5EEVA

Radiation damage to the trap-rna complex: dose (dwd) 3.88 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eevA00
5EF0A 1QAWA 4B27A 2ZP9A 5EEYA 3ZTEA 1GTNA 3AQDA 2ZP8A 5EEVA 5EF3A 5EEUA 3ZZSA 2EXSA 1WAPA 5EEZA 1GTFA 2ZCZA 5EEWA 3ZZLA 2ZD0A 3ZZQA 5EF1A 5EF2A 2EXTA 5EEXA 1C9SA 1UTDA
chains in the Genus database with same CATH superfamily
4KROB 5E23A 2BNRE 3WUZA 3DHMA 3MV9E 4GFXA 4OD3L 1UENA 2QKIA 4I48A 4OZHF 4K3DH 4XO5A 3TJPA 4NPJA 2JVUA 3TV3L 1R3LA 4L23A 1ILSA 3LTVA 4HHAA 1BAFH 5DRZA 2ZX7A 2F5BH 2G9HA 4E0RA 3KHQA 4OKDA 1G9MH 3RDTA 3ARFA 3WELA 1Q4NX 4JGNA 3OKDB 5IOPB 4ZS6C 4XZ4A 8PAZA 2BC4B 3NCXA 2OMYB 2LLGA 2KPNA 5A2LH 5TQ2L 4WV1B 3RILA 4A2DA 3KH4A 5AD0B 1H8SA 3INUL 5AYUH 3ULVF 2OMWB 2ZSVA 3PQYD 2P52A 3W37A 4K94H 4X6CB 3VWJA 1N2RA 1OCOB 2F1AA 3KHOA 4Y5VA 1FAIL 4OIBA 5GZOA 1BM7A 4TMPA 3LOWA 3HG1A 1THCA 5DYOB 3NCCB 3MACL 3DRQB 3MMEB 3P0GB 4P5TD 3UEQA 5KJ7E 2X0VA 3T6WA 4C47A 2HJFB 1RURH 2DJUA 5JYLA 1YN7B 3IK2A 3R0MA 1J0YA 1M2VA 4OLWH 3QJVB 1LP9E 5DJYA 3AS1A 3B8YA 2NY6B 4TOYH 5DMKA 3WUWB 3P30H 3KPQB 5GS1C 4G3YL 3NGBB 1INDL 3BP4B 4AIZA 4D3CH 1U4FA 2WOBA 2QPFA 3BH8A 1OZTG 5C0RH 4JAMB 5D1XA 5LDUA 1YEFH 4HF5L 4AH2A 1I4FB 4ELKA 4HIXH 1TTBA 2R0ZL 2VR6A 1W8EA 4P5TA 2PW1A 3QWRD 4KTEH 1TTGA 4M48L 4FG6D 1RMFH 3L16A 2ODHA 2AGJL 1XGTA 5ECGA 2ZSWA 4XMUA 2CNZA 2XWCA 4HJEA 2W88A 2QQQA 4CRPA 3O4LB 2HVJA 4M7ZB 4YO0B 4X6FB 3VFOA 5IBUB 2QR0A 3KBPA 2WKLA 3VXRA 4XCFL 3WTTA 1Q9OB 3ECVA 2ARJA 1TO4A 2R9HC 1FZMA 5F8QC 2B1HH 1IFGA 1L7IL 3L2LA 3LEYH 4ACTA 2VDMH 1T03H 3K80A 4KQ3L 4AC4A 1UWFA 1CG9B 2ZOUA 3IS1X 3EZ8A 1YHPA 3RTQC 1S9KC 4Y0GA 3HN3A 3NH7H 2E0PA 5GXBB 3A47A 4XCNB 4Q97A 1YY9C 2PR4H 2B59A 3ZDYE 4C83A 5EOTB 4KHXL 4Y16A 3MOQA 2O26U 5KYXA 2DQMA 4X6FA 2UWEF 1N8ZA 2FZ3A 2IBBA 4UI2A 1BG9A 5C6TH 1BZ9A 1WAAF 2P80D 1V10A 1XAUA 3EYSL 4MJIB 4RAUA 2W0PA 4WI0A 5AZEL 4JMNA 2JELH 1F1GA 3I6LE 3CQPA 1K85A 2GC4C 4P4RB 1PAZA 2B0SH 2Q1EA 3ZE1F 4FKEA 4P3DA 4X9HA 2MQ0A 5E1IA 3L8QA 4LCCA 3QEQA 4DGYH 3DX1A 1R5VA 1ECZA 4OZGF 5E2WH 5JOEA 3BVNA 3FPYA 5B8CC 3T8XB 4GQQA 2UVEA 2R1WB 3EG9A 3ZDXE 4IRZL 1B2YA 1CFMA 4IRSD 3U83A 4ECNA 2P24B 3BX7C 1DDHA 3C6LB 2OR8A 2FGZA 1EV2E 4AW4A 5H94A 1XR9A 3BAJA 1UC6A 1OT1A 3O3EA 1F4YL 2C9RA 5CN1A 4FTDA 1HDMB 1D2OA 4NZ8A 4PJCB 4IK7A 4OI7A 2VISB 1K4DB 1A7OH 3AUWB 3ILQC 5AW1B 5KBDA 3QNFA 4WJKB 5KWYC 1HQ4A 2X4RA 4JRLA 4BFOA 5JPMA 4POZD 4J3BA 4P3CH 4GXUN 4KHTL 1T0MB 1P9MC 2JF1A 4NKDA 5TQ0H 4F7CA 4L8DA 2NY1D 3WGVB 4Z77A 4PJIF 3CC5B 4R7DB 4M7JL 3RGVA 4RQQA 5H37A 2YPKA 4X6DB 4BSWA 3SO3B 1UD6A 4OQTL 5C08D 1RK0B 2CZNA 4AQ1C 1OIOA 4CMHB 1KTCA 4YK4C 4J6RH 1IEBA 4P9HC 3L6FA 1JWSA 4JFHD 1YPZB 2BSTA 4KGJA 5LJYH 4QTIL 2IOMA 1XDTT 3T8VA 2B4CH 1WE5A 1AS6A 4TSCL 3GJFK 2W59A 2XQYG 3OAUL 2BSSA 3BSZA 4RQQB 5CLZA 3OKLA 3IDMA 3MLUL 3NSJA 5KUKA 2NQCA 4XX1G 5I8EA 2VR5A 4R83A 4QNPF 2HTKD 4ZX3A 4UIMA 3MFGB 4LHJB 3RPBA 3RTQA 2MCPL 4GSQA 2BJMH 3DOSB 4GAGH 5A7EA 1DO5A 3P3YA 1HXYB 3K72B 4N0UA 2DJMA 3ENEA 3TH3T 2EE2A 5FA4B 1BM3H 3N04A 4OV5B 1TZIB 3BZFA 3KG5A 4PJ7A 1IKFH 3V5KB 1OTUC 1H6UA 4NRYA 4HIEA 2DLIA 4A2LA 3RVXD 1G0YR 3J2PA 5L6YL 3CH8A 2ZCLL 3L81A 5DI8B 1IC4L 3RNKA 1E9QB 5C2BH 3ATDA 4YUEH 2WWMC 1BQHB 2Z4QB 3ZYOA 5F9DC 4PWJA 2A77L 4A37A 3V4VB 4QCIB 1A6AA 5JIDA 3MGAA 3KDMA 4KNTA 5F9JB 3L13A 5GGRA 4ZUTA 3VH8G 3K4ZA 2EIEA 2OPCA 4JUTA 1KPVA 1AZVA 3WS3A 2OBGA 3QEQD 1N4XH 1QSEA 1S3KH 3FCBA 4YX2H 3UBHA 1X9QA 2BIIA 5LCVA 5E8OB 3AQYA 4EKXA 2IGTA 4MQXC 1UM4H 3MNWB 3BQUC 2B15A 2I9LB 4Y1SA 2GSGA 3QR1A 4X5WB 2IFFL 5J3HD 1IEAA 3O6KH 3SDAC 5CD3B 2E4TA 1TU2A 2YPLA 2ARJQ 2NDFA 4NM8H 4Y9GA 1NFIA 3ZDWA 4KZCA 4MMYB 1P7QB 4TNWF 3FQRA 5CINL 2XTSA 1M6UA 1DFBH 3VWKD 3H0TB 5DK2A 1WICA 3Q5YA 1VKXB 1NCGA 4KBPA 5FHBH 4TLTA 1OARL 1U95B 3LN5A 2QVFB 2WD0A 5SWZE 4J3OD 1BFSA 2IMNA 4M93B 3JSSA 3GD1C 5LCVL 2WKGA 4K2UH 4DEPC 5JNYB 4LARH 3S3CB 2K7PA 5IEKA 4RCAA 1HNFA 5KSAA 4G9DA 4Y4FD 2YK1L 5F44A 5CEYB 5JR1H 4PUBL 3OKOA 3RKPA 5LNEA 4HK3J 4M5ZL 4WSGA 4LCVA 2ITCB 2WNXA 1ZS8A 2GC7C 2R0ZH 1G9NL 5JQIB 5C0JA 2WXFA 4KRLB 1YEFL 1T1YB 3HI1B 4PBXA 4WK0B 5D9SA 3WOVA 3ZOAA 4F3FA 5IWLA 3QPQD 1XSIA 5L0QB 1AE6H 1GOFA 3T3MF 4HEME 