5EEVA

Radiation damage to the trap-rna complex: dose (dwd) 3.88 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
b'NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
molecule tags Rna binding protein
source organism Geobacillus stearothermophilus
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eevA00
1GTNA 5EF0A 5EEWA 1GTFA 5EEVA 5EF2A 3AQDA 2ZCZA 1WAPA 5EEUA 2ZD0A 5EF3A 5EF1A 2ZP9A 1QAWA 2ZP8A 3ZZSA 2EXTA 3ZZLA 5EEXA 5EEZA 1C9SA 3ZZQA 2EXSA 3ZTEA 4B27A 1UTDA 5EEYA
chains in the Genus database with same CATH superfamily
4FFVC 4W70A 3KPPB 2YSTA 5E8PA 3AQDA 1UWEL 4QWWD 5LBVA 1KV7A 3HN8A 3DXAB 3NACH 4L1TA 1BBDH 3SO5A 4EDXB 5D70L 3VFUB 3MA7B 3QWRD 1S7VB 4PREB 4BFEA 1I9RH 4XRCB 1EWHA 1FNEA 1KPRA 4XPAL 1X5AA 5T3ZL 5KZCD 4YEEA 3RVTD 5DA4A 3DX8A 1YEHH 1UOVA 3HS9A 4QHLB 5FKAB 3I6KB 2JKRM 5KYUB 3PDDA 4GUPB 3C60C 3DVNA 1N68A 1ONQB 4Y1AA 2WNWA 1LWHA 2WAQA 1WBYA 4NLAA 3RNKB 4KU1A 3P4MA 2WTRB 1HOCA 3BDYH 2Z31A 3PCYA 4XE5B 2QTVA 5FGRA 4PW4A 1ORSA 4G1EB 4QRSA 2WLLA 4OV5B 1T5WA 3F6IA 4X6BB 3WV0A 5ES4B 1RIHH 1KACB 1QA9A 4F5CA 2EYRA 4N1HB 5IVXE 3P1VA 4PJGA 5I6MA 2XA8H 2PW2A 3Q2NA 2F53B 3IWUA 3D18B 3H3BC 5DD0H 4UQ2B 4NOFA 2F19L 1S7QB 2IALB 4LCWA 2F8OA 4NAMA 4CGUB 1E6OL 1IEAB 1TJIH 1XF2A 1KGIA 2WTPA 4KWUA 3VI3A 3E6FB 1HHHB 1BQHA 1FNLA 1MCIA 2W65A 4I18B 5AVTB 2ORBH 5BS0B 3VD1A 2N1KA 4DKFH 2Q3AA 1CBVH 2FT7A 5TPWH 1QSFB 3UBXA 1ZLDA 3HRZA 1F58H 3KHOA 3PG2A 1BOGA 4ZSOE 5GS2H 1NBVH 4OI8A 5I74B 5I6XB 2XWZA 3TJEH 4WUUA 1KLFB 1MFEH 3DOSB 3SBWA 3TGXA 1DO6A 2CM6A 4YHYC 3KPRA 1KJVB 2XZAL 1FAIH 4UM8A 4M3JA 1CU4H 1FE8L 4XB8A 4XN2A 3Q48A 2D0HA 3RHWK 1T7ZA 4U0QB 4S1QL 2YGNA 3DUSA 2FWOB 2VH5H 2Q86B 5JORB 2ZYSA 1DO5A 4X6CF 4TULL 4HSCX 4G6MH 5IQ9A 2ADGB 3BLKA 2W81C 5IREA 2L3BA 1AMXA 4EJ1C 3KPSE 1RPQA 2Y1ZA 4ZFFB 4U6XA 1A1OA 5HYSA 4ZS6C 2F1AA 2Q8BL 5C0BB 4ODHH 4MNHB 1R17A 3QORB 1J9CT 4KHXH 3OXRB 2OYPA 1CWVA 4L9LA 5I1IL 1IBFA 4GUOA 1SJXA 4JZJA 3CZNA 3UDWA 3EO9H 2YEVB 4KTDL 3VGHA 4WHYG 1OCWH 2Y5TA 3LS5L 2V2WA 5SWSE 4WEUD 1UEYA 1TFPA 1B4TA 3CHXA 4XVOA 1PNDA 4X9FA 1LM8V 3OKNA 4HV8B 4L8SB 2WQWA 4ONOA 3DXAD 1MQKH 5IF0B 3K8MA 2FBRA 4L1HA 2ZPKL 2QPEB 1AR1C 1OM3H 3IDJB 3QHZH 3W2DL 5DC0A 4DVRH 3ROLB 1RERA 2GK0B 2YZ8A 4OZ4B 4QMEA 1UH4A 1XBDA 4XP4H 3C5SA 1P4BH 4PJGE 4G8GE 5AKTA 4MWFB 3ALXA 2V33A 3GI8H 3MBEC 2E6QA 4R7XA 5EEWA 3WJLA 3Q5OA 2VLJE 1FUNA 5C0RL 4Y1TA 3CVHA 1QSZA 5DS2A 1A6AA 2JKIS 6TAAA 4GG8B 1IUZA 5FDWA 4WFEE 3ZE0B 4M43H 3SY0B 1D5MA 3DPBA 4S2SB 1BAWA 3MV9D 4XWGL 4RFOH 5KN5A 4U6TA 4WI3A 4JO1L 3T3MF 2DM7A 4XVUD 4YXHL 4BK5A 1U21A 4FCHA 1MUJA 3I6LE 4N2FA 2ZAHA 1A7RL 5GHWL 3II3A 2DYRB 5TD4A 4RGOH 2KLTA 2WNKA 4GIPD 1UZ6F 2EH7H 1KPVA 2YAFA 2ICCA 2IH1A 2YAQA 4KH9A 4F33B 3WFEH 2RAMA 4K3GA 1MW3A 2DQCH 3IMWA 3KHQA 4WJ5B 3X3GH 3CU7A 5ISZD 1BA9A 4UQDA 3DSFH 4JFDA 4M8QA 1CICA 4LHUD 2XSKA 1CLYH 2WLIA 1OK0A 1M57B 4G6AD 2OL3B 1Q90A 1LE5A 1OP4A 4WGWB 2EE3A 4C4BA 2FX9H 3F7KA 1BWMA 3AU0A 3DPDA 1X7SA 4LKCA 3UG4A 3ULUE 1H15B 1YMHA 4IU3B 3GLAA 2BS8A 5C0ND 4Y4HB 5KSVB 3FAXA 2R0KL 4C56B 2CNZA 4G70B 2X38A 3M8OH 2KQNA 2VMDA 2VL4A 3BGFC 3R8BB 4B41A 1J5HA 4HT1H 3GZQA 2K3HA 4I1RA 4R8WL 4NDMB 1AHKA 1OT2A 3T08A 3B4NA 4BWUA 5B1AB 5EZPA 1MCWM 1JGDB 3D39E 3DSNB 4Y2OB 3TH4T 3T8VA 3WFEL 3WFHB 2HYMA 5DSCB 4P4RB 4S1SH 3WCYA 4EE2A 1Q0XL 3FFOA 2O5XH 3QJZA 4ZO8A 3F7YA 3WNNA 1A9VA 2APSA 1TQVA 3MNDA 4Q9QH 2KS0A 2CSPA 4QXUH 1P5VB 3M86A 4N2EA 5AOJA 3SYQA 4DKTA 2XWRA 4NIKB 3QG6B 1E5CA 2GABA 4U49A 1XIWB 4JANA 4Q56A 4WHTA 4IIQA 1M6OA 2A77L 5FA3A 3BISA 5IWLA 2YPLD 2ATPA 2HTLC 1BVNP 5A2FA 1IAIH 2WXMA 3MN8A 4OLZL 3ARFD 3S5LB 1MVFA 4XXWA 5AZ2H 4Q9CA 2FYVA 2IVFC 1U8JB 3NJGA 2WUCH 1ZDSA 2BOLA 1CB4A 1AZCA 3H4HA 2HT2C 1JVLA 3WIFA 1WAAA 5CEZH 5JNYB 1H3WM 3S37H 3FPXA 3MCKA 2BC4A 2KPNA 3STBA 3HZYB 1KCWA 3NCJL 3BWUF 3EF7A 4XBEH 3QEGH 2PCFB 5I19L 1GC1H 2QR0A 1FFNA 3N1QC 2YXFA 2DQFB 3S8GB 2VLRA 1KGCE 3QUYD 3LQAH 3MV7B 5EOCJ 2OXHA 1X5FA 1ZHNA 5SX5K 5E2WH 2MEJB 2D31B 4MCYA 1TEFA 4BJLA 4PB0H 4EUPB 1HE8A 2YHGA 1HTYA 1NL0L 1CL7I 2RQEA 4LLUB 1SOSA 2X4PB 3H3PH 4X7FC 1KFGA 2PWDA 5C3LD 4N0YH 3STLA 2HFGH 2NLJA 4FZEH 4OB5H 2FLBT 3LB6C 5T1KB 1VDGA 3M07A 4RMVA 5E2TL 4X7EC 2PYEE 3S4SA 2ZWKA 3C5ZD 3IN0A 4LHUG 5G5DB 5J1AA 1IIKA 5KG9A 4JR9L 1NAMA 1G6RB 1MRFL 1F90L 2QHRL 1ULVA 4HF5L 4W4OA 4AM0A 5FYJH 4OIAA 1N67A 1IKFL 4C56E 1KGWA 4EBQH 4PVNA 4N1EA 5AL0A 1DANU 3LDBB 3MUUA 3O6FC 3GPEA 1DN2A 1P1VA 4GO6B 4F2FA 3NJFA 1OD9A 2X4QB 3O9WA 3ZYIA 1CDCA 3ZDYB 4N9GA 3QJVB 1FRGH 1MZZA 2H1XA 1QATA 4J3SA 4YXLL 3MNVB 1MJ8L 4NCC2 4H4NA 3MTRA 4R5XA 3D12B 4GSUA 4BUGA 4YXHH 5C08E 3MLWL 4BELD 4GRWB 5IB3B 4UV7H 4G5AA 5I18H 1XF5A 3N44B 4AW7A 1MAKA 4OKVA 1O6VA 3U9WA 4YHYB 2Q6WB 4B53A 5E24E 3V9CA 3ZKSD 1II4E 3VD2A 2XUWA 4JKMA 2TSAA 2GFBA 2CMRL 5SWSD 2Q6WA 4BCYA 2YSSB 4UAOB 2EXWC 2P8PA 1XF5B 1JXGA 2DQGH 1RZGB 3CSYB 4TKWA 4E0RB 3DROA 4NN7C 4C4KO 4L4TD 1QSEE 1FYHB 2XHNA 2XZCL 3FCTB 4HMDA 2N0KA 1J1OL 4OT1L 2M83A 1R5WB 3I9GH 2APVA 2NY0D 5FM5M 3L4ZA 3BUTA 1A6WL 4MXVE 1P7BA 5HHXL 3QDGE 2F08A 3W57A 3AGVA 3FUNA 5H35B 2X4QA 4XAWL 3VG0L 2ADYA 