5EEVA

Radiation damage to the trap-rna complex: dose (dwd) 3.88 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eevA00
2EXTA 2ZP9A 3AQDA 1GTFA 2ZCZA 3ZZSA 1WAPA 5EEWA 3ZZLA 3ZTEA 5EF2A 5EF1A 5EEZA 5EEUA 4B27A 5EEYA 2ZD0A 2EXSA 1C9SA 5EF0A 1GTNA 5EEXA 5EF3A 1QAWA 2ZP8A 1UTDA 5EEVA 3ZZQA
chains in the Genus database with same CATH superfamily
1M53A 3GDBA 3QUYD 4U4BA 3VRJA 5I15L 4Q89A 4PU2A 2HMID 3TWCL 2F54D 2YOAA 3F65A 1UT2A 4KQ3H 4PRNB 4HF5H 4GXVL 5HJ3A 2V9RA 1PZUB 2DH2A 2OMVA 2X4SA 2EEBA 4YS4A 2YPKB 4NZUL 2Z91B 1U3HB 4LLWA 4NAMA 1SYVB 4JZNB 3UTZB 2DIJA 3VD4A 3P9LB 3V0GA 1EJOH 3QWNA 1TEFA 2DH3A 5IJDC 1DVYA 4B3VA 4F37F 5F6IB 4TUKL 2WNWA 1PG7X 1JZ4A 1H3XA 3K6SA 3POHA 4GRLC 1F58H 1F97A 2OX5A 2RCSL 2Z93A 5I6MA 1OAQL 5SWQA 2QADC 4F1ZA 1GYAA 1DBBH 2R23A 4UQBA 1AZUA 3FT2B 5E00B 5C0GA 4ZZFA 4OZIE 4AKPA 1F4YL 3EYUL 3WOVA 4JY5L 4ODTL 1U8KA 1G7IA 4FQJH 5I8KL 4OFDA 3Q8AA 5FYLL 2PYEA 2XFGB 3HC4H 3OGCB 1TQWA 2AJ3B 3MNDA 4HC1L 5DRWA 1DJIA 3LRSB 2DV6A 1O9VA 3BSZA 1S7QA 2BMKA 1SVBA 3GMRB 4KU1A 4MHHI 3VMOA 4EE2A 4KAQH 4Z95L 1D6VL 3NJLA 1ZLEA 3VDBA 1I3RA 1EZLA 2UXFA 1NEZB 3PCYA 4WFGD 1CFTB 3KBFA 4CJ0A 4UT6H 5D7JD 3ARFA 4N1HB 3M07A 2MQ3A 5EZOL 2VSDA 5AALA 4CADA 5B3SB 1PX3A 5FYKH 4C4BA 1DSYA 1INQB 3E7JA 3JVGA 3OZ9L 4B9KC 3CMGA 3X1FA 3GUTB 5D5MF 5T5FH 5EO0B 2F5AH 1T66C 3IJEA 2P80D 5CIPA 4QRSA 1D9KC 3TBVB 3PXHA 3QI9B 3BGMA 4HH8A 2V2WB 4R96B 2Z35B 3AS2A 2VIRB 3BMWA 4K4KA 3CSGA 3I3EA 1JVOA 1GJUA 2CLRB 2W91A 3VFUA 1E2WA 1MWAH 3QJHA 4MB1A 3OZLA 4PJ5E 3WTWA 3DWTA 3LD8B 1N6QL 5DEFB 3BKML 3LKPA 1IZJA 3ETSA 3V5KB 1DQLL 4BZ2L 4O2CA 4YHKL 3BWAA 3QQ9D 3TT1H 3AQYA 5C09A 4QAWA 3A22A 1OM3H 4XMUA 1TQCC 4P2QD 3RA7H 4GUPA 2ZXAA 2JKTM 3NFSH 2VR4A 1BVKA 3PGDB 1KXVC 4DAGH 2VZTA 1N59A 4FJZA 5AB1A 4G3YL 3HR5B 3V7MA 2ZX5A 5IROD 2WC7A 3NPZB 4Z3IA 1IC4H 2VN6A 1KCUH 1HEZB 1J5HA 3BWUF 1JAEA 1WISA 4TSAH 4I9WD 3VDAA 5I66B 3FONB 3FTGB 3KPNA 4WSJA 5J57B 1S7XA 1BXVA 3ABMB 4QRSB 4Z5RB 1YC7A 3BKMH 4JZJB 4BZ2H 4EUPG 1YAZA 2V9UA 5ES4B 1KGJA 3FU7B 2QHRH 5E6ID 1ADQH 1I8LA 4X7FC 4Q9QL 4NHCH 4GUOA 3LIZL 2E76C 3FSAA 4DN4L 3UZEA 3Q8CA 1DCLA 1PGRB 4AGNA 4EIUA 4UMGA 1NC2A 1V27A 3OJVC 2R1WA 4BKLA 1D5ZA 5L2JA 4ZMXA 3M8OL 4IEFA 4XB8A 5LCVH 5EMYA 2NYKA 2ZX6A 5TDPA 2CGRH 3MV8A 5EO1A 2Q8AL 4R9HA 4XCYA 1H3PL 1ND0B 3K2UH 1I9RH 1ONQA 1HXMA 3IJ9A 1C5CH 3WIHA 1JZ5A 4OLYH 3L95A 1H3UA 1T1YA 4MKTA 4LXFA 3KS0H 1MHHA 5T1KD 4UNTA 3KGUA 4MBRA 4IS6B 5F9JA 1T3FB 4MQ7A 5B1JA 5JW4Q 4AH2B 3HC4L 6TAAA 2EICA 1UJ3A 4UILL 2HT4C 4JY5H 4WWKC 5D7IA 3F7LA 3SBPA 4P5SA 5CZKA 2XRAH 4JHZA 4YN3A 2HVKB 3DIFB 4MTMA 2CE6A 3TYGH 5CCGE 3ZDYF 2WXLA 1ZT4A 5IHZB 4BUGA 5DGQA 3B7SA 2RALA 5TPWL 4WFED 3F7VA 2FBRA 4F57H 2J8OA 5IW6A 4XNMA 1SLUA 3HG3A 3S37L 1KY6A 4EVNB 4WWNA 1HH6B 4FULA 4J3VA 1S9VB 4Y4FD 5AVWB 4OGAD 3LPPA 1BGXL 1U91B 1AY1L 1D6EB 4M1DH 3NZHL 5AL0A 3V6OA 2JB5H 4G9DB 4XAWL 3IFLH 4J1UA 2WLLA 5D7JA 4OIBA 2H8PB 1S7SA 2EH8H 4EI5B 2VZ3A 1IC0A 3MLUH 4IW4C 5CU9A 5CGBA 2WUBL 5D5MB 2H1XA 2NMSA 2Y5TA 3HBZA 5JYMA 3IFLL 3II1A 3LNEA 4Y89A 5KSUB 4CA4A 1CTNA 5GZNC 2BJML 2ETWA 2NT0A 1CGSH 5E08H 2LAGB 2NNCA 1AR1B 4FFVD 3GBLA 4NJAL 2F53B 3C6EA 1NKRA 5GJTL 4RISL 3S36L 4M7ZB 4XBMA 3MLWH 5IJVA 2J57A 3VXRE 1IM3D 4AYSA 4KI5C 3ZDXB 5MENE 4G9FB 4JM0A 4N8CH 1ZWIA 4A38A 3AY4A 4F7KA 1EDYA 4LK4A 2BVTA 4Y4KD 5C92A 2O5XH 5AAWC 2ENSA 3MRNA 2WUCH 1MAMH 1SBSH 3ZRCC 2D8KA 2H0EA 4XR8C 4N2GA 1AP2A 1S4IA 4NCDA 5IB1B 3QEGH 3FTWA 4NSKB 2DWDA 4QYOB 3MBXL 4N2OA 3UO8B 3ZDXF 3N44B 5IVXE 3G3LA 4TVPH 3S8WA 3LMJH 4PJXE 1IT9L 1EXHA 2FO1A 3T6WA 1NKOA 1QQDA 4PRNA 3WN5B 3K0WA 4AM0B 5BV7L 4R4BB 3AADB 4ODHH 4KPHL 2VMEA 4KJQD 4G7YH 4TNWF 5LVEA 1HQRB 4PJBB 3P30L 1MHCA 4HUNB 4F7MB 3S5LG 2EIJB 1Z9PA 4U6YA 3SJVA 3WHE1 3T3PE 4MLSA 1J05A 4LP5A 4XN8A 1I1CA 4GIOA 4YPGA 2RBLA 5IGXH 4CADB 4MA8L 1D9KA 3H85A 3WO3B 4QLRA 4HLJA 2QGEA 4N9GA 1JCVA 3J27A 3TFBA 3H55A 1ACXA 2EDQA 2KERA 3AITA 2RA1A 1CICB 1OGSA 2F68X 3GXTA 4HV8A 2H3NB 4UYQA 4WW2F 3MUY1 1QFWI 5GRWA 1OCRB 1T0NB 2J1ZA 4UTBA 4G7YL 4H88H 4F7TB 4WV1C 3LXUX 2J1WA 1JVLA 4N90D 2VH5L 5DQ9B 1FZMA 4PBVC 1WC7B 5J7CC 4G7VL 4C54A 3T08A 9PCYA 5KUMA 2VR9A 4Z7WB 4I2XA 5JHAA 4HSCX 2VXSH 4PSPA 1IEAB 4PIBA 2VMCA 4NQXB 2K7PA 3E6HB 4TTDD 4KX9A 4NM8L 4PV8A 4LPUA 5FA4A 1MFAH 3PQYE 5BUAA 1PFCA 2ENJA 3IGAB 2D3LA 3QP3A 1SRDA 1LP9B 5I6OA 1JPST 1UACL 2OSXA 4FFYH 1G9NH 1MW1A 4HXAH 2K8QA 2PETA 2YK1H 1FIGL 4AW4A 3T8VA 4LLWB 4NFDA 1QFWL 5J1AA 1BZDA 3LX9A 4BGLA 3MDJA 2CJSA 1G7QA 2CDGB 2FBOJ 2IGTA 4HIHA 4HDIB 4NQEE 5IBUG 2G0LA 4JFDD 1DANT 2NZ1A 3KYMB 3NCBB 2IXQA 2XNAA 1K85A 3VGEA 4F5CA 3FU5A 5KSVA 5T1MA 1BAFL 1UB5A 4K23L 2K3HA 3BEVA 1FL3A 3BO8B 2WD0A 4Z95H 1FSKB 1AGFA 1EAOA 2X40A 2FYVA 2C3VB 3GUFA 5IB4B 2H47C 4OM1H 3L13A 4XCEB 1QI4A 1J1OL 4XVUC 3VXUB 4Y2NA 1U8KB 5LAXA 1MHHB 3NK3A 1BOYA 1F1AA 1NCAH 1XGQB 3D25A 2XTLA 3T2NH 3WJJC 1O9ZA 2Y6SC 3I75A 4LSRL 3VXPA 1G9HA 1ROWA 3L3HA 3PDDA 4JO1L 2QGBA 4EI5D 1I8UA 3CLEH 3PDGA 4GSUA 3ULAB 3RTQD 4OLZH 1A65A 1NAKL 4YXHL 3P2TA 1MFCL 3C5JB 1GOHA 1S7TA 3RPBA 1UWGH 3G9AB 4QHKJ 3Q7JA 