3EFDH 5SWZA 2DLGA 4HULB 1HE7A 3T5WA 3D9AL 5F1KC 2AEQL 3QJZA 5ESVB 4E41B 2FUTA 3TO2B 3KMDA 4F8TA 1T83A 4PGZA 4O4YH 3P9LA 4G9DB 1BXXA 2YZ8A 3WN5B 3ILPB 1BDYA 1FVDB 2YQ3A 1ROWA 3NAAH 1M2VB 5A16B 2VIRB 3IDJA 4X7FC 4XMLH 5EC1A 1GR7A 4CC0A 3KWVA 5I6KA 3SPGA 5D5MB 4MD5B 3HNVL 4QXTA 5I1DB 3HG1B 1X7QA 4UUJA 2AQNA 2F19L 3ATFA 1MI5E 3H0TA 4LO9A 2H2PC 1XD1A 5I0YA 2C7UA 5EZOL 2Z8SA 1X7TA 3V0AC 4Y4KC 2NTSP 1G0DA 4JPWH 3D52A 3GUTA 1MWOA 3QNXA 1JPSL 3AITA 4K8RL 3ZZSA 2APWA 4DGVH 3E8UL 3CFBA 3O81A 3VD9A 4N0YL 1AHMA 3MNWA 3EUDA 3ECUA 3AT9A 4JQVA 1XX9C 2F5BL 5ESAA 2OTWB 3TFBA 1R3IL 3ESOA 3BEVB 5DS8A 1A1MB 5G5DA 4DEPB 3V55A 2PR9A 5CSZA 5DVLA 2Z8RA 3DI3B 4XMPH 3AT8A 3IETB 4JJ5A 4L4TD 2HX8A 3RIAK 3NP4A 2VDKH 2VQTA 5DK3A 3EXJA 3N9GL 4U6YA 3V79C 3H3PL 4K3EH 5C0AA 2ZG1A 4OF3A 2NYYD 3FMGH 5IFJB 4UV4H 1IC0A 2QGBA 2BNQD 4JEGB 3OKEB 1XB8A 4OCNC 1XT5A 4Q6IB 1B9ZA 1CI3M 1IBGH 4PJHE 2GAZB 2GJRA 3CVBA 3CQQA 4JKKA 5JW4M 3V5KA 2BY0A 4A2EA 4GXFA 5IIEB 1XF2A 4L4TA 1EJOH 1I7ZA 3QFJA 4E9RA 1JYXA 2XIBA 1OOWA 4UNTA 3PAVA 2UXGA 2IG2L 1B4RA 2VXUL 1I1YB 4LAJH 4L9DA 2QMJA 4NUJB 3ABMB 1WITA 4FG6C 3ABKB 1AG6A 3FTYA 4XP1L 3BAEH 4YL4A 3SE3A 2FSDA 4OKVA 1UB6A 3X13B 1A6VH 2LW3A 3T2NL 4YVNA 5D1QA 2CG9X 4R4FH 4JM4L 2E46A 3E6FA 4ELMB 2WQRA 1DVQA 1LEGB 4CNIA 4PEEA 2UXTA 4LHUB 5D2NB 1LDPH 2FK9A 4KO6A 5IHUH 1JVOA 4C57C 3MRJB 4Z7UE 3X1EA 5IEKB 1CLYH 1A9EA 1JDAA 4Y5XC 2UZPA 3H9YA 1EVTC 1FL5B 2A6JA 1KBWA 5IT2H 3DSNA 3JXAA 4TNWK 2KYIA 2J7LA 3MBWB 3EOAA 5I1EH 3U36A 4DFIA 5I19L 3LZFL 5T8IA 4O58H 4I8DA 1S7RA 2HT4C 4OFPA 1DLFH 5ILTH 1MZYA 4K5NA 1IFHH 4O02H 1ZVHA 2FJFA 1FFQA 2F1BA 3ILPA 4HJGA 4GRLA 5FYLL 4Z76A 1BIIA 3QXVA 2AK4B 1UXSA 2EO9A 3QEGL 5ADOL 2QMKA 2DQIL 1IZJA 2WQ8A 5KUMA 3A24A 1SY6H 4R4FL 3TT3H 5FFGA 3ARBA 2CRYA 1JYWA 1G7LB 1M7XA 2Y25A 5DJ6B 5INDB 1HHGB 1ZMYA 3M7OA 3FO0L 4QRQB 1JMXA 3ETSA 2E27H 4I18B 3ZT6A 2R9HD 3OAZK 3VCLB 4C4UA 1U8KA 3D3VD 3TVMC 3ELQA 5T5FH 3IJ8A 1N26A 4MNQB 1LK2B 3PFQA 3KAAA 3CGTA 2GITA 5GGVY 2X12A 1NJ9B 3T0WA 2OZ4A 4F20A 1RJZB 1UT9A 2UUDK 3RZCD 2JLLA 2WM0A 2ZOLB 2DQUL 1LEKB 2OJZL 2Y9RT 5DZPA 5ACMA 4AIOA 3QJHA 4CADB 2C1OB 1FNAA 3ARBD 3QAZC 3EW3B 4UV4L 4YEFA 1I1AA 1HI6B 4ODSL 3L3KA 5J5EA 3V0HA 2YD8A 4KUZL 3HZYA 4BUQA 3ULUE 5D2NC 1BQKA 2OL3B 1T0PB 2WLNA 2WUCH 4K3EL 3H3PH 3DTDA 3BIAX 1TZIA 3BPOC 3IPEA 2ZOKA 3L7FA 1IARB 4PYGA 2WZAA 4IIQC 3V6ZA 2D3NA 5DK0A 3QG6B 2VDMB 4HT1L 4TSAH 1FN4A 2LE9A 1SOKA 2X9ZA 4YSTA 2G3ZA 1PD6A 3C2AL 5D6DA 2X6CA 4G6ML 4NSKB 1YMME 1TMQA 5JOPD 4Z3JA 2AXGB 1CVRA 2JIXB 1R3IH 4FG0A 1B0GB 4XP5H 1IIKA 3CVHH 4TUJB 1FNFA 4AK1A 2WQUA 4A2HA 1KWGA 2IVFC 5JPMC 3T6XA 4N0YH 1F97A 3V6OC 4UNVA 4FADA 2ICEA 3FDWA 4L4JA 3QORB 1E4KC 4XWGL 5IV2B 2ITDB 4K9JA 2WBJC 4H7VA 3VFPB 1KXVA 5AAMA 4NO0A 3TJEL 4G6FD 4GXVL 3QRGH 5DHDA 3FTVA 1FZJB 3KPNB 1QSFE 4LOUD 5EEZA 4ONFL 3ZTJG 1JGEA 2R2CA 3WHE1 1X4XA 3ZMRA 1XCQB 4KUCD 4N2OA 4WRLA 4KXZH 3VXSD 1KJVA 1OB1B 2P3YA 4L29B 4XOEA 3QCVL 1G1KA 2ISDA 1UT1A 3TYGL 1MHCB 4ADGA 1WIPA 1BJMA 2HAZA 2H26A 3D25B 1WGOA 4HIEB 4JGUA 3FRPG 3WG7B 4C4KO 5IB3A 4PW3A 2XRAL 5ALCL 1ZANH 4TNEA 1NQBA 2YRPA 3JYBA 4ICXA 2NY4D 3D9AH 2N0KA 4JZOA 3EFDL 4MVBC 1A64A 4YR6B 4N9GA 4HUCA 5TGBA 1NGWA 4MAYB 2CJSA 1P7BA 5D6DC 1CGYA 3O2VL 4GIPD 5BZDA 5C71A 1PYWA 2XIIA 5GGQH 4KDTA 2CCWA 4B3VA 5DA0B 4OLXL 3BPOB 1X9RA 4ZDHB 2VR9A 5DU7A 2VRKA 5D7LA 3MCKA 4Q0XL 5FUOL 2B20A 2HTLD 3K6OA 3NCYS 1QLRB 3UAFA 3L3KB 5BXFA 2VL5A 1Z5HA 3EYFB 4FFVD 2E8YA 4HMCA 4EDWL 2NSMA 5MERA 2EIKB 4KV5E 4ZFZA 3GPEA 1WWWX 5AFAA 1RZIB 4U7SA 3UP1A 1U2HA 4HIJA 5JW5A 4YFLI 1I7UA 1KN4L 2HT2D 1MSPA 2YUXA 3KGSA 4PRBB 3VTAA 1AQKH 1FQ9C 2VAAA 3FQ1A 4UQBA 1VFBB 2BNUB 5T1KA 4LVHB 5KVGL 4PJCA 3FN0L 1KIPB 1QLFA 2R83A 2X4PA 2NY5C 2XC8A 4WV1C 2GYSA 1ET8A 3BYTA 4PRID 2BP8A 4QRQA 4M6ML 1KGJA 2XV3A 3KGUA 4HKXA 5EIQA 3DJSA 3SEPA 5FIEA 1T0NA 1UM4L 1Q9OA 1O7DE 4KRPC 3SKMB 2XPGB 1CICD 4GBXA 1OAUH 2HLFC 4H4NA 4YX2L 3DETD 3O3AB 4Y16C 5LDSA 1E65A 3WNLA 2ICWI 1PBYA 1NC4A 1PJWA 2A6DB 4X7TA 3KJ4B 3TEYA 1D3CA 1T7VA 3II2A 1KACB 5HVGB 3K6FA 1E8YA 2XA3A 1JYNA 3BOVA 5IB2B 4HPYH 4RRPA 4CBPA 2KDYA 4PBDA 4OBSA 3VFUB 2QGEA 4LSQH 3MLZH 3NIGF 2Y36L 