2F54D 5IHHA 1JWMB 5F6IC 4LASL 2OR7A 4LSTH 3RGHA 3V0VB 3LXBA 3C75A 1T4KB 2JCWA 3MJ9H 4L05A 2BVOB 3MNWA 3LHPH 4JDZA 4FI8A 5T1KA 1JF6A 1ADWA 2EDFA 3CN3A 4AT6A 2X1PA 2X4SB 1KY6A 3C60B 3GTTA 2DQGL 2IMNA 1J9TA 2YPVL 4LIQE 4MASA 3AXHA 1X5KA 4MMZC 4K23H 1ZHNB 4I9WD 3V7AE 1T21A 4M1DH 4G8EA 1CDHA 3GSQA 3ZTJG 1ASPA 2VLRB 5AVUB 1BGXH 4DN3H 3HNVL 4FQIH 2QR0B 2WM0A 4A6YH 1KTLB 3O3DA 3IF1B 3VRLF 5FO7B 4TLTA 5T3XL 4YS4A 2ODIA 3HZYA 1DLFH 2BC4B 4PJFA 3MCKB 2FHCA 2O6PA 4ENED 1EV2E 3IDMA 5GRUL 4TRPL 1G7HB 3C6SB 3WIFB 3O2VL 1CT8A 2P5PA 3EYFB 2R59A 5EC1B 5GPRA 3S5LA 5C0NC 4H13C 1JZFA 1NJ9A 5L88H 1RZKC 1QSFE 2AQPA 2Z31C 5DYFA 4X0KA 1U3HD 2HP4A 1V7NL 1OAUH 4JANB 1XIWA 2AK1H 2A38A 1UA7A 1UWXH 5FA4A 4QR7A 5HDRA 1XD0A 3BKJH 2WLYA 5DUBA 5TTRA 3SYCA 5A3ID 3UJTL 3VGEA 2W0FB 3DSFL 2V9RA 4JRYD 4FNTA 3GFUA 1EHLL 3D6GA 3RURA 4UT9H 1T66D 5DUPL 4PJDF 4Y2OA 1JGDA 2VABA 3DSNA 3KLHD 1L9TA 3L1FA 3NGBC 1FFTB 1YNKL 4L8DA 3K80A 3RWEA 2EE2A 1GRWA 2O4EA 2OMYA 1KTRL 2OFQA 2PCPB 3GT6A 3QDGB 2N7BA 1IM9B 3D3VA 3Q8AA 4K8RH 4S0TD 4BK4A 4BGDA 1PFOA 3GZOA 1SUHA 5E6IA 4DPBX 1IGJB 4AUUA 1LO4H 1S5IH 4KRPB 3TURA 2LVCA 1QO3B 2IADA 3M6DA 1T0NB 1A22B 3O2DA 4DK6A 2B4CL 4PTUB 1ZLSL 1P4IL 3BUYA 4FULA 4Z0XB 5IFAL 2EDLA 1SLUA 4A7GA 3BX7C 2J8UF 5FHAH 3O2WH 4FS0A 4F1ZA 1P84J 1J8HD 2X53A 3GXMA 4JFYB 2H8PA 1H6TA 2EIZA 4GSDH 3HE6C 4M8QB 1O6SB 2I27N 3ZKXB 3L9RB 4OW6A 2VUOA 3HE6A 1VEMA 1UATA 4DKAA 1HC1A 2GBUA 1BQUA 2H41A 2IH1B 5LBSL 4ALAH 2ERJB 2MPAL 3PREA 3ESUF 1PTZA 5AB0A 1WITA 4K3DH 5I8EB 1CFSA 3UPRB 2HX7A 2EH8L 2NUPA 2WUBL 4KRPD 4UOJA 3GEWB 3KVQA 3VYOA 1GKEA 2PUQT 2HKFH 2Z3FA 3D4YA 3VE0A 2JTDA 3F12B 3SBQA 4HD9A 2X89A 1N6VA 2E7LA 1KTDB 2FO4A 3R7RA 4OLYH 5BRPA 1PLAA 3L7EA 4IOFC 4KY2A 5AB2A 1J8HB 3BIAX 4P2AA 1IVTA 4PRAA 3QJTB 2GQHA 4GI8A 2QQKL 2FQGA 2CK2A 4U7SA 3RILA 1AHMA 2HT3D 4KQ3L 5FDWB 1T80A 2UWEF 2V37A 1F86A 4U4IA 1A6AB 3VI4A 1RH8A 3FU9A 3UBHA 2CHWA 2HT4D 4ZQKB 1E9PB 3DOHA 3DX7A 4HIXL 5L4MA 4MLSA 1WO2A 4ABWA 2XNAB 3TO4C 2F53D 1AFVL 2R2EB 3GMQA 5GS1B 2RR3A 1SHXA 1KYUA 4OFKA 2OSXA 3D09A 2J2ZA 1IFGA 3FU8A 4KZ0A 1PKOA 4LRNH 1PY0A 2ZAIA 1ZTMA 5E2UH 3MGTA 2RD0A 2E56A 2Y6TE 1J87A 1LQBC 1P5UB 1KENH 3QDJA 1F6LL 4B3EA 1R5IB 2V2WB 2YZ1A 4HU2A 3P2DA 3NCFB 4FQPA 5EOCH 4H1LB 4JZJB 1DVUA 4Y5XC 2GJ6B 4YEFA 1CFVH 1CXIA 5D2LA 1FSKC 4ZAKD 4L9LB 5F7UA 1CTMA 2NY0C 2BHUA 4FG2A 3N40F 3EDEA 2WWMD 4N90E 4M6OL 3MRRA 1ZA3A 4P9HH 4MNHA 3UGUA 4PLJD 1A4KA 3TT3H 1J7VR 3JTSA 1JGEB 4KZCA 3SE8L 2MTAA 3DV6B 4QHUA 3ETBF 1F2QA 3T0EE 2GYSA 3P3SA 4KMQA 5FDYA 2J5LC 3SZKC 3KL5A 3T3PF 35C8H 4X6CB 2ADGA 4FNLH 3AT9A 3N1PC 1YO4A 3F7QA 2E74C 1Z32X 2DAVA 4M1CD 1NPNA 1EAOA 1NDMB 5JORA 5F6HJ 3QJOA 3DUSB 5D7KE 3GI9H 3C12A 5C9JA 5CN3A 1D6VL 1DBAL 1EPFA 2CHZA 4HKJB 2CH8A 3KPRB 5SWQA 1XD1A 3M1OA 1RZIB 2CZNA 4U1GC 4BQ9A 4Y16C 1PZ3A 1VENA 5KVEH 3HMWH 1HCFX 2F5AH 3MJGX 4HCFA 4X6EA 2Z4TA 3CXHK 3HRZB 4KROC 3U79A 4YSQA 4YK4B 2VC2B 3UBXB 3UMNA 4YHZL 3UYOD 4B7IA 2ZXBA 2VCOA 4K5PA 5DS1A 1QLEH 5SX5H 2B0SH 3S8WA 4NUGL 1KBBA 1KBPA 4J4PC 2W65B 3FQXB 5T3ZD 4W68A 1FG2B 5J57B 1UKTA 1RV6X 4FNQA 3VI3B 1F11A 3QZMA 5E94B 5DMKA 3WU1A 4MNQA 4W4OC 1QZNA 1Q9WB 1T22A 3AXIA 3BKJL 4M6ML 4N26A 1ZVYA 4PJ9C 4X98B 4ELDA 4QIRA 4V1DA 4IMLA 4J3WA 4WO4B 1CXEA 4PJGB 4JG5A 1QA9B 4LLWA 3VYNA 4X6BA 1CYGA 1OV8A 3AG2B 4NZRL 4R97C 3JT0A 4G1EA 1N0LA 1NFDB 4QRSB 4NQVA 3HG1B 1UH3A 4YUEL 3VI3E 2WTRA 2J57A 2WKOA 1IAKB 2VMEA 1ONQA 3CUPB 5DHYB 5GGUA 3ROOB 1C08B 4KHTH 3DVNB 4PWHA 1DVFA 2C4FU 3GM0A 3N9GL 4Z95H 1R19A 4CGTA 3POCA 3LV3A 4QHLA 1YEGL 4OLVH 4F7TA 5JPMA 1A7OH 1BVOA 1CD8A 3EXLA 4QY8B 5HI5D 1FNEB 2ENPA 4PREA 2G3XA 4NC0B 4YSAA 2BS71 3RUGB 1FVDB 3DXAA 4XC3L 4YDKL 4QTIL 3U1SL 3MLYH 4DQOH 4BKSC 1VKXA 4G9FB 4JG1L 4YSOA 5CMAB 2G9KA 2E7BA 1DBJL 1DQML 1JAEA 2GIYA 3CFJA 3CV5A 4L5FE 4XMLL 3LHPL 4FQXC 5BZWB 3D4ZA 4L3CA 2VE6B 5IKCA 5K9QI 5JHLA 1WWCA 1LEGB 2GCYB 1NM4A 5E1IA 2DDQH 4ZT1A 4HHWA 4GQZA 1KFAL 4LL9A 5DJ8B 5GSRA 4XP1H 3SO3C 2QTEA 3BCFA 2PKDA 1NEZA 5AALA 2V7HB 1L5GA 2JXMB 3VI4E 3EKCA 4QT5B 3KLAA 4L4TB 4TUJA 2IH3A 3BN9C 3HC0A 3KDMA 4AEEA 5CP7B 1OVZA 5GGRB 2E9WA 2LOEA 3FUIA 2CIIA 4OVVA 1EHXA 4CA4A 3BIBX 2GAZA 1D5BA 4QRRD 1IO4C 1IARB 4WU5B 5A40E 2F74B 3O2DH 4UNIA 4HUWA 4Z7UB 2ZOLB 3CCHA 2BZCA 2BXZA 4ODTL 2B59A 3KLQA 4HK0B 3RIAF 4Q9RL 1B0IA 2Y2TA 2ZX7A 5EN2B 4BSVB 4XZUB 3BT0A 2ZF9A 2WKGA 1PG7X 2VLJA 3DK2A 1G1YA 4EZJA 2JKSA 3HS8A 3DJZA 1R3IH 3PWUB 3NJHA 5L4JA 4HXAH 5IROD 3UJIL 4Y9EA 4ZW7A 3W0WD 2JV6A 3ZSTA 5CJOL 4W9GC 2WKLA 2YMTA 1HL5A 2X9WA 3DX6A 4YHLH 4AJWA 2RQ8A 1RUPL 4Z7UE 1CTOA 5HI3C 6FABL 3KYAA 5HGAB 2YQGA 5D96C 2X2HA 3PGCB 1F5WA 2H0JA 2H3NB 2VXSL 2A74B 1RJLA 3THML 2BNUA 1MHEB 2FZ3A 3S34L 4RQQB 1U8HB 2O61A 2AABL 2ITEA 2XXGA 3QA3A 4NFCA 3UXFA 3P0YL 4XP5L 1A2YA 5FIEA 3IMTA 3GSRA 3QFJA 2J5WA 3FB6B 4MCZB 1C9SA 1INQA 2D7QA 5DR5H 2BY3A 3WIHL 3EO0A 3QUZD 3ECQA 4YO0A 4E5XA 2X0WA 5ISZB 3OKDA 3AB0C 1W8OA 2OTWA 2BZ7A 5JIPA 1FZJA 2A6KB 2FQFA 2CDEB 4Y16D 3RU8L 5JHDE 1G7QA 4BRVA 1WF5A 5D7LB 1LWJA 4X5QA 2DLIA 1HFUA 4TXVB 1EJOL 5AD0B 2Y6SC 4JO4H 2YLHA 4A39A 1XGPB 1OAQL 2Z31D 2XZZA 