1N2RB 1P5UB 3BP6B 3CQPA 3ZKND 4OCLC 1DBAH 3QXAA 3LIZH 2VR7A 4AYMC 1TTGA 3EBHA 3H7LA 2B2XH 3BMVA 4LGPB 5CLYA 1J1OH 1JN6B 1Y18B 2VDLL 4XCCL 4EO5A 1G0XA 3P0YL 3TXAA 3VTAA 5CD5C 1I1FB 5IMMB 1MFEL 4LLVB 2FIRT 4G83A 1AHWC 3VXNA 1WITA 3ARBB 3DVNB 2Q87A 2XT1B 4RGND 2ENPA 3D39D 1FWXA 4DK3A 2ICES 2D7QA 1UCBH 2ADJA 2X9YA 3SJVD 2PYEB 1SJVA 2PR4H 4I18C 1NUGA 3T0ED 3EDKA 1T6VN 2EH7H 3HRPA 4EDXB 3BWZA 3GT6A 4TLTA 4L8DA 4Z7UB 3RDTD 3T3PB 1IIIA 3ZL4H 1GMEA 4ZW8A 5LXGH 1W8EA 4LSUH 1A4BA 2WK2A 3SGEI 4X6EB 3L4UA 5GHWH 1I8MA 2FHBA 5E94B 2VH5H 5JW5A 3NBNA 2AQNA 4DN4H 2D2CC 4TNWK 3WNLA 3OAZH 1UXWB 4CAGA 5KW9H 2YBRB 1U42A 3VA2C 3IDYC 4OY9A 3RVTD 4DTGH 5EDSA 3AACA 4Y4KC 5CD3A 1PZDA 4PJ9D 1PKQB 2DWSA 4XNQB 3IS0X 1A6ZB 3UTPE 4Y7MA 1J5DA 2XN9A 1TLMA 3BGMB 4NM8H 4B3EA 1I8KB 1WIUA 3K1DA 5E5MA 5FECA 1PS3A 1KYOJ 3E8UH 3H2PA 3WJJA 4N0FA 3SE4A 4OV5B 4NENA 5DK2A 3V5DA 5D2LB 1PX8A 3OV6A 3L4YA 3GRBA 1P6WA 4PJEF 4JY4B 3EXLA 1T1ZA 2GJZB 2JKSA 1FP5A 1GGIL 3VXUE 1ZV2A 3ISRA 3VJ6B 1JVKA 4H44C 2VISA 5I75B 2PXYA 2A7BA 4H88L 5FO7B 2D4FA 5D72H 1SHMA 1QEXA 1N67A 3K6IA 3V4UL 2KH2B 4JVWA 1TR7A 4YDJA 3EGSA 3ZYJA 3VW3H 4YXKL 3ARZA 3GHEL 2XWTB 3QYCA 4MAUL 3H6JA 4EQ2A 1JTPA 3ZSTA 4PREB 5HHXH 2Z6FA 5FK9B 5I8CB 2CKBB 1KYAA 3JTTA 2O30A 3QUMA 4B9GA 2BP0A 4UV4H 3LPWA 3BP7B 3GXIA 3SCMB 5AFAA 1LO4L 2KL6A 4K94L 3LD8C 3APFA 4L29B 3U1SL 1HCZA 3C60A 3EYVB 4RX4A 4PJ7E 1JERA 1TMCB 2AEPL 2VDRL 1K4CB 4P59H 4XMPL 3BFWA 3GI9H 1E28B 1XH3A 4X5RA 4JS7A 4Q8BA 1EDQA 4N8CL 2JNZA 1SQMA 2HFGH 4WY7L 1JNNH 2X2JA 3IDIA 3VWJB 2VISB 4QI3A 2XVBA 3EJQA 5T1KB 3ZMNA 4NQDB 5JOEA 1ETZB 4UB0H 2N0MA 4Q4EA 4W6YB 4YDVB 4ESKA 3RNKA 3CBJB 4DN3L 4EEEA 3PWPE 3CSTA 3RUGE 1Y0LB 4MFHA 7CGTA 1FNSL 3LQZA 5F7DA 1S5IH 4DWHA 4XOBA 3EJZD 2FX7H 2WXIA 2WWMD 4QRAA 3UDWA 4DVRH 1T0MB 1JZ6A 3BLKA 1EAJA 5FWQA 4DGVH 5CFHA 3L54A 4YSTA 4N5EC 4CSZA 1OK8A 4A2FA 3LTVA 4G11A 4PW9A 1PLGL 3C09B 1TZGH 2AJVH 1WWBX 3UG5A 4N8PA 5DVNA 1AS6A 3WSQL 1LE5B 2C3WA 2OZNA 4UT9A 8CGTA 3VD2A 3ZTJG 1L7TL 3BD3A 3HPLA 1NBCA 2A1WH 4X98A 3KJ6L 4LNRA 1FG2A 1VEMA 1J5OL 1QVOB 3ESPA 3I02A 1KXQA 5HY9B 1QYGH 2A4CA 4PJDF 3OKYA 5AL8A 5I82A 5IT2H 3WU1A 1SEBA 2WYHA 5DWPA 3PV6B 3MVSA 3PXJA 3HCVA 3F8UB 4R7DB 4WO0A 4ELMF 1TYJA 4W9KC 4W93A 4ZUSB 2NDFA 3S34H 5K9QG 4KQ3L 2BNUB 3DI3B 4M6ML 5HXMA 1J1XH 4UT7H 4X4ZA 4GW5B 5DJYA 5T1LD 4I2XB 3KYOA 1DSFL 4U6TA 3MXVL 3VYOA 3OR6B 4NHUA 2LLNA 4KQ4L 2F54A 3UBXB 4X4MA 2YD6A 1NLBH 1RP8A 4Y19B 4LCCA 4AT6B 2AKRA 5I1IH 3BX7C 1HESA 1NCNA 4F9PC 2OP4L 1OSEA 1IBDA 2C1PA 2FAUA 4PJ9A 1QLFA 1EWHA 5LBSL 3NZUA 4KZEL 5A43C 1CK0H 2IVFC 3HE7C 5IBUB 4ZJ9A 1FCCA 2NOYA 3RWEB 4IMKA 5JHDE 1JV5B 3ZQ9A 4D9LL 5DD6B 3L7EA 4JZJC 4HJJH 5F7MC 1X5HA 3B5TA 1INEH 3CU1A 1G5AA 5DHVH 3SE6A 3QDGB 4LEXL 4HIHB 1KWGA 1A3RH 2JWYA 4YE4H 4M9OA 1K8DB 4DUXA 3SY0B 3QE5A 5TJWK 3WAJA 5BJTA 2VR3A 3Q5TA 3AT8A 4GW4A 4U49A 1NEPA 1U3JA 1YUHB 4KNQA 4Y1AE 4N2BA 1AE6L 3GSQA 5AW4B 4JLRB 3GDCA 4J3WA 5GSVB 2EABA 15C8L 2VDNB 4U1KA 5EEVA 2IGFH 4WK2B 1KN2H 2X4QB 3BQUB 1WFMA 1UA6H 2QR0A 1BOGB 5F9OH 4KRPD 4PRID 3FUDA 3H3PL 3MRCB 3GIVB 1I3UA 2UY6A 3VGAB 4G80B 5CEZE 1OP4A 5KBNC 4TUJA 4U6VH 2WGNB 4Y4HC 1EDHA 2BVOB 4ZOEA 2HSIA 3AUWB 4Z7WA 2W07B 4A67A 2HG5B 5IBTH 2CIIB 3FQ1A 5LWYL 5GS1C 3VXMD 1M71A 2VC2L 1CDBA 1S7TB 4OFYD 5I0ZA 1X5GA 1UA7A 1MFVA 3G5VA 3O3EA 3RIFK 4JFUA 4CN4A 4C4KO 4HOWA 1YUKB 1YNTA 2PWEA 3UXFA 5D2NC 1XF3B 3LEYL 4FFZA 1LWRA 5LDUA 3SJVE 2ARJA 3LRMA 3B34A 4JO4L 4UI2A 4KK9C 3WEBA 1NGQL 1FFPB 2FECI 2AJZA 5FUZH 5GGSY 3D1MC 1H6FA 1INDH 4CNIA 4HJEA 5DFTA 1B4JL 3O6FB 4AT6A 2MTAA 5EFIB 1LP9E 3VI4B 3TVMB 2ZP8A 3C8KB 4Z7NF 2AF2A 3U9WA 1UWFA 4YQXH 1B6DA 5FUZL 4Y0GA 2LVCA 2X88A 1I7UA 3F3HA 2J21A 4WI7A 3T5WA 2GAZA 4J3UA 5B38G 1B0GB 4LSQL 3FF7A 4L3CA 3FO0H 4DCQA 4YMPA 3I9GL 3BEVB 3OJ2C 2WIMA 1T2QH 5CXPA 2CUHA 1A7RH 1R3KA 2N1TE 1EAQA 3CK0H 4P48A 4V2BA 4YHIB 5F6IC 4ZRGA 1HCYA 4H26A 2EE2A 4P3CL 1RVFL 1BIIB 2B1HH 2EEFA 2BNQA 1OCWL 3DIDA 1SBSL 5JQ6H 3S3SA 3ZL2A 1ZV5A 1SLWA 4MNGA 5HDQH 1ZT7B 2WLKA 5ILTL 3C2SA 3QUXB 4A6YH 4YDMA 2D03L 4C57C 2C26A 1HH9A 5HHPA 2WLNA 5T8IA 1JWSA 3KYNA 4ZFZB 4CMHB 4F8OA 4X8GA 1Q0XL 1ET7A 1T89A 1RIUH 3FFOA 1YECH 5H4YA 1BW8A 3F5WB 2BVQA 3BSGA 3K4DA 5GGQL 3VFVA 2ZXCA 1NMCB 5CEZD 4JFDE 3PYCA 4ODHL 4YSRA 4FA8A 4Q9RH 2NY3D 2J2ZA 3V0IA 1ML0A 1MCOH 4KJYA 4XXWA 3ARPA 1KTDA 1KY7A 2O6CA 1T6WA 4PHXA 5LN8A 2NXZD 4PJIE 2MTPA 5I6LA 1A02N 3CUPB 2HVJB 2V6HA 2R0KH 3EO0B 4NC2B 1ZVSB 4DPBX 1T20A 4TUKH 5EH1A 1TO4A 1DUYA 4FQ1H 2HT2C 3EOAB 3JXAA 1AFVH 1QLEH 1NIEA 4NBZB 3AREA 3G6JB 4WNSA 2EUXA 1QFWH 4E42B 3C60B 3EYVA 5TDPB 3WUZA 4LVOC 3DMMA 4J3OF 5JHBA 1IGJB 5EUKA 1NC4A 4J3XA 2IIJA 4QTFA 1KIPA 3IMVA 3MN8A 3TH3T 3WLWC 4YLCA 1ZEAH 1O0VA 2YHGA 3COOA 4DGVL 3VU2A 1AG0A 4X80L 1Q0YL 3MUGB 1DO5A 4PRHE 2M26A 1MIEL 4MYWB 2B1AL 4EUPA 1MKFA 3EJUA 4F2MB 2R29H 1QLRA 4KY1L 3LZNA 3SJVB 1G0DA 1N0XH 1XIWC 2VJXA 3DVNA 5KANG 4R90L 1G9ML 1DR9A 5EZLA 2CO7B 5ALBL 1NJ9B 1PG7L 2EXWD 3H9SB 3ARBD 1U6AH 1P4IL 1R4XA 4LCCC 1D5MA 3D3VE 1T1XB 4N0YL 3ULUH 3HPJB 4YNYB 4ZOCA 4IS6A 4OLUL 5BZXA 4LKCB 