5EERA

Crystal strcuture of dapb from corynebacterium glutamicum
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
247
structure length
247
Chain Sequence
GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
total genus 68
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eerA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eerA01
1R4MB 3HE3A 1UJMA 1C0PA 1PX0A 3PVZA 2AEJA 4R9SA 4HFRA 5T67A 2D3TA 4HKTA 5H81A 2PD4A 2A35A 3ETGA 3OQBA 1A9YA 3X2FA 5CEJA 1KS9A 2GZ2A 3WYBA 1T2EA 2AE2A 1UDAA 3PLRA 4HADA 1TT5A 4Y98A 5IZCA 1GU7A 3RC7A 1GQ2A 3FWNA 3JQ9A 1EFKA 4UVGA 3DHYA 3WTBA 2P5UA 3BXXA 1PS8A 1PJTA 3PIIA 3WOHA 1XLTA 3PI7A 4XDZA 5DDIP 4IMPA 3HDHA 3O8QB 2FR8A 1HLDA 1TXGA 4PLTA 3HDYA 2DUWA 3PZRA 4GWKA 3LDHA 1IHXA 3HQ4O 1WMAA 1GFSA 2NLOA 3GGPA 3Q3CA 5TF4A 2X1HA 1WMBA 4RVFA 3ZNPA 3GVPA 2HK8A 2X0JA 4AL4A 2Y1FA 2C82A 2CVOA 3RU9A 1PTJA 1SMKA 2ZJ1A 4NNJA 4W7HA 1NFRA 3ZW8A 2QRJA 3PHIA 4XRRA 3VVBA 3NJ4A 4XGKA 4RVHA 3D4NA 2EKPA 1PJ2A 4IZIA 1LBEA 2Y0DA 3R1IA 3ZWWA 4AICA 1ZVMA 3PYXA 4RVUA 4FOSA 4EZBA 3GMDA 1CDOA 1U5AA 3E6AA 1LRJA 2DFDA 2ZJ0A 3A1NA 2BLLA 2VZ8A 2I5PO 3PK0A 3MJCA 1QG6A 4W9NA 2BELA 1B3BA 4BQRA 5B12A 2PLAA 2B4TO 4R1NA 4BKQA 3A06A 4I9HA 3U4IA 3PWSA 2ZATA 3RVDA 2QZZA 2GN9A 4GMGA 4R51A 5C7IO 4KQXA 4ALLA 1MV8A 3RFXA 4BOYA 3GA0A 2PKRA 2OXIA 5THQA 1ZXLA 4GWGA 5U4QA 3R3JA 4WLNA 5DULA 1N7HA 2GZ3A 5CPBA 3NTRA 2BFAA 2JD1A 2TMDA 3ZCXA 3LC7O 3C7AA 1KEUA 3NYWA 4QTZA 2WD8A 5JLAA 4BS9A 2DC1A 3OM9A 4NDNE 1DFIA 4TVBA 3OJOA 4PLCA 2YDXA 2YY7A 4P8RA 2OGUA 2PY6A 1Q7BA 4ZICA 4N54A 2V6BA 1VL6A 4FC7A 4UEJA 2W2KA 1SNYA 3HWRA 4YB8A 4MVJE 2EIHA 4A2CA 1C1XA 1GQQA 3STHA 4BGUA 3G79A 3SLGA 3BZUA 4PLGA 3GH3A 1R0KA 1T2CA 3EW7A 3TZ6A 4WEOA 1FDWA 1OMOA 1CF2O 5F5LA 2EGHA 4M87A 3OMLA 4AJNA 5HTOA 4J16A 1ZEMA 2WTBA 4YAJA 1LEHA 1HZZA 5IZ4A 5L4NA 1X7DA 2VZ9A 4FIZA 2Y0EA 5B1YA 3PGJA 5KVCA 4PVDA 1NR1A 2Y99A 4ALNA 2OFPA 4JLWA 1ISJA 1JAYA 1D1SA 2ZKLA 1A9ZA 5L7TA 3EZYA 1Y7TA 3VC7A 1RYDA 4CLDA 1I2ZA 4JK3A 4LW8A 4P4NA 4Y6SA 3F1LA 5A05A 2PGDA 4CM5A 2GSDA 5T8KC 2NADA 3D7LA 3V2GA 1PGNA 3VPXA 3WDSA 5C5IA 4BO5A 4HFMA 2VUUA 3OHSX 2QYTA 3H9QA 3JQBC 4L4XA 2X5JO 4KWIA 3OETA 4I08A 4J7CA 4EUEA 2QW8A 1ADCA 1XG5A 3JQCA 2R00A 1U3TA 4ZQFA 4O1MA 4DBVO 5KNLA 5IDXA 2VHVA 2J3JA 1M67A 1JWBB 1BVRA 3VOSA 1GCUA 1B0AA 1EUDA 4UVEA 1I36A 5AVOA 1T26A 3BHIA 3W4IA 4EDFA 3DTYA 2XOXA 1NX6A 5JYFA 3PIDA 4KUGA 4EGFA 1WW8A 1T24A 2I65A 5T64A 4K26A 5ILOA 4AFNA 1AE1A 1BMDA 2G1UA 4FOOA 3K31A 3ZWXA 3I23A 3LSYA 1A4UA 4TRNA 3GVXA 4Q3EA 1YJQA 3GNQA 4MO2A 1NPTO 1M2WA 4AJ2A 1H6CA 1YBMA 3OEWA 2NNLD 2ZCUA 5F5NA 5KWEA 2OP0A 1ISIA 1EMDA 3FCOA 1DIBA 4I5EA 7ADHA 5DCWA 1Q7GA 1TT7A 4RL6A 1DRWA 4IXTA 5A3VA 3WR5A 4EYEA 3D1LA 5DOVA 4DMLA 1I01A 5TX7A 2VTEA 1C1DA 1ULUA 1YB5A 4OXYA 4JNKA 3G1UA 3QSGA 1AXEA 3RC1A 1OZAA 3WLEA 1EUCA 2JFHA 1SCUA 3ZW9A 2D5CA 4Q3NA 1P74A 1PZFA 4GH5A 4BKUA 5ENDA 3RJ9A 1U28A 4CJXA 4ZQGA 4RVGA 3OIDA 3DZHA 5KCZA 2GN6A 4CMBA 1WXDA 2NVBA 4RF3A 3FNEA 4XIJA 1GTMA 1C0KA 1I8TA 2HKIA 3P5SA 4GL4A 2HJRA 1SB9A 3GG2A 3OQ1A 3WWZA 2CNBA 3FRJA 1DPGA 4FGSA 2Y1DA 3PHGA 4NG5A 3U4HA 3BIOA 3HNPA 4ITUA 2DAPA 3WJAA 2HO5A 3EDMA 1ONOA 5IDYA 1KC1A 3ADOA 2G82A 1KOLA 4PLYA 4EJ0A 2VN8A 3BYZA 4UEOA 1P1RA 2BF7A 2Y93A 3H2ZA 4Z9YA 3SC4A 2UDPA 2X22A 1XDWA 4K6FA 2CY0A 4OMUA 5JSFA 5L7WA 5A04A 4BGIA 3OJEA 3ONEA 3RKRA 1MFPA 1X7GA 3WGOA 2VWHA 3PQEA 2H63A 4KOAA 4JJGA 4ND2A 3F6YA 5IXSA 2I76A 2V6MA 2OL4A 4E0BA 3EGOA 1U4OA 2POQX 2QRLA 4J6FA 4UEKA 5EQDA 1G1AA 3E8XA 4C4OA 1SBYA 4RVDA 2QRKA 3QY9A 1C1DB 2CFCA 3GOHA 2DTXA 4G5HA 4IDDA 3W1VA 1YRLA 3UCEA 1TI7A 1IPEA 3BTVA 1BDBA 4NBUA 3DZBA 2CDCA 1RM4A 4J1QA 1T2FA 3CKYA 2O3SA 4PLWA 2JCYA 1UR5A 1QV6A 4E5YA 4IINA 4BNXA 2O7QA 2R6JA 7MDHA 2CDBA 1LC0A 3H9EO 3FPCA 1ZSNA 2FPIA 1LLCA 1WAMA 5DP1A 4CPDA 2DKNA 3WQQA 5EERA 3MJEA 2EF1A 5JAIA 4E2XA 4HWKA 2Z1MA 5ILGA 1O5IA 2HDHA 3WFJA 4KUEA 1UZMA 2EERA 4IIVA 3I9KA 1PJBA 5HM8A 1XWFA 4HX5A 2ZTVA 4DRYA 3PHLA 3K2BA 2B36A 4WUVA 2IXBA 1ZO8A 5A9RA 3FNFA 1P1FA 5K6AA 3FWZA 3S1LA 1LDMA 3IJRA 1JAXA 1GPDG 1I3MA 3M2PA 4L76A 2P91A 1ENPA 5JYEA 4YRBA 4HY3A 3VKVA 4FS3A 4EI2A 1YOVA 3DHEA 1ENYA 3GDGA 1U2GA 3O03A 5DCUA 4NH4A 2AG8A 3B6ZA 2EG9A 3GMSA 3JD2A 4BNMA 1OFGA 1HT0A 3PQDA 4WEQA 5T8KA 1P44A 2FRDA 4FFLA 3NTQA 5JY6A 4G2NA 1QSGA 1ZK3A 4R68A 2HAEA 4WNIA 3ABIA 4Q9NA 1YH3A 1F8FA 3IS3A 3F1KA 1X15A 5I7VA 1U3UA 5T57A 1YVEI 3JQFA 5IG2A 4P38A 1VKOA 1K2WA 3WGTA 1NFQA 3VKUA 3MJSA 3WSVA 4PLFA 2AG5A 3IC5A 1AUPA 1XA0A 4IIUA 3WG9A 3HSKA 3E9NA 2YHUA 3I9NA 4N5MA 1UP7A 4CLRB 3I4CA 1V6AA 4L4RA 4MP3A 2OO5A 1U7HA 3TFQA 1JW9B 4J91A 4Z0HO 1N7GA 3KZVA 4L73A 3JQAA 2W8ZA 3R0IA 1Y8QA 1BSVA 2Q1UA 3N74A 4DYVA 1AGNA 2O50A 1PU2A 3ZI0A 4O6VA 1MLDA 1GL3A 2BD0A 4YJHB 3GT0A 2GASA 3L4BC 3GDFA 4ID9A 4Y6PA 5JBIA 1NYTA 3VDQA 1Q0LA 2PGJA 4B4VA 3ONFA 4BNKA 2FSVA 4ND4A 4YT5A 2Y1GA 3DMYA 4URFA 4DWVA 2BGMA 1BW9A 3HZZA 4R5MA 4UVIA 5GZ1A 1CYDA 5EN4A 5JXWA 2C5AA 1HSOA 1Q2XA 1ZK2A 4L0QA 3VVCA 1RM0A 1YONA 4B8ZA 1CRWG 4J3FA 5FFFA 5LDGA 2NU9A 3WGIA 2CVZA 2CD9A 1CWUA 3CH6A 1T4DA 5CPFA 5I7EA 2RBEA 1V0JA 5C7LO 