3NFNA 4FTVA 4KDTC 3G08A 2H26B 4ZTOH 4OGQC 1I8KB 4WUUE 3GRWL 3KZ8A 3IJEA 5ICXB 1RD6A 1ZT7A 4KTEL 1RK0B 4M62H 4ORZC 3DTXB 3OHXB 4Z7NF 2C1PA 3BEWB 3NVQA 3TFKD 1SYVB 4POUB 3LZRA 4XO3A 1E6JL 1NGQL 4HKBA 2Y22A 3GUFA 4ATTA 1JWSB 5D9SB 3DVGA 4E9YA 5DZNA 3A67L 3KPQB 1SXNA 4YGAB 1F4WL 3MKKA 4GRWF 2APWA 4ECNA 5EMYA 4DH2A 3N44F 1AQKH 3KBPA 3O6MH 3O2VH 4YAQA 4JCLA 1UQSA 4ZD3H 4QPEA 1YC7A 1I9EA 1YYML 2DBJA 1JGLL 4GXUM 2Y7NA 1S9VB 2GJRA 3GMMB 4JREC 4C47A 1OLZA 2QZQA 1AXTH 1AQDA 3QE5A 1B0RA 2YRLA 3AMKA 3VB8A 4W4NA 2VR7A 3EYUL 4B9YA 2Z91A 5KVDL 3SCMB 3LIZA 4BHUI 2DQJL 3TEUA 5C7ZA 3P4OA 1CS6A 4GBXD 1MCEA 2ZOKB 3V5KB 3QAZB 1SEBA 3RYMA 4LSSL 4NQQA 2Z65C 1N3NA 4OQTL 1CGVA 2YEZA 1T1YA 4U6HB 4PJCA 4KQ0A 4FKHA 4XXWC 4LCVA 3PWNA 3GBML 3I75A 1FLRL 2AJVH 2VM3A 2ED7A 3TC9A 3A47A 3TT1L 4Q8BA 1ZGLB 3OAUL 3IFLH 3MRLA 5K33A 1ILUA 3TZVC 3U0PA 3FKUS 1QEWB 5GS0L 2VL5A 3K91A 4QAMB 4EIGB 1BDYA 3ILDA 4GAGH 4N5EC 5FV1L 1H5BC 3DGCR 5L2KB 1BVKB 2IGLA 1F8TH 1UYWL 3B9KC 3FU3A 1A1MB 4FYTA 3FCUB 4HH9A 3F5WB 4DN4L 4IOFD 4DK3A 1DSFH 1VGEL 3MYJA 3FQRB 1IC5H 5FF6B 3CMOL 3HHSB 2CBTA 4WCYH 3QIUC 5K1JA 1G7JA 1MNUH 4B5ZA 2BVEA 2VLRD 3AW5A 3WJMB 5DYOA 3EH5B 5EU5B 5IK3B 1EQWA 3TBBA 3QNYB 2AJXL 4RDQF 2HRGA 1XVSA 1NGQH 3ZE1B 3NCEB 1WQVT 3VFMB 3NPZB 4F5CE 4XWGH 1X4YA 2VC2L 3OQRA 3WG7B 1EDHA 1WAAF 1PKQB 3MODH 3LNGA 3N85L 3VXPB 4HJUA 1X9RA 3PHSA 3DDGA 2QKSA 2ADJB 5EO9B 4AL8C 1RZKL 5AAMA 2VJXA 1KCUL 3NJNA 3MLTB 1B2WH 4YBLB 5ELIA 2DLEA 3QR2A 3RPIB 1LK2A 4WNQA 1EH9A 3APCA 1E9OB 3IPBA 1AKJB 4WTWA 1LL1A 4ISVB 3V0WH 3OVUB 4XXDB 4X4YA 3S34H 2VDLB 4UT7H 1AKJA 5TK4A 1Z66A 4WNQB 2Q7NA 3FSVA 4LHQB 3N40P 4LMQE 4NQEB 2CCVA 1FC2D 3Q2WA 4U1IA 3TVMD 6FABH 4F8NA 2FQEA 3ARUA 5EO9A 1T0OA 1P4LB 2D0FA 2NY0B 1AO7B 4PJDB 3PL6C 3QUZC 3HI6L 2FNBA 3V0HA 3N42B 4L3FA 1VESA 2AXFB 3CPUA 1SF5A 3SDDC 4N2HA 4NQCE 4UDUB 1S9YB 3KAAA 4E68A 3BVNA 1CFNB 3QJHA 4IJ3B 4K3EH 5AFAA 2CA3A 1NAML 4RFNC 5JOPE 1IGCL 2WANA 4K5MA 4GRMA 2DQDL 3WN5C 4OY9A 1GSMA 4N90D 1CE1H 2C9PA 2J8UB 3ZDXE 5C71A 3VMPA 4G80B 3P9MB 4FNSA 1LJMA 3BUPA 4GAAA 1MFBH 3UCRA 2CK0L 1JPGB 1NQBA 1WFTA 3O9WD 3PWNB 5CF3A 3OGCA 1GGCL 2XZAH 3MRNB 5ICYB 4IBYA 1YPZE 3HBZA 4WI9A 3RY5A 3WY3A 1EAJA 3G3LA 5JHBA 1ICTA 1QFWM 1YDPB 4UQIM 1WCBA 5F3BA 4KVCH 2GI0A 3CFNA 1ZK9A 3HB3D 1QFWL 2ZOKA 1N5AB 2HH0H 2Z64C 4IK7A 5KSAA 4EZKA 4BCXA 2KHAA 4UQEA 4XP6H 3ZT6A 5F89A 3QS3A 3SCMA 2M26A 1U36A 3FPYA 5C0JA 5L9DH 4CN1A 2XYCA 3BDXA 4A2EA 4DNLA 2GTWA 4MD4A 4N2GA 3GSVB 1B0RB 3SZ6A 1J9SA 4PCSA 4ZUUB 2QADD 3FUEA 5FCUH 5JHLH 3EH3B 1IU1A 3C6LA 4J3OC 4KTYA 2IBGA 4WWKD 1KFAH 4PJ8B 4KMLB 5KANG 3T6XA 5A2LH 2DM3A 2VDNH 1MNNA 4TN9A 2CHDA 3RL2A 5DJ2A 2FJUB 4HDIB 3TL5A 4X7SL 1RUMH 5DJ6B 2EVGA 2AERT 3L1GA 1JWSA 5D9SA 2FNWA 1PG7W 5AAWA 5FUZH 4H8PA 2UZPA 3SB3A 2C1PB 1FGVL 4QJ3B 3DTXA 3CVBA 3IJ8A 3L3OC 1KC5H 2GC7C 2ZKHL 4DP2X 4FQLH 1GGTA 4UZUA 5ICXA 2E9GA 2HT2D 3SJVA 4RMQA 4GFTB 4HA1A 4KTEH 2AF2A 4MNGB 1M42A 4BFBD 1XB8A 2H26A 3PL6A 4HIQA 2FAUA 4XNQA 3NFNB 4FTVB 3ATDA 3RTQB 4TPRH 4I9WE 4Q6IC 4JFDE 5HYQB 1N64L 5E9DA 5E6IC 3K2IA 3C5ZA 4KK8C 3Q6GH 4ETYA 4WTQA 2WXKA 3NAAL 1JZ3A 2JELL 4NWUH 1G7QB 2CDEA 2A6KA 1SLWA 2OTWB 3IB4A 1T03H 4GP8B 3L3JB 1J12A 3T3PB 5CU9A 4E5XB 1JZEA 2B1HH 4JQVC 5EB9A 4HIEA 3T09A 1JI2A 1INQB 3FB6A 1TQWA 1YNKH 4JGJA 1UKSA 5HI4D 5F3HA 3U2IA 5C0CA 3C08H 3DRTA 5JZ7D 3CG8A 2QQNL 4PGBA 2DEWX 4LPTA 4AG4H 3TF4A 4DVBA 3HB3B 4FZ8H 2A74A 3CX5K 2H3NA 2WO4A 3T65A 3DX9A 4LFHG 5HDQL 3B2MA 1X5LA 2H6PA 5JIHA 3N55A 2AGJH 2X44D 4H5SB 1P6FA 2WVSA 3ARSA 3L5WA 4ZBJA 2X4RA 3VG9C 4XNZB 4MA1B 3W9EB 4KMTL 5FYLE 3IE4A 4K9EL 5EO0A 5EORL 3NZHL 4RIRB 5GRUH 2ZSVB 1A7NL 1JNLL 3C87A 4MGXA 3D3VD 4H20L 3CDCA 1U8LA 1JI1A 4F2ME 2EUVA 4MD5B 1KXTB 5JUEL 4H1LH 1GYAA 3P69A 4UNVA 5KVFH 2XN9D 3ZE1E 1MJJB 2Y3AA 5CFAA 2BOCB 5KYXA 5GGRA 3V4PH 1BJMA 2NNAB 2FBJH 5IBLC 3VD5A 2IH3B 4IRZL 2AQ1A 1CFTA 4L4TA 3KLAB 1KWGA 4MJIB 3MRFB 3MJ7B 1A6UH 1G9MC 3CFBB 3CAFA 4WIQA 1W8EA 5IHUL 5B8CA 5FYKL 5GSRB 3QNXB 5M7QA 4Q0XL 3CZFA 1D7CA 3SQOH 5B4MC 1LEGA 4R7NB 5EHFA 3EZ8A 4M00A 5IKCB 1EAPA 2LU5A 5J4MA 3KYOA 4BV1A 4Z78B 5BZWA 3AM8A 2DLGA 5I1DA 3PWJA 4KRMB 3J2PA 4RGNE 2PYEA 5CMAA 5ABAA 1HL8A 4KO7A 3PIQB 5I30L 3CBJB 5GRXG 1EZSA 2VSDA 3RUGA 1NMBL 2JB5L 1CL7H 2MNUA 2QV2A 3BVVA 3FCBA 3FQ1A 3MDJA 4YBLC 4K7FA 2WNXA 1JMZA 3T0VA 2AJYL 2DL9A 3JVFC 2ADFL 1FO0H 1HL4A 4B95C 4E9XA 3GXNA 1VZHA 4CU8A 4F7TB 4UANA 3EFOB 3U83A 1I7TB 5BV7B 5E8OB 4OF5A 4LHUB 2MPVA 4R7DA 4EI6A 2DMKA 3TV3H 1DVFB 3KW7A 2IDUA 3KWXA 4IMKC 2B9AA 5DHYA 3TNNB 2ESVD 1OB1B 3I6GA 4Y2DD 1A8ZA 1KF9B 3FYIB 2PNDA 5AW6B 2GSGA 3ZKMC 3CFIC 1N0LB 1NFDA 1Q72H 3K8LA 5HD8D 2P5WD 3IGLA 2AP2A 2FSDA 1UM5L 3WKML 3WIIL 1E3XA 3QFJE 1LP9F 4PTTB 4WO4A 1S78D 2X6VA 3ARBB 4GW5B 4IMLB 2DTMH 3RVXD 1MJ8H 3LZQA 4E5XG 1KJ2A 1NKOA 3HE6D 2CUAA 4XN8A 2VDLL 1E50A 1T22B 1E2ZA 3NCYS 3FOLA 1PAMA 3QI9D 3Q6GL 3U4EA 3TF7C 2BINA 3V0WL 4U0RB 4IEFB 3AITA 5JPNC 5JXAL 2BXYA 2QHRH 4TPRL 1FNSH 2CLRA 4CMMB 2IPKB 4ODUA 2P24A 1FVEA 2O6FA 4AQ1A 2NXZD 5D1XE 2ZX8A 3VXSD 4EF3A 2WAHA 4WSJA 3T3PE 3ZHFA 4AYSA 3G7TA 1MRDH 4Z77B 