1IUZA 2JB6B 2P5WD 1UWXK 1CDJA 1JGEA 4PRPD 1Z3GL 5E6IB 2WZAA 2XPYA 3JWNC 2PPDA 2E6QA 4U1SB 1L7IH 3MV01 3TEZA 3GZOA 3U4AA 5J6HA 2AK4B 3C2AH 2J1KA 1FPTL 4DVBA 4XN9A 4PLJC 3HN3A 3GYRA 2LGNA 2CMRL 5I1GH 1NA8A 2A99A 4L9DA 2LFEA 3D85A 1C8QA 5I1DA 3HUJF 2FX7L 3FU9A 3QEHA 3RWIB 4KNUA 4CW1A 1YNKH 1OAXH 35C8H 1YDPA 4NWTL 1KB5L 3DX9B 4OD1L 4JREC 1G7PA 4DP1X 3OR7A 4PB0L 1E5UI 2OSYA 2GJ6A 2P5ED 4BCZA 2WB7A 3DSFL 1ZS8B 3TBVA 1CT8B 2XX0A 4NO2B 3FCBA 5BVJA 3V8OA 4HALA 3WHE0 4JREB 1FH5H 3BAYA 3UGEA 4KH2A 4RWYH 4FYSA 3S7GA 1WZAA 4PY8J 2CR3A 2XZAL 3LV3B 1OP5K 2XA3A 3V0DA 1BQHA 5HDWA 1PY4A 1R5WB 3PIQB 4FQXB 4X6BA 1LO5B 3NIGB 3UYRH 5J9PB 1JYWA 3HAEG 3MOAH 3N1GC 1H3PH 4OZGA 4YC2B 3D18A 5MP6L 1H3VA 2RHEA 3MRKB 4AQAB 1RD6A 5LCVL 4XNDA 1BX2A 3M8OH 4K7FA 1JPGA 2ZG1A 3Q3GB 4FYQA 2AXFA 4YZFF 2P47B 1XR8B 1KJMA 1HZHL 1I85A 1SHXA 5D7LB 3NIDE 3EADA 5I18H 2IBBA 2ZCHL 2HMIC 3VQ1C 5KG9A 3ARWA 3QNXA 3MLZL 5L8JB 4HJGA 2DQHH 3DURB 3KMDA 4NAJA 1NUDA 1KNOB 4B0MM 4HLEA 1IFGA 2W92A 4J3OG 5JW4N 1U9KA 1MI5E 1XGZA 4GIPD 5JIMA 1CIUA 1CYXA 4RQQA 1F6LL 1XR9B 1M42A 5LGKA 1NFIB 3PWLA 4U6HB 1CGSL 4NZTH 1FYHB 4Z3JA 4MDIA 2HRPL 1ZTXH 4XPBH 3IJYB 1K2DA 2DQCH 4Y5YB 4GKNA 1QASA 1RZKL 5AKTA 4JE0A 3E6FA 3I50H 4GUPB 3TP4A 1L9MA 3HBPA 4ZT1A 5GZOC 4KI5E 3CFNA 4Z7QF 4PWGA 4E9VA 3QPXL 3RWFB 4DF9A 1BZ7A 5C0IA 2NY2C 2PP8A 4KTDH 4XHJD 2IH9A 4JFDA 5FWRA 1UOLA 5F9AC 3RTQB 3N3EA 3QG7H 2IWEA 5KWYC 1OTTD 3J07A 3P2BA 2VDKL 3KYOB 1CICD 4ODTH 3DXAA 1ED3A 5B1KA 3CHSA 4WHYH 2CDFB 3ARDD 1AG6A 1NCHA 4OKVB 4LASH 1HINH 2XOTA 3WS6A 4F91B 3QFJB 5CGYC 2X42A 3HI1B 2YMOA 3P77A 5AOJA 4XRCB 2IG2H 2AJZB 4PAZA 3RWEA 4BRVA 4ZFGH 1FVEB 2X4TB 2J8UA 4XNYL 5FOBB 4X7SH 1A0QL 1NGPH 4HWEL 4JG5A 4AMKH 3DX8B 2OYKA 3ZJAA 2EE3A 4JFOB 1B3IA 1UUNA 2HJKA 2X4NB 3BPLB 3CFIC 2HUEA 4DVRL 1WO2A 5DS8A 2FD6L 4XNYH 3J2PA 1CL7I 1S5IL 2J73A 4HIIB 4XP4L 1H0DA 4MDRA 3BGFB 3ZDWA 2HUHA 2JKWA 2PABA 2HKHL 3BPNB 2AMUA 1DBAL 1PDKB 3RAJL 4A66A 5DVMA 1RSFA 3SEPA 4Z7VE 4WUKH 4ZMPA 3ULVC 1CIDA 4OBSA 3TJPA 1V8HA 1TJMA 3IRZA 3W5NA 2FHCA 4WGKA 4WHTA 4QOKB 4LCWB 2GJ6D 2P5EA 2R69A 4I9WE 2AQSA 4X4KA 2VLRD 3AGWA 4YHYB 1ERNA 4RAVB 4G82A 2NZ9D 2A1WL 1D5IH 4H2CA 3RVVD 3SDXE 2I25N 2YOCA 1W9XA 4N25A 4P4RB 2CKBL 3EO9L 1KBGH 4JO8A 4IRJC 4G6ML 1MJ7H 2D3JA 2YSTA 4LMQE 5FDWB 1NZRA 1BZ7B 4JFYB 4HUWA 2DKSA 3FT1A 1OOWA 5BS0B 5F1SA 3QIUD 2IALB 5DDHA 1AC6A 5DHMC 4JHVA 4FG0A 5F88A 5CCKL 2XICA 1A6AB 2VXTH 1UZ8A 3LXBA 3L16A 3OKKB 4BZYA 4FLQA 3NA9H 3LNFA 1LQSR 1U2YA 3C5SA 3L4ZA 4ANKA 1HI6B 2H6PA 5HHVH 4Q4IA 2NTFB 4MYPA 3BN9D 3EG9A 3EYOA 4OJFH 5E1AA 1AD0A 1GS8A 4V1DB 5E1GA 5E8DH 4Y4HB 3DYPA 1SYSB 4WW1B 1E3XA 4LFHG 4QJ5B 5DK3A 5I1DB 2HWZL 1L3WA 4MRCA 2MPAL 2I27N 2GCYB 1J8SA 2J8UB 3WTVA 3QNXB 1NDGB 4PCTA 3R18A 3FW6A 1QZNA 2F6AA 4JFOA 4FNLH 5INDB 1EUTA 2ZX9A 3NESA 3MX0B 4JQVA 5CJQL 3S8FB 2DD8L 3L3OB 3WL9A 2XWJB 3FSVA 1MWAB 3GSVB 3UGXA 1RZ7H 4M7LT 2YC1A 4K3GA 2ODHA 3MTXA 2PKDA 2YPVA 1OTTC 4M5ZH 1H8NA 5IMOA 1FAIH 2BNRE 5F0JB 4R4ND 1URZA 2C3VA 4HQQH 1RQ5A 3TBWB 1B88A 1WK0A 3I3DA 3RIAK 4R90H 1EEZA 5I8EB 5DJ6B 4DKFL 4E9RA 1BSIA 1V3LA 2X6VA 4LAJH 3VXSA 4PGCB 4JJ5A 4X6BB 2XZCH 2JCCF 2KLTA 2OYPA 2R29L 3HRZA 4CU7A 1VKXB 2DKMA 5E8NB 2JKJA 1FFOA 2MQGA 3GSUA 2BW4A 1AZRA 1T7XA 4R5XA 3Q06A 1GTFA 3VFTB 2R23B 1G7MA 5E5MB 3MRBA 2B39A 3D2UA 4UT9H 5C0NC 1N8ZA 3LKQB 1G9EA 2XWZA 3MLYH 2DICA 1VJSA 5BMFH 2UYLA 4NJAH 1XL4A 3AUVA 3PP3H 4GQ9L 3VXQB 4MDIB 1E9PA 1EMTL 1X7TA 1BZ9B 1YPZA 3UGUA 5GZOA 3MRGB 4E41B 4EKXA 3S98A 4IBLT 5E2VH 2ZUVA 3MRFA 3HAEB 3BUBA 5ERWB 1S3KL 4PTUA 1DZBA 4XCNB 2QSCL 2J1XA 2BIQA 2ZPKL 4JMXA 4KDTC 2YPKA 1WC7A 3TL5A 2GI0A 3AXLB 5DS8B 1CXFA 4PG9A 2XWTA 3QCUL 4UQ9A 2XTSA 4W6XB 5FC9A 2WZPA 2X6CA 3NCYS 3TPKA 5C9JB 1OCZB 2NY4D 3O3AB 4XNZC 4ENEC 2PWGA 3B3IB 4R2GB 3AAZA 3UYPB 1CD1A 3WAKA 3ZTNL 2P80A 1T2JA 5FLVA 4HGWA 1RZFH 1NMBH 1KJ2H 3O3DB 1V05A 3DKHA 3UL4A 2BFVL 2A77H 4I3RH 3CHPA 3R7QA 3U1PA 5GS0C 1T6BX 3GBNL 2FWSA 2YZ8A 3DX7B 1UZ6F 3FQUA 1OE2A 4FQQB 4WI2A 4RRPM 5CINL 3SDDA 3AY2A 3W38A 4FRWA 2JJTC 4YEEA 4FQ2L 5F0LB 1UB6A 2L7UA 4Y5VB 1I1AB 4P5TD 3IDXH 2GABA 4IGBD 3GD1C 2OTUB 3BUYA 4UILH 2WO3B 3S3PA 2WQAA 1CLOH 1I7TB 3L8QA 3LRSA 4O2FA 4F1SA 4FFYA 4F8LA 4J27A 4M4RB 5TE7H 1AKJB 4CW1B 2WBXA 1JF5A 2DMBA 3WMQA 3HLAA 3HUJA 3TZVD 1VFAB 2A77L 1MH5B 4I48B 4XVJL 5LBGA 4PWEA 3KLSA 5EC2B 4IOFC 2VW4A 2YQ3A 4QY8B 4XT1C 5J56B 3MLVL 3EUDA 1L4IA 3D87B 1PG7W 1RMFL 5EU6E 2G9HB 2XQBL 3GMPB 5HHOE 3BSHA 3EIFA 4YIQA 3CWGA 1BVNT 5E4IA 4A6YL 1F2XK 2WXHA 3RHWF 2XUWA 1C5BH 1DJYA 3FCTA 5HDQL 1I82A 1ESOA 3BW9B 3MBWA 1FNGB 1TSRA 3RP1A 1AGDA 4NWUH 2VDMB 3R0MA 3VH8G 3D8MA 3FUFA 2A9AA 4HEME 4W4OA 2FATL 4OLXL 3MRLB 4X6CE 1JZDC 4UZSA 1SEBB 3EW3B 5PAZA 2Y0SA 4OZGF 4G8EB 3ZR6A 1CN4A 4GBXC 1HEHC 1MCFA 3H9HB 2ENQA 1T22A 4DKDC 4EIBA 1FGVL 4GRLD 4MB3A 1B3JA 5TK2A 3T3PF 3O4LE 1TTBA 5G5DA 3ZE2B 3QDME 1ZXKA 1TYEB 1LD9A 3V95A 5J0BA 3D48R 4M5YH 1IFHL 4L3EB 1RUAH 1DBJL 3ML8A 2W80C 2YGVA 4DAGL 4MJJA 1JSYA 2E0PA 2NY5C 4QHNA 4X9FA 1ODAA 5GS0H 1YEGL 4PBDA 1DYZA 2C1OB 1R5VA 5AG9A 5KZCB 1XGRA 