4WOKA 3LYLA 3CZMA 4IM7A 5DZSA 1J4AA 1E1LA 2GD1O 4PLZA 3JQEA 4UUNA 4QEDA 3D64A 1M6HA 4YTEA 3S2EA 4N5LA 4NI5A 1PWXA 2I6TA 3UAGA 2YV3A 1DC3A 4H3VA 1P0CA 3JQ6A 2NVUB 2CZCA 4TZKA 5F1OA 1IE3A 1EBFA 4BO1A 5A06A 2NVWA 3TOZA 1P1KA 1DOHA 5KJEA 4YCAA 4MIEA 1TVEA 5G4KB 5THKA 2HRBA 3U49A 4IQ8A 1O95A 5G2OA 2BFPA 4M54A 4WLEA 5JCJA 4O59O 2ZTLA 3Q2KA 4S3MA 4YVFA 1BVUA 1QP8A 3L07A 3RBXA 3K96A 1T2AA 4ONEA 4GSLA 1EVJA 3WLFA 1O6ZA 1Y5MA 1UH5A 3ZV3A 1PGQA 2OBNA 1KVQA 4IGEA 4RF4A 3MEQA 3FHLA 4CV3A 3FR7A 1DFHA 1O89A 3UW3A 4IQGA 3VZPA 2QHXA 2DM6A 4TMFA 4YA6A 2PZLA 2JJYA 4DXHA 2VT3A 1DIRA 3NEPX 2Q3EA 2EP7A 4GKVA 3WIDA 3KYBA 4ZRMA 4GSKA 3AUTA 1ADFA 1CQJA 1ZK0A 1B8UA 3GPIA 3H9JA 1YXMA 1SEVA 3QRWA 3Q11A 1MX3A 1ZXBA 4FFMA 4XJSA 3IL2A 3PHHA 1A27A 4Q3AA 3E48A 3SJ7A 4E32A 3WIEA 4WNCA 1L7DA 3TNLA 3WGGA 1E7RA 1I24A 1PSDA 1IHYA 1E7YA 2AE1A 3UH1A 4GVLA 3NT2A 2J5KA 1LU9A 4U6QA 3S2GA 3GVIA 5I7SA 2UVDA 5A9TA 3RJ5A 5IDQA 4G81A 2IZ1A 2EWMA 1QYCA 4OOEA 4YXFA 1N5DA 3AU8A 2PGLA 1HTBA 2AQ8A 3RUCA 3WX0A 5KTKA 2A4KA 4MVJI 1B3RA 4CLEA 3DBHA 3KYDB 4PZDA 2Y05A 6LDHA 4RJTA 1E6UA 2X5KO 2EHDA 4B4OA 1GPJA 4YACA 5DNAA 1PR9A 1ARZA 5FF9A 3GQVA 2NVUA 3G1TA 1QXSA 3OICA 4U8GA 1EK6A 5A02A 1LDEA 4GX2A 4NR0A 4ND5A 1X1EA 1SO8A 4DQVA 2H9IA 3CUKA 4YT4A 3JCZA 4WKGA 1KBZA 2VUTA 3WFIA 1R6DA 4ZRNA 4RPGA 3A9WA 3AY6A 2UUPA 4TROA 4HNGA 2W2LA 1CJCA 4RPHA 5EESA 3EMKA 3DOJA 1H94A 4FW8A 3C3XA 4KDEA 1NQAO 3ANLA 4E13A 3EYWA 3KHUA 4R1UA 4BL5A 5A4DA 4XKJA 2CUKA 3I1JA 3JYLA 3NRCA 4Z0TA 3WBFA 1ZSYA 5LC1A 4N18A 4N7RA 2QZ9A 4DA9A 4WCFB 4XWYA 3DC2A 2IYPA 1ZK4A 4D42A 3AI1A 3KB6A 4LSMA 1X1TA 2VCYA 1LLUA 5L4SA 1UUFA 1KEVA 2EW8A 4FPXA 4NIMA 4C7KA 4CQLB 3GFBA 1V3VA 1SAYA 4BV9A 1UXIA 2VYNA 2NUAA 1C3VA 3H65A 1RKXA 3M6IA 4FJ2A 4KDFA 5DOZA 3LC1O 1Y8QB 2FP4A 3KVOA 3PQFA 3WS7A 1YL7A 4E21A 3OA0A 2E82A 3FD8A 4J1NA 5T6BA 5KVQA 1LC3A 4H15A 4R1SA 3B1KA 5KKAA 1E0DA 3HG7A 3O9ZA 3H2SA 4JCOA 4CLRA 5JFOA 3RFTA 5COBA 2RH4A 2DPGA 2JD0A 1WDMA 3OIFA 2GUGA 4BNVA 1Z74A 1LJ8A 4A26A 1R0SA 4P4GA 4J0EA 4CR8A 1ZJYA 2W90A 4DC1A 1D4FA 2NSDA 3BHJA 3VH4A 4B7UA 4BB5A 5FWNA 3ZN2A 5BSHA 3HN7A 3IIEA 2IRWA 2AQHA 2FZEA 4MVJM 3DZIA 4XD2A 3GG9A 5KJFA 5DBGA 1ZH8A 3RC2A 2NTVA 1B8VA 3OJLA 5EINA 1YKFA 2BFOA 1YOVB 1DC5A 4CV1A 4FJ0A 2I3AA 4PN3A 1YO6A 4CM3A 3OP4A 1MB4A 3AUSA 4Q39A 1ZNQO 4NJMB 2HSDA 1GV1A 2GNAA 3O4RA 1NVTA 3OEYA 4FFNA 1I2BA 2DQ4A 4D3FA 2ZYDA 1N9GA 1EE2A 2P2SA 1PL8A 3QWHA 3PRJA 3UF0A 4PZEA 3H9UA 2EJWA 3P7MA 5TJ9A 3DXFA 2FPGA 2O2SA 4FBGA 1ZIDA 4D0RA 1N1EA 2DUUA 2VRCA 1UAGA 2UUOA 1IB6A 1D3AA 1I10A 1R66A 2Y0CA 3EVTA 4H7PA 4RDHA 2O3JA 3TF5A 3RUIA 3ZV6A 1H2HA 3QVTA 2FN7A 2Q2VA 8LDHA 4CM8A 4J2HA 1S6YA 3L0DA 4AJHA 1BXGB 1HL3A 3FTPA 2HMTA 4JQCA 5AXDA 1LNQA 5U1PA 3FTNA 1B16A 1UZNA 5IJZA 3ZWAA 3LT0A 4TZTA 3JQBA 4Q3BA 1SOWA 4K6CA 4IY1A 1OBFO 3PDUA 1WDKA 2O3QA 3VPSA 4IDAA 2Y68A 1P45A 2FSSA 3DBHB 5LDHA 4DLBA 2Q4BA 3JQ7A 4NU6A 1XU9A 4ZN6A 3GNTA 4PGFA 1AN9A 2Y66A 3UVEA 3DB2A 5GY7A 1LDGA 3K6JA 3LQFA 3FNGA 3GAFA 4MVJH 2PD3A 2F1KA 2JHFA 3DZKA 2QX7A 5TSDA 3JD0A 5F1KA 5BSEA 4CM4A 4RLSA 4J49A 3CIFA 2VNAA 3V2HA 1E7SA 1PZHA 1F0YA 1E3JA 1HKUA 2O23A 3KO8A 3VHRA 2X7HA 4MP6A 3M2TA 5ITWA 4BNFA 1V35A 4J4HA 3DTTA 3NDJA 3L6OO 1XCBA 3V1YA 4JXKA 4XZ3A 2YDYA 1C0LA 3BMCB 4ALJA 3BTSA 3OA2A 5G0VA 3CEAA 3ZHZA 2OORA 2O4UX 1XHLA 3ZU2A 4E3ZA 4BKRA 4RQTA 3TZQA 4LGVA 4M89A 3UCXA 3KM0A 4D0SA 5AOVA 2PNFA 5ES3A 1YB4A 2HRZA 4FFPA 2C5EA 1F17A 4XA8A 4XR4A 1IOLA 3K5PA 3Q0EA 1DLJA 2ZTUA 1JKJA 4Y67A 2DBRA 2ZQZA 3AU9A 4B79A 4ESOA 3IMFA 4I9UA 2I9PA 2PR2A 3PLNA 4OGWA 4KP7A 1E7MA 1GUYA 1XSEA 3TDKA 3JQFC 1RJWA 2Q2WA 5KVVA 5J9GA 1F8GA 3AK4A 4CMKA 4GKBA 1H6BA 1QORA 2QIOA 4JJFA 4GLLA 1GQYA 4D7AA 4PLVA 4OAQA 5TT1A 1ISFA 3ZWMA 1PJSA 5TNXA 1LLDA 3AFNA 2B0JA 4UAGA 5CG1A 4RO0A 2B5VA 2Q22A 4NK4A 4R69A 3GNSA 5KVSA 3ZU5A 5JYAA 1HE4A 3ITDA 5FI3A 4O5OA 1BRMA 4XB1A 4QSMA 4RGBA 1XQ1A 1NR7A 3IKVA 4N5NA 1ZKMA 3K9QO 3EUWA 4DLAA 1IZ0A 5JCJD 4OSPA 4ZVVA 4E5PA 3WJ7A 3S8MA 5FI5A 3SBOA 5JW6A 3PYLA 3BMQA 2VQ3A 1DEHA 4J9UE 4WK6A 1BXZA 1K89A 3FI9A 1PGJA 2IXAA 5TGDA 5A1TA 4CL3A 5JYDA 3TZCA 6ADHA 1QYVA 5LCXA 1W4ZA 2PZMA 1VL8A 2X9GA 1Y8RA 1SB8A 2WDZA 1EZ4A 3GUYA 4EJ6A 5CEEA 2ILTA 3T7CA 1DIAA 4CM9D 4YT8A 3U0BA 2UV8A 3JSAA 1JWAB 5GZ6A 1O9BA 4MKRA 5IXYA 2IEDA 3ROQA 1SEPA 5EPOA 5F21A 1PR3A 4JBGA 3QWAA 2DT5A 4RPLA 3ZZNA 4J43A 3CMMA 1FXSA 3PZBA 3PDJA 4RPKA 4BNWA 1OC2A 3H5AA 3M1LA 4CQLA 5BR7A 3BA1A 3D5TA 1Y8RB 5H83A 1CERA 4CLXA 4RPJA 4D3DA 2BRUA 4YAGA 2ZB4A 1D7OA 3LF2A 1YB1A 2VNSA 4J0FA 1YE3A 2Y1CA 1B15A 1UXHA 3AW9A 3ITKA 1E3WA 1YDEA 1HRDA 3ZDFA 3F5SA 4YJFB 5HBRA 1VI2A 1DJQA 2YFHA 4L74A 4LRTB 1SC6A 1WZIA 1SOVA 5COAA 1N92A 3QV1A 4R3WA 3AOGA 4IQ0A 5K6AC 3ETEA 3ICCA 3DFZA 2B4RO 4L9RA 1EFLA 1IZ9A 4RCVA 3GEMA 4YWJA 4GVXA 1M6WA 3X2EA 1YDWA 3CPSA 5CEFA 1LI4A 3NUGA 3LF1A 1TA4A 2Z1NA 2FY8A 2Q1WA 2R00C 4B4UA 2C54A 2EKLA 4CM6A 1DHRA 3K8ZA 3BMNA 3EHEA 1IULA 2V7PA 3RD5A 1Q0QA 5TS3A 1DFGA 4B4WA 3GRPA 1MP0A 4EEXA 4J9VA 1H9AA 5IN4A 2JL1A 1HYEA 1XKQA 4A10A 2Y1EA 3NX4A 3VH2A 3VZSA 3AY7A 4DIBA 2ZB3A 2C07A 2JCXA 4TSKA 3TSCA 1J0XO 4JP2A 