3FQTA 2C4FT 2WYZA 3PWPD 5DMGD 2P45B 2XVKA 5G4NA 1A3QA 2XT1B 1NGZA 2Z4QA 2X10A 2WUBH 1P1ZA 2DWDA 4TUOA 5E9AA 3P9MB 4S2SA 1L9OA 4MAYC 3VXQA 4DKEH 3MI6A 3CAFA 3SKMA 3SPVA 4NZDA 1MCBA 3F7PC 3V5HA 4GKNB 4MMZC 1TJXA 1COBA 1IU1A 1ZT1A 3T08A 4E2OA 4QY8B 5E2TH 3IXAA 5KS9B 4GI9A 1MLBA 1SYSB 2DWSA 4P9HL 3BZEA 1JTOA 3NJFA 2DZEA 3VXTA 3RPIA 5KVFL 2IH3A 3MMEA 5I1IL 3KNBB 2OP4L 1EUTA 1PYWB 4GMSH 1YEJL 1TMCB 2VJ0A 4IBQA 4OH2A 4P23D 3DSNB 2BDNL 3HRZB 3Q9QA 4TS6A 3SKNB 5FECB 4QKTA 3VD7A 3KLAB 4QHMA 3ME0B 2VAJA 4S1RH 5M94B 1T5WA 3PYCA 2B4CL 3RVXC 1VERA 2AKRB 4HJ1A 4Z6AT 1AHWA 3WKQA 4N90E 5J13C 3LKRA 3MO1A 2HPOA 1FE8H 1GGYA 2ICWA 2YOAA 3K8KA 2OXGA 4OCSH 4OZGB 5ACZB 5IHWA 2NZ9C 3IFPA 4Z7NE 1HILA 3WLBA 1N6QH 5HVHC 3OZKA 4M7JH 4ZNEA 3WIAA 2COVD 4FNLH 3S37L 4ODXB 2EVIA 4NENB 2E5EA 1CYXA 2QKSA 2VW6A 4IS6A 3FRUA 4P3CL 3S5LA 3S5YA 1P7HL 3GGWB 2ZAGA 4L2YA 5ESQB 4G83A 3VG0L 2ADJA 4XPGH 4E5XG 5AW3B 3I75A 3QJFB 4Q6KA 2V9RA 3HI6H 1FZJA 4S0SD 4TQIA 1MIML 4GRWF 3RNQA 4P5MA 4P4KA 2PWDA 5E00A 1KCLA 1I7ZB 3QFJB 3GRWH 1OLZA 1UWXH 4MB4A 4GAYA 4PFEA 3ZT5A 2RFXA 1CMOA 3FNKA 2R2EA 2Y7SA 3JV5A 4KC3B 2WZPD 4JDZA 4ETQB 1YNKL 4ZO7A 1EEZB 4M00A 5BJTA 2BRRL 3ULUC 3UDWC 2WXHA 1PJ9A 3VW3L 5GIRB 4JY5H 1FL3A 2O5ZL 1YUHB 5CM1A 4OGZA 2VH5L 5CHNA 2X88A 1JDCA 4LP5A 4KRMB 5ABDE 1NOFA 3HMWL 5E5UB 3W9EA 3WIHH 3LH8A 4NQQA 4X4XB 4HWBL 3MBXH 2J8UE 4PJ5D 4PREA 2X6MA 2NXZC 3FN9A 1GKEA 1NPJA 3TYFA 3VQLA 1G5GA 3C5JA 3W11C 3HE7D 2HN7B 4URKA 2PXYD 3PWNA 4GRLD 2YGPA 2QZQA 4N0FB 4MXQC 3MLYH 2DLFH 3CVCA 4DGIH 2IV8A 5DRZB 3N6YA 1I75A 4CKQA 2OK0L 3E6HA 2X87A 3EJCA 4KKBD 3R4RA 5I66A 3LVTA 3CPLA 4QXUL 1XGUB 4YHIB 3QIBC 4E9TA 5JMRA 3OGCA 1U8JA 1MCLA 4QXWA 3WFZA 3LS4L 3DX8B 3PV6B 4M6AA 1E28B 2UX6A 3GSVB 4MJJA 2JFCA 3CFJB 1FZKA 4KX7A 1T03L 4DOHE 3KWWA 4ZFOA 4QHKI 5C70A 3DX2A 4FQIH 4Z7QE 3CVHB 1BOGB 2PYEE 3BDYH 5I1DA 5EFIA 4PJCE 2BOCB 2X53A 5ISZA 3RWIB 1VGEL 4MCNA 4Y9EA 4CDGC 1J0IA 4XCFH 3FZUC 4CN1A 1A4AA 5SV4A 2R1YA 4Y5XA 5EEWA 1B0WA 5HJGA 4YDLB 4YSQA 3SE9H 3GMOA 1TJMA 2WVVA 4O02A 4JQIL 1NCWH 2AGJH 4FAAB 4MGXA 3D18B 3MV8D 3TO2A 3CDGB 5E1QA 4MHHI 3F7KA 4OJDH 4TKWA 4FG4A 4NN5C 4OF7A 4P2RA 1UCBH 4MAZA 1IT9H 4EQ3A 3TWCH 1LP9F 3QUMH 2ENSA 3EJZC 3BGMB 1U3HA 3QHFL 2WBKA 4S1QH 5EU6D 5IB4B 4J23A 4YL9A 4D3CL 3P3RA 1ET5A 4AZ8A 4LEOB 1INDH 1DQIA 3IGKA 2PP8A 5KAQG 5LAPA 1TTAA 2H8PA 2ZONA 4G7YL 1T83C 4MJ6A 1F45A 1AG0A 3OGCB 2PTTA 3EJUA 1WDAA 3DHUA 2FATL 3BFOA 3SPVB 4U3CA 2Y3AA 3ZHKA 4AL8L 1WAAE 3QFJD 4LLDB 4HUMB 2AI0H 3FFCA 4P9ML 4YBLC 5FW8A 3WTSA 4NUGL 4Y16D 1TTRA 4XPBL 4KOCA 1KLGB 2HLAA 2WMPB 5GGSB 1TPXB 1AXTL 4M7LH 5EBWB 3V6OE 1DVYA 1CFVH 4NCDA 5DO2C 3ZSSA 5HHOB 4JG5A 2FIRT 2ZWSA 4HCRA 3QI9A 3KXFE 3LHPL 4KQ4H 1XF4A 4KKRA 3U82B 2ZUYA 3WFHA 2V2XA 3U1PA 2WVVB 4O02B 3LNDA 2DEXX 5B38B 3BRGC 2ZUTA 3HAEB 4U6VH 2W92A 2OTPA 4MMXB 4PTTB 4H0GA 4NQTA 4U2YA 3QIUD 4OD3H 3ARTA 4BHUI 1A7RL 4ZXBA 3EJPA 1IVTA 1XBRA 5AW5B 1U93B 2WINA 3EH5B 4ZFOB 4NQDD 4DP7X 4QWWD 2QGCA 3SGJA 2D2CC 2BK8A 2F54D 3VFMA 5GGTL 2XTJD 5I15L 5F89B 2V7HA 4HUXB 4Q9BA 1ZT4A 1KBGH 2UWEB 1F11B 3MJWA 1T1XA 1TJIL 3D3VE 5DRWB 5IHZA 1DJYA 5FYJL 4DN4L 4HUVA 2QQLH 4Y89A 4OLZH 2NTFB 1FFNB 5F2FA 5I66B 3ZE1E 3AU1B 2CDEA 4PJ9B 2GJ6E 2VDQB 1NFDA 1WHOA 5CJOL 3X1GA 4BE6A 2B77A 1MG3C 1NDGA 1FYTA 2R4RH 4UOW1 1A2YB 2AQ2A 1ET7A 5IBTL 2OXGB 5JPNB 2WXRA 4L05A 4NC0B 2Q20A 5A6MA 3D34A 3JZ7A 1E6JH 1EEYA 2W38A 5I16A 3JV6A 3GNMH 2ZOTA 3FC8A 5DUBB 1FI8C 5BS0E 3MRCB 1A4CA 1BFOB 2W60A 4WWKB 4EZJA 3QAQA 1E5BA 4HUWA 4OF0A 1FRGH 3SPIA 4KFZC 3W2DH 3I9AA 1CDHA 4IW4C 5C8JB 4DUXA 2TSBA 1MF2L 2XXCB 3T1WA 4ADIA 3QAZB 1UZGA 1D5BB 1P4BL 3K6NA 3J27A 4PV8B 3DV6B 2RFXB 4NHCH 4B9CA 1A3LL 3PQYB 4YXHH 5CLWA 2X6VA 3BHBA 1H3XA 2N7AA 4HJSA 3IXAB 1LE9B 2H4EA 3LDBB 3OM3B 4IMLB 4L29A 5J4MA 4YDJA 5SWQA 5F88B 2A83A 4LLWB 2CIIA 3TA4D 3QXAA 3A4DA 2CO2A 1JPEA 3U6XA 2KKQA 2R69L 5IB4A 3JV4A 3TBSB 4DO4A 1KB5B 3VNYA 4X7EC 3BVNB 2V33A 2LV4A 3EUUA 4NO2B 3FHQA 4M7KL 4G7RB 2VZOA 5CU9A 3K4AA 2ADIB 1H3UA 2NY6D 4FI8A 1DUYB 2MWCA 4HCIA 4TNVK 3S4SA 5CZXD 3L1EA 3LQZB 3PWVB 4PP1D 2EINB 3T0EA 1PZ2A 2D9CA 3LN4A 3L4WA 1A47A 1I9RL 4TXVB 2UX7A 1F90H 