3SGKA 2XV6B 3ISWA 1RUAL 1F3DH 3MJ8B 3NJIA 1DLFH 1FNFA 2OKMA 1XIWD 2PWDA 1D3CA 2XKSA 3H3KA 5G4MA 4K9EH 3NJNA 3PHAA 2KUTA 2WP3O 3BD4A 1BCIA 3RIAF 3CZNA 3RGVD 2I85A 3DO3A 3MRLA 5GGUB 1NBZB 1F90H 3UPRA 1GZHA 4PGBB 5A2CA 1RURH 4GUCA 5IB3A 2AMGA 2WWMC 1XO8A 3GK8L 5A40E 2VSMB 1FNLA 2FBJH 3S8GB 4HK3N 4PH8A 5D4QA 3TPUA 2D31A 1EXGA 3B9KC 4MA8H 5HYSB 3FUHA 2YD3A 3GB7B 2OTWB 3GO1H 5EZJB 4U1JB 1GHFH 4L1LA 3FFCD 5FYJU 5KVGH 2GHZA 5DMGD 1V3JA 3KEDA 5I1IL 4QXTB 3NFSL 5HP5A 5HVWA 2CBPA 2Y1ZA 3QFDB 5BW7A 1DQIA 1F1DA 4YR6B 4HUVA 4QOKE 4E41D 4PJ8B 5E8NA 2K1MA 5FV1L 4HU2A 1MCLA 1BXXA 3QUMH 3MRRA 1JNLL 3MRCA 3CFBA 1YQ2A 4K7PL 3QCTL 2WBJA 5DJ6A 3ENEA 3DIVA 3BH8B 2XVGA 3FQRB 2WOBA 3T71A 4BFEA 5A6IA 5AZUA 2P28B 2ZUUA 4PJ5D 5AZEL 3MA7B 5SWZA 2CO6B 2ZSVB 1XSOA 4X99A 5KSBB 1H6EA 3ILQC 2HB0A 1J86A 4WUUB 3QQ3B 5C70A 4NO0A 1JV2B 3ESMA 4CU8A 5D4HA 5G5DB 3LJ3A 3EH2A 1FFPA 4HUUB 5H2BB 4KVPA 5GGQH 4M7LH 1UM5H 4KI5F 5I6XC 2VABA 4PJEA 4TN9A 3W82A 4JFFB 4TOYL 2MHAA 5EFIA 3VI4A 1Q1PA 2EDKA 1IU1A 3VQLA 3FOLA 2NUPB 3EHBC 1IKNC 1U8QB 4ELKA 3ZTDC 1PLAA 5FPIA 4I1NB 1TQCB 1QSEB 5TK4A 3W39B 3VU1A 1JMXA 1ZHLB 1KGYE 4APQA 4FKHA 4ZBJA 4UIKL 3UDWC 1KXTA 3ARBC 2RH0A 2GIXA 3HS0C 5ERWA 1DVFA 1HXYA 2X4NA 2EKJA 3AGVA 3JVFC 3BUQA 3QZWA 5AYUL 4JQIH 3FH8A 1EUUA 4O2CB 5KVDL 1JGLH 5ICYB 5HGDB 5E1IA 1YO4A 1KGCE 5IHBA 1HQRA 1Z9LA 2VSCA 3OTTA 1KB3A 3PP4H 5EBMB 4BUHA 2ICEA 1N7ML 1WBXB 3WE6A 2MNUA 3B1TA 3DJTA 3LN5B 4ZFQA 1XCTB 3VB8A 2OSLA 5JXAL 2OMWB 3ARGD 3U7WH 1UQSA 4Z0XB 3SDAC 1PL3A 1ZD6A 4I7ZC 4DZ8A 1NFDA 5C2BH 2KI6A 3SPVB 2R2EA 4JKPH 1G6RB 2KKQA 3NJVA 1S9WA 3MUJA 5CJOL 4GKOA 3QZNA 4UV4L 4OTXH 4JO2L 2I26N 5EUOF 2DLIA 1PX4A 2LQRA 1DVSA 3QFGA 4HETA 4Z78A 2EO1A 4IIQA 4AEEA 4ZMOA 1DDHA 3EFDL 3GK8H 4NZFA 5IR1B 5TDOA 1Q94A 4TNVF 1TQSA 2Y36H 5JORA 1A4CA 4ZPTA 2F54E 3WDHA 1GGCL 3QPXH 3H3BC 5K1VA 3VFPA 5SWZD 2FE0A 4FJYA 1WE5A 3EAKA 1KTDB 3EOAA 2XN9E 3INOA 1I1RA 1REIA 1UG9A 3OR6A 2VTFA 3GXUB 1E65A 3NACL 3MRJA 5DJDA 4R0LC 3VO0A 4GP4B 4EI6B 3K71B 2Y5TB 2B14A 4PJAA 1YEGH 3D0VB 1F4XL 4X8XA 5CCJA 4JJHA 3KNBB 3ZYZA 5JR1H 4UZGA 1MRDL 3B8YA 3NABH 3ZKMC 2FGZA 2LV4A 3K6FA 5D6CB 2CRMA 3T09A 1CURA 4U7MA 5CGTA 2IQAB 3CN2A 3IMBA 3WIAA 3UH8A 4CVZA 5FCUH 2VN5A 3R1GL 5J4MA 3DJ9A 3GEWB 3KLAA 4IK6A 4M5SA 3VGFA 4JPKL 3VM5A 1GC1H 3WJLA 1HH6A 2QSTA 2YD8A 3MLXL 4PJFE 2OAAA 2X89A 5GRZA 3WFCL 3QZLA 2XWXA 2QSVA 4QXTA 1GAFL 3CBRA 3GKWH 1IBZA 5LWYH 4MNGE 2Z65C 3OBAA 3T1FA 2UY7A 4UNUA 5FM4A 4LSSL 3S35H 3NABL 4PG2A 1E8YA 1P7QA 1M2OA 3EZ8A 4XP4H 4DEPB 4PVBA 4WFFE 4TMPA 3ZPDA 3W2DH 4L1TA 1UD3A 1ZVSA 3G6JF 4PBWD 4XMZA 2XYCA 4L4VA 3KNBA 1UCTA 3Q8EA 1XCQB 3HRZC 4LZKA 3UPRB 3BEWB 1XEDA 2H1PH 3EDJA 3MRIB 1AS8A 3QDAA 1RZGA 3DUUA 4O00A 4OM0H 5FB8A 3EGXB 4AG4H 2PP7A 2BRRL 3PWJB 3MACH 2XIBA 2CKBH 1OAZH 3ABZA 1U8IA 1NCBH 3TO4C 5CBAB 1T2XA 4PRDA 5MENA 2IJ0C 2VM9A 1JHKL 2W0FA 4NCC1 1YYLH 1J8KA 5AENA 1W8NA 4OD2A 4P4KA 3MV9E 1CFSB 5ICXA 1INEL 5C0BD 3HG4A 4PLNC 4E68A 4NKOA 3T6QC 2OJEB 4GT0A 1E9PB 1FNEB 5IVNA 3OWEA 1KGWA 2IPKB 1D7DA 3OSVA 4PGEB 4TQHA 5CJOH 1IGFL 1DEEA 1PJWA 5C3IA 5J6GB 4N22A 1JDAA 2EACA 3EYQC 4JKPL 3BH9A 1GZQA 4YVNA 2A0LD 4YJZL 2DYPD 2V8MA 4AQAA 2DLHA 3BH8A 4M6OL 3RFZC 2R4SH 2FSEB 4KHTH 4N8VG 4C4UA 4C56E 4JRXE 2AAVA 3FQTB 2KHAA 2LU7A 1A9VA 3FFDA 1GJWA 3POCA 4ZUTA 4H25A 4WTXA 3KYKL 4L3CB 4L8BB 2R0ZL 4D0BB 5EIIA 4FQJL 3K4AA 5IQLA 1KENH 4K5LA 4Y2DB 5GZOD 3FUEA 1JZ8A 2B1AH 3IXTA 3AS3A 4X5XA 2CUAA 3WKML 1BYOA 2WLMA 2HA1A 5FO9B 2AQPA 3QWRA 1LK3L 3OAWA 3FSZA 1ZLUK 2XPGA 2P24B 1KB9K 3D0LB 3NG5A 2DQGL 2DOCA 2AZAA 2EKSA 3ECWA 1FNEA 5LGYA 3KPRD 3IBOA 1E3FA 4H20H 1TETL 3QYMA 1VDGA 4W9GC 1BEYL 2EQDA 5LAPA 4Z23A 2B5IB 1U8NA 3D06A 4N2MA 4P9HC 4AJ0A 1WUZA 4NZJA 5FW8A 4Q7DA 1JCKA 1N5AA 5D2NB 3IDMB 3QUKA 1AFVL 4FL4B 4GAYA 1BD2A 1PQZA 5ADOH 5E1HB 4Y5YA 5JUEH 1VHPA 1XGYL 2AXGA 2FRGP 3QWOA 2EUWA 4L8DB 2GCYA 4O9HH 2E56A 5KSVB 1WVZA 3GSOB 4OI9A 5HYSG 1GA2A 2Z3FA 3LH2H 1A64A 1MCQA 1VPOL 5GRYA 2F58H 4FQPA 1NMAH 1QZ1A 2BY3A 2DIBA 3OMAB 2HXAA 2DWEB 4LPWA 1IGCH 1D5RA 4BXSV 4QHNB 4F8TA 1A3QA 3JWNE 4WCYL 4YXLH 3U4KA 4FQXD 4JAMA 3IDNB 3SDXA 3DUSB 3FTUA 4JGNA 2Y7LA 4RGOH 4XPTH 3DJZA 2N59A 3O11B 4X5LA 3MMEA 2YPLB 1RIHH 5B3NA 2V8LA 2QFPA 1IKFL 3O6KL 4CVXA 4YEFA 2OK0L 1WTLA 1SOXA 1OKEA 3BZDA 4ISVA 5SWZE 2H2SC 4R7NB 1AHKA 4GMSL 5I5MA 4JGJA 1N2RA 3QUGA 1MRDH 2D03H 4NQVA 4KUZL 3ZTEA 5TD4A 3IFNL 1NAML 3MO1B 5MP6H 5EEUA 4KKBC 1UWXH 2ITDA 5IHUH 2VXSL 1OGAB 4BZ2A 3CXHK 4BSJA 1VACA 3TPUB 2FNBA 2JELH 5CLZA 1R0AL 1X4XA 2NZIA 4P2YA 4OFIA 4HGMA 4JRWA 2DQUL 5DZPA 5F1IA 1CJYA 5IWLC 5IVZA 4OVUA 2BDNL 2HN7B 3TVMD 5L88H 3WTXA 5I0XA 1XCQA 1L9OA 4JFTA 2Q5BA 5HDLA 4MWFA 3DSFH 4ACPA 1IL1B 4JDEB 1N9PA 3CFCH 4LOUD 1H8LA 1P84K 1U8HA 1UUSA 3AQXA 1DANU 4ONGL 4X9HA 4XCEA 3LKRA 3ULVL 2JJUA 1T7ZA 3PFUA 4FLSA 5D7HA 3APCA 3GM0A 1LMIA 1AO7A 3EYSH 4F92B 4AIZB 2ODIA 1S9KC 4QF1B 4UTCA 4DJMA 1BP3B 5DS2A 1MHCB 1QVOA 3I02B 4BK5C 3O81A 5JXAH 1ZLWK 4ADIA 4LEBA 3QSKB 4JFZL 4MD0A 4XP1L 3RL2A 1B2YA 1MLBA 3MJ9A 4Y8AA 3RZWA 5JPMC 4G72B 5K1JA 5A16A 1GGYA 