4PVCA 4YPOA 2AEFA 3MCVA 3VPFA 1I3LA 2VOJA 4XYBA 1LXCA 2Q46A 4YRDA 3IUPA 1F14A 4GBJA 2FMUA 3JD4A 4W4TA 5T5QA 2O3TA 4ALMA 4JP3A 3A14A 2E48A 4MP8A 4E12A 4DQUA 3RWBA 1I0ZA 3UOGA 1K0UA 3TPCA 5BT9A 3WMWA 2H6EA 4BNLA 1WPQA 3F9IA 5ER6A 4HXYA 4JX8A 1LSSA 2A94A 1CEQA 2YHIB 2RHRA 4FSHA 1QV7A 3H3FA 4OL9A 1Q1NA 1Z7BA 3WNQA 4BO7A 5ADHA 2X4GA 1OOEA 2BI7A 2H1SA 2VUSA 1BGVA 2W98A 3O38A 3WTCA 1W73A 1E3EA 4DUPA 4K1LA 1P3DA 1R37A 1ZBQA 2O2YA 1B26A 1K5HA 5JDIC 4FC6A 3I83A 2B69A 1EVZA 2XPCA 3DO5A 3DBVO 1WZEA 3VZQA 4XGNA 3EK2A 3ZH2A 1KETA 1E5QA 1BDMA 3LT1A 4YYZA 5JC8A 1U3WA 2XF8A 4XQGA 4ZU3A 4EEZA 1DRVA 1NAIA 1NM5A 3E5MA 4CM9A 4E2YA 4EBFA 3E9QA 3TQHA 1Y81A 3S2IA 1L7EA 2EP5A 2P9EA 1EE9A 3FPLA 2DLDA 5L45A 3GPDG 4OQYA 2AHRA 2J6IA 3IUSA 3E1KA 5AYVA 3AOEC 4U5QA 3JQ7B 4MDHA 2NQTA 2OUIA 1BG6A 1VL0A 1VM6A 3I9JA 5G4KA 1PQUA 4BO9A 4YDRA 1EDZA 2JHGA 4MVJD 3VPHA 2YV2A 4R41A 2QQ5A 4FD3A 3HFGA 5ENVA 1U9JA 3T7EA 5L95A 2WD7A 5L9AA 1MA0A 3HN2A 3AFMA 1T1SA 4P22A 3TRIA 1DAOA 4BNUA 1LDNA 5L53A 4IGFA 3ADPA 5JDCC 3KLMX 1MC4A 1JTVA 3LC2O 4WOJA 1X0XA 5TC4A 3RUEA 1QYWA 4CV0A 1ENZA 4J90A 4D44A 1EDOA 4NMHA 3R3SA 1HZJA 2AMFA 4GGPA 3U5TA 1FDUA 4YJGB 4IDEA 1Z75A 1LSOA 4W7IA 4C7JA 2C2YA 2FPPA 4JBHA 3C1AA 1BW9B 5F3RA 3ZWBA 1ZFNA 2NM0A 5HS4A 1F12A 1LSJA 1W0CA 1ZMTA 3NDIA 4W99A 3L9WA 1TEHA 4WGGA 4BO6A 3TL3A 4MIYA 2ZYGA 4MINA 1R0LA 4LVUA 4DGSA 1NHGA 5DCYA 1PQPA 1YGYA 3ORFA 4W6ZA 5G0UA 4CM1A 1HWYA 3LLVA 4LISA 5ITVA 3W4JA 2ZQYA 4PRKA 3G3EA 1W6UA 4CMHA 3LLSA 1QYXA 4DPKA 3EZLA 5J23A 1A4IA 1X14A 3H3JA 1IY8A 4J2OA 3UHAA 1I30A 3NT4A 4HNHA 5B4UA 3MTJA 2VHYA 4ZJUA 3WBBA 2PH5A 4X54A 1B8PA 4D41A 3RROA 5L40A 1DC6A 2D2IA 1MG5A 4BO3A 4BNGA 1U1IA 2Q50A 2VWQA 3FF4A 4YJGA 3LVFO 3E03A 4HFNA 1X7HA 3QVXA 3PXXA 4OXKA 4NJOA 2V65A 2XAAA 4TKMA 4IDGA 3PYMA 3UCFA 2YV1A 3HUDA 4CMAA 3PWKA 4PLPA 5MDHA 4OYRA 3D4PA 4IJKA 3V2UA 3WGYA 1XELA 2B35A 4XB2A 4R1TA 3ZWPA 4Y9DA 3WGZA 4ND3A 2WD7B 4INAA 4IS3A 5KJCA 1E7QA 2UYYA 1QLHA 4R3NA 3SVTA 4GAEA 5EL0A 4TQGA 3DBLB 4QX6A 3VTZA 3OQ6A 4B8WA 5M6DA 4R16A 1R16A 5JNLA 1PS0A 2P4HX 4I5GA 3AJRA 2O3RA 4OO3A 1V8BA 1E7WA 3D3EA 1HF3A 1HYGA 4YBZA 4RF2A 5GZ3A 2FR1A 3AM3A 4R9RA 3Q1LA 1Z6ZA 4WCFA 4FDAA 3PPIA 1I33A 3PHJA 4BKPA 2PA3A 2BMAA 4E5NA 5IAAA 1HE5A 5EJ2A 5AQ1A 3DBRB 3QLJA 1J6UA 4A5OA 3WICA 4AVYA 4DPLA 2X58A 1NPDA 3TJRA 4BQPA 2LDBA 2VWPA 1WLYA 3KOUA 1RM3A 1JVBA 4II3A 4CV2A 4E4YA 3N7UA 1ID1A 3Q9NA 1NBOA 1KC3A 4LMRA 4RORA 5JO9A 1P31A 3WSWA 2HUNA 1Z82A 3I6QA 3I9LA 4DC0A 2EXXA 3W8EA 2W4QA 3RUHA 1I3NA 1KEPA 3KV3O 1XQ6A 5CP8A 3TN7A 5C7OO 3INGA 5KOIA 4B3HA 4XQCA 1U8FO 4AJ4A 4FFOA 2E6UX 4RLHA 4AJEA 3I9OA 1ZMOA 2RAFA 2VZ0A 1Z73A 3JYOA 3MWEB 2R2GA 4NBWA 5CDTA 5HWSA 5I9LA 1Q0HA 3DHNA 4XEHA 4OOFA 5G0WA 9LDTA 4R01A 2EJVA 4L4SA 1A5ZA 2TMGA 3VTFA 4E31A 4GX1A 1ZK1A 5L4LA 3DFUA 4XYLA 1HYHA 1DO8A 3WYCA 3MWDB 4NBTA 4MIOA 1PJ4A 1JN0A 1C14A 1R15A 1HDGO 2D1YA 4WECA 2GN4A 4BO8A 4FJ1A 4II2A 3D3WA 3E82A 3M1AA 4D79A 2GR9A 2B5WA 3HB5X 4ZGWA 3BMNB 3JQDA 1A7KA 3S2FA 2VHXA 4Y6RA 4BIIA 4CQMD 2AXQA 1GUZA 4XYGA 2EV9A 3I4FA 3U9LA 3C8MA 2YHIA 5TT0A 2CVQA 3RC9A 1PEDA 4BNJA 5JDIA 1VPDA 3WQSB 1U5CA 3TL2A 2C7VA 4YJFA 4UUMA 1CQIA 2P68A 1NXQA 3H8VA 5JDCA 1DB3A 1BTOA 4XJTA 4CLOB 3T4EA 3PP8A 5T73A 1P77A 4JGBA 4YAIA 1PL6A 4LSWA 1X0VA 1ULSA 4IUYA 2JD2A 4YJDA 3ZGYA 3ULKA 3RI3A 5BSFA 4F46A 1YBAA 3UXYA 3KSUA 3AOEA 2BGKA 1TB4A 1PJLA 3TWOA 2GERA 4BNIA 1OAAA 1YS4A 4JJIA 1I2CA 4NU5A 1J5PA 2PZJA 4A27A 4RZHA 1P1HA 1DXYA 1LTHR 2VWGA 3JV7A 4GMFA 3JQ8A 1HEUA 2AQKA 2HCTA 1JDJA 1PGPA 1T1RA 4Z9XA 3NTOA 2HK9A 5B4TA 4E5MA 4PG8A 1LRKA 4BNNA 2EEZA 1XEAA 2WYUA 4TWRA 3C1TA 1A71A 4CMEC 3Q9UA 2C29D 4CMJA 2J5QA 4OQZA 3ZNOA 4MVJG 1KVUA 2X23A 4JROA 1ZZEA 5G0SA 5FYDA 3DQPA 4D46A 3WGQA 1AHHA 3AUUA 1JLLA 5B4VA 4Z0PA 2JFFA 3OSUA 2HQ1A 2Q1SA 1I3KA 2YJZA 3ICPA 4OXNA 1U3VA 2YQ5A 3LU1A 1G0NA 1DJNA 3RCBA 4ZHSA 5I9NA 4O0LA 4AJLA 1JVSA 3W6UA 3VH3A 4XGIA 4ZQEA 5JAMA 2RCYA 3ENNA 4QFDA 1YQXA 3G49A 5CDYA 2HU2A 1H0KA 2X8LA 5BNFA 2DBVO 5CHEA 3UGKA 2G17A 2CSUA 1PGOA 1NFFA 3JQAD 3OFSA 2VT2A 3AM5A 1YJ8A 2JCVA 3QWIA 1CETA 1SPXA 3JD1A 3L4BA 3B1FA 1NQTA 3GVCA 2JAPA 4ZD6A 3AY3A 2JFGA 1N1GA 2V6GA 3EVNA 1PJQA 4QQRA 5EQFA 3RIHA 3WQRA 1GADO 4GI2A 4KWHA 4WLOA 5CG2A 4D3SA 2PWZA 5JAZA 3V1UA 3NGXA 1VE9A 4CMEA 1XIVA 3IAHA 3AI3A 4UVHA 3F5QA 2F00A 1GY8A 2W2KB 3EC7A 3IP3A 3C7DB 3F46A 3BTOA 2BFMA 2GDZA 5I9MA 5EIOA 1B14A 3V8BA 2I3GA 1DSSG 1PIWA 4YAEA 2FHSA 4BNTA 1RWBA 1ADGA 4XYMA 4CM7A 1GV0A 5HRUA 1EQUA 3GAZA 3D3WB 3KTDA 3JTMA 3NV9A 1YL6A 5TLSA 3GEGA 4PRLA 1DC4A 3DDNA 2X6TA 5DBFA 4CMIA 4I1IA 1MC5A 3EY4A 4M55A 1KIFA 4PCVA 3MOGA 2O4CA 1M75A 3RSHA 2RH8A 4AJJA 3ASVA 2WYWA 5JMWA 1YL5A 2Y1OA 3D0OA 5HS6A 2NWQA 3QW2A 1R12A 1LX6A 1QR6A 4JIGA 2ZCVA 4CODB 4OH1A 1IPFA 2PKQO 3B20A 4YT2A 2GLXA 3PJGA 1GEGA 3GR6A 4J1SA 1O0SA 3GGOA 2DVMA 2GF2A 4D45A 4IZHA 4Q3DA 1KVSA 2FZWA 3CXRA 4FFRA 4IS2A 2E37A 3CE6A 4FB5A 1G6KA 4DVJA 2J3HA 3BMCA 4OM8A 3DZFA 3QJ5A 2CF5A 1AXGA 3LT4A 1ONPA 3G0OA 1EQ2A 3O8QA 4AJKA 1K6JA 1YQGA 3INRA 2X5OA 1GD1O 1HDXA 2RHCA 2YZ7A 4I9NA 1PJCA 3H5RA 4OIMA 3UFXA 3QWFA 