3RWCA 3WSQL 1HVXA 5HYJB 3RLSA 3TEWA 3ABLB 2J8UF 5CEYA 3B7UX 1CR9H 1HKLL 4G5ZH 2XTJE 2P44B 4GQRA 2CRIA 3HG5A 3DO7A 1X6NA 2ARWA 4JKWA 4LEEA 4ZUSB 4APQA 1UH2A 2F54E 4Y1AA 4WENB 1E4XL 2O6EA 2RBLA 5BCAA 3ARBC 4IKIA 1A25A 1FDLH 4LZKA 1VEMA 4N8VB 5KBNC 1U0QA 5E94A 1MHHB 4M8QB 4NQSA 4OI9A 1DJZA 3A4FA 1OXYA 1MAKA 1MAMH 1UKSA 2P8MB 2RCSH 1FZKB 2G60L 3OTTA 1EBPA 3VXSA 2CHZA 2GJ6D 3U1SH 4MBRA 4NQDB 1BGXL 5BZXA 4DFHA 2RHEA 1I31A 3BQVA 4U1JA 1JJUA 4UDUB 3HB3D 5GRUL 4RGNE 2K70A 3IJHB 5MI0B 1DSYA 2Z31C 1KYOK 3BSZL 4XCNA 1YNTB 3RHWF 4XBGB 4K9EL 3GMNB 1E4HA 3N1GC 1SVCP 1WJ3A 4ZX4A 3WIFB 1JI2A 4P5KB 2ZT9C 3ZVVA 4ANXA 1NGQH 4OZFG 1OZUA 4ZTOL 5AZ2H 1PSKL 3BXNB 1QSED 2DJ4A 2J43A 3IM1A 3V6OA 4FF9A 4XTRC 1FFOB 1MFDL 4M1GH 4AH2B 4XOAA 3WDHA 1JTTA 2MPAH 2DBJA 5CAYB 3SOTA 2H5UA 2CA4A 4Z3EA 3QC5X 4R5VA 4YHKH 4YOKA 1YUHA 5KZCB 3QUXB 1KFAH 4ZQKA 1RFDL 4YHML 3GKWH 2BHFA 2ZSWB 4LCIH 4XCYB 3WEAA 3U7WH 5L88L 4JFFE 4HSCX 4NNPH 5CZRA 3ZTCC 2BXZA 4MA3A 3K8LA 3L1FA 4YLBA 1XGQB 1ACYL 1UACL 4QIRA 4Y8DC 4L9LB 2HKFH 3FU8A 1JZFA 3CSYA 4JG1H 4PW4A 1S6NA 1MY5A 3HNSH 2Q6WB 5L2JA 1GAFH 4N0UE 3QHTC 3QO1A 2DBLL 3WFDH 1NWOA 1AZRA 4KK5D 3O41B 3HN5A 2KC0A 4NGHH 4YSDA 5I2IA 3T65B 1DJWA 1FNEA 3A4AA 4RGMB 3DRTB 4KO5A 1WC7A 2Z93A 4KMTL 1UJ3B 3AS3A 3GRWA 1A4KA 1QYGH 5DFVC 3IJ9A 1RK0A 1R3KB 3K4DA 4E5XA 6FABH 4FXLA 4XXDB 1VAHA 4KTDL 3PGDB 1HSAB 1ZHBA 3B9VA 5T5NG 3TIDA 3EGDA 2R0LH 4OB5L 3KCWA 3MXVH 3O0LA 3BESR 3GI9L 4MJHA 1G7HB 3CHOA 5FYLE 4HPHA 2IWEA 2YZ1A 1WS8A 2YO3A 3QG7H 5CEXA 4PCSA 1CN4A 2NY3D 5E2UH 1HQ4B 1EWHA 2B9BA 3MJ9L 1ZLUK 5JHLH 1TZAA 1YEGH 3HBQA 1BXAA 1TCRA 3HC3L 4HCRL 3DURB 1M56B 3G7TA 4X4KA 4YC2B 3M17A 2NSXA 1HDMA 3CLFH 5C07D 2CDFB 3O8XB 1A6UL 2C34A 4JO1H 1NL0L 2NZ1A 2ZXDA 3IDIA 2OTUB 5F70A 4BSWB 2DMHA 4XT1C 3DBXA 3VSTA 2ZUWA 1CGSH 2CDEB 4PJEF 2IAMA 1S7VA 5DEGB 1ZHLA 4H0IA 3EBHA 1NBYA 1NCCL 2H9GA 4O5LL 4BIKA 2B2XL 1EZVY 1E6OH 1PKOA 2JE8A 3DX9A 3KWXA 4QRSB 3N85H 4XNXL 1OY3B 3IBEA 3AC0A 4NFCA 1KPRA 3ZHFA 3EADA 3RWEA 5HD8C 1T21A 5CJXC 5ID0B 2DMBA 3VFMB 4KH9A 4NQCA 1XGQA 3QEQE 4EIUA 4XMTA 5E8DL 1QTYT 2JJTC 4AQ1B 4DVBB 2V17L 5IB2A 1LQBC 3QB7C 2V7NA 4W4NA 3F84A 1ZJBA 1A6ZA 1O6SB 1B90A 1X5MA 2XJKA 4M1CC 4XBGA 3TBVA 2EVFA 3SDXB 4GG6E 1OCCB 1BMZA 3GB7B 4PJHA 5HP5A 4WI6A 3MROA 5E70A 4B0MM 4M3KB 4PJ5E 3FSZA 4OJFH 4U7MA 1XF5A 2PUQT 5DEFA 1BBJB 1YMHA 3IMBA 2WVSA 1J88A 2FWOB 1XF4B 2JI2A 2IALB 5D70H 5DMGC 1PVHA 2NY5H 3M88A 5GS1B 4NBXB 1D9KD 3UXFA 4Y4KA 5DD1H 4UIKL 2VOTA 3WIFA 4JY4B 4DTGH 3KWUA 4KI5F 1J1PL 4FQQB 3N40P 2PCFB 1U36A 2YUWA 4N2KA 4ZMYA 3Q8BA 5CF3A 4GP4B 4Y7MA 4PCTA 1DBMH 4RISL 3JWDC 4N85A 3L3HA 1ZEAL 4Q9RL 5FKAA 1ZLDA 2P42B 4HJUA 5HI5D 2A7BA 3L4XA 4WUKH 2JNZA 4LVOB 3CVIL 1H3GA 1CD0A 4MDJA 3U2IA 12E8L 4R97B 2AQ3A 2J55A 4MRBA 5HYJA 4K3HA 1BCIA 5GGUA 1J9SA 4KK6D 4PRPD 1WZMA 3THML 2EVHA 2XWBB 4G59C 5J11B 1GZPB 1OHQA 2FECI 4S1SL 1S3RA 2ZJSH 4YBQD 4M8UA 1J8RA 4YEEA 4GT0A 4I0CC 1KB5A 1ZDSA 2HJLB 4Y2DC 3WNOA 1S7XB 3S8GB 1BEXA 3WCYA 3L5WA 1BXVA 4F9PC 4LLQA 3UO1L 1UXSB 4OLVL 1I1FB 1MCQA 3WUWA 5DMKB 4LGRB 4UB0L 5SWSE 3NIGB 3SDAB 4JVUA 1HWWA 3GK8H 4ZFFA 3WS6C 4PV8A 1G87A 3FULA 3WLWC 1MH5B 1N64L 4H5SA 2L3BA 1CPUA 3E6HB 3OHXC 4JLRB 4WU5B 5HHMD 3NCWA 3EO9L 4LASL 3BJLA 1CFSB 2WLIB 3QZWB 3AVEA 1FC1A 3TF7C 3PWJB 3AXLA 3FU6A 4OAWB 2OAAA 2BMKB 2Z65C 4HLZH 2W07A 4GQ9H 3NDZE 1E28A 2MPVA 2NQ3A 3FQYA 4WUUB 5CLYA 2VYRE 2BY1A 5F1NB 3ZR5A 2AK4E 1TQCB 4NQCD 1BZ7A 2Y7OA 3HG1D 4Q6YA 4EJ1C 3WKML 5T1LB 5KVEE 3UTTD 3I6SA 3NCMA 4L1SA 4P57A 5E8OA 4Z78A 1NBZB 5KG9A 2QSCH 1DE4B 1OB0A 3UMNA 4OTXH 1XO8A 5B3SB 3C6LC 1GKOA 5F1SA 3TC9A 3RE0A 1W72A 3GWJA 3V6ZB 3MRFA 3UBGA 1PY4A 1BYNA 3ZHNA 2YPVH 5I1CH 2UZIH 2IADA 3QIBA 1AHKA 1AHWC 1SYVB 1X6LA 3NJVA 4U6HB 2D73A 2EDOA 2XWXA 4WU7A 3GSNA 1GL4B 1I9JL 3AY4A 5IVXE 2YOCA 4XB8A 3ULUH 1SOXA 4UV7L 3B56A 4HFUH 1TEFA 5FS5A 1RHHA 1FNSL 1KELH 2QGDA 3C8KB 3MUHL 3MV7D 2FSEA 3SOBH 4LLUB 1EUUA 1UEMA 4PTUB 3VX0A 3O8XA 1MFEH 1EO8L 1KIRB 1TQSA 3MC0A 4FA8A 4XN1A 4IHOB 3P4OA 4FCAA 1NCOA 1I1FA 1I9IH 4U3XA 3TTYA 3D09A 5A1AA 4GRMB 3S96B 4L5FL 3MV9B 3VCLA 2OYPA 2BZ7A 5GGSY 5K1JA 1U58B 3PE9A 2DL2A 1RJCA 2AQQA 