1JNJA 3D0AA 1V5JA 4ECNA 2ALAA 4PG2C 3LN4B 4AZUA 1OP9A 5DEJA 4O51A 2QKIB 4Z7OE 1IAOB 1URIA 5I6NA 3ELAT 3OQ3B 2YBGA 3RQ3A 4LVOB 2O5ZH 3W0WD 1RPUA 2YPLA 2FZ3A 3RVUC 3HHRB 4KK8C 4RMQA 3T2NL 4XNXL 5B7MA 1Z5YD 3OAUL 4O5LH 4M1DL 5LNEA 1ZJAA 2QMKA 2BIPA 1LNUA 1Z32X 1U3HC 3ZLQC 1OT1A 2VZOA 3RGBA 2UVFA 1RULL 3AABA 1JGUL 2ZQKA 3S37H 2Y5QA 1WAEA 3LYRA 2EE9A 5MERB 4JRXA 5E6YA 4JCWA 3IDJB 5AOMA 5L2KB 4QKXB 1XXFC 1VPOH 3L7EB 3BQUC 5BO0D 2R0LH 4NKOB 2WY3B 4PVLA 1M7IB 1HAWA 4NEHB 2GHWB 4PD4K 3FF8A 4WO4A 1M6OA 1XH2A 3MCKB 1KJMB 5M7QA 4G8GD 2A6KA 3FQ4A 1K3ZA 3ZUNC 4XB7A 1Q38A 1U8NB 5KVFL 3L08A 1XH0A 1WWWX 4TL5A 1YEJH 3SZ6A 4OIAA 2EO9A 2HLAB 3D52A 5DT1L 4E9XA 2A9MH 4MQTB 4NHUB 4HJ0D 2RMNA 1XGTA 2R0LL 4PGZA 1BQKA 3B5HA 3VFRB 4I3RL 3BFOA 3N1MC 3U9PL 3STLB 4JPWL 1NGZA 1FL5A 2VQ1A 3VG0H 4URTB 5F1OB 4N1CA 2DQTH 3BKCH 3OB8A 3OC5A 2A0LC 4O4YL 3GMRA 1IGIL 3QIUB 4KH9A 3KXFD 4XPHL 2I60H 3UIYA 3ETTA 4P05A 2VLJA 2ZNWA 4HZLA 3WY4A 1S2EA 4JPIA 4H0GA 1MPAL 1S5HA 2AV7B 2DQFA 2HRPH 4OQTL 4YSSA 4GKSA 3KL3A 1XGPA 2VL5A 5BJTB 2QPUA 2B1HL 1BM3H 3KPTA 1EHAA 4HBQA 4KDWA 4Y8DC 3DO7B 1XF4A 4HAGA 5DF0A 4WWID 2Y7MA 3KJ6H 5D2NA 4ZQKB 2Q7AA 1QUPA 2I07B 3MRGA 4BWTA 3SE9H 1NANI 3QIBA 1RUKL 3SE3A 3QDJE 2DIEA 2RFXB 4XVUD 5IMKA 4RAUB 4HX1A 1UH4A 2O6DA 3VD0A 1J1PH 2CXKA 4TLKA 3QIWC 1A6UL 4I8DA 2XN1A 4RNRB 4U2ZA 3D39A 4JRXB 2X2HA 4KK6C 4XB3A 5DZ9A 3U0TB 4KO9A 1AD9B 3WIIL 5D71H 1FGNH 3IDIB 1I1YB 1S9YB 4YHOH 5FIEA 4NN6C 3C6LD 4KGJA 1A2YB 5F3FA 3GHBH 1QABA 1OLLA 2Q8BH 4BH7A 5KBMA 2VQTA 2Y3AA 4OZFA 1YNTB 4G43A 5C0BE 1EBPA 1FAIL 2AEQH 3RDTA 2DMGA 1OSZA 1CFBA 5H37G 3WNKA 3ABLB 2FJHA 1MRCH 6FABL 3FUIA 3DO7A 1SLXA 3IF1A 1HHGA 2XIDA 4A2EA 2DWTA 4R26H 3QUYA 4YE4L 1T7YA 1KPRB 1DEDA 3FTYA 2FX9H 3AVEA 4PJGF 1A1MB 1DHKA 4NBYB 4HKBA 3L3JA 2APBA 5M94B 1O6SB 4HUKB 3AS0A 1KTBA 3UC2A 2YKLH 1XTLA 4PB9H 2GJJA 2KBGA 3IFPB 4J23A 3TCTA 3BKYH 3ZDYB 3FTSA 3R06B 2FX9L 5TGBB 4KMTH 4ZS6D 3B83A 4YSEA 3L3OA 5HGGS 5EPMB 4GI8A 4YAQA 5EOQH 3TO4D 4KNSA 4XNZB 2PO6D 2QPFA 1GMIA 5FOJA 4F9LC 3QHFL 2GBTA 2JTYA 2IGFL 4POZC 4PSRA 3SKNA 5MEOA 3T4YA 5HDBF 1K8IB 1Q8MA 4DKAA 5MHSE 3CVHA 3DJRA 4KK9D 1U8HB 1NWPA 3FT2A 3MV11 3HI5H 3LH2L 3UJIH 3SQOL 3HS0A 3D30A 4FCAA 2HVJA 5D1ZB 3SDYH 4Y9BA 1OW0A 3RB5A 4ONHB 4I0PA 3WY1A 4DH2A 2VMJA 4MJIA 4Y4FC 3C12A 3NIDB 5BO1H 1T3FA 1YEDB 1PBYA 2ED9A 3OKEA 2EC9T 2V2XB 3OQRA 4DSYA 4ZMLA 3H7BA 2YPLE 2H3NA 2NTFA 3KPPB 3O9WC 4Z0BL 3ARRA 4X4XB 4NUJB 1J5OH 3C87A 2GYSA 3C75A 1DP0A 3TLRA 2X9ZA 1NCIA 1XMEB 1YSOA 3MXWH 4XOAA 2E9WA 1E6JL 4AQ1C 3MRBB 1ZHBA 4J28A 1J0ZA 2HX8A 4WDIB 4LBEA 3UJJL 2Z31A 2PO6C 2DPKA 3QEQD 4LSUL 2OMBA 4OIIH 1NEZG 4K8RL 5I8CA 4J4PC 2CR6A 4KQ4H 3ZL4L 1QEWB 4WIQA 1LYQA 1XCTA 2FZ3B 1DFBL 3MRPB 4XP6H 2EH7L 4PJ8A 2BWQA 1KYDA 4Y4KB 5DU7A 4ZAKA 3T2QA 4MNHA 1L3NA 2W0KA 2CD0A 5I1HL 1S7QB 3QUHA 4MD4A 4S1DD 1TFPA 1HHKA 1LLAA 3BIKB 3MV9B 1EO8H 2WQRA 2Z1KA 4S1SL 4PJ5A 3MYZA 3Q2NA 3WIHH 3PPEA 2VDLH 3Q9PA 1FNAA 3S96B 2PCXA 1D9KD 3VFNA 1EJOL 2GTQA 3VWJD 4OZHB 3NRFA 3DX0A 5DLLA 1CD8A 3CNKA 4AV0A 4KOBA 2XG4A 4XMXA 3IU4L 3QJTB 4PJIB 2W0LA 1XF4B 1O7SA 4KDTA 5IJVB 5K59F 1ZY9A 2D31B 1PMYA 5CIPB 4UIKH 1ZHLA 3Q5OA 4WHYG 2NY4C 3RPIA 4GBXD 4NQSA 4YXKH 4N24A 4XO3A 5JDJA 1KSRA 1S78D 4ZW6A 4L8SB 5K93A 2P52A 2F9BT 3V55A 4WU5B 5BXFB 2BOCB 3UBFA 3O9WA 2WJ7A 2QZQA 4QO1A 2E86A 3VFMA 4D8PA 1E9OB 1OTUD 2LABA 2X4QA 4P2RB 3FCSB 1E42A 4RRPA 3V0VB 3JWDH 2UWEA 1CR9L 1VACB 3STLA 4XNXH 3EBIA 4QTIH 5F7YC 1JTTA 1ZVHA 3QFJE 4XOEA 5F3HA 1OP3H 3CDGA 1JZFA 2OMXA 3G5ZB 5ECJE 1E8ZA 2HPTA 1MIMH 4JKWA 3EFFB 3BUIA 3AAZB 4K7PX 4J3OH 1E40A 4N2KA 3KL0A 2A74C 4WW2A 5B8CC 4U1JA 2VUOA 4M8QA 1T7WA 4YL4A 3WMSA 4FP8H 3RPIB 2ICWI 4L8CA 2DB8A 5BPPA 3GIZL 2FSDA 2ARJB 2LOEA 2EYTA 2C1PB 4FFYL 1CDGA 4PJ9B 4WENB 4BZ1A 4UV7H 5CEZH 2FNWA 1HYSC 3GMLA 2J55A 3QULA 4UDTA 3BPNC 4X7DC 2UWEE 4GSDH 4IQHA 1WTGT 5D7IF 2W8CA 1XT5A 2F8XC 1F4XH 2SEBB 4XO4A 1TOXA 3MLRL 4JGMA 4ONFH 5ACZB 5CBAA 4YSPA 4TQ8A 2EC9U 4MZ2A 2VRQA 4E9WA 1CGYA 2G0KA 1FRGH 2VXTL 5ESVB 1EH9A 1NJ9A 1S9XB 1ZA3B 4P57B 4NKQB 5EO9A 1MFBH 1SJEA 5F1IB 1CDUA 2AJUL 4GQPH 2QQKL 3LPOA 3Q6FB 2QKIA 3VVVA 4Y2DD 1RLBA 4S1QL 3B2XA 1NBYB 4YZFE 1MFEH 4M43L 1S7VB 2B9BA 4TUOB 4I77H 2NY0D 4C56A 4JEGB 4R97B 3EUUA 2VIRA 4R7XA 4Q6IB 4M1CD 1AGEA 1KIPB 3RVUD 1G7HA 1DQQA 1BF2A 1KACB 1ULVA 3QNYA 1E9OA 5TQ0H 3HLKA 4OLZL 4OF8A 4BH8B 1CXIA 1D7BA 4WWPA 2YWZA 1T1WB 2EC8A 2R1YA 2MOQA 3RTQC 5B3JF 3N6YA 5FHBL 4QTHA 2NW2A 1T22B 3D4ZA 2JV6A 3PPSA 3LSOA 4P2OC 2NCMA 2VLLB 2DYSB 2WYIA 2ZUXA 5HGDA 3QI9D 4FCHA 4KK5D 1WHOA 1BFOB 1HWGB 4JDVA 5LUMA 1KPVB 1MFUA 1CU4L 3KW8A 1C5DB 2V3EA 4HKZB 3NEEA 4HH9A 3MFGB 4PRHA 1LK2A 1EXUA 4Y5XB 3WNMA 5DHYA 3MRJB 2EDNA 1MHPL 3NN8A 5EOTB 1KGXA 2NQDA 3GHBL 2B20A 3DI2B 1DSFH 1EIBA 1QSFB 1V3KA 4GP5B 3WENA 5C0AE 3IRPX 1KJ2B 3NTCL 4I0KA 5B1AB 4R6UA 5I1HH 1A3ZA 3VACA 3BWAB 1CBVL 5AWNL 2VXQH 2FLRT 1RLWA 1Q9KB 2CM6A 1NCTA 5ITBH 1ZXQA 2PPFA 5CZRA 4HJGB 3AT9A 5JIHA 1TETH 1I9EA 3L5JA 4U1NA 2DLEA 4AYEC 3C6LB 3B2VH 4LSRH 5L4MA 3NEOA 3UO1H 5CZXC 5EBWB 4UIMA 3MRPA 4N0UA 3V9FA 