4CQMB 3AWDA 4CLHA 2X86A 3GZNA 1LRLA 3IOYA 4E2WA 1GEEA 2HMWA 4PG7A 2WE7A 1VRWA 4LCJA 1K6XA 4YEDA 2BGLA 3DMTA 3UUWA 4EUFA 3SEFA 3K73O 1YWGO 2Q45A 4E2ZA 4GGOA 1KERA 3OIGA 3VZRA 4J7XA 1Y9EA 1MXFA 2W2LD 1UXGA 5TRTA 1DIGA 5A3JA 1D8AA 1MFZA 1R4NB 1VJ0A 5BQFA 4MVJP 2YQ4A 4MPDA 2AEMA 4J7UA 3GZ4A 5JCXA 1LDYA 4XCVA 1P1IA 3AM4A 4B7XA 3ZU3A 5TQVA 3RASA 2YW9A 3UKOA 3IDSA 2D0IA 3RU7A 4ALKA 1TLTA 2PFGA 1NHWA 1GZ4A 4XX0A 4CR7A 4CM8B 1JQBA 3DBRA 3RFVA 4E33A 1L1FA 3L9XA 3G17A 4IJWA 1P0FA 2BKAA 2C2XA 3ANNA 2D5AA 4NBVA 2H5LA 4YQZA 2NACA 1LQTA 5G0TA 2GYYA 3L4SO 2ZK7A 1NPYA 3GUCA 3ZHXA 5I8WA 4PG5A 5AXAA 4A03A 4CUKA 4PFJA 2HK7A 3KBOA 2B83A 4UVDA 3VH1A 4F45A 1SZJG 3I5MA 4PG6A 4MVJA 1XYGA 1ENOA 1FF9A 4ALIA 1HLPA 4I5FA 3U4DA 1V3TA 2FWMX 3A4VA 3DBLA 3HHPA 3A28A 3WMXA 5MGBA 1QRRA 3WB9A 3DZGA 1ZUD1 3PTZA 4DPMA 1B7GO 3JQ9C 3DWFA 1IL0A 1JKFA 2IODA 3FR8A 1U8XX 3OECA 5AXBA 4BV8A 3ANMA 3KYCA 5JPIA 4YAKA 1MUUA 1KYQA 2DBZA 1NQ5A 1RYEA 3QQPA 3NAQA 5L7YA 1ISGA 4ZQBA 1GDHA 4DYDA 1E3SA 4F6CA 4Z6KA 4FQ8A 5A9SB 1H2BA 3E18A 1GCOA 2VYVD 1HE2A 4GLOA 2VRBA 1M66A 4RZIA 2Z95A 3P2OA 1GYPA 3ZV5A 8ADHA 4ILKA 4NZ9A 1E5LA 1PWZA 3H7AA 4QUKA 1ONNA 2YFQA 4TRRA 2VRCD 4BO0A 3DR3A 1GZ3A 2FR0A 4QO8A 1XU7A 1I32A 1T2DA 5IDWA 4J1TA 2OZPA 4NBRA 4W9NC 1H93A 3QIVA 3K2EA 1OC4A 1J49A 1DRUA 5DN9A 2X0NA 2OBYA 2D4AA 4BO4A 1GUFA 5KIAA 2GO1A 3FNHA 3F4BA 2G5CA 4RDIA 4DQXA 3ZNQA 4LN1A 1C0IA 4FR5A 3W6ZA 1HXHA 3DZJA 4YRAA 1HDOA 1IYZA 4WCFC 3OH8A 3GRKA 3NT5A 2ZB7A 2IEBA 3LT2A 4KMSA 4U0JA 1DAPA 2A92A 2EW2A 1BHSA 3GC6A 4UREA 3SC6A 4DREA 1P33A 2IZZA 1HDRA 3UICA 4E6PA 5BSGA 3GZNB 1C1XB 4DLLA 4CQMA 2GCGA 5C3MA 4L8VA 5I8ZA 2IE0A 3RKUA 3W4KA 4WASA 2WEKA 3TZKA 3QE3A 2RIRA 3R6DA 4OKNA 4EUHA 3FN4A 4DBZA 3HB4X 4XRGA 1NNUA 4OJNA 1U7TA 4QO7A 5EMHA 3HFSA 5B37A 1DLIA 2O7SA 2E49A 5H82A 3WWYA 1NVGA 3F4LA 3MJTA 1ZJZA 2A9FA 2OOSA 3U62A 2AW5A 3C1OA 3K92A 4GX5A 1K6IA 4BNZA 1EBUA 1T4BA 1FK8A 4HUJA 2P9GA 1LQUA 3ZWCA 1LSUA 4FCCA 3GHHA 3KYDA 3L6DA 3MJVA 4Z3DA 1LUAA 4RF5A 1KY5A 4XQEA 2E4AA 1LA2A 2I66A 4WPGA 4LCEA 5IFLA 5IN5A 4F6LA 2PKQP 2P5YA 1H5QA 2HMUA 3D4OA 3KRTA 3QHAA 4B3IA 3HDJA 2X9VA 4CMIB 3EAGA 4CR6A 4LMPA 1UP4A 2Q4EA 2C20A 3ZWNA 4MKXA 2BH9A 4BMVA 4IPTA 3JQGA 1EK5A 1E3IA 3GY0A 4PZCA 4B3JA 1BWSA 3CTMA 9LDBA 5ICMA 4R5HA 1N2SA 1ZSVA 3T4XA 2DTDA 4TVOA 4XDYA 1FDSA 1WDLA 4KQWA 2OHXA 1K3TA 2VYVA 1PJ3A 2QG4A 1Y6JA 4S1VA 1OI7A 3ASUA 4HFJA 3HDQA 2Q1TA 3GLQA 1NASA 3MOIA 1DDOA 1EVIA 1NTOA 2DTEA 3V5NA 1E3WB 4MKZA 4W82A 4BO2A 1WNTA 3H5NA 1TT5B 4M1QA 3NKLA 3TOXA 2YUTA 5KKCA 3GDOA 1DIHA 3KLPX 4QXMA 1VC2A 3DL2A 1UAYA 2G0TA 1UZLA 4IMRA 4YJHA 1ML3A 3HJAA 3NDRA 1P9LA 1DBVO 1Y9AA 1W8DA 4NQZA 2IYOA 3D5QA 1P1JA 4Y8VA 4Z9FA 1H6DA 3GN2A 3ONDA 4QFCA 4GQAA 1R4MA 4OKIA 3JQAB 1NWCA 3CINA 4P4LA 3W8DA 4BUCA 1JU9A 2J3IA 3ZHYA 4TRMA 2CDAA 3U3XA 3OF2A 3PFWO 1ISMA 4AJIA 4CUZA 4HV4A 2X9NA 5DF1A 5A5EA 5KJ1A 1N8KA 2Y67A 3GK3A 3LZ6A 3ROKA 1PZGA 1VSVA 2D8AA 2O48X 5IF3A 2EKQA 5C37A 5L51A 3RUFA 4O63O 4XYEA 2PV7A 1BXKA 2WMDA 2VYND 4WLFA 4E30A 2ZYAA 4MVJF 3CZRA 4DTIA 3B70A 5A9SA 1O94A 1WP4A 1EEHA 2FOIA 1GYRA 4JBIA 3INTA 2WWRA 2VOEA 2X0RA 4J4BA 2V6FA 4BB6A 1KEWA 3KYCB 4YQYA 3ST7A 4HP8A 3H6KA 2GGSA 4YR9A 3DOOA 2ZIZA 1XR3A 3IP1A 1NVMB 1UXKA 3I6IA 5CDSA 3O26A 3KUXA 3QVOA 2NV6A 3ZWVA 2AQIA 2DFVA 2WSBA 4G65A 2J8ZA 4RVSA 3OJFA 4U0KA 5JY1A 1RM5A 5JE8A 3HADA 4BMSA 3CSDA 3B1JA 1KVRA 3ENKA 4R54A 4E5KA 2SCUA 1NP3A 3I9MA 2P4QA 2WYVA 4OSOA 3V1TC 3PWZA 3P2YA 3WNVA 2QYSA 2DBQA 2WJPA 3BMOA 4BNHA 2Q99A 1E6EA 5KJ6A 2WM3A 4AJOA 1G0OA 1KVTA 4CL8A 3L6EA 4U6SA 5GMOA 4IJUA 3RQSA 4FN4A 3RBZA 1D1TA 1ZW1A 1H9BA 2C59A 1DHTA 5DP2A 4CLOA 1ZEJA 2HMVA 1QMGA 4NFHA 4GX0A 1FMCA 1A7AA 3OBBA 3ON5A 3DAGA 1LDBA 1HDZA 2DU8A 3COSA 3IQDB 1QYDA 2AA3A 3P19A 3DONA 4EW6A 3BMQB 1EUZA 4K28A 5I7FA 2D59A 3DOCA 4MJLA 4BKOA 1VKNA 4M8SA 5FEUA 3PGXA 2NQ8A 2I99A 3PJEA 4I5DA 3GHYA 3FSRA 1PL7A 4BGEA 1VSUA 3DAFA 5JO0A 1R4NA 4XQ9A 5F1PA 4ZQHA 5TIIA 1UXJA 5DT9A 1NWHA 1E1MA 1GYQA 3QA9A 3GFGA 4CMCA 2B37A 1MXHA 4BNYA 1ORRA 2I67A 3JQGB 1VJ1A 4ROSA 4F3YA 3H4VA 4OHUA 1FJHA 1E1KA 4BHTA 1M76A 1U4SA 4NK5A 5JMPA 3K30A 5COQA 3WGHA 4U7WA 2NU7A 1NAHA 5IZCC 5K0ZA 5A03A 4D43A 2XXJA 2ZTMA 4KTTE 3WYEA 3N58A 4KZPA 4XR9A 5TJHA 5A5FA 4MOWA 3I3OA 1WWKA 4H16A 4TKLA 4L75A 5HA5A 1ZCJA 3IJPA 2OP1A 2BI8A 5AXCA 4BGVA 2PD6A 4GPD1 3PEFA 2PK3A 2GN8A 3C85A 4I8XA 4AG3A 4LRSB 1HE3A 4UULA 1IUKA 3DAPA 2WE8A 3SJUA 2G76A 2UAGA 2PH3A 4A0SA 1A72A 1E6WA 3BTUA 2GRAA 3JD3A 3VDRA 4NFSA 1JA9A 3ZWYA 3ZNNA 1NQOA 3KXDA 1V3UA 2O3UA 3C7CB 2ET6A 3BHMA 4RV9A 1PZEA 3Q2IA 3F3SA 1U2DA 1YBVA 1RPNA 2XXBA 4EITA 3U09A 4QECA 5L3ZA 2VHWA 1E1NA 1VJTA 4A7PA 5CDGA 3SLKA 4NHEA 1MG0A 1VLLA 3SXPA 3WXBA 3FBTA 1T25A 4NFYA 3ETDA 4WLUA 2Q49A 4WCDA 3KEQA 3GF4A 3UN1A 4CM4B 1Q7CA 3KSZO 3GEDA 1YQDA 2IDZA 5JAQA 2VTDA 4WLVA 5JS6A 2CMDA 1QLJA 4FGWA 2J5RA 3S55A 4Z3KA 2NTNA 1MGOA 4CMGA 2NU6A 3L77A 4M49A 5JC1A 4KUHA 3TFOA 2HLPA 4PG4A 1N9GB 1HDCA 3MTGA 4R4JA 3QVSA 3KEOA 3MZ0A 3GVHA 3QP9A 3BAZA 1AHIA 3KSDO 4NJMA 3QVWA 1KY4A 2B4QA 3E5RA 4LVCA 4WE3A 3ZV4A 2NTJA 5CFZA 3CMCO 2C7GA 