2Y5EA 1LMIA 2KDGA 4M29A 4HKJA 1AGCB 4ZNEE 1P2CB 4R90L 2VAAB 5J3HC 5C9JB 4B9PA 4N4YB 4ZS7L 5HHMB 3VRIA 4K15A 5CKAA 1NDMA 3ARTA 5IM7A 5D4IA 1DBBH 4ZFGH 3E9UA 3PAYA 2BOBB 3HJ0A 4OZHF 1CGXA 4KTGA 1LLAA 4RX4D 5D7EA 2NW3A 3P11H 4QEGA 1OKEA 4WI7A 2CJUH 3DV6A 4QHUB 1H5BA 3JTSB 4L8BA 4PJIF 3BWZA 1EFQA 2QVTA 3BC9A 4X6DB 1DQVA 2NR6D 4N5ED 1ZA3B 2D7NA 2HX8A 3V4PA 4WTZG 3GRWA 3IFLL 3ZZ1A 2B3IA 4BRJA 2R8SL 3VACA 1P5UC 3STZA 2JI2A 4X50A 5F71A 5D2LB 2WXNA 2GJ6A 3O3BB 2FL5A 3WN5A 4H1LA 3PABB 1NOAA 1KTKE 2WC7A 2DYSB 1CFMA 4PBWD 4UMGA 3CZGA 4FGMA 5BRZE 1XV8A 2EO1A 3MGTB 3L3OB 1QVOA 1QBLL 2MOGA 1U58B 4NHUA 3FB5B 5FXCH 2ESVE 1PEWA 1NCDL 3KYMB 1QRNE 5F93C 3VU1A 3KM1A 4XCCL 4C4UA 1PCSA 2XN0A 2OW6A 5DS8A 3GXDA 4DGVH 2P47B 4JG0H 3GMQB 5GS1A 1FN4B 4UQ3A 2MWCA 4M7LT 4KOBA 2YGOA 2BP0A 2WLKA 3VFSA 1S9WA 4M61B 1HHGA 2DN7A 2ZSWB 3U0TA 5KBKA 4PWEA 2VDMB 2YC1B 1NKRA 3AG4B 4X9GA 4NEHB 3V55A 1YAZA 3VI4B 4QRUB 3V6OC 2OW7A 4XPHH 4MHHI 2HH0L 1LHZA 1BIIA 3DKHA 3R18A 3R1GH 3K81A 3Q6FA 4AYEC 1T6WA 2EJ1A 5J0BA 4HQQH 4J3OF 1KIRB 1FZOA 2R2HB 1C7TA 3COOA 1U8QB 1C5BL 4YL9A 1NMCB 4BXVA 2ZXEB 1P7QD 3V0FA 3TBYA 1MI5A 1FPTL 1JTOA 3HI1A 1SN0A 1SOKA 2WXQA 4KI5C 1VFOA 5BOJA 2FWUA 2WBXA 4ODSH 4PVLA 5I8EA 2BNRE 3WLWD 3TONA 5CSGA 5DEFB 4QCIB 3GSNA 1AD0A 1I1YB 4KAQL 2G60L 5J06A 3OMZA 1NPJA 4LOFA 1T1XB 3GXUB 4R5VA 4IRSB 4YJZL 5JW3H 2VLJD 1A6ZB 3ZOAA 4Y5XA 1J10A 3RG1C 2F9BT 3RFRA 2IOOA 5BV7C 2WYZA 4PMFA 3MV8E 3NJKA 3HHMA 4EBQL 1X5MA 2HT4C 2H8PB 5CUSL 2CPCA 3CZUB 1I31A 1KY7A 2IV9A 2NYYD 1YNLL 4XMUA 4Z0XA 3FTGB 3GXPA 1DUYA 2B20A 3EFDL 4PTUA 5BZDB 4UZSA 4YLQT 1Y6KR 1A4BA 3VWJB 3C60D 5DWUH 4QWWC 1T0NA 1QO3A 5CJ8A 2YIHA 2P3YA 4QRRB 2R9HC 4Z3TA 1CLCA 3NIDF 3HBGA 1K5NA 4OIIH 4I8DA 5EC2B 2LVEA 2ZUYA 3D3VB 4NNXB 1Q1PA 2AZAA 2ICWA 2OMYB 2PCPA 3FB8A 5DQDH 3RWEB 5JDSA 1PCXA 4J3VA 2OQJA 2DOCA 1OAYL 2X3CA 3RFZC 4ZSOA 3T8MA 3L1OL 1KB5B 1TNMA 1Y18B 1CXKA 1NGWB 4GG6B 3HC4L 1S7TA 2J1YA 3SGJC 4XX1E 1D5XA 4KVNH 4J3OH 5F9WB 1GAFL 5I5JA 1RLBA 2WQVA 4BGLA 1BMGA 4JFXB 5FA4B 1EZVX 3KS0J 2FJSA 4CMHB 4RMWA 1XTLA 2EKJA 4MJ6B 4O9HL 3H56A 3V9EA 1MFCL 1K2DA 5C08B 4DW2L 2PWEA 2BY1A 3S37X 4A7TA 1C5BH 4JN2B 4HUXA 1THAA 3LRSB 4M56A 4JDVB 3QUYA 1NJ9B 5E5RB 4BYHA 4YX2H 2ZCLL 3K6IA 5KSUA 1I3VA 2CCLA 3CH8A 1LMKA 3D5OF 1AC6A 1CT8B 2IPTL 4HIHB 1G7HA 2VZUA 3U9UB 3LD8B 1JHLL 3AUVA 3IDMB 4L3EB 3NESA 1C12B 5DQDL 2EIKB 5FO7A 5CGBA 4P99A 2R56L 5B1JC 1MCPH 3IF1A 1T6VN 2WQSA 3N43B 5IB4B 2K3TA 5T3XH 1UD2A 5E70A 2EIBA 2K4AA 1T1WA 3GSQB 4Z7VE 4D9QE 3CHOA 4LCCC 1K85A 4KKAC 1NFIA 4EN2A 4F9PA 3RL1A 4DEWA 4Y5VA 5E2VL 1SHSA 4D0BA 3UTTE 1D7FA 3W1ZA 1AOZA 3AC0A 3C60A 4ZD3L 1YY9C 5I74C 3FN9A 1MVUA 2XPGA 2QQLL 2VISB 1T5XA 3HZKA 4N6QA 2P28B 2N59A 2JE8A 1TCRB 4LF3A 2LGNA 1YEJL 4U1HB 5FUCC 1T4KA 4PJAB 4ZFZB 5LQBL 4OF7A 4B9GA 1DJWA 3ATAA 3DDFA 2YN5A 1AP2B 3W11D 1XBRA 4JY6A 3KDPB 3TWCL 1JWMA 2DJ4A 4J3UA 4QRRE 3QARA 5D7HA 4BQBA 2BHFA 2KUTA 2IC2A 4KJQD 4Z3FA 2FSEB 1I7ZA 4XNZC 2IAMB 2OJEB 1MFUA 1J1PL 4LCYB 2FJHA 3VFWA 1XF4A 3BQUD 1QTPA 3FCTA 3QDHA 2FD6L 2OCCB 1RZGA 1KG0B 3CSYA 3ULUC 2NDFA 4F3FA 1JD9A 1OCZB 5LXVA 4L8CB 3ETTA 1IX2A 3UZEA 4XH2A 5CD5D 1SY6H 4G7YL 3BHBB 2G4EA 1JHTA 1S7XB 4MD0B 5DURB 3I6SA 5H37G 1TJGL 3SKNB 1SVBA 4P2OA 1J5OL 1NLDH 2NXZC 2VIRB 1HINH 5ESAA 3LDBC 3O6FB 4UWQB 2OP4H 4HHGA 4JX0A 3MNVA 1F42A 5GGSB 4P5KA 1BM3L 1AY1H 1XL6A 2B0SL 3CGTA 1MCPL 3PAUA 4ETQA 1AACA 1XCWA 4RLDA 1VPOL 2Q7YB 4RA3A 4JHWH 4M6NH 4X8CA 1U42A 4DGIH 4NN6B 2WSKA 1P9MA 1UASA 2BWIA 4Y2DC 5LWYH 1G6RA 4LOEA 2DV6A 2HG5B 3L3HA 4AIOA 1RSFA 1C16A 4JO3H 2X2JA 4N8CH 4JO1H 5CEXA 4I3SL 1U8IA 4NQTA 5DLLA 4J39A 1T2QH 2NR6C 2IANB 4DSYA 1NEPA 4F2MB 1LYQA 2DICA 3CLFH 4LLUA 1A14H 4EUPA 1DQLL 2UZIH 3CXHJ 1NGXB 5I73C 3AREC 4FLOA 4Y7OC 3SKUD 1N26A 3U7YL 4MDJA 3R1GL 1FP5A 2V7NA 1YN7B 1OAYH 2J8HA 3BWUC 3EIFA 1T4WA 3VQMA 1KYFA 4AE1A 5JW4N 1G9NC 4PVMA 3FSWA 1ZXQA 3K2MC 4NHCL 3IU3B 5JNYA 4YDZA 2Y36H 1NMBH 2JB5H 4LIQH 4MAZA 3EDKA 1CGSL 1NCNA 1XGQA 4O2FA 4XCFH 2KERA 1AZZC 1QKZH 4LSVL 1ZD6A 5E4EB 5HVFB 1KJ2H 5DWUL 8FABB 4JZNB 1OCWL 5BVPL 1C5CL 2ATPB 5FHBL 4OFPA 3TS8A 5C0GA 4IS6A 4HOXA 4PS4H 1WD8A 3TN0D 1MELA 4WK4B 3RVVC 4ODXA 2IFFH 2E7HA 1VFUA 1BXVA 3OKOB 2OSLB 1BZ8A 1RMFH 1IT9H 1T83C 4CADA 4JRFA 3MBEB 3WFHA 3E9TA 2Y06L 1KZQA 2XTSA 4NO3A 1L9QA 1VHPA 5F44A 1WIPA 1QR1A 2FYYA 4TQEL 4HCRH 4R0LC 3VXRD 4RFEB 2AJZA 4NDMA 1UENA 4TQ8A 1QQDB 5AOZA 5LLIC 2K70A 4XCCH 3ZMEA 5D7SL 1L9NA 2J6EA 3Q9PA 4C56A 2Z1PA 1CBJA 1TDQA 5MENA 3QEQE 1LDPL 4Y4HA 2R1YB 4P04A 5KSVA 4IU3A 4JFSA 3ECBB 3ET9F 4NQXA 1DBKL 4DUVA 2NY2C 5DD3L 5E08L 3N41F 1DBJH 1DQMH 1MF2H 3B3BA 4PY8J 3U6XA 3G5YB 2C1OA 5CHNB 1GJWA 5A16B 4YSDA 1LQSR 2OL3A 4DP9X 2WLIB 2AJSL 1TSHA 1RU9L 1KIPB 1IRAY 1EBAA 4JM2C 5BNXD 2NYYC 4WJ5A 3CZLA 1OTSC 3NJVA 2GSMB 1NANI 2CRYA 3S6CA 2BMKB 4W6WB 4EZLA 3SE3A 4NQSB 5IGXL 1AOHA 1U8CA 2ZXAA 4YXKL 3TA3C 3VW3H 4AUJA 2H1LM 4PRIA 3H9SA 4WW2B 3D7PA 3VNZA 1GA2A 4A7UA 3Q1EA 5DUMH 1F00I 4JDEA 4G9DB 4DCQB 5A2CA 5FO9B 4HS6A 2IDCA 4BM7A 4PRID 2EECA 2VXVH 3O6LH 4Q6YA 1V3JA 1SEQL 1V54B 3IJ9A 3LKNA 3SY0A 1LP9A 