2Y2WA 1YY9C 3QZBA 4ORGB 3MUGA 4AYFA 4DP4X 1R34A 4ZW5A 4FXGB 4ZFOA 1MCWW 2K8MA 1IBHA 3EDFA 5DD3H 2EVGA 4Z7NB 5EU6D 5LKNA 5AWNH 4F2ME 1IM3A 2QLYA 1SY6H 4JPQA 4OCRH 1QLEL 1R46A 3HR6A 4BJLA 1A7QL 1UASA 1JUFB 5D4JA 3QJRB 3M46A 4NO5B 3WKYA 3PUUA 1G4MA 4JRYE 2IBGA 2KZBA 4L8BA 5HGBB 2UWEB 4EN3B 4N68A 2Y7QB 1V55B 4XC3H 4CC4A 5GIRA 4M3JA 3UIZA 1SY6L 3ALPA 4PJHB 1RULH 3REWA 4TRPH 3MROB 5IW1B 2A38A 4G6KH 5FR3A 3K6SB 1ZLSH 4PJIF 4EI5C 4Z7IA 3IFOB 2ZP0T 2X2UA 3VD9A 5TE6H 3P9WB 2GIMA 2JQZA 4M02A 2JSFA 1CI3M 1XF1A 4WKXA 3WL9B 5G55A 4F57L 4OW6A 5F7FA 3CSPA 3ESVF 4NKDA 4PJIA 2EDHA 5EF3A 5I5RA 3SYCA 2VLRA 1SXAA 2I5YH 3AS1A 3X13A 1JZ2A 4AEHL 4I1RA 4G8AC 1U8OB 5JA9A 2GK2A 2EAEA 1A9BB 1AANA 1SJHB 2V9TA 3TA4D 4Y2DA 3VB9A 1LGVA 3C5ZC 4RAHA 3SDAD 2BIMA 3E80A 1E4KA 2HJFA 2I9TA 1PZBA 5FB8B 4KTEH 4D7BA 4PGCA 4ZPTB 2Z91A 3ECUA 1ITCA 4WWKB 2OJZL 3CDGB 4XPGH 3FPXA 2PXYB 1MCPH 3GSUB 4K9EL 1MNUH 4O2EB 3HG5A 3IMRA 2ZXDA 5AVSB 3RE0A 1HKFA 4ONGH 5D55A 4PIRF 3VSUA 3QJZA 4FNSA 4HJUA 2P5WE 3AM8C 1KXQE 5F70A 4F5CE 3PHQA 2YD5A 4QEGA 3D3VD 4HWZB 5F0PB 4NN5C 5B8CB 3LIZA 1OAKH 2IPTH 2X12A 5ANMB 1OO2A 3O4OB 4KITB 5JYLA 1FZJA 3MODL 4APQC 4PJ7A 2JJWA 4XP5H 5DD0L 5JOPE 1H5BA 3IDMA 4OLVH 3GS4A 4KTEL 5CKAA 4ERSL 5IB5B 1YN6A 2WQ8A 2P7TB 3O4OC 5HI4D 4NQSB 2BX5A 2F8VA 1KBPA 3VXSD 3D69B 1A6TA 1H8SA 2AQ3A 2ZF8A 4U1IB 5FEBA 4JG0L 1CI5A 1VFBB 1ZJBA 3OJDA 3BDBA 3HR5A 1CDHA 4DKEL 1U6AL 3KPQB 1YMHA 5IEKB 4LP8A 2CJTA 3FSWA 4QGTA 5DD0H 4LU5H 2C4XA 2J56A 5DXWA 4XPHH 1RU9L 3VFOB 4M62H 1TIUA 4GXUN 2EH8L 3BN9C 4N2FA 1M71B 1ZANH 4XHJC 3CV5A 2BP8B 2LTQB 2WZ5A 1P7QB 1PSKH 2R2BA 2WBJC 4MSWA 3RGHA 1L9SA 2HFFA 2X3CA 3H3PH 3ZKSD 4JRLA 2YXWA 1A7NL 4QCIA 5CEYB 1OHZA 4U1MB 1N3NB 1A6WH 1SLVA 3HHSB 2NY6D 1E7UA 1OGAD 1UEYA 2GFBA 3C9NA 1NWOA 3MBEA 2OXGB 2APVA 2PYFA 1N12A 4Y2DC 5F2FA 5L2JB 3WJLC 1OAUH 2J25A 3ZU8A 1I7ZB 2H2PD 4OQTA 4OCYH 3LNHA 4MVBC 1RUPH 2BHUA 4FQLL 2B2XL 3ZUCA 4HCGA 3FT3A 4IOIA 2LAAA 2J6EH 4JFYA 5EZOH 1K5NB 1AI1L 5EBLA 2YC1B 4LLYB 1CFSA 5ICXB 4HG4K 4HJJL 5DRZB 4P2OD 3CXDH 1O6VA 1Z6JT 3RFRA 2IF7A 2NLJB 2DI7A 2JKXA 2J88H 5E70A 1PF3A 2Q3AA 3ATDA 4ZDHA 2EDXA 4DP0X 2UX6A 3QUZD 1S6NA 3ZTNH 4P23C 5GGVY 2ZCKH 2C8NA 1RZFL 4YIQB 2W9EH 4MZRA 1UGKA 4PY7A 4UUJA 2CKNA 4R8WH 3TJHC 1NDTA 4HKZA 2DBJA 3QRGH 5EEZA 5IHZA 1F42A 2E7LA 4GKLA 3F01A 2DKUA 4RRPG 3J8F7 4Q58C 3KM1A 2WM0A 3DXAD 3MLPA 3MJGX 4O9HL 1SEQH 3L9YA 3WTSA 5J11B 2VLRE 3B7UX 4F37K 1W72H 3TZVA 3S88L 4L4VE 4FQCH 2VZVA 4K8RH 4B0MB 1MCSA 1AXIB 3FU6A 4GQ9H 5SV4A 1AC0A 4B7IA 5AG8A 3QA3B 5CCHE 4R83A 3IJEB 3FL7A 2IOOA 3ES6A 1T2QL 2GSMB 2J4WH 4ABVA 4QTHB 4QRQA 4D3CH 1B4TA 4GRLB 2FT6A 4IHOA 5J6GA 2NX5A 4MMXA 4AITA 1MELA 4PI2A 3RDTB 5C1MB 3SKMA 5IB2A 1KFAL 2QL1A 5DVLA 2XYBA 2CK0H 2YO3A 4KXAA 1W0WB 2PCPA 1QNZL 5FHAH 4K94C 4OT1L 3QUYB 4P23B 3SDCA 2XTJE 3NSFA 3V4PA 2A4ZA 2H8PA 4U1KB 3OG4B 4WWKA 1KLUA 2D7NA 2DLTA 3G6JA 1F11B 3TN0C 2WNKA 1II4E 4QXUH 3ZIYA 4PCYA 1MVUB 1TTAA 4IOSD 2BNRA 5IM7B 4PBXA 2UXVA 3UAFA 5JIDA 3OB0K 3FFCA 1P7HL 2JELL 4Q2ZB 3VQMA 1CU4H 2H1LM 2MCG1 4PS7A 2F1EA 3RUGF 4NQCA 4Q6KA 5DJ8A 2DL2A 4UTBH 3GB7A 3RX5A 3IGUA 1CMOA 3ZKNC 4P46D 5ABAA 5CP7B 5C0CE 4E41A 1T4KA 4PB9L 5GZND 2P44B 1AOHA 4QRRE 1KEGH 5TF1L 3PWPA 4Y1AD 1XIWA 4ADGA 4GRWF 3D0LA 4M7JL 1AQDB 1MLCB 3HC3H 2WOYA 1DLHA 3HE6C 3KPLB 3RX7A 3MA7A 5CJ8A 3FB5B 1JGEB 3O45B 4KI5D 4PJAF 1J88A 3T6VA 4JFEE 1UADC 4MXQC 4FN0A 4HC1H 4UOQA 1CFNA 1FZOA 1VZHA 2GTWB 2ICWJ 3F12B 3QDHA 5JHLH 1WD9A 4XMVA 5I8KH 4N8VB 4MXVE 1KXVA 4PLJD 4AGMA 3AMKA 2QKIC 4UM8A 5DDHB 2H1PL 1GIGL 2BSRB 3KPSA 1SXSA 4DPRA 4ZAKC 3ZDZB 3HZMB 4MAYB 4ZG1A 1YYML 4N28A 2X6BA 5IF0B 5D1ZD 1E4HA 3B2DC 2JQAA 3BZFA 5IESH 3SBRA 1U8CB 1MJ7L 2WLHA 3EO1A 3V8CA 5F1KC 2FWLB 1JZJA 1TZOA 4GYBA 1EGJL 1SPDA 2BRQA 4FHBD 1NAMA 1ZRUA 4ODSL 3H9HA 4UT6L 3K2IA 1CLZH 2G3NA 1CVRA 1AHMA 1ETB1 3WKPA 2PW1A 2DQGH 5JZ7C 1IAII 4PJCF 3U25A 3U4EA 5F6HJ 3UG3A 5I0YA 1ZT1B 3QO1B 2G3MA 1R6VA 4ZMTA 3HKZA 1FL6B 2IEPA 5BOJA 4U3CA 2BIIA 1FLRL 2N7AA 2X2IA 4S11A 5D93B 1MPAH 4RIRA 4MS8D 1DN0A 5E08L 1BQHG 1RPQA 3BC9A 3RAJH 3WJMB 2CMRH 1T1YB 1HU8A 5I1GL 4BSWA 1HHHB 3WXWL 1GPOL 3BRDA 5IVZB 2XG4B 4HS8H 3JV5A 5HI3D 2P5WA 3VFOA 1DQJB 3CDZA 3ZOAA 1G7JB 1RZJL 4K5OA 2VNCA 2F54B 1LM8V 4QYAA 4UQ3A 2CRZA 3NACH 5FHAL 3T8XA 4YUEL 4NUQA 1UKQA 4W68A 3BUTA 2DS4A 4PWIA 1RIVL 2VXVL 1KFAH 2W9DH 2KPWA 4XBPA 4NT6B 3D4CA 4OCXH 2QGCA 2WBJD 5CM1A 2X44D 4NXSA 3SE9L 1M3IA 4PRIA 4L4TA 1DVUA 4HAFA 5C3TA 5JDSA 3QO0B 3GF8A 1HH9B 4P2RA 1NLDH 4RMTA 1U4FA 2F19H 5CUSH 3M1BB 1OANA 2O93L 3L2LA 4F2MA 5D96C 1WV7T 3QDGA 4F15B 1DO6A 3RL2B 1ZS8A 4IOIB 1LO2L 2OTWA 5EZJA 4OQTH 1JHKH 5CMAB 4KZDL 3HZKA 4Z7UF 2B16A 2BY1A 1LWHA 2G2PA 5EU5B 4FLRA 2C9SA 3QARA 4LSPL 3E8VA 1S8DB 4G5AA 4GG6A 2H5UA 1BFVH 3BVXA 3TNNB 3ZMRA 2O5YL 2JK5A 2OZ4L 1A47A 1RJYA 3C5XA 3UAJC 4BCYA 5IUCA 1Y6MR 4MQXD 4XPAL 5CILL 3QDJA 4XP9H 5D1ZA 3IN0A 4OI7A 4FF9A 1XGQA 3C8KA 3IE9A 2R0KL 1MJJA 2DQ6A 1IGTB 1L0YA 2LU5A 5EA0H 2EP6A 3MJ7B 4HA1A 3C6LC 2P8LB 3N43B 3OKOA 2IH3B 3I50L 4M61A 3VWJA 4OZIA 1QSED 4UTAH 3ARFC 