5E5MB 5I9QC 1ZCRA 5KSBA 4Y8AA 3VWKC 3S6CA 3FUIA 1I8LA 4A63A 4ENED 5IZ7A 1K2DA 4QHUB 5I76A 1R3KA 3MTRA 1LNUB 1DHKA 1JWSB 3DX6A 2YWYA 3FB7A 3GMQB 2V8MA 4OIIL 5F7LB 3WFHB 5F9WB 1A6WH 4GO9A 1NSNH 4OFYD 1QEWA 1N5AB 4Z8FH 1FIEA 2GIYA 4MZRA 2AMUA 3WYRA 3S48A 2P80A 2O61A 4XNDA 4WJ5B 4Q4EA 4R8WL 4N5ED 3VH8B 1MCWW 32C2B 4LHUD 1NC4D 2WANA 3QQ9C 2ZXQA 1FFPA 3VI4E 1WCBB 4PRDA 2FO4A 1IM9B 4P2OC 3E3QE 3CCHA 1SXCA 2VC2B 2XTLA 3CZJA 4NIYE 3UYRL 4ALAL 1O75A 5IMKB 3O0RH 2K6WA 3KPRE 2IXQA 3VVVA 2IQ9L 5T1MA 2WPGA 4G80A 1D5RA 1MHEA 4XC3H 2YXFA 2VR3A 3QUYA 2KLSA 4LPWA 4Z0XA 2UZXB 1S5HA 2A1WH 1IAII 1MCPH 1QKZL 3QIWC 1SM3L 2QT6A 3KJ6L 4M4RB 4QHKJ 4XVSL 5GISH 3ZZQA 2HMID 3WNKA 1W80A 1JGDB 1MI5B 2NLJB 3NN8B 5HJ3A 3AT0A 2NY0B 3UFIA 4ZUVB 4TULL 2V7NB 2OYLA 3RJDA 4A68A 1LO0H 1EIBA 3DI2B 3RL1B 3VGAB 2CALA 2XWBA 2VMCA 1BD2A 4OCMC 3MGOA 5TF1H 1YJDC 4LGPB 3UO8B 1HL8A 4X80H 5ANME 4EOWL 4PB9H 1K8IA 4JB9H 2FZ3B 2ZOWA 3T0EE 4XWOD 1LP9B 1DJIA 4X9GA 1A65A 3HS9A 1KLUB 1WAEA 2OI9C 1LMKA 5JW3L 2HVBA 1KCKA 3AREB 1F6FB 2YJLA 1IBYA 3MLWL 1TLKA 3DO3A 3MDJA 1UXWB 3CVHA 4FYTA 2JB6A 1EAQA 3GTNA 3Q06A 3T9WA 1VADA 3M17B 3R1GH 2YD7A 2J6EL 1IAIM 1KIUB 4NZTH 1JSYA 1TTFA 4Y4FA 4WWNA 3KS0H 4WHYG 3VFWB 3H54A 3K1DA 4M4PA 2MQCA 5F7EL 1RIHL 1UD2A 2KLTA 3UZQA 4WF7A 1MLCA 1RULH 1JERA 3H2PA 4ZD3H 2XNAB 4M3JA 4XXWA 3JWDL 1TZ8A 4JW3A 4ZPVA 1CB4A 3ZDXB 1FGVH 4YE0A 1TQTA 1EEZA 3X11A 1UM6L 3SDYL 4F37K 2CLZB 5K39A 1ZVSA 4FQJL 3BT0A 3GMMB 3C5ZC 4Y1AD 1TQVA 2O6PA 1IBZA 1OTSD 2ZTBA 3HE6A 4K23H 1JWUA 1N18A 3CC5A 1KJVB 1OB1A 1UH3A 3E9TA 4R7DA 5IUSA 4GOSA 4UT6L 2WVTA 3HZKB 2E76C 3QNYA 3OC8A 5J6HA 5D1XC 5CP7B 1WO2A 2H9GB 3QCUH 4AJVA 1NCBH 4B9FA 1X7QB 1KGXA 4UUJB 2UVFA 2OMUB 4BFBD 4ODVL 2VZVA 5E99L 3U46A 1IRAY 3NK4A 5GRXG 1R3HB 1FL6A 8FABB 1USQA 2K9UA 5DRNA 3ZL1A 5BZWB 1IJNA 3FSOA 5GJSL 4M43H 2VDRL 1ZVSB 4POYA 5C3IA 3S88L 3FHEA 3BAXA 3EGSB 3LD8C 4MDIA 4YGVB 2Q7YA 3ESUF 5EN3A 2APBA 3U4BH 1ZY9A 5JHAA 3FOMA 2WYTA 1BEYH 3L1OH 1MCCA 2B5IB 4HS6B 3KCPA 1FHNA 3ZMEA 1GHFL 2WXQA 4OY9A 3VI3F 5DUJA 2VUYA 4HJJH 3V0GA 5HDQH 2EDDA 5A2IH 2HFGL 3ERXA 1NCHA 5E4OA 2EDHA 1GZQB 1SBSH 5BVJB 5CJQH 3IDNB 3VFVA 4HC1A 3SQBA 1DJHA 3WAJA 5FR3A 5F3HA 1QP1A 1QFWH 1IEHA 4LVNC 5LQBL 4NJAH 3FRPB 4Y7OC 4HVBA 3W0WD 1OGTA 1HEHC 3MODH 4YXLH 2OKMA 3AMLA 5JIMA 1OTTC 2X5PA 4MAYD 5IGXL 4PJBF 4CADA 3AM8A 4YPGA 1AC6A 1MJUL 3FYEB 5HI5C 3PAYA 1OAXH 4NKDB 4F7CB 4BSVB 4X8GA 4OFIA 3PXJA 5GS0C 2R27A 1BQLL 1FVEB 2JJSA 3HR5B 1HL4A 1JHKH 4K3JH 4PWHA 1V7MH 2ZOKB 3C5ZB 3O6LH 3P2BA 4HZAA 3ARED 1U8PA 3CDYA 3MBEA 3IAQA 2K3TA 1OPOA 3KE0A 1QSZA 4QY8A 5KS9A 3L17A 2R15A 1YNLH 1KF9B 1N67A 5D7LE 4FQLL 2EYSB 5B21A 3OAZH 3UMTA 4N28A 3VD4A 4FP8L 4ODUA 3ARRA 2VMEA 4GW5A 3VRJA 1YYML 4H13C 4FLQA 4Z7QF 2W8CA 3IU4L 4QDGA 4ZW8A 3RZCC 1PAMA 1KB9K 1A6ZB 1O6SA 4HUNB 3L2NA 5LLIC 3WFBL 5GGVL 4KXBA 1F4AA 5F71A 1KPUA 5CXPA 5F6HJ 4C56A 4PGCA 1TEYA 3TZVC 2J8UB 3EBAA 3T0EB 3NFSL 3RWFA 1B2WL 1ZHKB 2QHRL 2HT2C 4HC1L 1FIGH 1J9RA 5C9JA 3MVSA 3T6VA 4DKAA 1OM9A 3LV3B 5EF3A 1EXUB 2DM7A 2B9AA 4IJ3C 1RZFL 2J8OA 5CIPA 5IESL 3S35L 4R9HA 3F00A 2KZ1B 5EU6A 2MQ3A 4YQXL 3MNDA 4JG0H 1V5JA 3CZUB 2BERA 2BOBA 4ZAKB 1R33A 2KL6A 5EF1A 2I7SA 4UT9H 1HZKA 1CUOA 1QLRA 1NCAL 1ZXKA 4LSVH 4NKIL 5I5RA 4Z7WB 1MPAH 4N0CC 1MIEH 3N1QC 2CDFA 2X4PB 1YN7A 3H85A 2XN9D 2G5BA 2C8NA 4OV5A 4NT6B 2YEZB 4RZKA 5E9DB 2ADGA 3RAJL 4UMSA 5FYKD 4CAGA 5DJ0A 4CSPA 1KLFA 4EDXB 1HHHB 1QABA 1MREL 3AQDA 4JRFA 1Z1WA 2GBAA 4YDKL 2IH1B 2CD0A 3R8QA 5BVJA 3OD3A 3UGUA 3OKYA 4H8VA 1J7VR 1K4CA 2K8QA 3LKNB 3BUYB 2MNWA 4PJ8B 3FN3A 4WEBH 4P3WA 3EGDB 2NCEA 5BRZE 1IAOA 4ONGL 2APTA 4A67A 2Q7NA 1ND0B 2K1MA 3AABA 4XBEH 2F74B 2EEBA 2ZWYA 4XNZB 1JHLH 3QISA 3B9KD 2OW6A 4QRPA 1TSRA 3O6ML 4WTZA 1T4KB 4DSYA 4W1TA 1FWXA 3RU8H 5CR1A 2FBRA 3IDGB 4AENB 4F7TA 2DYPB 4UINL 5K93A 4D8PB 4U2ZA 1X5LA 2DEYX 3OR6B 5MEND 4IYKA 1BQSA 1H5BC 2EDBA 2Z64C 3SJVE 1P5UC 5DHYA 1DBAL 5I1GH 2XQYA 3QIUA 3UCQA 2J20A 1M7DB 5FHAH 4XCCH 4GAJL 3EO1A 4CVXB 2QQNH 4APXA 1JK9B 1QO3A 2A6KA 2X89A 2ZYIA 2ZKXA 4IRZA 4U1SA 3C87A 4A2GA 1F3RB 1L4IA 4RWYL 5D1QD 4AEEA 1RU9L 2GCYB 3BAWA 1NLDH 1KXHA 5TE7L 4AMKH 3OKEA 4XP4L 