1DQDH 1UVQB 2I60L 2MH4A 4GG8A 1MDAA 1E67A 3SPVA 4JJ5A 5IROA 3VFGL 1DVYA 4L3ED 4JHAH 2XN2A 2KBGA 3C5SB 2IPUK 1CI3M 2HTKC 3M7FB 3QPKA 4OZ4A 1E9QA 4HZLA 2J43A 4FQLL 2A83B 1KELH 5H94B 5J89A 5CXPA 3P73B 4LPVA 3B9KB 3GMOB 3W5NA 1JXJA 5CN1A 2NMSA 3TEZA 2Y5TB 4KQ4H 1SYSA 2ZONA 5K9KA 5DZVA 2J20A 3PNWA 1EGJH 4MS6A 4FJ6A 1G7MA 3IDIB 1RUAL 5G55A 5IHWA 1DLFL 3QORA 3QQDA 1FNSL 2NZ9C 4J3XA 1F1GA 2E7LC 3ISYA 4B9JA 3GMLB 5C0BA 3LZOA 3BZFB 4TS6A 4U6XB 1NFAA 4G9FD 4OLUL 1TTAA 4M1DL 5GZOD 1SFDA 3BH8B 4KVPA 3O2DL 2G9HB 4JM0A 5IQ9B 1FL5B 1AZUA 3O9WC 5K1VA 4N2MA 4ORGB 5FEBA 2YAEA 4A7VA 3VAEA 1D9KB 1IC4L 3MV7D 1X3DA 2XG4A 2UXFA 3FHQA 4XN7A 1K4CB 2RJMA 3WEBA 5KVFL 4FFZL 1NC2A 3EOTH 3P0GB 5KYYA 3HNTH 3QWQB 3ZU8A 1ZEAL 4QRPB 3K4ZA 1KJVA 2ROXA 1DVFD 3P30H 1JZ8A 3ZRSA 3K1DA 4OLYL 4RMRA 1DFBL 1IGTB 1KLFA 4D7BA 2IAMC 2EXSA 4KNUA 3NIFF 1A7QH 3F8UB 1ZT1B 2AJ3B 3P02A 1S8DA 2Y0SA 3GTNA 5IHUH 5A2AA 1TJMA 4NQDD 2NNRA 1FWXA 2XLLA 2YPLE 4O02H 1HHHA 1U3NA 3A3YB 1UB6B 2EVIA 1OAJA 1UXWB 3D05A 4ES9A 2K7PA 5KVEE 1S7QA 3V52H 3SGJA 1X5IA 5DVNA 4KFMA 4D9RE 5GRJL 3W82A 2JKXA 2X87A 4IGBC 4RGMB 3D18A 4X7SH 4PWKA 3JV0A 2AJUL 4H8HA 1E8ZA 1VFAA 4UNTA 3QZLA 2EYRB 5D7JB 2GHZA 5GJTL 5IW1A 1JZ5A 4LVOB 3S96B 2A0LD 2IXQB 4NBZB 5IFAH 2EADA 3FULA 4FTVD 4ONGL 3LN5B 4XN5A 4Z7AA 3VFTA 3OR7A 3MLWH 1AIFA 3X17A 1WISA 1WBYB 3MC0A 3RNKA 5HDOA 3TVMC 4YHPB 1LO4L 1ZS2A 3Q01A 4WI0A 4Y1AD 3V6FA 3BQUA 4NYLA 5EBLA 2BVPA 4Y16A 3WEAA 1GZPB 4J23A 4BFJA 1VPOH 2ZCLH 3HG0A 4W93A 2FRGP 1I7UB 5F6IB 1RZ7H 4NKMB 5F9AC 4IJTA 2YD7A 1K8IA 3OF6A 4ZUWA 4AKOA 4YZFE 1KXVA 4A1RA 2Y1AA 3SDAA 2Q8AL 2B1HL 3BEVA 2QFPA 1GGBH 2HVBA 3DTUB 3AXLB 4ZAKB 1ND0B 3RP1A 4Y19A 2DEXX 2GITA 4MRBA 2Q20A 5AVYB 2KDYA 5ID0A 1I1FA 4PY8I 3KMDA 2OMVA 4GRLC 4K7PH 2ZOOA 4MXQC 1WGOA 1DTUA 4AQAB 1Q72L 3U7YH 3PJSA 3FH5A 3L3GA 2ATKB 4IJ3C 1I8AA 4TOYH 3L7FB 2UY6B 5D7SH 2LQRA 3L4UA 3ZDZF 1U92A 1WTGT 5CZVH 5L6YH 5I6KA 5I1CL 3I85A 2V2XA 4YPGB 5ECGA 2VNCA 2FBOJ 3MNZA 4LKXB 5I1GH 2A6DA 4NQDB 4K23L 3ARWA 4YIQB 4F7CB 2R23A 2QV4A 4FQ2L 4GQ9H 4N6RA 4MZ3A 3RDTD 4DP0X 5K1NA 1R3LB 4NJ9H 4Q6IB 1Y0LB 3SBPA 1T0MB 2YO3A 2XWTA 3QJQB 4TSCH 3O6KL 2Z0UA 3BYTA 3FN0L 3MOBH 3T4YA 2NY3C 3ZL2A 2EDMA 4AE0A 3VXMB 2I9TA 4P2RD 5IB2A 4XPTL 2HA1A 2Z4QB 1V7ML 1ZE3H 5EUKA 3VW3L 3TBSA 1MWAB 3BD5A 3BH9A 2NOYA 4IGBA 5D4QA 5FW7A 4WFHD 5DK3A 3WTUA 1M7UA 5L2JB 2ALAA 3B37A 3K5SA 4GAJH 2OYMA 4JFQA 4YDVA 3RJOA 2JCCE 2OL3L 5IJKC 4J1UB 5FCUL 3S5ZA 3BPCB 2KZWA 4LIQL 5HYFA 4KGJA 32C2A 2HB0A 1HQRB 1MJUL 5JZ7C 1A9BA 5KSBB 5AOIA 4N0CD 5E1GA 3QJFA 5EBMA 5HJBA 3VXUD 3ZTDC 1OGAE 4PJFF 2KZKA 5AUMA 2LAGB 3WJJC 2PO6D 1HH9B 4WO4D 3ZMNA 3EGXA 4DJMA 5J6GA 3N43F 3RB5A 4UZGA 4JVPA 1NOFA 2P8MA 2WO2B 2ZG3A 4MZRA 1HQ4B 2UY7B 4WWNA 5F7LB 1MFDH 1R46A 2P26A 3V0GA 5BJTA 5D1QA 2DEYX 5D96B 1X4XA 3KH3A 4WY7L 4WHDA 1HSAA 5CINH 5TFSL 4Y9CA 1H3UA 1ZVSB 2W9LA 4PGZA 3O0LA 5IQ7H 1AR1B 3UBXG 2C3XA 1MXGA 1QUNA 1KB9K 1B4JL 3FFCE 4X9HA 5HHXH 4PJAE 4PJBE 1F3RB 3CFDB 3RWFA 2XZQL 2P5EA 2WQUA 1IAMA 4WGVB 2VDQB 1PYWA 1A7RH 4FLHA 2OTPA 2ZG2A 2OMNA 4RBPH 4AZ8A 4K2UH 4GQ9L 1I7RA 3GWJA 2X7LB 3BO8B 1WT5C 4ZPTB 2QSQA 3VSTA 2WBJB 3ZYJA 3FO0H 5F96L 2A0LC 3I9AA 1J0JA 4ALAC 1SPDA 1J05B 4NRXB 3GLEA 1GL4B 3ILPA 3MLSL 4ZMZA 3IFPB 4IBUA 4G82A 4J3TA 1A9EA 5IQOA 5I9QB 3D52A 4PVBA 2X9XA 1T83A 2F15A 3BPLB 2BNQD 2NX5D 3CIQA 2WYIA 4AJ0A 3RX7A 3KE0A 2JJSC 3GGWA 5CBEA 4Y4FC 4AQ8A 1DEEA 3ZHDA 1G7PA 2E47A 3BP5A 2FECL 2YD8A 3GBNL 4IBQA 1GCFA 1FH5L 1GJUA 5CEZL 5EZOL 5FYKD 1OY3B 3PHAA 5TF1L 3UJIH 5JHMA 4P4KC 2J4WL 1L9MA 4K8RC 5AZ2L 2HVJA 3US1A 4CKQA 1UD4A 5I1KH 5DTFB 3O4OB 1ZCRA 4MA1C 3ULVC 4TUKH 1CZ8L 1SVCP 4G8GA 5ALBL 2PABA 5D55A 1NCAH 2I5YH 4X99A 1RLWA 4ODHL 3MBXH 4G2AA 5I17A 4GKSA 1FBIH 4KKCC 1NH6A 2WHVA 3HG4A 4JO4L 5SX4I 1THCA 3IJYA 1F3DJ 1YEEH 3BGFB 4GB9A 2HJFA 3QAQA 3N0AA 3V10A 5I0DA 3QULA 4WUKL 4BSWB 4U3SB 2A9CA 2OK0H 5IMKA 1XR9B 2HTKD 3D2UA 3FFCB 3KPLB 1MN4A 4QNPE 4RX4A 1MCJA 5DJ0B 1H3XA 4NXKA 3QJXA 4RGMC 2IWKA 5F70A 3UTQA 3ZE2F 3T2NL 5F96H 3T6QC 2R1XB 4FC3E 2DWYA 1V8HA 4OU3A 5A2KH 1GW6A 4HQQL 2KI6A 4UUJA 3O8XC 5C0EA 5GISH 3U2SA 3L17A 5BQDA 3O0RL 2XICA 4Q9QL 3DIFB 2V5YA 4FMVA 2AK4B 3D9AH 4JY5L 2WSDA 3UAAA 5E5LA 4PGCA 3FU6A 4DP1X 1JV5B 5CD3A 1I3RB 1MFCH 4DW2H 4XPBL 1UACL 1AMYA 4Y8DC 5KSBE 1TJIL 1PW3A 2WLHA 4DPAX 3B2UC 1BP3B 3QXDA 5C09B 1DFBH 2PETA 4JNXA 2BVQB 4OIBA 5KBDA 1TLKA 3MZGB 4NCDA 1DDHB 4CDHA 1HH6B 3CXDH 3H9HB 3MRPB 4U1KA 2K9UA 3LVTA 5KBPA 5HHOA 2MQ3A 4BZ1L 1S7UB 1JRHL 3OXSB 4MXWL 3FN0H 3MOBL 4ZO7A 1EJOH 3TCXA 3TBTB 1BBJA 1GPOL 4NM4L 1E8WA 1DJXA 2CKBL 1G6VK 3T0ED 2MRYA 4JHUA 3KVDD 3SKMB 4CVZB 4Z7OF 4EN3A 4XMPH 1U91A 3RGVC 1BLNB 1M7XA 3ZKMD 4KK6C 5EBWB 3QR0A 3C8KB 3NP3A 4M43L 4O02A 1PEZA 3EHBC 1QTYT 3FO2A 1NDGA 1UURA 4H44C 3UPCA 4X80L 1F18A 2O1AA 1H6FA 1HZHL 1BBDL 4G6KH 3BP7A 2JB6A 3G04A 5EZLB 4C4KT 3WTWA 1OSPL 3LQAC 3I6LD 4O2EA 1EUUA 1F4WH 1XGTA 2BVUA 4FJYA 4R4ND 4XNAA 1QMUA 2A73A 5TDOB 3T3ME 1URLA 3JTTB 5JLZA 2J56A 1NZRA 4G5ZH 2FTAA 4MMZB 2YKKA 5C07D 1XCQA 5DQ9B 3LKPA 5EA0L 5CCKH 2GJ6E 4U3XA 4O51A 5F7EH 1XQ4A 3U1QA 3MRIA 