4JM2F 5CD3B 3ARGB 4YHML 3DBXB 3DX6A 3EH5B 4LCUA 32C2B 3REVA 5HHMD 1R5IA 3RWCB 3CFKA 4FHJA 5CLWA 3P3YA 3HZKB 1XF3A 4ILDA 5DTFB 3Q01A 4EUPB 2X4UA 3DOSA 3O0LA 5C7XL 3LH8A 2GBVA 4QRRD 1A4KA 4DP2X 2YK1L 2VDQL 1NUFA 1MFAL 4IU2A 2X4PB 1KCRL 3BPLC 1HYRC 5JO5A 1PLBA 1FH2A 3ULVD 1FL5B 5KVEE 2ADJB 4GY4A 3PGCB 3P4LA 3RILA 3WN5A 3B9DA 2CPUA 1IB5A 2O5ZL 3IPBA 4Y9CA 5D6CA 1E4WH 5CSZA 5D7JC 5A7BA 1A7RL 1LTXA 3CK0L 3F7YB 5FUOH 1SN0A 3BSZH 4M61B 4XMLH 3ZTJH 2G9KA 2VQ1B 1NGZB 3CH8A 5F96L 3TIEA 3BVTA 3HUJE 3NFPB 1NBZA 2DTSA 2ZWYA 1A6ZA 3FH5A 2CHWA 1NINA 3PL6A 4N9OB 4HFWA 2W0PA 4IHBA 2K45A 5KVFE 1GKEA 1GJIA 3O8XC 4XZUB 1OQXA 3MRMA 5IFHH 1XH3B 2OCFD 4QJ3B 4R97C 1XSIA 5C6WH 1HHJA 3WFEL 4BD4A 3GMLB 2JJVA 2PW1B 4PB0H 5IQ7L 3L5WA 3O8XB 3FN0L 1LDPL 1F6AA 4HCRH 1JWSB 3KYNB 4ZFZA 1NGQH 4AUJA 2X1OA 1QSFA 4YFLF 5DC9B 5AKVA 5BZDB 4BDVB 4FTVD 4XMKL 4FABL 1XX9C 4LCIH 1TJIH 1WFUA 2C34A 3FQWB 3OHXA 2I07A 3N91A 1RZGB 3DUUB 4FTVE 1OK0A 1YEKL 4Z7OB 4YSQA 4OLUH 2K7QA 3KCPB 1AIZA 3OAYH 1IGMH 4ZTEA 1JYXA 2I9TB 1IBYA 1NPUA 4KRPC 5ITFB 5DJCB 1IT9H 1BM3L 1X9QA 4QRUB 5C7ZA 2ZKHH 4TVPL 2F5BH 5E7FA 1AQ8A 5C09E 4DFHA 4B9YA 2OMWA 3EOYG 4O02L 4N8VA 3GWJA 1JZHA 4ZS7H 3PXLA 3HG1E 5D1QE 2VXUH 3V4PH 3FS9A 2I60L 1JNHA 5C6TH 2C9AA 4HS6B 5IQOA 3S4SG 3MNWA 2OJEA 1JHLH 1G9MC 1O5PA 1PCXA 1G1YA 1A6UH 1F58L 1RZJC 2FYYB 5FECB 5J1TC 2DI9A 3O6FA 5B4MD 2X1WL 4XWOD 3MRFB 4ZO9A 2X7LB 1XIWB 4XE5B 4XVOA 1LHZA 5IVXF 2WZ0A 1DQKA 5D2LA 3JTSB 4QWWD 3BJLA 2R7EB 3BDYH 1JPSL 2ALWA 1OY3B 5T3ZL 1F4WL 2ZONA 3MV7A 4P3DB 4CILA 1NL0L 2ATAA 1DL7L 3ULVE 3WFDL 2W94A 4P4KD 3HE6A 3Q6FA 2Y22A 2Z8RA 4OLXH 1CXLA 2C9PA 1QHQA 1TQBC 3C08H 1YYCA 3CHRA 3TIEB 4HKXA 3CMOL 1RHHB 3STZB 3VFTA 2APTA 4FQ2H 4S0TD 4M1CC 4B9IA 5FO9A 1OGAE 1NIDA 4Q0XH 2YAQA 4Q14A 1INQA 1CXKA 2VYRE 1G1CA 1JYNA 4WKZB 5KBPA 3VFPB 1D5MB 2CK2A 3MLUL 1TTUA 1ID2A 3FBQA 4A7TA 2CG9X 3BEWA 3MRIA 4XP9L 5GQBA 3DDFA 1AQHA 3KR3L 3MO1A 3C08L 1VADA 3OKMB 5C8JB 1TG8A 5JW3L 4L3EE 1OQOA 1QSEE 2VERN 4IEFB 5DD3L 1NPJA 1HN1A 3CFBB 3MXVH 4ISVB 4X7TB 1IGFH 1P6FA 3V6OE 1E28A 1NCCL 4JDZB 5AYQA 3S5LB 2Y7SA 1EAPA 2Q7NA 3NVQA 4UIMB 1ZHNB 4AEIH 4CVUA 1R3IL 3CFDB 2V7NA 2WQWA 2C3GA 3HNSH 2NY1B 4M62L 4PRAB 1OIOA 4AL8L 5HY9A 3L9BA 5HYJA 3NMEA 4K8RD 5E8OB 4S0SD 1AI1H 1FC2D 4QXGH 3RU8H 4DO5A 4HJ0C 4K3EL 1UFUA 4HW6A 5DJXB 3QEUB 5IFHL 3BAXA 1O9WA 5KVEH 3L9EA 5HYIA 1G43A 2FBJL 3QAZB 1E2VA 2YEQA 5KS9F 1GTNA 1X5YA 2Y06H 3JYCA 3E2HC 3LV3A 4GJTB 4WKZA 3VTTA 5BMFL 5I74C 1DUYB 4GLRH 1NBYA 4NBXB 4MWFB 1A4JA 5AUMB 2BINA 2CH8A 3FO0L 1WEJH 4GMTH 3FMGH 4LHUA 5T3XE 1A6WL 4AMWA 3CHQA 2AEIT 1T0NA 5E1AB 1KXTB 5DLML 4UU9B 3MRQB 3AG2B 2ZCLH 4G70B 2GUOA 4HXBL 1GPOH 3C60C 3QPKA 2V2TA 3PWUB 4ONFL 3V4VL 4MS6A 3GXFA 4HIEA 1NBQA 1A7PH 5LGJA 3CU7A 4G1EA 4KXBA 4OB5L 4ZMZA 5IGXL 4PRBB 2G3ZA 3DK0A 2CJUH 2F2HA 4TSCL 4GG6F 2CJ3A 1QBBA 2XA8L 1GR7A 3BP7A 1X44A 4J3SA 1RAMA 1ZTXE 4WNQB 3SPVA 1YEHL 1KN4H 4DQOL 3QIWB 4UQAA 1QP1A 5AVRB 4NQCE 3UADA 3DOSB 2R51A 3UTQA 5LB1A 1L5GB 5L8KB 2ZXBA 4TSAL 5J3HC 4CDGC 5C0BB 1A7BA 2IANE 3X1GA 1MCRA 3FQTA 4YO0A 1S7SB 4EI5A 5CSZB 1QBAA 3EJZC 3HVNA 2VUKA 5GGRY 2QR0B 3GKZA 1KMGA 4IRSB 4BIKA 4PJBA 3S5YA 3MOAL 5DJCA 3B4NA 2IOMA 2QVKA 1GZQB 4FEMA 1W6WA 1KCUL 4N0CD 4W6WB 2FLMA 4MNQB 2RACA 3F12A 4TQPA 5DA0B 4XNUH 2FL5A 3TASA 1HEZA 1OB0A 3FTVA 1MNNA 1HHHA 2FO4B 3N2JA 4RFNB 4RGOL 4JRFA 3LQZB 4XPTL 5CILH 2GUYA 2OL3H 3QPQC 5E4OA 3QJFA 4Z7WF 4FHKA 1U8LB 1KBWA 1RMFH 1U36A 2X87A 2OZ4H 1C8PA 2EDFA 5LBSA 4JRYD 5B21A 2DWDB 4JPVL 5CNHA 1P53A 2OJ1A 3S36X 1FAKT 3MCKA 1R0AH 4NJ9L 5FKAA 1YQVH 4WUUE 3UTSB 4Y19E 3BCFA 3FO1B 5DI8B 1O5DT 2UWEF 3VXTB 3P1VA 2PXYD 3TJEH 3X17A 3LZQA 3LVTA 3QNFA 4P49A 3KVDD 5MI0C 2ITDB 3IAGC 4ZFFA 1F3RB 1MW0A 5KAQG 3HN8A 2CDEA 4WFEE 1KLFA 1BVNP 3W11D 1FHNA 3HZYB 5IFAH 2V3FA 2B0SH 1KB9J 2FGWH 2JB5L 4AQ8A 1DBML 2YMXL 4N0YH 5D7LA 3HC0A 3MU3A 3JWDL 5C0AD 1HNFA 5ITBL 1BFSA 3P40A 4TQEL 3LQMA 5H2BA 5DVOA 3WD5L 2IWKA 4R7VA 1U4EA 2GFBB 4JFFE 4X5XB 2ZPKH 4JMNA 5K39B 3L1OL 4TSBH 3KCWA 2NYYC 4F33A 2PTVA 1E8XA 3TBTB 3W3BA 2RCSH 1YCSA 3QIBD 1BYNA 3LRKA 3SKMB 2JIXD 43C9A 1M2VB 3F58L 5B4MC 5C6PB 5KYYA 2CBMA 2W9LA 5LCVA 4KUCF 5CWSA 4C55A 1A7QH 1XGTB 3RBSA 3P4MB 2EUZA 4APQB 4QF1A 1RJZA 5F3BB 3KVQA 3ABGA 4JFHD 2C3HA 2DDQL 2QVIA 3MLYL 2I32A 1R9FA 4NQQA 4OZIF 2WKGA 2VDOB 3KEHA 2O61B 2ZT9C 3ROOB 4Z7QB 2WSKA 2XTJD 2W0FB 1K4DB 2Y4SA 1N64H 3VRLF 5AOZA 3IGKA 3BVNB 4M7KH 4BZ1H 1P5VA 3GSNL 4D9QD 1DQTA 4GXVH 4Y16D 2YBRA 3K81A 5IOPB 4BFOA 2WANA 4RGNE 1XAKA 3EH4B 3S4SB 4NQCB 4KJQC 1A14L 1OSPL 2PPEA 4NZRH 3TT3L 4MS8C 5DZVA 1T04A 3OMNB 4JFPB 4AW7A 1J8HB 3IGLA 2EDEA 3QCVH 3N41F 4UB0L 3C5ZB 1V10A 4QJ4B 1F00I 1RUQL 3VGDA 3WFBH 3Q5YA 3SQRA 5GS2H 3ARSA 1J12A 4KMLB 4PV9B 3KWWA 5L6YH 1E5ZA 4M48L 4ODUA 3QWRD 4S1QH 4IIQC 4WWKD 1RIUL 4ZUTB 4HULB 5CJBA 2OTUA 2YQBA 3BUYB 1IGJA 4AUUA 5AAMA 1I4FB 4HD5A 4P2QE 5E99H 5GRVK 2AHIA 5EUOB 1CT8A 1QBLH 2ZJSL 2WAHA 5E7BA 4V33A 1RHFA 5CP3A 3NCWA 3GI9L 3TS8A 3HVDA 1U41A 2AQQA 2NX5B 4MMXB 4KWUA 5I6KA 4JR9L 3HC2A 5DTFA 5IB2B 2QDWA 3P73B 1S78C 