2PZKA 3ROMA 1HSZA 1PQWA 1E77A 3LK7A 1GZ6A 3DEYX 3KETA 4WJZA 2X0IA 3W8FA 4HBGA 1BXGA 5BNIA 5DBIA 1UP6A 2C0CA 4IDBA 1V9LA 2VHZA 3AUAA 2Q2QA 4IBOA 4Q3CA 3E9MA 4DIFA 3F47A 5BNTA 1Z45A 4DMMA 3JYQA 5ICSA 3GGGA 1HDYA 4LK3A 3PFFA 1ISHA 4XIYA 3RAJA 1PS9A 1WVGA 3BMOB 1QKIA 1F06A 3U4CA 3ZHBA 4M86A 3ZWOA 5CAEA 2GZ1A 3FBGA 4NPCA 1HETA 3VAZA 1S7CA 2DPHA 1UDCA 2PTGA 4J4TA 2JKVA 2GPTA 4EJMA 4IXWA 4PIVA 3DMTC 4QT0A 3ZU4A 2J3KA 4KTVE 4RQUA 4IDFA 1FDVA 1E92A 3I52A 2HMSA 1XGKA 3Q6IA 4AJPA 1B2LA 4JN6B 3JYPA 3OJ0A 1JKIA 1H6AA 4K9DA 2OMEA 2IZ0A 3MJ4A 4DIOA 1I5RA 5CDUA 1GR0A 1FDTA 1Y1PA 1Z7EA 3H9GA 4DL9A 3RBVA 4CUJA 5ER9A 5U9CA 3C24A 3NJ8A 3ROPA 1GAEO 3GN1A 4AJ1A 5G4LA 4IJVA 2LDXA 1E3LA 2Z5LA 2EGGA 2HJSA 4TRJA 2BHLA 1EVYA 4BVAA 2YYYA 3RUDA 3TZHA 3VPGA 4IDCA 1O8CA 3QWBA 3JQ8B 4ZA2A 1ADBA 3SX2A 1LLQA 3JYNA 3NGLA 2NU8A 3PJDA 2P9CA 2ZB8A 3PJFA 2CF6A 3IKTA 1UDBA 3AI2A 4BMNA 4ND1A 1CIVA 1Y5RA 4UUPA 4A73A 4UUOA 5K9ZA 1X13A 3RUAA 4B7CA 4PLHA 2JAHA
chains in the Genus database with same CATH superfamily
1UMBA 4EGQA 3T5TA 4QTYA 4YUAA 4ARUA 1PX0A 3I5YA 2IPOA 3H1EA 1FFBA 5T67A 1K86A 2Q4DA 3E3AA 2BPOA 2HIGA 2PD4A 4WIAA 2CLIB 5H81A 4QUGA 1H0RA 4HC4A 4QU8A 5G41A 1TPZA 3OQBA 5JNRA 3S40A 3X2FA 1FVFA 2PGXA 2QNRA 1SIBE 3OQHA 2GZ2A 4DCSA 2NSJA 3WGVA 4F2GA 5CEJA 2SECE 5KYNA 4LMAA 4YC7A 2F48A 2YBDA 3ETJA 2WHYA 3RC7A 2ZREA 1GQ2A 1EFKA 4S0XA 3DHYA 2Q3FA 4M53A 4AUNA 3WXMA 1L5HB 2GWRA 2XOEA 3BFPA 3MELA 3WHPA 2DUNA 2PE5A 3FSGA 4JP8A 2QAGC 4BE4A 3O8QB 2FR8A 4X24A 1HLDA 3VV3A 1W88A 3QV2A 1QB8A 4J76A 1DS6A 2FSFA 3FFAA 3X1KA 4FWTA 3LDHA 1IHXA 2YS7A 2NTEA 2PS3A 4IJ6A 4BWYA 3WADA 2X0JA 3UYLA 1KU6A 4XIGS 4R6WA 1VSBA 1RWVA 1TJ3A 1PTJA 3UEOA 1SMKA 3B9PA 4NNJA 4NABA 3TAXA 1VDZA 5FLKA 3SIRA 4D9FA 3VVBA 1JLRA 2B94A 1H05A 4IKOA 5JD4A 2FLWA 2IEAA 3NWEA 1A7JA 2JIMA 1LBEA 1TJPB 4N4AA 1J2UA 4Q1VA 3TX6A 2BR5A 2LIVA 3OTOB 4AICA 2GPAA 3PYXA 4EZBA 4F71A 4TV8B 3LQ1A 1MC1A 2Z2XA 3A1NA 1E5DA 1NUQA 1Z0DA 2VZ8A 2FQQA 2R79A 5DO9A 2CYBA 4ZT5A 1CDZA 3CLSD 2WNSA 3KB1A 1N57A 2QGZA 4W9NA 5LYJA 3RYHB 3H0CA 1B3BA 1L4GA 4B6SA 1LWNA 1MJHA 1AKYA 2B4TO 3DEKA 2HIMA 3K6SA 5B3JA 2Q0QA 4D74A 2QN7A 2ZATA 4QPZA 1EP2B 4GLBA 2GPBA 4JT9A 2AR7A 3SFTA 3B5IA 4DW8A 2ZAIA 5CLHA 1MV8A 1PWYE 2DWPA 3RFXA 2OXIA 2PRSA 5EKSA 3Q7PA 5THQA 3OX3A 3HV0A 1L4UA 4YREA 1NVAA 2IH2A 1N8NA 5DEOA 1S2OA 3G0DA 2W6ID 2IZ7A 4Q24A 4S1TA 1N7HA 1UWLA 1G19A 2YJGA 3ROZA 4KR3A 1UKBA 3T1TA 2UXDB 3NYWA 2OZLB 1H1LA 2G40A 3QH4A 5ALXA 4KI0A 1Z8HA 2WMNB 5K0JA 4TLMB 2RH5A 1XEXA 1K98A 1JAIA 2HWUA 4PZZA 3MBOA 4RZQA 1AV7A 4PLCA 2D0DA 2HXGA 2OCLA 2YY7A 5SZKB 4DA8A 5BRJA 2BSQA 4KITB 1HURA 3OF5A 1Q7BA 4ZICA 2YNMD 1CEYA 3BE8A 5K51A 2QM0A 4JA0A 4Y2GA 3ABRB 1G3MA 1MEJA 3AR2A 3OURA 4UEJA 4CKWB 1SNYA 4KFTA 3QMPA 2H9AA 2WHXA 1ZW6A 2A0WA 2EIHA 2XVMA 3G8YA 5K3CA 4TZ6A 3STHA 4X8LA 4ZQIA 3G79A 1B23P 3BZUA 4PLGA 1R0KA 1QBGA 2WFLA 3OC6A 4CI0B 2BH2A 3IFSA 3EW7A 3TIXB 2Z5FA 1ZICA 4WOCA 3UXEA 5LB4A 1CF2O 5PGMA 2IHNA 3OO0A 1QIIA 4DKXA 2ZE6A 1K5DA 2WTBA 1M6YA 2QPTA 2PV0A 2WZBA 3G5LA 4F9GA 3Q8KA 4C7OB 2QLBA 3D6FA 3AR9A 3EZFA 3OKAA 5DI3B 4HZUB 2FH5B 4WOPA 5EG5A 2NAFA 1FP2A 3KKNA 2O1WA 2OZKA 3HN6A 4UKDA 2G28A 3FDZB 4JLWA 4JI5B 1RT9A 2RHLA 5G3ZA 1ISJA 4QOSA 3E3LA 1QIEA 2ZKLA 3FYSA 4DYHA 5L7TA 2PQ6A 1I7CB 1N8SA 3I1FA 4PYIA 3W77A 3TO5A 1BJRE 4BVEA 3V8PA 1I2ZA 4FOTA 1N7JA 4I46A 3W2IA 2GJSA 1KPIA 4MWCA 2ORVA 2PGDA 2Z5VA 3KOZA 3HWX1 3T5DA 3VYTB 4DG8A 1SVSA 1PGNA 1ZI9A 5C5IA 4OV6B 3F90A 3WBKA 2P62A 4HFMA 5ALUA 4DAEA 2VUUA 1XRMA 2BFDA 3SZGA 1NLUA 2QYTA 3OE5A 3JQBC 3EA0A 2O6LA 4ZPXA 1COWD 2WP0A 3GJYA 4KWIA 2FF5A 4RK1A 4V03A 3BXOA 5AVSA 3P9NA 2ABWA 2DWUA 4DUGD 2QW8A 4MYRA 3LO8A 1Z83A 5LBTA 4XIIA 4DBVO 1V43A 1JPUA 4MGZR 3CLRC 3JAKA 1XRJA 3L84A 4B2IA 1M67A 3G8BA 1DAIA 1JWBB 2GETA 4RV4A 4AM8A 2XQKA 4US2R 3ZCQA 2ZITA 5E38A 3C0KA 1LVHA 3AHIA 1WXIA 3FUUA 3L8ZA 1B8OA 2DWOA 3W4IA 4U7FA 1JSLA 1ZWKA 3JWEA 5DM0A 3BL6A 5JYFA 2RG7A 3PIDA 5BQ3A 1WW8A 1T24A 2I65A 3GJZA 2MSDB 5FUBA 2ZXFA 3AO0B 4HMQA 4H7FA 2DRIA 4AFNA 1P2FA 1RHMA 2G1UA 3NOXA 3RG2A 4JI2B 3GUUA 2XUPA 5EQTA 4ENRA 1DKUA 2ETXA 1YJQA 3NIFB 4NAHA 1ZM9A 5A0VA 3QYPA 1NPTO 1M2WA 2R25B 2CHQA 2HM7A 4MW4A 4AJ2A 2GN0A 2PUHA 4BRSA 1CEEA 3O8RA 1GFZA 2NNLD 2ZUBA 1KJQA 3L8GA 5DM70 4MV3A 3TOCA 1JNYA 1T4CA 1RS0A 3OLZA 1SBTA 3PCTA 4RTNA 4FM9A 1SQ0A 2QVZX 1AHNA 4Q4LA 5CDFA 4PBTA 4REOA 1MBZA 2K7ZA 5JXJA 2O8NA 5TX7A 2VTEA 3SQNA 4GPIB 1C1DA 2RSLA 1YB5A 4OXYA 2YUIA 4AX8A 1JE0A 5FV7A 1KHHA 1OFIA 3OTQA 2BSAA 4HK4A 1AXEA 3RC1A 1CDDA 4YI5A 1QMHA 1J1ZA 4H7IA 4GPAA 3S27A 1EUCA 1XTKA 1YC5A 2IYQA 4LRXA 1NOJA 4ETNA 2QM8A 5CXQA 2D5CA 4BKUA 3U6BA 2Z8YA 4RMJA 3N8HA 2YJ3A 1QOZA 4JJKA 2C5BA 4YMLA 3OMXA 4ZQGA 1YZGA 1GU1A 3OIDA 1HQYE 1N2IA 4KRGA 2VSQA 1T2UA 4YV7A 2NVBA 4L9AA 4LOKA 5HKKD 1SVNA 3W34A 3FTCA 4RF3A 5EWJA 1NM5C 1C0KA 1GL9B 1OJ7A 4GECA 1CUAA 2X77A 4G4SP 4RMNA 2RJOA 4GL4A 1E1YA 4HDMB 1BIFA 1SB9A 4TUYA 3OQ1A 5KTPA 5E1DA 2GZMA 4NYIR 1DPGA 1X87A 2UZ1A 2XUHA 2Y1DA 4MS3A 4NG5A 4TZ0A 5EIFA 1QCZA 4ITUA 4Q7QA 5FR2A 2HO5A 3BFKA 2Q4RA 4QAJA 4F3CA 3M6MD 3FYUA 1RD4A 