3GJFB 5JDJA 2JKNA 3I02A 1FZKA 5B1JA 1AJ7L 3WNMA 5LVEA 2OS7A 3MODL 4B27A 2D7TL 1BJ1H 1D2OA 1XEDA 3GSNH 4RISL 1M71B 4AIEA 4LHJB 1CD1A 1RAMA 3IYLW 4AZUA 4NRYB 2X5PA 4HGMA 5MI0C 4CILA 4DGUA 1FZMA 1ZWIB 4LEXL 5FO2A 3SDDA 3G5ZB 1ORQA 2ICEA 2C3HA 2XIIA 4IU2B 1ES0A 3UTTA 2R4SL 5E2WL 4PLNC 1P4BL 3FFCD 5DHVB 1V27A 4XNUH 2GT9A 5I16A 2BJML 3K71A 4OF8A 2L7EA 2JKJA 5KTEH 4FRWA 1OAXH 1V3KA 3IKCA 4HJSA 3ZZQA 1CQKA 4ZNCD 2DKUA 5D6DA 2OMBA 1RUPH 3H6AA 1L7IL 1LNUB 5CBAA 4V2BA 2VDQL 1S5HB 5HGDA 1E8XA 4LCWD 4ELKA 4FHJA 4NNPL 4QRBA 5DJDA 1ITCA 4UF7C 3VTAA 4BDVA 4LRIA 3TX4A 4UTAL 5I76B 3DHPA 2NT0A 1CGTA 1PX4A 3SGEI 1DQJA 5GRJH 5I6PA 3GBMH 4TNEA 2ZICA 2F6AA 3P0YH 2Q2EB 2D2OA 3KYNA 3V79C 3VI3F 2WLNA 4FXGA 1KGUA 2QBWA 2YBRB 4OQTH 4IBWA 1QSED 5CWSA 4JS7A 3FT4B 2OTUA 3I2CH 4X4KA 3I74A 2SEBB 1QPKA 1QLFA 5DMIL 2VDPH 3ZYZA 4AXWA 2C3VB 5DXWA 4E42A 4RAVB 1HXYB 3GHBH 4QHNA 1CL7L 3DRQB 2CUMA 1OF2B 1PX3A 1XH2A 4PJGF 3WO3B 5E8EB 1QSEA 3SCMC 1JWUA 4PQXA 3GIZL 3FQNA 4ODSL 1R3JA 3CH1B 4NKIL 1NFDF 2AXGB 3TO2A 4A68A 5B3JE 1AGDA 2RHEA 3BZ4B 2EDYA 1X9UA 4JPIB 4DESA 1T6BX 2UYLB 1U0QA 3NZ8A 4ZMWA 4K3HA 5IMLA 4IRJA 2MMXA 2WKOF 4GO9A 3ZZSA 1AQKL 2NUTB 3O6ML 2RACA 1UJ3A 3K4AA 2ZUQC 4NFBA 1P1ZB 4OI7A 2EH8H 1HIML 2ICES 3CFEB 1NBVL 1S46A 1JWUB 1KTCA 3AACA 1QSEB 3C9NA 3MACL 4IRSD 4N0CC 3WSQL 5KS9B 4BZ2A 1B3JA 3US0A 4RAVA 4OV6F 1A3ZA 2C3VA 3LNEA 4X8XA 3QZPA 4WI8A 4B9IA 4P2QE 1ZHLA 4HCIA 1A7OL 4JG0L 5CWSB 2H32H 4PS4L 2QGBA 3AG1B 1TVBB 3MA9L 3ESNA 1QI4A 3GINA 4FG0A 3V4UH 5LUMA 4LGSB 3KGTA 4ZYKB 4CBZA 2DQIL 1OB0A 1U2CA 1H9DA 4R84A 1XGUB 4W6YB 1X5HA 5EU6E 3U6XS 5TF0A 4BDVB 2L7JA 2IH8A 4ELKB 3BUIA 1Z7JA 4M4RA 4WDIA 1S5HA 5HGDB 2BIQA 1F4XH 5GGTL 4HKXA 1WZ1H 2B5IC 4PJFE 5FUCE 5F7HA 4U6YA 5BXFA 1RZ8A 1N6UA 3IKCB 1T04A 1WG3A 4JFWA 4POZD 1XSKA 2ISDA 3K71B 2XTJD 4Z0BL 1DVZA 2R7EA 2C7UA 3IMRA 1MVYA 4HEPG 3MJ8B 3A24A 4CNIA 3CDGB 3B3IB 1WS8A 5I1JL 3RTLA 4IOIA 1L0PA 3OKLA 4NRYA 1MRCL 4JK0D 1CD1B 3MJWA 4BFOA 1Q9KB 3QG7L 5CLWA 1M71A 3B2XA 1KEMH 4HUCA 1KJMA 2G5UA 3QUXB 2CO6A 4Y1SA 4O51B 2F7RA 5ETUA 1KCLA 2WIIB 5DQ9A 3D0AA 1A8JH 2MPAH 1ADQL 1HAUA 1DZBA 4MMZA 4QXTB 4YSSA 3JTTA 4L1DA 5JLZB 5TDOA 3GK8H 5FK9B 2R51A 4P8QA 1E7UA 5B39A 4NXSA 4GEIA 2X2YA 4ONHA 5F9DC 3F65A 3RDTB 1TQTA 4OCWL 4QOKE 1JTTA 4EVNB 2XOTA 4AC4A 2MCMA 3V6ZB 3KPOA 3FJTA 5T1LB 4X5RA 5D2NB 3BVWA 3PUCA 2A9MH 4MJJA 3CHRA 3O2WL 1JMXA 1QLRA 4TQPA 1WK0A 3KPNB 4UOZA 3KPRD 3FO2B 3QIBD 4EUPH 3D2TA 1D5RA 1YMMD 4XVJL 3N2JA 3H2PA 4NC2B 4O02B 2Q76B 2QPUA 2YRZA 3BWSA 4PGDA 3SGKC 2YPVH 4JZOB 1FGVH 3GDBA 4LE8A 1TU2B 1L0XA 3E8UL 4B7LA 3RVWD 2Y7OA 4MB4A 3V95A 4CVZA 2XVGA 3K5RA 2BHYA 1BECA 4M02A 43C9B 4QD2E 5I8CB 2X12A 2YRPA 1Z6JT 2R2BB 4L9DA 1BBJB 4TVPE 1G9MH 1VGEH 2O30A 5C0IA 4M5ZL 1WFMA 3CVIL 3GKWL 4QXVA 1U4FA 3RGVB 5I6NA 2XG5B 2LU3A 2PXYB 1CLZH 4GH7B 5DK0B 1LWRA 4O4YL 3NP4A 35C8L 1F4AA 2H1PH 3LEVH 4K5NA 1JFQH 5DJYA 4NZFA 3PDOA 2X3AA 2Z7UA 4LQFH 3V0EA 3VG9B 4KPHH 4Z6AT 3FU7B 3WFCH 3I9PA 2OZNA 1QI5A 1TVHB 3HEIB 3L5JA 5HSFA 3ETBJ 4JKWA 4DQAA 4P2OD 1HHKB 5ESVB 1A7BA 4PBVC 3IETA 4PGCB 2W60B 5CD3B 1YUHA 3D0LB 3SHSA 1UZGA 2UV3A 3WYRA 2W92A 2WCPA 2YPLB 1BYPA 2P5WB 4NPJA 4KJPC 5CCJA 2OZ4L 3V6BR 3U2SB 1SJHB 1AI1H 3DECA 3SIKA 3D50A 1BPVA 3VXRA 4PN6A 5FKPA 1JVKA 4N2LA 2DWDB 3ZSSA 4RBPK 3V4VB 3F6JA 2J55A 3O6FD 1JP5A 4A7GF 3DBXA 3UTQB 1F3JA 3MFGB 3WS3B 3NRFA 3VQLA 1I3UA 1XR9A 3M1BA 1YEEL 4JFPA 3UYRH 1BZ7B 4U3SA 4KROB 4HIXH 2K6WA 4PIRF 3RRQA 2HJFB 3NG5A 3FSAA 4MAYB 3FOMA 1RY7B 1N64H 3VGAC 1MHCB 1U95A 4XTRC 2Z1KA 5I17B 2G30A 4P5TA 5J56B 4Q9BA 2UZIL 1PL3A 1EIBA 1KXVC 3D87B 3T2PA 2XN9E 1FGNL 1HJBC 1I9RL 5DTFA 3SDAC 2QPFA 3AU1B 1DL7L 1A65A 3UPAA 3AWFA 3SE3C 4HJJL 2EP6A 2AEPH 3DYOA 4N86A 5D7KD 2HVJB 1HHIB 3Q8EA 1KJ2L 4U3CA 5TDPB 5LBGA 4EI5B 4JG9A 4K71B 4NC1E 1WV7T 3JZYA 5F3FA 1RK1A 2BY2A 2HFFA 2ZWYA 3EYSH 3CHSA 1UXLA 3NFPB 3HE7C 4Z7WB 4ZZKA 1GSKA 2AGJL 2GPZA 3F2LA 4WWPA 4IIQC 4RSYA 2C3GA 5HGBB 2FX8H 1N59B 1Z5LA 5CBEB 3SDXE 1VFBA 9CGTA 3QG7H 3HG2A 1HZHH 5F88B 1GC1L 3SKJH 3P4NB 5D1ZA 2UZYA 4OLEA 3CFCL 1SDYA 1SMOA 3CZSA 2PCYA 4GSDL 4FG4A 1NLBL 3HG1D 2IDTA 3UAEA 4BIKA 4IMKA 1PLBA 4ZMPA 3IFPA 4YWGH 4R4FL 1HU8A 5DI8B 3EHBD 3ILPB 4MDIA 4XCEB 2XKUA 2EKSB 3FONB 4HXBH 1MCWW 2AJVL 4OFQA 1TZGH 5DVLA 1I53A 2WBJA 3W56A 2CRMA 3BO8A 5B7MA 4HWNA 4IBTA 4AQEB 2J73A 4AZ8B 4OM1H 3T6ZA 1JF5A 4PY7B 1PYWB 4Z7VF 2OXGB 2R29H 3RLSA 4JRWA 4TMPA 4BQ8A 2P5EB 3WS6C 3WDJA 3CFDA 3G6JA 1SVZA 3VFPA 1YCSA 1J1PH 1D2PA 1MAMH 1SM3H 5ITBL 4LL4A 4AEIL 4QGYA 3AB0B 1IGFH 4HLJA 5IVZA 5SWZD 1H0DA 3WD5H 4QTHA 3JV4A 4PRPD 4OD1L 1AG6A 2WZ5A 1WVZA 3QUXD 2EE9A 5DRZA 2F7QA 1ZXKA 2UY7A 4YSRA 1ED3B 3TP4A 2P5EE 1TIUA 4MKMA 4LDLB 2COVD 1GYUA 5IIEB 3NPSC 1T0PB 1YECH 3L9YA 2JWYA 4MAUH 4F8PA 2ZKYA 4X8GA 5JHAA 1I9IL 3S3BB 1MCLA 4DAGL 1AXIB 1RULH 5D71L 2YUXA 1BHGA 5A6MA 3QJFB 5D1XA 3EJYD 5AZEL 3RE0A 4DGVL 1HQRA 3HI6H 4HEME 5C0AA 3X1BA 1NGPH 4AWJC 3GC3A 5HXMA 1A4CA 2DBLH 1HCZA 4IOSD 3WTVA 4ZW3A 3D8MA 1IEHA 3JV6B 2WK2A 3TBSB 4I0PA 4M93B 1L7TL 3KPRE 3KGUA 5FB8B 2I9TB 4HJ0D 3MBXL 4LLMA 2VR3A 3MRDB 1FNAA 