4X6FA 3GLEA 1OF2A 1MQ8A 3CZKA 3QJQB 4WU7B 2R2HB 1EJ8A 5TQ0L 4P3CH 4ATWA 1ZK9A 3A67L 3IVKB 4BKTC 3B6SB 3VX0A 3KM2A 2ZUQB 3EJYC 2WKOF 4PJEE 3EZJB 2VAAA 2HT2D 3GPSA 4EI6A 3K71A 4YBQC 4M3HA 3WYRA 5J06A 1QQDB 1G7LA 1JXFA 3UTTA 4NQED 2BPBA 4MCZA 3I75B 1Z0NA 4LKCA 3N44F 2CO2A 3K72B 4YHOL 1IARB 3QFJD 2YQGA 2FR4B 2VR6A 2EDWA 3KLHD 4WFGE 2FEEI 5GS0L 5IIEA 3ILQD 1E5CA 1FYTB 5HVHC 5T1KA 3DX8A 4XNQA 1E50A 2VR5A 5E9DA 1Q94B 1DN0B 2DQCL 4G8FB 1M7XA 4G2AA 1LEGB 1E6OH 4KUCD 4C59B 2V17H 3BVNA 2NY2B 2IXQB 3AT0A 4NZTL 3OWRA 3UTSA 3NCFB 4N9GB 4XWGL 2ORBH 3H2QA 5AB2A 2NY3C 4W1TA 5F21B 3F64A 1W2KT 2J8UE 1IGYA 3BAJA 1HX0A 3HEIB 4OUUA 3LXAA 2WINA 3HZ3A 4JFSA 1TF4A 4Z7UA 2HT4D 3RY5A 1JWMA 2BSEA 4ZUVB 3RPKA 2G5RA 4QXVA 3RKPA 4Y1AB 43CAB 5IK3A 3MCLH 1K6QH 2WW8A 5SWSA 3ECBA 3UP6A 2WBWB 4TULL 5EWIH 2Q6WA 1DVFC 1KG0B 3EHBD 2ARWA 2Z0BA 4M3KB 3WNOA 4ETQA 4I89A 2JF1A 4NUJA 4IRSA 4UTAL 5EU7C 3Q0HA 3U79A 5CHNA 1JF1A 1H3GA 3H54A 4P2OB 2COQA 3KLKA 4IOSA 1SXNA 5SWQB 2F7IA 1AQKL 2NXZC 4IJ3B 4UYPA 2IMNA 4HHAB 4LPCA 4KXDA 1KCSL 4ZUUA 4BSVA 3RGVC 1FHGA 2ZCKL 5C7XH 1UXMA 4H8VA 1CF8H 1P4IH 5I0WA 4Z76B 3V5DB 1QPKA 2IQ9L 3FDWA 2G75B 1EZVY 4DNLA 2A9ML 3K8KA 4GG8A 5FFOA 3FH7A 3MYJA 1OE3A 1NGPL 3FUJA 4HWEH 1I8KA 4NKIH 4LEXH 2CUMA 3ZQWA 4BFRA 5IB5A 4QXGL 4WV1B 1OP3K 4GEJA 2DBLL 1FBIL 4DUVA 1N8OE 3O8XD 1YAIA 4N2LA 3O0RH 2H32B 4WI3A 5CKGA 4XNBA 4P5KA 1UOWA 1R47A 4PJBE 3HNVL 5IQNA 3ARXA 1FN4B 4POZD 5DO2C 4G5ZL 4OIIL 5FAAA 4N26A 4AK2A 1SYVA 2AJYL 4H1LA 4NQEB 2XQBH 4EZKA 2WLJA 1JRHI 1R19A 4ODWB 3LHPL 2Y07H 3KL5A 4EN3C 3QDMB 1NFDB 1VGEL 1GYUA 2VJ0A 5E9DD 3U9UA 2CO1A 4PR5A 1MG3C 1RZQA 5EOCL 2OS7A 1R5VB 3KW7A 1BM7A 2XHNA 5CLTA 3SKJH 3WE6B 5ISZE 1A2YA 3OXSB 2YGOA 3UZQB 2MCMA 1ZTXL 2N4IA 3KWTA 5BOPA 5LXVA 1S3RA 5MEND 4KZDH 1BQLH 4JQIL 4TUUA 5HJBA 3NQIA 1RCYA 1CLOL 3UZEC 5IQ9B 1HS6A 4LGRB 3IDUA 3TO2A 4CKVX 1A7OH 1EAPB 2WXFA 4QRRB 1OWWA 3NJGA 3TZVB 3Q43A 1OARL 3DARA 4HAKA 1KOAA 1P5VB 1CFMA 3PUCA 4JFWA 4W4OC 3SPIA 2IH8A 4NJ9H 1Y7VA 4RMVA 4D0DA 2KLSA 5FO7A 3KLHC 4AQ1A 4FG2A 1S7XB 4YDLC 2JKRM 4QRPB 4YHLH 4OI8A 4XP5L 2WLZA 3K8LA 4J8RA 3MLZH 5D7IE 4AL8C 1HJBC 3IAPA 1UACH 4WI4A 4HIIA 4LARH 1B90A 3D25B 5BQDA 1G7LB 3ZK0A 4G6JH 1P69B 1WUNT 3QH3A 2ZOWA 3MJ8A 3V0EA 3W9EB 1HEJC 3FQXB 2V2WA 2WWNA 3GXDA 3WG7B 3QUXC 5B38B 1IAIL 1QA9A 2AI0L 3FQRA 2Z7YA 2ILLA 3L4XA 5JHLL 4KVCH 3M45A 2D0FA 4L3FA 4MGXA 5E4EB 1WICA 4P2RD 4U4IA 3VFWA 4P59L 3MV8B 5EO1B 4NI3A 4OZ4B 4MD5B 2I9LB 4GRWB 4IMKC 1F3DJ 4HCRL 5FDWA 3A24A 3EYSL 4V1DD 3L3DB 5BVJB 1DBJH 5HGHA 1GW6A 4MKMA 3TBYB 5IBLC 1EZVX 2AVFA 2F15A 2XSKA 3KPNB 4RMRA 2XCMC 4Q74A 3VXTA 3VMPA 1FPTH 1WIOA 4YFLI 2VRKA 4HZAA 4LVNC 4ZXBB 3VQ2C 5DMYA 3NIGF 2F8OA 3T65A 2R29A 1SJXA 5EEYA 1F90L 5FX3A 3FK3A 1BQSA 1IBGL 4Y2LA 2E7LC 2NQCA 3D0VA 4NI6A 3D07A 4XCFL 2X6UA 3KXFE 4WAFA 5I9QC 1KJ2A 5EIQA 2F58L 5K59E 2X0VA 3MBXH 3MOQA 4MMZC 3SOBH 4MRBA 3DSNB 4U6VL 1UT9A 5J1SC 1SQ2N 2LFGA 3H9SD 3OKDA 3LMJL 5ALBH 2X1PA 3NIFF 4LCYB 2W81C 3ULSB 4AVKA 4H1LG 1SVZA 3M7OA 1ETJA 3BPOC 4IDJH 1P6AB 3E3QE 3GSRA 3PV7A 5HHMB 3QRBA 3WEMA 1KNOA 3QI9A 4XI5D 1JUFA 2J5WA 4AL8H 1BOGA 4NFCA 4NO0D 3RB7A 1KULA 2IMMA 1ZLVH 3SDCC 3VFUB 1Q0YH 1NANH 1NAMB 3Q9QA 1KJ3H 1Z7JA 3AZUA 5AW0B 1HOCB 3F7KA 2L0DA 1G9NC 1BF8A 1N26A 4CVWA 3VXMB 1ZCRA 2J44A 4UNIA 4CL7A 2QQLH 2X09A 4HUCA 1EZUA 1T5XB 5E8DL 3OMZA 5I1JH 2VGLM 5KVFH 4HPHA 2V4LA 3FULA 1YMMB 2Y7QA 3RWFA 4ZS6C 3HG1A 5D1QA 3OLEA 4K3HA 3QJOA 2EJ1A 2ZOTA 2IDTA 2KDYA 2GJZA 3DVFA 2FECL 5HHNA 2JI1A 1FLTX 2B4CH 3FCSA 4MX7B 5F7DB 5CCKH 2NXZB 4DOHE 3G7TA 2QT6A 1X6NA 3EJSA 4HK0A 1DVFD 3UC0L 2MMXA 5GS1B 1N0LB 3X13B 2E7CA 2OMYA 3TN0B 4PJBF 5DFVD 4N8UA 5K5YA 2IPUG 4HWBA 3ZE0F 2HT3C 4RFEB 4OF0A 4LSPH 4RESB 1F4WH 1QPPA 1JZGA 2K78A 2Y5EA 2A6JB 1KV7A 2R7EA 4JY6B 3MC0A 1F4HA 4B96A 4K5MA 3I2CH 5T5FA 2OI9B 4D9RE 2Z4QA 1FVEA 1UXLA 5JLZB 2VDOH 1MREH 1TENA 1A7OL 1E5YA 1MFNA 2K3TA 3G6AB 3PNWB 4M4RA 1A3RL 5TPWH 1CB4A 4U1SA 2H2PC 5IHWA 5C08D 3IJHA 4YX2L 1E67A 3W57A 1JHLL 3CFEA 5T33H 1A9EA 1HQ4B 3OX8B 1ADQA 1CLVA 4DGIH 3B2MA 2J6EL 4YSOA 4YOKA 5EA0L 1Z0MA 3P73A 3NCCB 4DP9X 5EIIB 1CC3A 2UZIL 4D0BA 5SX4H 2VE6A 5JMOC 4M6NH 5KBDA 3V6BR 2ZZUT 2N1KA 1H5BB 3TNNA 3ZKMD 2YA1A 2OA9A 1IC7L 3OVUB 4HC1A 4JVPA 4MNHB 3PHQB 2WXQA 1S46A 3ESUF 2AJYH 4KVNH 4OCSL 4RMUA 3WS3A 3ZT5A 3OAUH 2PTUA 1BQHB 3TJEL 4M7ZC 5D7SH 2MOVA 3T2PA 1TJHL 4LDEB 4O02A 4E9SA 2AXWA 4HSQA 3I9AA 4HJ1A 2H4EA 5KYXA 3O6FD 3DO4A 2DM7A 3CC5B 1MDTA 5JXEA 3UCQA 5E03A 1INDL 3WFCH 2IV9A 3F7VB 4AIEA 3IJHB 2DBLH 2AJXH 3U7AA 1IVTA 1B9KA 2G2RA 2HJFB 4G6AD 3A4DA 1FIGH 3AG4B 1BMGA 1JOIA 4KXCA 3I6GB 4N0UB 4OH2A 4R4BA 4WJ5B 1NCWH 3BPOB 2IQ9H 1T20B 1CTOA 4BYHA 2D4DA 1JK8B 3MXWL 4L9LA 5F97E 3DV4A 3HNTL 3T6XA 5E9NA 4M43H 5IEHA 1MEXL 1USZA 2CGZA 4JFXA 1FUNA 4HH9B 3RURA 4AH2A 4B60A 2XPZA 4MA1C 1AD0B 4APXB 2GEEA 3DLQR 1C08B 5C0ND 4MCZB 3N04A 4LEOB 2X28A 4DPCX 2IV8A 1KUMA 2Q6WB 3VXRB 1OB1A 3K4ZA 4ZQTA 4XNAA 2BY2A 1HL8A 5F7KC 3U0PA 2XQYG 2X9WA 3SCMC 4IRJD 1NGWA 4LCVA 1KTRL 5EG6C 3ETBJ 4AEFA 1FL3B 1KPUB 1EANA 3BO8A 4AOFA 5TDOB