1NNSA 2P3QA 4MYCA 3PC3A 1E9VA 1PO7A 4L5AA 3PXDA 3PRHA 4PLYA 2JK0A 2I2AA 3U4QB 3MQ2A 2I8LA 1P1RA 4IX1A 2L18A 4R8VA 3SC4A 3G02A 2X22A 5EKDA 5HKKA 1CLUA 2ZAOA 2B9EA 2D3WA 2CY0A 2XDQB 2E4UA 1E9EA 3A1EA 4GC9A 4QOHA 5E8JA 1M9NA 4JI3B 5L7WA 4X66B 1T5DX 1TK2A 3WGOA 3PQEA 4KOAA 2YMQA 4UCXA 1X7YB 1R6XA 2W0SA 3CG4A 3F6YA 3FZYA 4OXRA 2WQZA 2I76A 2V6MA 4KIGA 2BGWA 3EGOA 3OLVA 4D6XA 4EG1A 2POQX 5TMPA 3ASZA 2ZIGA 2XXAA 4NCIA 3A9RA 2R11A 2IHBA 1TE2A 5K0EA 1G1AA 3TTVA 3J81A 2ZQ5A 1QHFA 3D7KA 1E94E 2JLZA 3FGNA 3GOHA 4EDHA 4L8WB 2CNKA 3DLIA 4A92A 1TI7A 2P8SA 4GNKA 4O8CA 2WTEA 2YJ6A 3IHTA 2CDCA 2F43B 1VHLA 3A1UA 1V1RA 3M3HA 3N0WA 2ECOA 3JYHA 1TCUA 2JCYA 2XNSA 3MWLA 3RVJA 3ZDRA 1HV8A 1XAGA 2O7QA 3HXTA 1U3DA 4L7QA 4TQUS 5CU7A 4GP6A 4GGMX 3RHTA 2ZI5A 4I3HA 2F1OA 3CX4A 1KYWA 1XPOA 3OESA 2JGDB 3WQQA 1QZZA 3IKLA 4NHOA 3NAMA 4W8GA 5AJZA 1MT3A 2H7XA 1O5IA 3KHTA 4HUQB 4P83A 1N2XA 5TXGA 5JSHA 2ENWA 2WPDA 3KVYA 3B3AA 3O7WA 4PYRA 5E2BA 2BHTA 1MEOA 2QPLA 4B47A 5CB4A 4KQMA 3CZAA 4UM8B 4DABA 4QATA 4KH0A 2IX9A 1QO7A 4HDKA 2CHFA 1VB5A 2Q5LA 3AHGA 3EQ6A 1ZO8A 3D6TB 3HNRA 2C8VA 5H9WA 5K6AA 1F4VA 1Q50A 2EFYA 3E7XA 4ADSG 2H2GA 3ZHOA 1U04A 1Q92A 3TE6A 4DLPA 1MC8A 4G23A 1DV1A 4MWGA 4L76A 2P91A 5LZ9A 1QVRA 1XKTA 2F3TA 3EXHC 4KRXA 4YRBA 5J4KA 3VKVA 1KFJB 4LE1A 3GDGA 1IY9A 3HUTA 2BF4A 4HLNA 1E0AA 4KREA 4AKEA 2EG9A 1E9FA 3CF4A 5EXSA 3RSQA 2C03A 5IAEA 1R1DA 2Q3BA 3L8YA 4UQLA 3DDSA 1R7RA 2QX8A 2X5XA 5SZIA 1QSGA 1B73A 1T0HB 2HAEA 4LJ5A 4WNIA 4QUAA 4C5AA 4G0UA 1L1EA 3Q4GA 1FFYA 3F1KA 4Q9AA 1YZVA 2PX3A 2ZIWB 1F0NA 1VKOA 1Z16A 1NFQA 1U8AA 5EZYB 4R2WA 1KZ9A 1ZL2A 4RHYA 4O2LA 2GFHA 4IIUA 4B6OA 3HSKA 1TZ2A 3LV8A 3OCZA 4N5MA 1UP7A 5TPZA 1H1DA 2OD7A 1V6AA 3ZXIA 3QJYA 4HRYA 5HQ3A 3S81A 3ELUA 5CB6A 1N7GA 3SN6A 3N39C 3AP2A 5FYQA 3ZQUA 3ZJTA 3AUKA 1OBCA 1S2GA 3CSUA 2Q1UA 1PJ8A 2GAAA 3N74A 1QG2A 1UQTA 5HK9A 2B7LA 1PU2A 3KR9A 4BP9A 3K9WA 1IOVA 4BATA 4DCPA 1MLDA 2PL9A 2YWFA 3F7TA 4EB3A 3T3NA 5C8DA 3FAZA 1YIOA 4EENA 1YRQA 4MB6A 4D4IA 1AZSC 1EFUA 4LYYA 3VDQA 1IMJA 1THGA 5F2KA 3R44A 3HDTA 4PTYA 1I7DA 4CQNA 2FSVA 2Y1GA 5TPZD 4JY7A 4LRUA 5FOSA 3UENA 3DMYA 2BGMA 2AJBA 1BW9A 2FUKA 4R5MA 5H16A 4QICA 5BVGA 5EN4A 4X3PA 1ZK2A 1LPNA 2QWXA 5ADWA 1RM0A 4FEEA 2JGRA 4B8ZA 4UOEA 4XVUA 4UBJA 2CD9A 4KLRA 4TMKA 1ESEA 4AWBA 1T4DA 5KMGA 1V71A 4KQGA 4CDMA 2RBEA 1V0JA 1QLWA 4BVFA 4WOKA 4XVHA 1EJ0A 4IM7A 5DZSA 2PX2A 1IN5A 2C4MA 2BY4A 2GD1O 3B36A 1UYJA 1T1GA 4QEDA 4K6KA 1UXOA 2JIZD 1R9GA 1RHRA 3IPXA 1RLUA 4FEYA 1Y4AE 4Q1CA 2G9NA 4RGQA 1DPFA 1FTYA 1PWXA 2PXAA 5JUWA 4JVLA 3OZAA 2FV8A 2XNDA 4H3VA 2AV6A 3FPGA 5BPFA 1FFGA 2NVUB 5TMEA 4WBNB 5J2UF 4BFLA 3BPSA 1M8GA 1P1KA 4N6OA 5KJEA 4JVNA 3NIGB 4YCAA 3RRZA 4DSNA 1TVEA 2Z3VA 4U2BA 5G4KB 4FP9A 1WMDA 1O95A 5G2OA 1L5OA 3Q5EA 3U49A 4BFCA 2Z3ZA 4QELA 3LY8A 5TPWB 5JCJA 1Z33A 3AF4A 3KQHA 2XA2A 4YVFA 5LOVB 1BVUA 1GTVA 2EATA 2VSFA 3VDNB 3QUTA 2WWFA 1CUHA 3GWGA 2C2HA 1XJ0A 1B2RA 1YIAA 1UH5A 2ZYSA 4BN4A 3RSCA 1PGQA 4DMCA 5ESWA 1D2AA 3AFHA 3K2IA 1R0BA 3Q5DA 4IGEA 2B1RA 3TAUA 1R74A 4IO1A 5B55A 2ZT8A 4D9MA 1JT9A 4DLUA 3KXPA 5BYBA 1AKVA 1SKYB 3TLYA 3UAXA 4BE7B 2E6KA 2DM6A 4YA6A 3DZ5B 1WD5A 4QXPA 3VZBA 4DXHA 1X42A 4LHXA 2VT3A 3JARA 1FPMA 1DIRA 3I0NA 1SK9A 5DNYB 4X84A 5BQOA 2Q3EA 3AF6A 5BNZA 3BEDA 2DFLA 4B1FA 4Y2RA 4WESB 2QLJA 1CQJA 2K87A 3D02A 2SKCA 2GJ4A 4FFMA 1YXMA 1UBGA 4XJSA 1MX3A 1ZXBA 4NENB 5DOVA 1MX9A 4BZWA 4C21A 1CKEA 3QIAA 4UXIA 1A27A 2AG1A 3N8NA 2HLNA 5FWYB 2RGNA 1ZRSA 4JT2A 4N9QA 4LV8B 1ODFA 1NLZA 3O8DA 3UAYA 3WIEA 3TNLA 4YUYA 1JXQA 1I24A 2IDMA 3W5VA 1PSDA 4D3XA 5BW8A 3EISA 1TJYA 3PTAA 4D81A 4FE3A 2O8DB 4B9EA 2BLNA 2MJLA 3ONNA 2ZYHA 2CCGA 3HGMA 3CT4A 3DS8A 3GVIA 5I7SA 1NSTA 3NIBA 3EP3B 4C6HA 2XDYA 3TUTA 1QYCA 1SQFA 2EWMA 4IV0A 2FX2A 4M0MA 1EZZA 4OOEA 1EX7A 3W8RA 4EFDA 3IAFA 1NUTA 1FS4A 4OQDA 5AI6A 2OT3B 3VNVA 1SBHA 1N0IA 1QQTA 3WX0A 5KTKA 3DV0B 3IIMA 1QH8A 1IEVA 1W6RA 2V7XA 2A67A 3DBHA 4FK8A 4CLEA 4DLYA 4GI1A 4YXWA 3MMPA 1PNOA 4YMVA 2X5KO 1JQJC 3O82A 1GPJA 3Q88A 5HTKA 3TGWA 4D2IA 1PR9A 1SCQA 2IXGA 2PHZA 5ED4A 2AF4C 2NVUA 3GQVA 2NV0A 4EO4A 1KJYA 4OUDB 4GX2A 1LDEA 3H0EA 2R7KA 3QVGA 1LS6A 2R8EA 3P26A 3AMVA 4MYHA 3CUKA 1VKHA 3JCZA 3NU1A 4KIJA 4AXXA 4E46A 3H4MA 4EPWA 4O1HA 3FKSD 1PNQA 4ZRNA 1PK7A 4RPGA 4YRKA 4OHMA 2QDXA 3F0TA 1KAHA 1DAKA 1R27A 2YXNA 4C2BA 4DN6A 2OQIA 3DOJA 4PQEA 1TM5E 4FW8A 7YASA 4JC0A 3NTUA 2HJGA 2H16A 2V5VA 4GYWA 1NQAO 2NO6A 3ANLA 4POAA 3GLFA 3KHUA 1YF3A 1QUEA 1UBMS 3DOFA 4AULA 3AVTA 4P82A 4IILA 3BWVA 3RS2A 3T34A 2WIAA 4K2AA 1ZSYA 2IH4A 1B0UA 4N18A 4U4AA 2FCRA 5BSWA 1AQLA 2NXWA 1D2EA 1JDBB 1U02A 4BLQA 1CEXA 3A9UA 1F60A 4ZHQB 5CIWA 3P2JA 2BEWB 1OTHA 2VCYA 1LLUA 5L4SA 1KEVA 1Z6QA 1E5XA 2OBMA 3RTGA 1P0PA 4ZVNA 4ENWA 3OCVA 3MPUA 5SYMA 2C4NA 4C7KA 4K9NA 1V3VA 1GN8A 4KO4S 4WFJA 1SAYA 3V1NA 3CZ9A 3LK6A 1DVRA 4DS3A 2C4WA 4KDFA 5DOZA 1GKYA 2FP4A 3PQFA 5U9CA 1T2NA 1YL7A 5AUNB 3LL7A 4IR7A 2E82A 1JR3D 1T29A 2GCEA 1EFDN 3K35A 3SAJA 1Z37A 4MEJA 3TR6A 4U63A 2BFFA 2IOFK 3E5HA 3HG7A 4CLRA 3OPYA 4FFBB 1VG9B 2QY9A 4QJIA 2DPGA 5YASA 1EG2A 3RIMA 2CUZA 1JAZA 