3P77B 3VRJA 2A9BA 1VADB 2OMTA 3QEQB 4JRXB 4TVSa 1KPUA 1NA8A 2EDKA 3K74B 3FO1A 3LIUA 4XC3H 2E9BA 4YDKH 2XWTB 1Y0LA 4WW1A 2IGFL 5EDXA 4CSSA 3UTSE 3WXVL 1S9XB 2VXQL 1PLCA 1YEGH 2AKRB 2R23B 3FL7A 4MBOA 1TEGA 2NQ3A 5I2IA 2ZUVA 3FQTA 3FUMA 2HMIC 3IGAB 4PRNA 4WI2A 3D07A 3W0WE 1WUNT 4JFZL 4YPGA 1PG7H 1NL0H 2HSIA 2V2XB 5I5IA 1A0QL 4OZFB 3TESA 4G42A 5F8QC 1U92B 5AOLA 4Z7OB 4R3SB 4FEIA 2UY6A 2UXGA 2XY1A 1RKRA 1ACXA 2EE6A 4GS7C 4AMWA 1ZSHA 4PR5A 4AQAA 1PVHA 5LGYA 1BW8A 3V4LA 3KVPA 2OMVB 1WAPA 2VUKA 1URZA 1MOEA 4PSRA 2YA1A 1FNGB 1ZSDB 3W0WA 2GITB 3GNML 5KVGE 1BJ8A 3AXLA 4ZAKA 1JF1B 2FGWH 2XTJC 1TKWA 1IC7L 3DNKA 3SDAB 2EZ0D 3EO9L 4JFFD 1QRNB 4MBRA 1R3IL 3X3GL 3F05A 3OF6D 2DQHL 1WWAX 4R4BB 3GRWH 3MFFB 3REWA 2BLFA 5FM8A 4ZDHA 2I24N 3MV11 1I7UA 2FX7H 3CVHH 5BRZD 2F5AL 3PPEA 3JWNC 4RWHA 4G3YL 3BWAB 5CJ5A 1WICA 4EEEA 1I8LC 4OGZA 3S5LG 3M17A 1CTNA 3QEGL 3BLPX 2B9BA 1NINA 1QWNA 3GF8A 5ACZA 4PI2A 1KCUH 4X5WB 3LKOB 4NPYA 2EEBA 3GI9L 1AIFB 3HI5H 3V5HB 1MI5E 3LN5A 3DTDA 2A2QT 2DH2A 3GZKA 3KGSA 4TV3A 5HDBB 1JGLH 4BZ1A 2ZT9C 5D1QD 3OJVC 3OL2A 2OCFD 4LP5A 4YE0A 5IB5A 1YSOA 3H3PL 4G8IA 5D7JA 1SHMA 2P7TB 5FYKE 4GXFA 3B7YA 2HJLA 3BAEL 3H53A 4GKZB 4OI9A 3S3DB 4Q9RH 2ZXQA 4YZWA 4I2XE 5MENE 3H2QA 5IJVA 1QG3A 4TSBH 1WBXB 1FYTE 1TPXB 3O3AB 2ZP8A 1YAIA 1TENA 1M7IB 1PFCA 1Q0XH 2PW1B 1P4UA 3QUZB 5F1NA 4Y9GA 1OGTA 1IC0A 3DHUA 2F18A 1PU0A 1IL1B 1ZT1A 4GRLB 2FH8A 1XIWD 1MCSA 3A0OA 4MNGE 5HYJD 4XCNB 5DDHA 5JIDA 1IAIL 2BSCA 1BD2A 2WQXA 3HLKA 3UJJH 4QRPA 4U3HA 3OKYA 4PHZA 1HL9A 1Q94B 1KULA 2PTUA 1NC2B 1N19A 3Q2VA 2AV1B 2HUEA 4H26A 2CO3A 2XG4B 5EDSA 5ITFA 5DQJB 1D9KA 4M9OA 3NIFE 5ACMA 1FL5A 3SDAD 1UGNA 2BPBA 4OUOA 3VWJC 3B8SA 3F58L 1J5DA 3RBGA 1E7VA 2EXYD 2YLKA 4CVXA 2DQCL 4PCKA 1OW0A 4K9JA 2YUZA 1HXKA 2M1KA 4H20H 3GMLA 4TOYL 4U33A 5DZJA 1Z0NA 4YVNA 4DAGH 2X05A 2NQDA 3QQDB 4JB9H 5JXEC 3IDNA 2FATH 3IDIA 3BFWA 3S4SG 5BMFL 2LV4A 4A67A 2FJFA 1TZIA 3PNWB 1OTUD 5HJ3A 1E90A 1UD8A 3LCYA 4N0UA 1SYSB 5GS2D 3PWLB 5K9KB 4DT2A 3HN3A 1T89C 4OCYH 4EDWH 2R9HD 3B5HA 2HLAA 3FTWA 1INDL 4YX2L 5A6LA 3R4RA 1WA2X 2WOYA 2Z35A 1HX0A 4P06A 4KKBD 4X6CE 3PWPB 5K93A 2C9RA 4HOZA 5E6RB 4A2FA 1BVLA 4WTXA 4NFDA 5AB1A 1KLUA 5IT2H 3UEZA 1OSZA 1N8OE 2ETWA 4DEPC 3MKGA 5I75C 4M5ZH 1RSYA 1GS6X 2C26A 2R1WB 2Q8BH 4OJYA 4X5XA 4PJIA 4JJ5B 3QBTB 3VH8A 5KWYC 1OGAA 3T6WA 4N8VB 1UVQA 3MV9B 1LP9B 4UTCA 1S5IL 5ADOH 1IBGL 2PYFB 1RHHB 1YEDB 3ZQ9A 1HEHC 4PRPB 3MGAA 5D1ZC 4APXB 2ENSA 4HS6B 4EIZC 2DWEB 2NY5H 3L45A 3VXMD 4KDTA 1JDDA 4N85A 1U8MB 5L0QC 4YE4H 5FYLL 2H2PD 1Q9OB 4QHPA 2DM2A 4DZBB 4P2QB 5CLZA 4R83A 3QYMA 3RZCC 2OZ4H 4F7MB 1L9RA 3QXUA 2VKWA 1QYGH 1CE6A 3NDZE 2WBJC 3UJTH 4YLBA 3EOBA 2IAAC 1MEXH 2R39A 5EO1B 3MCLL 3ULUH 2AABH 3WEMA 1G0DA 1TQCC 5EO1A 4KKLD 4H1LG 4U1JB 1G9NL 4DTGH 1TZAA 2YUWA 3GMRA 3RFZA 4M93C 4C83B 3DX2A 3WXWL 2HJKB 4N3TA 1B4JH 4NN7B 2CR6A 3S3JA 4Y4FA 3EF4A 4P2QA 4KQ3H 4EN3C 4LK4A 3HVNA 3WKMH 5TFSH 3ULUD 3OJ2C 1E3ZA 2Z0BA 2EZ0C 5E23A 1DN0A 2DWEA 2D73A 4N2KA 5HHNB 4GRWE 4FYRA 3ECBA 3FT2A 2R1YA 3V5DA 5I1JH 1V3MA 2Q3ZA 2VXTL 3E1F1 2OMZB 3LEXB 2WZPA 1RHHA 1YEDA 3NIDE 2PMZA 4HLEA 5JW5A 1K72A 1X4ZA 1I75A 4PJ5B 1UEMA 1OGAB 2I26N 3E3QC 4N3UA 3JWNG 2X10A 1C1EL 4OJAA 2AJZB 3ZRFC 2R4RH 2YFNA 4YQXH 2FYYB 2A6JB 1LEIB 2CKNA 4HC1A 1K8DB 4ZPVA 4NO0D 2IFGA 3IU4L 3QRGH 3ASNB 1E4KA 1Y07A 2DWTA 4AJVA 4JN1L 3MBEA 1ZLWK 4KNTA 5DJCA 5B1BB 1S7WB 2NZ1A 3PWPA 5DVKA 3HC3H 4LSDA 5IW6B 4YSCA 1HOEA 2D7PA 2ROYA 1UD3A 1C5CH 3MLUL 1KENL 4H25B 1AYRA 2Z35B 2X42A 4ZOCA 5CGYC 7PCYA 2XTJB 5C0GB 2P48B 5B22A 5FPIA 4NKQB 3PWLA 4JVWA 1P4IH 4JZNA 2ESVB 5HJ3B 1UHVA 1AAJA 3FTXA 2ZWNA 4C58B 1OAXL 2FJFB 3GBEA 4R2GC 5H37H 1OARL 2NT1A 1XGQB 2FEJA 3AFLA 4O2FB 3ABGA 3QIUA 2XVBA 4GXUN 4OT1H 2F58H 1P6AB 5AOMA 3V4PL 1PZCA 3GRBA 4CVXB 3CFQA 2VITA 4N0FA 4G6FD 4ZOBA 2I32A 1H8SA 4HFUL 2V7NB 5B38A 5JOEA 1UZ8A 1ZHKA 1SRDA 2V3DA 4OUUA 1CLZL 3IK2A 5KJRH 1B88A 2IH9A 1O0VA 3TCLA 1GKOA 1WAEA 2E7CA 4ZMAT 2B77A 5FYJE 3QDMB 3SE8H 3ZRCC 3K72A 2JI3A 1Z9MA 2Y7SA 4GG6E 3ARGC 4N8CL 4PGEB 2X6AA 3FQ2A 1ZS8A 3NGBB 2XI9A 2XX1A 2DQTH 4PJCE 4DUWA 2NNFA 4FQ1L 4UM9D 4KX9A 3Q06A 4YLCA 3T77A 2XC8A 1DBML 2HG5A 3L3HB 4FP8H 5BMFH 1OE1A 2L8AA 5BPPA 3TYGH 3ZT7A 5HYSG 3BQVA 3SE4C 2BSRA 1YEHL 1K6QH 2Q7YA 1SBSH 2EINB 5HVHC 2R83A 1M3IA 1A3LL 3QUZA 3UROR 1TTUA 4ETQB 4RMTA 5E2JA 3QB7C 4KHXL 2ENYA 2WXGA 4W9EC 5GGSA 3O3AA 2NW2A 1C5DB 4NC1C 5IJVB 3NSDA 2AC0A 3O6FA 2NY4C 3KD4A 5F9OL 5E8DL 4MB5A 4UDTA 2IWGA 2HJLB 4JFEE 1QABA 4WWID 5E95B 4JPVH 3VTTA 4XNYL 1JHTB 1S7XA 3BHBA 3T9WA 4RDQG 1A1NA 3QIUD 4M7ZB 3EJCA 1KV3A 1AVAA 5ICUA 4CAGA 1KG0A 4L1SA 3LKOA 4NPYB 3DMMA 4LSQH 3OJDA 3K4DA 5KVDE 5DUJA 5ACZB 3QWOA 4L2YA 4EKJA 2ARJB 3O3EA 4L0ZA 4PUBL 2KYIA 3B34A 3M17B 1NCWL 4U1NA 2FJHB 3VFWB 4GNKB 1GGYA 1LXMA 4HC1H 4LCYA 3RWHA 3EH2A 2IAMA 2OJEA 3BOVA 2IDSA 3FCGA 3OAUH 4PV8B 2QQQA 2G5BB 4JL2A 4J6IA 1K3ZA 5F6HI 1INDH 3ZX1A 3RDJA 3S7GA 4N0RA 5I24A 4LLVA 2FLMA 1HILB 1JFQL 1Z0MA 1AR2A 2BIHA 4PJ7E 4BFKA 2DJSA 4OZGB 3ZVVA 2CRZA 1A6VH 1ZV5A 4KXDA 2BNQA 3HZKB 4N28A 1T5XB 1F0LA 2XPGB 2W88A 4MFHA 