1I3GL 1PX3A 2NY1B 2WXMA 4QOKA 2DPKA 2FLMA 2V5YA 2YHGA 4N1EA 4WO4B 2WBWB 4JPIA 1T66C 2HLFD 5T1LA 3C5JB 1V3MA 3J07A 1WFNA 2J5LC 3EYQD 1WWBX 3EDJA 5HGAA 4TNVF 4WI8A 3HN8A 2VLJB 3IJ7A 4Z95H 1KIUA 2H0JA 4OLYL 4EUPG 2NDGA 4Y1TA 9PCYA 4HQQL 1MCIA 3ARFB 5DHVH 4WO4A 3H9SB 1PY0A 1PU0A 3OMNB 5HHMB 1PMYA 3WFCL 2R29L 3EJTA 4PJ8C 2EUXA 5JHDD 1RVFL 4J3SA 5EIIA 1CCZA 4F5CE 1OGAB 5D1QC 4PJ5B 4B60A 3A21A 1Q94A 4JDZB 5CCJA 1MCEA 1E30A 3DMMA 4L8SC 4WFGE 5I6XB 1IGFL 3V0VB 5DJXB 5DHXB 1IBBA 3FFDA 3SY0A 4G8GD 5BVPL 4BZ2A 3OQRA 4IGBA 3LEVH 5HHOE 1WWAX 2I25N 3RFZA 3Q2LA 1ZHNB 2PCPB 4G8FB 4PJEB 4ZK8A 2XICA 2Y5QA 3L5IA 4U4IA 1QUPA 3FT3A 3K6DA 3PHAA 5AW0B 3FAXA 3OR6A 1BAGA 4I3SL 4LEXL 1N7ML 5C08E 2EXSA 3MCLL 1T0OA 3ZSTA 2FX9L 4X5LA 3FU7A 2P5WD 3MRKB 4FFZL 2ZUUA 4J7RA 4UQ3A 5BO1L 3HVDA 4HETA 5I1JL 2FB4L 3AROA 5DURB 1B9KA 4BDVB 4FFWC 4JANA 4MNGB 2K78A 1HZHH 1MWAH 3M8OL 5B1CA 2NUTB 2E86A 2CKNA 5EU4A 1AGEA 3VDCA 4NQUA 5JNYA 3GQFA 3CQFA 1C16B 3IJYB 3L54A 4BK8A 3LKNA 1IJ9A 4BGLA 4N8CH 1NMCB 4OUUB 5EDSA 5INDA 2EO7A 5C0CE 3RA7H 3U4EB 3VD5A 4TPRL 1WZAA 3SE8L 4BWWA 3IN0A 2JI3A 3MJ7B 1KENL 5IROC 2O61B 4KDVA 3RVTC 2EYTB 3GMPB 1OM3H 4JL2A 5LAXB 2WBJA 3QNZA 3RBGA 3FB5B 3ZL2A 2Z92B 1ED3A 3HG4A 5D6CB 3OQ3B 5FUCC 3EJSA 4QD2E 6CGTA 1TOXA 4JHWL 1J1OH 5EU6B 3CIQA 2VJ8A 4DAGL 4HK3N 2ZAHA 1W91A 2B1AL 1I8AA 3T0VA 1KBBA 2CJTA 1JF6A 3EJRA 3K81A 3QXWA 3MQIA 1NMBH 1RZQA 4FQQA 5D1QB 3U0PA 1N10A 2CGYA 4WHYH 3P11L 4V11A 1Q38A 2D4FA 2C9PA 3UYPA 3S97C 5TDNA 1AS8A 3Q6GL 3E8VA 4FQCL 4NAMA 4XR8C 5HPMB 1A6AB 1NC2D 3KPMA 1LDSA 4L8SA 3MJ6A 3LRGA 1F4WL 1IBFA 2H45A 1G9MC 1EHLL 2PMZA 3CDFA 3OKMA 2EYSA 4DP4X 3WXWL 2YMXL 4HS8L 5IMMA 5CBEA 5C0CD 3QUMA 2CKBH 5HHME 1BYPA 1VJSA 2BCMA 3GIZL 4YBHA 5IMOB 3FQUB 1GW0A 2CLRA 4C56E 3VFRA 4G8FA 3FU9A 3TL5A 3LNEA 4N90D 4K73A 5DR5L 5BW7C 3D50A 1Z3GH 5IW3A 2DLEA 2RALA 1BWMA 1AQ8A 2ZCHL 4U1LA 5DD5L 3QIUB 2JCCB 1NGXB 4JJ5B 4HXAH 1QNZH 3VTTA 1OGAA 4F80A 1DSFL 1U8OA 2HH0L 5JIHA 5HDWA 4H1LB 1O9ZA 4J28A 4XN2A 5D7KD 1S7UA 2KERA 1E7VA 2DWEB 2HN7A 5AW9B 4GO8A 5H2BB 3CFBB 3HG2A 4ANVA 2Y7MA 5F3HB 4X5RA 1FNGB 2CGRH 2W9DH 2KUTA 3MO1B 4PG2A 5IREA 3MRLB 5ITFB 1M3JA 2AXJA 1AIFA 1RIUH 1ND0A 2WZ0A 4NUQA 4Q9CA 2NOYA 2O72A 3WJMB 1PCXA 4EI5B 4NI6A 3F58L 2R4SH 1EXHA 1XF3A 3LIZL 3CMGA 4MQ7B 1K4CB 1DJGA 1R19A 2DQFB 2K3HA 1ADQL 3U0PB 4HDIB 3QZMA 4KMQA 1UG9A 5I74C 4I5BA 4X9YA 1QTPA 2NX5D 4OGXL 4FNSA 3IPBA 2VL4A 2Q2EB 5IEHA 4L4VE 1ORQA 3H56A 2AJVH 4NS0A 2BIHA 4UU9B 4EUPA 4P49A 3IDUA 5K9OB 4L8DB 1HU8A 4K55A 1Z0MA 2ADJB 4HIIB 5SWSB 4LKXB 4AVJA 4B27A 1RZ7H 1AGFB 2D3VA 3QA3A 2IJ0C 4LK4A 2B08A 3V52H 1JYVA 4UQ2B 4WGKA 1R5VB 1OF2B 1QVOB 4LOEA 4G6JL 1J12A 4F8OA 3T4YA 2X1PA 3EHBC 3WNPA 3INOA 1CFQB 3BJ91 3FJTA 5MP6H 1SMDA 3CUPA 3IFPB 4AKQA 2VDOL 2YEVB 1CGWA 2Z91A 2XZAL 3AXIA 3TFKC 5LHDA 1DEEB 2VITB 3Q6FA 2ZG2A 4GMTH 1JVLA 3MOBH 1DDHB 3C6LA 1OO2A 1DQQA 3T3PB 1TETH 2XBTA 4V33A 5C0BD 4IBYA 3PCYA 4LRNL 2IDQA 3MRKA 2HTKC 1G7PB 2BWQA 2KQNA 3L5XL 4PP2B 4DN3H 3F83A 3BMVA 3DGGA 4F3FB 2YLHA 4U4BA 1J8HB 4E42A 1DL7L 2I24N 5MENE 2J1YA 4OR1A 2EZ0D 5HYJD 5TE4H 1QBMH 1P4LA 1A9VA 3UL4A 4XVJL 3ML9A 5T33H 2FJSA 2EIZA 2Y1ZA 5T1KB 4YDIL 1A0QH 3DBSA 3JBG7 4NQSB 4N26A 3GSVA 2IALA 5IY5B 5HHPA 3RZCA 2VLLA 3O4LE 2G3XA 1FVEA 4Y4KD 4EI5C 1YYCA 1L0QA 2XCMC 4NAQA 2AEIT 2OM5A 4WDIA 4YHIA 1WUNT 5DMIH 2Y6SD 5DZAA 5T3ZL 2DQDL 3ARGC 2X70A 3VXQB 3V5DB 3SE3C 3K74B 2WLLA 2DIJA 1OCWH 2FLBT 1ASPA 3BVXA 4DH2A 4CU7A 4S0HA 3FRPA 4CMHC 2K45A 2ICEC 5IFHL 4D7BA 2DRUA 5F9WC 4ZFGH 3IE4A 3TA3B 1RV6X 2Q5BA 3ZKXC 3A6CH 2MRYA 1FO0A 4LVNB 4D9RD 3T4YB 3KH3A 5J06A 1NIAA 2PNDA 1UGKA 3GXDA 3Q3GA 4G6AC 4D0BA 1BLNB 2V4LA 5ERWB 1G7LA 3K6SA 3F2LA 3NJJA 4OT1L 1F6LL 1XZ0A 2C7FA 5AVVB 1QNIA 1EJFA 3D0AA 3WUWG 4G7VH 3ARPA 3D0VA 2OFQA 5JHMA 3CSPA 3LPOA 2CH8A 2D3LA 1UOWA 3Q8AA 1N0LB 4NDMA 1EDHA 4FLOA 4QOKD 3NCJH 4Z76B 3LKQB 3QP3A 3CHRA 4NO5A 3VGBA 4TQHA 1AXSB 1MRDH 2H0EA 3SD2A 1JV5A 3DOIA 1ZLEA 4M5YH 3QUKA 4FTVA 1T21B 5ID0A 1D5BA 3KLHD 1PZAA 1IAIL 5JOPE 1OAKH 4TNFA 2DQFA 1EDQA 1L9MA 2GABA 3JV4B 4MVBD 1INQA 4X8CA 4DKFH 4ZUUA 5A3ID 4IJTA 4K94C 3O6FB 3P3TA 2OMWA 2ZSVB 4O2CA 3EO0A 