1EHIA 1GZHB 4J0IA 3OIFA 5EZYA 4UU1A 4A26A 2HIHA 3A1SA 1ZJYA 2CUTA 4O4LA 3BHJA 1I9CA 3DEZA 4DQLA 4HDAA 3ZN2A 3KXIA 1PT6A 2Z0MA 1IBSA 2AQHA 1PR2A 5BWOA 4G5OA 5AHKA 3TZLA 5KJFA 3AUFA 5DBGA 1ZH8A 3DZ6B 4G9GA 4B7ZA 2DUMA 4RNCA 2NPFA 4N5IX 1C8VB 2YWHA 4LA4A 3Q7EA 5FTNA 1YOVB 1ELOA 3K94A 3F98A 5AHRA 3LVRE 1YO6A 1DTEA 1AKEA 4Q39A 1VBNA 1ZNQO 1P29A 3O83A 2GM5A 4LRWA 3O4RA 2OG2A 1DBSA 4RCZA 3OEYA 4FKBA 3MCAA 3SJCA 1I2BA 2DQ4A 4TV9B 1SU8A 3KSBC 1N9GA 1W0KD 1X9GA 1GU0A 3H9UA 2JGEA 2EJWA 1IUNA 3DXFA 3I5AA 5TJ9A 2D7CA 2HO4A 2O2SA 4FBGA 3IB6A 4G25A 4MJXA 4YLGA 2C94A 3RRMA 4PPNA 4Z4IA 1Y3HA 1ZLXA 5CGZA 1L4KA 3O4IA 3A1CA 4LDJA 3FZGA 2JFXA 4MHOA 5CAEB 5JCPA 3EVTA 2O3JA 4K7JA 3TX2A 1OFUX 1RCTE 4PSAA 4D92A 3HVJA 5KAMA 3ZV6A 4A6PA 4TXNA 1H2HA 2CDRA 4YRRA 4M8KA 4RGYA 2YXEA 1SCBA 1V8DA 3QVTA 2O1XA 3UGJA 3CN7A 1O54A 3RVLA 2Q2VA 4CM8A 2D2EA 5CA0F 8MHTA 1S6YA 3L0DA 2D1SA 3N86A 1HL3A 3CZCA 3FTPA 1KAGA 5AXDA 3LBHA 4PYLA 5U1PA 2Q5CA 3ZGVA 2XB8A 3LCRA 1CPYA 4BQSA 2B2XA 5EE5B 3ZWAA 2VYFA 4OYHA 2R96A 1QP7A 3IUEA 1D9ZA 3GFVA 3QBDA 4PF1A 1G20E 3RTAA 4P36A 3ZY3A 1JFLA 3PDUA 4IVRA 1Q21A 1WDKA 4BVGA 2BGJA 4DG5A 3TTSA 2DWCA 1TYEB 1Q0PA 3LA8A 1P45A 4B3DA 1Y1RA 3T9EA 4HNQA 2B61A 3ZQJA 2XVXA 4NU6A 1IBKB 4LC9A 1ZOIA 3GNTA 4U7DA 4BB0A 1AN9A 2Y66A 3A9TA 3EOBI 1PR1A 2MYTA 5A0TA 3PE6A 4ER3A 2VA9A 2VK4A 2P3OA 3FNGA 2ZRLA 3NHAA 2J7PD 1GLGA 1CIJA 2ZDQA 1L4EA 1XL0A 1NDUA 5B7NA 3JD0A 5F1KA 4HGPA 4PHFA 2EFGA 2FZ4A 2ZDHA 4J49A 1NOIA 1WY5A 3V2HA 4EF6A 2PU7A 3B1VA 1E3JA 3IVRA 5I9IA 4DV7B 1TD9A 2O23A 3QKSB 2X7HA 4MP6A 4Y1GA 5BV1A 3DTTA 2XBUA 3NDJA 1S4QA 3V1YA 1DZIA 5FORA 4XZ3A 3BMCB 4Q1AA 4BP3A 3FSEA 4E70A 3IMKA 1DG1G 1X1DA 4PSDA 1XHLA 1K4KA 3ONVA 4UMEA 4N47A 4ZEOA 1A8QA 1U1GA 2R4QA 4PAQA 4RIHA 1A2OA 3HFRA 3TZQA 2QD3A 5CW2A 4W5JA 1R6TA 3D7RA 3GYBA 2J3LA 4ZZ2A 3UCXA 2GTPA 2V54A 5AOVA 3M3PA 4C5CA 2AUNA 3MERA 2ZJ2A 4P35A 1N5KA 5DLQC 3HY6A 1X7XA 2KBFA 1F17A 1U0TA 3P97A 3CLHA 5JJCA 4L07A 2AFVA 4U8HA 2WMYA 2PUAA 2ZTUA 4Y2SA 4KPUA 5LLSA 3DWEX 1ITZA 1E2GA 3ECCA 3LE8A 4B79A 4EG6A 4UE6A 1SG9A 3GQBA 2PYIA 4ESOA 5CFLA 4OGWA 4KP7A 2B1JA 4QG3A 1P0QA 1L3IA 4YJ2F 4KVAA 4RTQA 4LAFA 1R0CA 1BH6A 2FW1A 3JQFC 1E89A 1HH4A 1XD2A 4EG7A 5KVVA 3J80A 1Z6AA 4TXHA 1C3XA 3MTQA 3GBVA 1DC8A 3SY8A 3KCNA 3LBFA 4KKXB 1CXZA 3R3UA 4FXPA 4GLLA 4S1OA 4YCNA 2G1JA 1Y82A 1IK4A 1EIWA 3HCNA 5KEIA 4K9LA 4XEUA 2ARKA 4KPFC 5ALNA 1ISFA 5BT8A 2FW6A 5AJTA 2OGZA 2DECA 3PXEA 5TNXA 3ZLTA 4P0PB 2CLMB 2WUDA 4OB7A 5ULLA 4NK4A 4CIXA 1BE6A 2GT1A 3GNSA 3JU3A 4GZMA 3UQZA 1KZ4A 1HE4A 5JISA 5FRDA 3SQMA 4ZFNA 3VGPA 4O5OA 4NCXA 4GXNA 5AM3A 3GT7A 2IYSA 1XQ1A 2I2XB 4ZYTA 4N5NA 3BILA 4U2GA 2J07A 4IKEA 3TQRA 1IZ0A 3FSGD 2AR9A 3OEHD 4RH0A 4E5PA 2INGX 4WINA 3SE0A 1EXWA 1M1UA 1RQRA 1YJAA 2Z9DA 3BMQA 2JLVA 2V0CA 2WHEA 2VBGA 2IVFA 3K2QA 3KX2A 4WNAA 5ARCA 3V4ZA 4BUZA 1K89A 3FI9A 1YT5A 1XU4A 1E9RA 1PGJA 4KWTA 5LZ4A 1ULAA 4ZVLA 3IEUA 2GZHA 1Z9BA 1Y80A 3I73A 3BDAA 1F0PA 3E05A 1KJZA 3GGCA 2IYUA 5FCDA 4CL3A 5A1TA 1P5HA 3ZPXA 2F3QA 4B87A 1NXPA 1K08A 1W4ZA 4DMHA 1VL8A 1LF0A 1N3BA 1W35A 3DJYA 3LXXA 3OJWA 3W7VA 3OBIA 1YDMA 4X7RA 1EUQA 1JIIA 3LWNA 4R84A 4RSRA 4V3CA 4RVOA 3WGLA 2PXCA 4YT8A 3JSAA 5ITZB 1PZMA 2X2PA 3A7EA 1O9BA 3DE3X 4AJ9A 3SEZA 3TCKA 1SEPA 4CKYA 5F21A 2QM3A 3P0JA 4MTLA 2AFIE 4QODA 1AS3A 3FDZA 1KTIA 1R9NA 4N41A 3VHQA 3GZJA 3CGWA 2GM4A 4C78A 3PDJA 3L82B 3ZWDA 2YRWA 4BNWA 2HA7A 4RD3A 4EHBA 4G8CA 1ODIA 1CUFA 1ESZA 1OC2A 4P31A 4AS2A 4HQ6A 1WO8A 1Y8RB 2PBFA 4L3VA 4MV0A 3OWOA 4CT4B 4RPJA 4D3DA 5B3JC 3RADC 2CL5A 2WF9A 1D7OA 1DADA 4F06A 1KR2A 4PIPA 1G41A 2Y1CA 1GG9A 3AW9A 1R8XA 3PC6A 2QTBA 3P0FA 4A6XA 1E3WA 3F5SA 4LOIA 3OQNA 3MTEA 4RMGA 1DJQA 2JGAA 1SIOA 1BHQ1 1SC6A 4L74A 4EQZA 5J2TA 1UEIA 4IQ0A 1YA8A 1RXUA 3ETEA 3ICCA 3UKJA 4QDZA 4C87A 8AT1A 3OY7A 3ZCTA 4IH1A 1M8JA 3GRVA 2RHWA 3GEMA 1TC1A 4PE5B 2RJ3A 4GVXA 3KEFA 3X2EA 4EW3A 2P4EA 1UWCA 3BJRA 1U9ZA 1MAWA 1NW3A 2HPAA 1TA4A 2FW8A 2XYRA 3LF1A 4OYLA 3T95A 1C9NA 2R00C 2BZ0A 4JWTA 4ZO6A 1WU8A 4CM6A 1DHRA 1JDTA 3WRVA 2OZLA 5I7OA 4TT3D 3DLCA 4LTDA 1KSHA 4BX3A 2GVZC 2ZYRA 3N3AC 2V7PA 2YHSA 4CG3A 9ABPA 5TS3A 4KX5A 3JATB 3IULA 4W1QA 3VO9A 3OPXA 4HN4B 2PUDA 1KBQA 4JYZA 3OIUA 5IN4A 2JGKA 1AKUA 1WUJS 4E1BA 1PYOA 2LTAA 3KU1A 3K6SB 2OXFA 2YIJA 1JSXA 2Y1EA 3AY7A 4YAUA 4DIBA 4RSGA 4TSKA 5JZBA 4GL2A 1EK1A 1B74A 3FIJA 2Q3MA 2FGKA 2FUEA 3MWEA 2KJQA 2VOJA 4XYBA 3B52X 3B8EA 5H3CA 3AG6A 4YRDA 1F14A 3EC2A 4O4IB 5JZ9A 4DM4A 3VRHA 1RI2A 5T5QA 4OF4A 4ALMA 2FVYA 3R77A 1JSZA 1S2MA 4JP3A 2J0UB 3MS7A 1P61B 4QG7A 5DXJA 5F9MA 2CMHA 1Q1EA 1JBQA 4RKWA 3RWBA 4E12A 1G7TA 1UKVY 2AN5A 4RFLA 3GLUA 1E9CA 2RHDA 4BNLA 4C0KA 2O8DA 5ER6A 1YULA 3A10A 4PZLA 3ZDQA 4LF6B 1EE1A 2IPNA 4JX8A 1LSSA 1SHZA 2CYCA 3PBKA 5F7ZA 2H1HA 4GMXA 2RHRA 5EUCA 3H3FA 5IVIA 3W6PA 1E5TA 2I1QA 4G3XA 1Q1NA 1TM7E 3TI9A 2JGIA 4EFMA 3EBPA 3IUJA 3WNQA 5FEMA 5ADHA 2X4GA 1WIWA 1OOEA 2BI7A 2H1SA 2VUSA 1BGVA 1COWA 2W98A 3O38A 2J32A 3VHXA 1W73A 4BJ5A 5M2QA 2P40A 5KOYA 2K2QB 2WKSA 4DUPA 3LUCA 1P3DA 1SCJA 5LL6P 1TKAA 1B26A 1D2CA 1O5OA 2OOKA 4FC6A 5EIBC 1EQAA 1BEZA 