4FQXA 3LEYL 1BZEA 3W0WB 1ZSDA 4IKIA 1BQHG 1XGRB 1FNGA 1JGIA 2FE0A 4RGND 1UADC 1LP9E 3BLBA 3RWIB 3TBCA 4NKIH 4Y5VB 1RZFL 4AGOA 3RWJA 3DIVA 5E5MA 3SPGA 5C3TA 3L8QA 1T1WB 1BF5A 4IRJC 5ADOL 2FUTA 5IEHB 1TYEB 4D0DB 4URKA 3IM1A 4AV5A 4OIFA 1QRKA 5J13C 2IPTH 1FSKB 4L3EA 2BO0A 1HEJC 4OSUL 4LFHD 1EHAA 3IGAA 4PRNB 1RURL 5I2IB 3UJJL 4N20A 3TA4D 3L5HA 5GXBB 2DTSA 1S9XA 1T66C 4D9LH 1MRFH 4X6DE 3BAIA 4MMXB 5CIPA 1QX1A 2VXTH 4NO2B 4OQ1A 3QUYB 5TH2B 1R0AL 4OFIA 5BVPH 4HUXB 4KK6D 4JN2A 5ANHA 3FO1B 4AY0A 4GBXA 1KPUB 3ERXA 3H1ZA 4JRXA 3VFVB 2OMTB 4J3OD 2XFXA 3C8DA 4LLMB 4Z7QF 3QEHB 2XX0A 4YXLH 4KO6A 1LD9B 2X1OA 5INCA 4CSTA 3SDCC 5LBSH 4GG6A 1NGWA 1CGWA 2YMXH 3PJLA 4OLWH 2O5NA 1Y18A 1OO2A 4DETA 4UT9A 4IBLT 4JCWA 2VERA 1G6RH 4FQJL 4ZSOB 5C0AB 2UZXB 3RAJL 1F90H 5D1XB 3FB8B 2HRHA 2ICWB 4NNXA 1RZKH 4R97B 1YJDC 1BEYL 4H8UA 1SXCA 1W0VB 4KK9C 2J88L 5E6SB 1J5OH 2OCJA 4NAQA 3MRJA 3O8XA 1XH0A 1BAFH 2XRAH 3CK0H 5BZDA 2PR4L 3FTGA 1MPAH 1ED3A 3EJPA 5EA0H 1U8OA 5LDUA 4P57B 2BRQA 3C2AL 3JV4B 4OLXL 1KBGH 1RPKA 2H3XC 3IXTB 1H0DB 2KT6A 2JELH 4G3YH 5FO8B 5L8KB 4A7SA 3UAFA 2QVMA 1J11A 2FHFA 2C9XA 2PCXA 4Y5XB 3EADA 1AZBA 1DEDA 2EACA 5C2BH 3HUJA 3G6JB 3LKSA 5FFLA 1B0WA 1AD0B 1I1YA 5DHVH 3D85B 1D9KD 3CXFA 5DEFA 1ZK5A 1RCYA 2OXGA 1HINL 5C9KA 4Q4IA 5DJZA 2B8OT 3L95A 2JJVA 3L4TA 4Y4HC 4AQEA 1BFVH 2YEQA 3N0PB 3TBYB 4HBCH 1AS7A 4KK5C 4Z3EA 4FXKA 4QYAA 1U8QA 5CJQL 3CIAA 2R2HA 1FZOB 1J88A 1U4EA 1ZIBA 3EYVB 4O58H 3LKRA 3R0MA 4JCMA 2FATL 3ZJAA 2JNZA 4TNGA 5TE7L 2XCMC 4OD1H 5HDBF 1O5PA 2VRKA 1JPEA 4NKOA 1AXSB 1MWOA 1H3PL 2YC1A 4N9OB 4NWTL 5C3IA 2OPCA 4J8QA 2UZYB 1JK9A 5ILTL 5D1ZB 3QEQD 3P4NA 3UO1H 3VFSB 3QHFL 4NT6A 5IJDC 3AWEA 2FT6A 4A6YL 5F88A 3NN8B 4UQ3B 1E27B 1ZOXA 5GGRY 3IDGA 1LO0H 1EFXD 1N59A 5HGBA 4X7TB 3GM8A 1VSCA 1WHOA 3UAJC 3KYMA 3QHTC 3MVSA 3WN6A 1HAWA 2X0UA 3EAKA 3L3OA 4JPKL 2HFFB 3CVHL 1RK1B 5H2BA 4AIZA 3O6KH 1AC0A 3Q3GA 1KIUA 1IKFH 4BZ1H 4XNXH 3M46A 3HPJB 3AU1A 5DEJA 4DO5A 1CBVL 1JYNA 3PABA 3ZBMA 3O3BA 3FH8A 1FL6B 3VD4A 5D2LE 5TF1H 3STZB 1W2KT 4KNSA 4WF7A 1U95B 1GAFH 1UB5A 3BPLC 3FTZA 1RUQH 2Z8RA 1A25A 1BZ7A 3OPZH 5DD0L 4JFOA 1YYMH 2XQYG 4IHBA 4P05A 3AY4C 4BBWA 3H42H 3LQMA 1ZGLP 5FUOH 2BOBA 2H7WA 4ZS7H 2K6YA 1AGBA 4NM8L 4MSWA 5B7EA 1ETZB 3ZDXB 5IM7B 4QHMB 3QO1A 3L08A 3DBXB 1NBYB 5CJQH 3TASA 2D2CC 3VH8G 4ONFH 4F57L 1JXKA 2FX9L 4HBCL 3VSUA 2DWDA 1W72H 3HUJE 2Q8AH 1AGCA 3VXRB 1OM9A 1HKLH 4Y4KC 4ELMA 4Z77A 4FTDA 1GC1C 4MXQD 2D4FA 4MAYC 1FVEB 4AQ1B 2BSSA 4Z76A 5I1IH 4OCWH 5BZXA 3OAZH 1V7MH 3IETB 3MRCB 1HHKA 4F7EA 1UM6L 1FRGL 5B39G 1U41A 1UG9A 1QHQA 2YMXL 2DB8A 2CHXA 4IEFA 3FU7A 3UYPB 3VJ6A 3ZGHA 2BK8A 3GKZA 3QUKA 4V2CB 1JXDA 1IKNA 1G7IA 1WE5A 3JV5A 4ZFQA 3FOLB 4Y89A 1UFGA 3B7RL 4J4PD 4W9ZA 4TULH 2PXYA 1MKFA 2XG5A 2GUOB 4LSRH 5HD8C 4XX1G 3VFOA 4JMNA 2EICA 3T71A 4X4ZA 3POHA 2R2BA 4P9HC 3K6DA 3WIHH 3ML9A 1N2RA 2WVTA 4HT1L 3B7SA 3LPWA 3CPLA 2AW2A 2YAPA 1TU2A 4HFUH 3RVTC 4JZOA 4YDIH 5IR1B 4QRPE 5E7FA 1OB1A 1GPOH 4NM4H 4G43B 4FQCH 4EI6B 5E8OA 2VXSH 3CHPA 5AW4B 4K71C 2NY7H 2EO7A 3ZGIA 2HVKB 5D2NA 1PMYA 1WZ1L 4K7FB 4JFZH 2ZKWA 4ONHB 4PLKC 4RGNC 3CZJA 5CINL 2VLLA 5FK9A 5IVNA 2DDQL 2GHWB 4QXTA 3A4EA 4W9CC 4ODBD 4PJ6A 2F54A 2X3BA 2EABA 2Z7YA 3BKYL 2CD0A 1G4MA 2EDWA 4Z78A 1BJ1J 2C8NA 5DHMC 1EAPB 2IG2L 2VMFA 1MREH 2CO6B 3FHEA 3UTSB 1KJMB 3QUXA 4POYA 4R7NA 2R0ZL 3I84A 4AKQA 1TJHL 3CZFB 3ULVF 3PQYB 3GLDA 4PG9A 5FM4A 3BPOB 1NCIA 1KNOB 4FF9A 4HS3A 4ZZFA 4WNJA 3OKLB 2VDKB 3MV8D 3MJ7A 5I23A 4R26H 5J11C 3L3IB 3B3IA 4CNIB 4X9BA 3VD7A 5IB1A 5KYXB 4APQB 2R7EB 2E8YA 1MJJA 3O41A 1IEBA 4GEJA 4M7ZC 4XVSL 2G2PA 1J0KA 1TO4A 3BUDA 4HFWB 3IDXH 3IJSA 1RJYA 2YKLH 1KXTA 1MCCA 4JJHA 4R8WH 1T04B 1YPZA 1RZ8B 3N1GC 4GXVH 2DZEA 3DK0A 3F01A 1YYLL 4HPOL 4UBDC 4WI5A 5C6TH 3PGDA 2ZSVA 3MXWL 4ZRGA 3A4AA 1PZ2A 3AZUA 3EJSA 3NDYE 5A2IH 4M4RB 1V05A 3W9EA 4OJEH 3UCQA 5FOBB 1IFHL 3FMGL 1YVLA 1OPGL 2X4RB 2XWJB 3EYSL 4RDBA 3UZQB 3L5WB 3V4VH 5AVQB 2V2TA 1XGUA 2H6PB 2AEPL 1TVBA 4OLVL 5D1XC 3DX9B 1KEGL 4I85A 1XCTA 5I1CH 1T2JA 4B3VA 1XGYL 2VN5A 2LLLA 3VXSA 5I73B 2A3TA 4AV4A 3AJ7A 4RESB 1OCOB 4JFVA 4LBAA 4PB9L 4PGBB 1G94A 1BQLH 2Y6SD 3OKMA 4PH8A 4HJTA 2GC4C 2D3NA 1AGEB 1QSVA 1QPPA 4YUEH 5D5ME 1JPTH 1TVDA 1KWKA 1WA0X 4DWHA 3X3FH 1ODAA 4HIEB 1U3ZA 2E5EA 2PO6B 5D4HA 4NO5B 4AK1A 1U8NA 1T03L 3W39A 3CX5J 3ZZLA 5KBMA 3QI9A 4IRJB 3VSQA 4RMSA 3BZEA 4GKNB 1L6ZA 2VJ0A 3AADB 3MLXL 3MLSH 1FYTA 1BXUA 4BFRA 1WT5A 1AGDB 2ZYHA 3BZ4A 5MHSE 2AXGA 4Z3GA 1TZ8A 3LEYH 1VACB 3FQNB 3D33A 3RWCA 3P9LA 1FIGL 5AYTA 5HDWA 5DFAA 3MOAL 5HYQA 3DRQA 4XPAH 3SPCA 3REVB 5LG1A 5I26A 4E41A 3IGUA 3FT4A 3IJ7A 3LY6A 3ORJA 1IKOP 1J0IA 4BK8A 2YBRA 4MNGA 5KUKA 4HKZA 2Z6FA 4FXGB 3KCPA 2VLKA 3KYNB 2EDOA 1CDBA 1RIUL 4NN6C 4UMSA 2FB4L 3Q8CA 5HYIA 2Y72A 3DJ9A 3G9AB 1DQJB 3F84A 3WFCL 2FECI 1JPSL 1FNFA 1NOLA 3MXWH 1A7QL 5F1IB 1IQDA 4UTAA 2Y4SA 3F7PC 4HAGA 5DF0A 1JSYA 1BAGA 2YD0A 4YR6A 4HIIB 1LNUA 2XACC 5KJRL 3ULUF 3PWPE 4HBQA 3F64A 5DJ2B 4WK2B 3RIFK 3RL2B 4KDVA 3ZDZB 1SJMA 1BGXL 5I16B 4AENA 3RZWA 3V52L 1DJZA 5T5NG 3ZKND 4WAFA 1CO1A 2DQUH 4LPWA 3WAJA 2XVLA