  4C3I J;  3BR2 A;  4A93 J;  4M3B A;  4D5C A;  5M5X J;  3HM5 A;  3LNQ A;  3JRF A;  1U78 A;  1FEX A;  2DMQ A;  1MBH A;  1FTT A;  2Y0S N;  1JJ6 C;  3JRG A;  3Q3S A;  2DA2 A;  2ELK A;  5F0F A;  1W0U A;  4BY7 J;  4BBS J;  2JN6 A;  2H1K A;  5EG0 A;  1I3Q J;  2ME6 A;  2L7M P;  1OFC X;  2K40 A;  4DZP A;  3JRD A;  3BR0 A;  4LOC A;  3BR6 A;  1BW6 A;  2NVX J;  3BQZ A;  4D7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...