5CYFA 1AURA 1JZSA 3CISA 3BM5A 4XGNA 5P21A 8OHMA 2Q5IA 2FI1A 4YYZA 2IUUA 3S0JA 1UBHS 1DRVA 4CM9A 4D8VA 4DQ0A 3MTDA 2CNNA 3V4PB 1SA0A 4TLBA 3HJGA 4F5YA 2XUKA 4F5EA 3N87A 3I3SR 1RSZA 2OWEA 4EUSA 3QPCA 2HU8A 1CUJA 2P9EA 1CULC 1Q1GA 2R47A 3FPLA 2FWRA 5L45A 5DNVA 1HO3A 4X7MA 3GPDG 3EVDA 3HM9A 3UXHA 1YK0A 3D0RA 4TTPA 2O8FA 5K0CA 1KYXA 2I4RA 3KV1A 2Z6UA 3FUTA 5CH5A 4QUDA 1D2HA 2REQA 1AY0A 2FXIA 3I9JA 3KALA 2QE7D 5G4KA 2HQOA 3JWPA 1QE5A 4YDRA 1EDZA 5I3ZA 4MVJD 3EH2A 4ZZ3A 1JEYA 5MF6A 3HFGA 4XIFA 5F35A 4IG9A 3T7EA 2QVGA 3HA7A 2WD7A 1GP2A 1ZGHA 1T1SA 2CMKA 2G1KA 3TRIA 1DAOA 2C4TA 3EVFA 2BP7B 5D3QA 3T35A 4IGFA 3J7AC 1S96A 4LFAB 4Z8YA 5JDCC 1QHNA 3KLMX 1MC4A 1JTVA 3RO7A 2OM2A 2PUTA 3VR4A 3LC2O 1COZA 3IQWA 3WKAA 5CVCA 3H11A 1D6NA 4CKEB 2HFJA 2BGGA 2X1MA 2QSYA 3E84A 1ENZA 2GYUA 3TW8A 2G5TA 1LI5A 1EDOA 1M1YA 2CB0A 4TMVA 3AB7A 3SYNA 4YUZA 2WTUA 2NP6A 2NU9B 3MXOA 4LMBA 1FDUA 3M9XA 1LSOA 3Q2OA 4QNRA 1CFJA 3IEPA 1ZVJA 5IKOA 1H66A 4NVRA 2HWWA 4IICA 4OQQA 4JBHA 1OH5A 2KE5A 2KHZA 1DMRA 5HYVA 4N76A 1NZDA 4FGJA 3VBCA 4N3CA 1E69A 3O2QB 1LSJA 1W0CA 2OV2A 1F8XA 4W99A 1U28C 1TEHA 3TL3A 1M6VA 2ZYGA 5ICFA 1NHGA 3IKJA 3DKKA 2C04A 1H0HA 5G0UA 1HWYA 2G83A 3LLVA 2HC9A 4OL0A 3DKVA 3ISVA 4CT0A 1L7RA 4MQ4A 4KBYA 4A1FA 2HREA 2P6RA 2F2TA 1UFVA 3RGWS 3DE2X 3KR1A 5D3KA 3R0ZA 1A4IA 1IY8A 3EP5B 3UHAA 4YLEA 4GYKA 1SD1A 2ORIA 4FS8A 3MTJA 3SYTA 3WBBA 2IPMA 1WQ4A 2QTWB 3K9GA 4X54A 1B8PA 1SUSA 5JXHA 1P39A 5L40A 1QC5A 2OCGA 4B45A 4BQIA 2C61A 1H5UA 1CD5A 4J6EA 4BLRA 2G9QA 4DA7A 3R7AA 2H4HA 4QBFA 1H0SA 1SBIA 2C0QA 1X7HA 2I2CA 1DQNA 3PXXA 1BA2A 1OFHA 1LCIA 4GIBA 4H9GA 3P94A 4NJOA 4OXKA 1L5LA 3WIUA 2HPZA 4TSFA 4UBKA 2YV1A 3WK9A 3LJKA 3PWKA 2MMCA 4HDCA 4DIUA 5I48A 5MDHA 1PJAA 1NP6A 1QGYA 4KQKA 4HN2A 4LHYA 4U1RA 3V2UA 1MKYA 1QYRA 4R1TA 4XB2A 1FZQA 5SY9A 3VZDA 4ND3A 3AEXA 2WD7B 3SHVA 2GYVA 4IS3A 4XPZA 5K3SA 4YK7A 3WLHA 4GKKB 4OQFA 4RJLA 3DZ3B 2JRLA 4R3NA 2Y1LA 4H3SA 2IT1A 3QY0A 4ITRC 3V6MA 3DBLB 1RYHA 3WV4A 4WXRA 2PWBA 5JBNA 2RGDA 3BKXA 2V1UA 4Z4FA 3OT5A 1U0NA 2Y71A 3NHPA 5JNLA 2BEVA 2P4HX 3OM1A 3CBQA 1U9IA 1E1RD 1GM5A 1FS5A 3K9HA 3GLGE 3V32A 1DQZA 1E2UA 2ZSIA 1W5SA 1HYGA 2JFZA 2WPDD 4CCWA 4ZI7A 3KJIA 3OCXA 2O9JA 3K1YA 3JPWA 5GZ3A 1SA0B 4Z4CA 2P35A 1H2WA 1Z6ZA 3GJ5A 1ODTC 4WCFA 3KWLA 3QHQA 4KU4A 2X7XA 3L49A 1QMIA 1X3SA 2PMWB 4Q1DA 2PA3A 4M0EA 4XVQA 3RRNA 4DBLE 3HEBA 1HE5A 1WXXA 1TAHA 3AF0A 5AQ1A 3QNUA 4KLAA 4GUAA 3QLJA 1J6UA 4A5OA 2PZGA 3PNPA 4I6GA 3T9AA 3WICA 2QMEA 4J8PA 1NPDA 1O8BA 4K6OA 2OV6A 4M76B 3L0OA 3TJRA 4BQPA 2W6JA 4X5OA 3DOEA 2QUZA 2I7CA 2O5RA 3U7RA 3MMZA 5KWSA 3HO1A 3G5TA 3PD1A 4HQRA 3STYA 1DBQA 2H48A 4XASA 1ID1A 2QRUA 3Q9NA 3U1TA 1NJGA 3EVGA 2G1AA 2A9PA 2IJGX 3ESDA 5AI8A 4IWNA 4HDRB 1VYTA 4GRAA 3RSFA 3WSWA 1KO5A 4DC0A 3H99A 2C95A 3VQTA 1AO3A 1RWQA 2B1IA 1RHKA 2GKGA 4NKRA 4X20A 1BCSB 4GXRA 1KEPA 5FBVB 3MW8A 4LGMA 1EPUA 1M2VB 2J59A 2OUKA 1XVTA 3O9MA 1K5PA 1JZQA 2PRZA 5D6NA 3GJQA 4FFOA 1I1QB 1IN6A 2FW7A 3P71T 2GEBA 3MWEB 3JYOA 3V4VB 3IXMA 5KNCA 2CFRA 5HWSA 1XTPA 3DV2A 4XEHA 2JHAA 3DOHA 2A0KA 2EJVA 1RQGA 3I34X 4LJ4A 2TMGA 5H80A 4PYOA 3VTFA 1BMTA 1CUSA 4D57A 2A58A 3CUWA 1YBHA 1ZA1A 4DLWA 4E6EA 5JLJA 3DBIA 5D51S 1NIJA 4KMOA 2JK1A 5H59A 2WIBA 1HYHA 2PAAA 2UZ1B 1DO8A 2AZXA 2Y8EA 1QG0A 3EVZA 3MWDB 1R15A 1KQGA 5C8YA 1DARA 2ZJZA 4HRAA 1KQPA 1U2QA 1ZM2A 2VP3A 4II2A 5F2OA 1XMQB 3IV7A 2GR9A 5C7YA 5IJ0A 1MB0A 5AM5A 3KWFA 4JGIA 5T3YA 3BMNB 5CFOA 3N7AA 4OI4A 1MPTA 1CHDA 1U2GC 1GTRA 2BCGY 3ERCA 3DULA 1VE6A 4YFVA 4CQMD 3GD7A 1GUZA 5CJPA 1VMKA 2WOJA 3GCGA 1UOEA 2ODQA 1XDBA 3OEED 2P9QA 1WCWA 3QU5A 4M38A 2ZWPA 2CHVA 3EP8B 2C8LA 1C9DB 2DPMA 3DFFA 4JA2A 4RM2A 4Q9JA 3T0GA 3C8MA 4GP7A 5K0FA 1L8OA 3B89A 1TCAA 4CIYA 1B1AA 1Z4MA 3NJRA 3MCZA 3HYRA 1VE5A 1PEDA 5FNZA 3O8CA 4LJ9A 4TUYF 5BSTA 2J9GA 4FN5A 1VPDA 4EELA 3WQSB 1U5CA 3TL2A 2C7VA 1FNDA 1NC3A 4RW0A 2EHJA 4ZRDA 2P68A 1NXQA 4URXR 4TMXA 1BTOA 3R0JA 4P4SB 5F4BA 4XJTA 4IIXA 1VZ2A 4S12A 1E2MA 1SXJB 1U80A 4PQRA 3E7WA 1XXLA 4KK3A 2JD2A 1ZUWA 2R8ZA 4RD0A 5IZ4A 5JZMA 5LP1A 3PQ6A 3DUFA 4D56A 1XVIA 1JGTA 2H4XA 4HGRA 4RKRA 1Z4NA 3IV9A 3MFYA 1RQ2A 2CZGA 2Z2JA 3Q7RA 1T1IA 4BB6A 4QM6A 1O95D 5GVRA 1XPJA 1DTWB 3C2QA 5CK4A 3TLMA 1TB4A 1XQ9A 4H7JA 4OJYA 1OAAA 4JJIA 2XWBF 2P1DA 1FNNA 1V6CA 1J5PA 1R0YA 1W49A 2ID4A 4KI7A 5AKLA 2PZJA 2UZIR 3L0PA 1T9DA 3B7GA 3FWYA 3UTCA 3ZX5A 2VWGA 4KFSA 3JV7A 4GMFA 1J0DA 2PLNA 3R23A 4UHCA 3GDHA 4IEEA 3VR4D 5IM4F 1T1RA 2CNDA 1K97A 2FQWA 2HK9A 2WG0A 2ZAYA 3BAFA 3L8HA 1VYHA 4UBNA 4WZBA 1BX3A 4OBBA 2AF3C 1W5FA 4GPTA 4YDHB 2XT0A 1DO2A 1EZ1A 4YRMA 1PTJC 3NHYA 3DPUA 2Q5JA 4JSYA 4R2XA 4CMJA 3T99A 1LFAA 1ZA2A 1P8JA 3UA3A 2CNLA 4WN9A 2QN6A 1ZNWA 1GAWA 1UBKS 4MR7B 2PMEA 3VAYA 2NMVA 4X7PA 1JLLA 1KAEA 2I80A 4V0RA 2A7XA 4Z0PA 3VPBA 2WTXA 5B4VA 2RKWA 5JXGA 3GELA 2RK4A 3WK7A 3WKDA 3Q41A 3LU1A 1X1CA 5HUHA 4ZHSA 3ZDXB 4WGFA 1GNTA 4AJLA 3I62A 1JVSA 2QTVB 1OTYA 2XT6A 4ZQEA 3LPCA 1V16B 1JAHA 2ID8A 3ENNA 5I5EA 1H0KA 2X8LA 3WIVA 1HI9A 2GI4A 5EZSA 1HT3A 2WBLC 2WIFA 5CHEA 2A8YA 1EA7A 3IEKA 4RXUA 3R7DA 2P1ZA 2NPOA 3REQB 3ER9A 4FR0A