1T04B 2J88H 2Y69B 5C09A 4QT5A 3I6KB 3A67L 4E5XB 4PLKD 3QIBD 15C8L 3KW7A 1YPZA 2BSTB 3CXDL 4CC4C 3KPPA 2I69A 3TO4C 3CH1B 4N2DA 2AABL 4FQ1L 4J2QA 3MAWA 2VABB 1DBJL 2N0MA 3ROOA 5IR1B 2G9HB 4ZMLA 4ENZA 2I5YL 2TAAA 4IOIA 3IAGC 1KYUA 1RUPL 1U3ZA 4GNKB 3ZDXF 5JZ7C 2JIXD 2DQEH 3VXME 2EKJA 4JO2H 1GOGA 4LCWB 3W11D 2BCKA 4ZZFA 4N8UA 3BWSA 1S7SB 1WZ1L 2AXFA 3T2PA 4NZUL 3PGDA 1KXTA 2DWXA 3LRMA 1HWHB 3DX4A 3F7YB 5K9KB 2H2SC 5L2KE 1G6RH 2DMCA 2FHBA 4EDXA 1N12A 4AUUA 5C0IB 2QBWA 5CEZL 1F58H 4NERA 2WTOA 3EFFB 4KAQH 4J3XA 2JKTM 4NN7B 4NZRL 4X99B 4G43A 2A99A 4PWEA 4QRPE 2WXIA 4FQ2H 4ACPA 2PW2A 3ATAA 2FUQA 4ZO6A 4ES8A 4HUVB 4KV5F 1YMMB 1CLOH 2ZP9A 3MOAL 4X9BA 3O3BA 5EHFA 3QNYB 3RI5F 1NM4A 1P1ZB 3SPCA 4J8RA 3WIIL 1KSRA 3F6LA 3R8BB 2VQUA 2O5XH 3V0FA 1BLNA 3CSYB 3X1BA 1UEYA 2BLFA 1ZAGA 2OXHA 1R3JB 1PZ3A 1MQ8A 5K59F 2LVCA 1SEBB 2DYPD 4N22A 5K39B 3AU0A 2ZWZA 3RG1C 3VI3B 2YGOA 4XO9A 4IKJA 3GUFA 5DLML 4ZTPL 3FBKA 4RAUB 4M9PA 1L3WA 3O11B 1BZOA 1KOAA 2EEFA 2NY2D 2OR9H 4U49A 3VG9C 4K7PH 3BRDA 2UZXA 1DN0A 2ZX8A 4GG8B 5T1DH 4AGPA 1GTNA 4MJ6B 4PI2A 2X09A 5HVFB 3VFNA 1FPTH 1FO0B 5JDJA 2W07B 1JD9A 3CFDB 5T5FA 4Q2ZB 4DP6X 4F8LA 2DQJH 3QE5A 4L18A 1TSHA 1JGUH 2MOGA 3I9GL 2B5IC 3ES6A 4U3HA 3U0WL 4ETYA 1AZBA 1MHPH 5GZNC 4JFEA 5AVRB 4NB7A 1A66A 4UOJA 2XN2A 4A6YB 1KCVL 4IDJL 2OCCB 4Z3TA 4N2HA 1HESA 1SDYA 3SD5A 2E74C 3H2WA 4HIHB 4Y5YC 3WN5A 4YZWA 3QQ4A 4YWGL 4AW7A 3DX0A 1DJSA 2I60L 3GSNL 5DSCB 3WTUA 2WWNA 3FT4B 3QUHA 2MIZA 4FL4C 4WI3A 5ESVA 5IFAH 4JO3L 2VDQL 5I18L 1QBLL 4FQXB 3IVKA 1R4XA 1K6QL 2VDRB 1QLEB 2VR7A 5K1VA 1FCGA 4XNQB 2D7TL 4J5VA 2A74C 2P5WA 4Z7QB 3ZGIA 4ZX6A 3VRLE 3PLYA 4XCEA 2XACC 3GXUB 3GBNH 1IC5L 1WT5A 4N2FA 1MQKH 3NIFB 4W9GC 5KSBF 2VXQA 3C8HA 4LT7A 2FBOJ 2Y72A 1XGTB 1QFUL 4ZOBA 3D2TA 2Z91B 3H2QA 3PHSA 4RMQA 2XKNA 4XODA 5D4QA 4YAQA 7FABH 3PWPB 4F27A 1XWVA 5AW7B 2GK2A 4OM1L 4KROD 3PNWA 2KHAA 2L8AA 3CMOH 3DRQA 3RWIA 4QOKE 2GT9A 3RX5A 3WE1A 3BPLB 1CXKA 5J1AA 1C08A 2NY4C 1W0WA 4PMFA 1QA9A 2EEDA 4JCWA 1HINL 5FCUL 5DURD 5E1AA 1OANA 1QLEL 3GO1L 4FABL 3FONB 3MRCA 2ZNXA 4P07A 3L4YA 1EO7A 3AMKA 3HI5L 3OSKA 1QWHA 1R34A 3U0TA 5BNXD 3F7LA 4MWFB 1KMGA 1A8JH 2GSGB 3B83A 4MA7L 4B6ZA 4Z7OB 1E2WA 2CHXA 2OZ4L 3LS5L 3TBYA 1LM8V 3CC1A 3IFLH 1TKWA 1QQDA 3ARWA 1E7UA 3PABA 3SDXA 2DL9A 5IK3A 2YBRA 3L2MA 3FHAA 4NBYB 5D72H 1CF8H 4ZYKB 4A6YL 1NMCC 2R1XA 3B3IA 4GKSB 3HMXL 2WXKA 4ETQA 3QWNA 3QFJE 3D39E 1F11A 1KFGA 1AIFB 1Q72H 4EIGB 3UTTB 4KVNH 1P4IL 4JHVA 4M8VA 3O45B 4F15C 5IOPA 5I8OL 4DETA 5CHNB 2WXGA 2EDTA 1EXGA 1Y0LA 5EU3A 3VFRB 5C92A 5A6IA 3US0A 2R56H 4I0KA 3S5LB 3QDAA 3RWHA 1RUAH 1JCVA 2O30A 4JO4H 1A9BB 5TE6H 4NUPA 4GG6B 4D8PA 2E47A 3DBXB 2ORBL 4FKKA 1FBIH 2FBJH 5FYKL 4HUKB 4WTWA 5KJRH 1EMTL 3EFFA 4RFOL 2CK0H 5JUEL 2WGXA 1U8MA 1JS4A 2KBGA 3S8FB 2FL5B 1Z9MA 1YQVH 4MD4B 3TVMA 5FPIA 3G6JE 5IOKA 2LLLA 2XVLA 5FM5M 3A22A 3G5VB 4JDTH 4N2IA 4X4ZA 2F74A 5CEXB 5HHNA 4Z7VF 2VXVL 2VXSL 3LQMA 4I18A 4KK9C 5EBLA 4PWIA 2DDQL 2ALAA 4NENA 3O4LD 3FCTB 2IPKB 5CN2A 4FQXD 4PTTA 1UXMA 2BH0A 1MFAL 2NXYB 2UZYB 3KR3H 3IDGA 4AENA 4F7TB 2V0AA 2BVPB 2ADGB 3NEXA 4LAQH 1K5NB 5IMLB 3BE1L 2MTPA 4JR9L 2CHWA 5AQ0A 2Z1PA 4WTXA 2EICA 1XGYL 3G6AB 2YARA 4P2RD 1JFQH 1NAMA 2N59A 3LNHA 4GRLB 4LOUC 4POUB 2L7UA 4TQ8A 1IAOB 3JQOB 3CFMA 2DN7A 3KBFA 1J1XH 1IM9A 1UFGA 4G6AD 3RY6C 1SEQH 3PWJA 2FCBA 5EV7A 1TUPA 1OQXA 4Q56A 3AG1B 1ZLWK 2Q8AH 4WO4C 4BH8A 3BAIA 4NHUB 3QJSB 1KC5H 4OCYL 5AVSB 4QRRA 5C9JB 3VH8A 4YBQC 4OCWH 4LU5L 4NO5B 4KY1L 4XTRD 2YPLB 4NFBA 1U8IA 5DC2A 3MRDB 4KROC 5JO5B 2BOBB 1BVLA 1P6WA 3AJ7A 1RLWA 4N87A 2IWGA 3C09B 3TBTB 5ITBL 3QDME 4F33B 4DNLA 5GS2H 2IDFA 1HXMA 1IM9D 1MW0A 3P4MA 1A7PL 4FX5A 3X1NA 4XZUB 5C7XL 5F7AA 1J5HA 4PBWD 1WBXA 1UTDA 3OB0K 3BKCH 1BYOA 3MUZ1 2A5UA 2XWRA 2WNGA 4FG2A 3TJHC 4EN3C 1I1CA 1TR7A 4AG4H 1PX4A 5GGRB 3X12B 2ODIA 3SE4A 3BP5A 1R3JA 3Q48A 4AEFA 4P46C 5IF0B 5EOQL 2J4WH 4HUUA 3EYOA 1J5DA 1HH9B 5SWSD 5E8NA 1GXEA 4G6KH 4Z18A 4HIJB 5DWPA 2ENPA 3CFKB 1CDUA 4LSRL 4U3SB 3VRJB 1BPVA 4AWJC 1E4XI 3KVQA 4LSPL 2VDPH 5D7JD 5FDYA 1BA9A 2OMBA 3OKNA 1N6VA 5FK9A 1UWGH 5KOVC 3KXFB 3FB6A 4JKLA 1OP3H 1MEXH 3M86A 1OPGH 5KYYB 1J11A 1C1EH 3MXWH 4YHPA 1SN5A 5GJTL 4Y9BA 1D7DA 2HT4D 1KJ3L 3FQRB 4MMYA 4JVPA 4L3AA 3NUKA 2IFGA 2VM9A 4BA0A 3VXRD 4K7PX 3KLDA 3BUIA 2C3XA 4MRCA 1IKOP 1D6VL 5GSRB 1MFCL 4Z23A 5EBMA 5KSBE 3LMJL 3CNKA 5JIKA 4APQB 4HJ0D 3WNNA 2QV4A 2OJ1A 3O4LA 4YO0A 1FL3B 5KVDL 3VFOB 4ES9A 3G5YB 4X2UA 5KW9H 4YPJA 1S8DB 4PJDB 4ENEC 3N42B 4KQ0A 4UTAA 1W72H 2WXJA 5IJKA 2AEPH 4NWTL 1JBJA 1B4TA 1S9YB 2RMNA 1I8IB 4GKLA 3SDDC 1IV8A 2EILB 2JJSC 2D7MA 4X4YA 1N19A 3BAKA 4P5MB 2O5YH 3OJ2C 3FCUB 2IANB 2A9NL 4BZ1L 2Z35A 5HJBA 3IDYC 4O2FA 3TPUB 3SYPA 4FQHA 2AQTA 5J6GB 2MHAB 5DXWA 5LGJB 3LN9A 1BFVL 3EDDA 4JZOB 3H4FA 3L95A 2WW8A 3PHOA 4FMKA 3R0NA 3BUPA 5DC4B 1RSFA 4BFJA 3FUDA 3AG2B 1XH1A 2FEEI 1F3JB 1Q9WA 3NABL 1MJJA 2VO5A 1AJ7H 2WKOA 2MTAA 5T3XL 4CDHA 3T4AA 2ICEB 2Q0ZX 5F1IA 4JRYB 1MJ7L 2VDOB 4HGWA 4FYQA 1AXIB 3HUJE 4ZOEA 1FO0H 1YEKL 3BIKA 1SJHB 4IMKA 1I9EA 3HCVB 3S35X 2BPBA 4R4BB 4FFYH 4M61A 2IAMC 1CIUA 2XNAA 3KYNA 1JGEB 4PJFE 3FQWB 2XZZA 1BBDL 3T8XA 2P5WE 3LYRA 3OV6A 5F93C 3SJVB 2X1WL 2V5RA 5BRZB 4IOIB 4XAWH 2WSDA 2AJYH 3VXPA 3H6AA 1D5ZA 3IF1B 1IEBB 5E9NA 2NT0A 4JPKH 2EH7H 2XA8L 4NEHB 4RFNB 1HT6A 4Z7WA 3Q7JA 1IGMH 3HZYB 1JF1B 1UA6L 1U33A 5JXEC 4J4PC 1FV1A 4UYQA 5FKAB 2NTFA 3MUGB 3UIZA 1CD9B 2O4EA 4F57H 5ACLA 2DIBA 3T0XA 3U7YH 4U1LB 3ZXAC 1KCBA 5KBLA 1CGXA 1R0AH 2ADFH 1MFBH 2F18A 3MLVH 3LV3A 4GI6A 4AKPA 1HHIA 4LPYA 4LQFH 3WD5L 1VKXA 1S5IH 3S5ZA 1T89C 1JV5B 2O6CA 5TFSH 2GTZA 1Z9LA 2IQAA 3HHSB 3S36H 1J5OL 1A21A 3G6DL 1DBKL 1T4WA 1QHOA 4G11A 5I1KH 1ASQA 3QHZL 1I1AB 1G6RB 1IIIA 4X6BB 3V5HB 1D5MA 1UVQB 3GLEA 3TTSA 4X5WA 5GGTA 4A7VA 2GSMB 4PJXB 5CILH 3QZNA 1TJHL 4OLUH 5SX5K 3SDXE 1RJZA 2ROXA 4LIQL 2FTAA 3AS2A 3SO3C 2A9BA 2NY2C 2VXTH 4WO0A 1BVLB 4HAFA 2EE3A 1OAYL 2HRLA 1M9WA 4IRJB 4K7FA 1DZBA 5CMAB 1F8TH 1XB3A 3O9WD 3QI9B 3US1A 3IFNH 4OCXH 2EH8H 1C5DB 1D5IH 2JV6A 5D71H 5DD0H 1NFDF 3HIZA 4G42A 5FUZL 2BSEA 2VLME 4P2AA 1KPUB 1WCBA 4M1DH 1E9OB 2XZQL 3B2UC 1C7TA 3NK3A 1SOSA 1YMMD 2ZYHA 4DK6A 4UM8A 5EOCL 5DJCA 5LN4A 1UWEL 4FNUA 1JGLH 1E67A 1ZLSH 1KWKA 3FTGB 1MHEB 5E6UB 4J27A 3U4KA 1N5AA 3ROLA 2OMZB 4O2EA 1AFVL 3HE7A 1QSFD 4NWUH 2L04A 4HD5A 4LNRB 1HSBA 5JQ6L 3LIZA 1CTMA 1REIA 4DO6A 1GMEA 2Q7AA 2YPVA 4AZ8B 2RACA 3LRKA 1JRHH 3CVDA 1WISA 1A3RH 1L3NA 5D8JL 4B7LA 1NIFA 3C5XA 3CFQA 1DJXA 4YSAA 3H42H 3EOAB 3FZUD 1RZJL 1VHPA 5C0CA 3D5OF 3UCRA 1KJ2H 2Z7YA 1M4KA 2UUDH 4TN9A 1FLRL 3CFCH 5TD4A 2Y07L 3EGXB 4KWUA 4NLAA 1YEIL 3VQ2C 2UY6A 3FOMB 2PP7A 1ITCA 4OZ4B 4S11A 1ZE3C 4F7KA 2OL3L 5KANI 4BDVA 1PFCA 3TIEB 1LILA 4OSUL 1ZKAA 3EH3B 4R26L 3LN4B 4TVPH 1OAJA 1NGPH 1BQ5A 1J48A 4PJ8D 3IAPA 2G4EA 1GC1H 4PV9B 4YE4L 3N50A 3DPBA 1LHZA 3RWHB 2A38A 3UJJH 2PCYA 1VEOA 4QHLA 3FUEA 2QHLA 3CHQA 3WY1A 4FJZA 35C8L 4IIZA 1QTSA 3CZEA 3QDGB 2IANA 2ZQKA 4MDIB 1SBBA 2NXZD 2OCFD 4LMQI 3BHBB 5MENB 2WSKA 4AMXA 2GAZA 4FQXC 4PS3A 1CZ8L 1L6PA 4IBZA 4TUJA 3IMTA 5DUPH 1V55B 4HAKA 4NC2B 4N0FA 2EACA 3QJRB 5AW2B 4POZC 4AM0B 1I1AD 4YMPA 1SF3A 3HFMH 3ZUCA 1YEEH 5I75C 1DEDA 3I9PA 5EZIL 2Y6TE 5I8CA 4FXKC 3FO2B 4XP9H 3ARDD 5CR8A 4CVZA 4BKLA 3PP3H 4JN1H 3NTCH 4TVSa 3DNKA 1U2CA 4MX7A 4PS7A 4I77H 3HFML 4JFDE 4IRJD 1N5YL 5I8KH 3BEVA 3U30B 3I6GB 5L0QC 4PCYA 3ARGA 1DQMH 1UXLA 3WV0A 3DGCR 2VQ4A 2HG5A 2XIDA 3BKMH 1AYRA 5AEAA 3R7RA 5FM5O 3ZRCC 2ITFA 4P5RA 2E3VA 4B9YA 2Q8BL 4AYGA 2BOLA 1Y6NR 2F58L 3KLQA 1SHSA 2A6KB 4N86A 2DD8H 2JCCF 5C07B 4LLQB 4J3OG 2J8HA 1XVSA 3CU7A 1AO7B 5FB8B 5HHQA 3U6XS 3KYOA 3LD8B 4YHPB 3WDIA 3OXSB 5IW6B 4LSUH 1P4LB 4AYFA 5IMOA 1VZGA 1BF2A 3ULSA 4BFKA 3AWEA 5EBGA 1TPXC 3LKSA 4UTBH 1OV8A 3B5TA 3FCSB 1HILB 3WLBB 1YDPB 3RVTD 3MR9B 3UPCA 3MBEC 2UY7B 1E43A 1HFUA 2VRAA 1MN4A 3N06B 2P5EB 3B6SA 2AITA 5TPWL 2DM3A 4LVEA 3BFQG 3UYPB 2CBMA 3RB7A 1I82A 2HWZL 1QZ1A 1VPOH 2Y07H 2FWUA 1S7RB 4B9IA 2YEQA 4CW1B 3MYJA 4LPVA 2EEAA 3W0WE 1JGDA 1MI5A 2AJXL 2NLJA 3GS4A 3NN8A 1RKRA 3I74A 5DWUL 3BUTA 3DUSA 3ARBB 4U1NB 4Q9QL 4AGLA 5KVEH 4L48A 2J73A 4WW1B 5I5IA 3ZL4H 1JRHL 3POHA 1LE5B 3IJEB 1JL8A 4I4WA 1IM3B 2EJ1A 5KVDE 4X7SL 4HXBL 5CJXA 2VC2H 2G0KA 1AFVH 4ZODA 2J72A 3B9KC 3HVNA 1NEPA 5CU5A 1T6WA 3SKJL 2YA0A 2AAAA 1AI1H 4JFYB 3P40A 1K72A 4L0ZA 5BUPA 5C0GB 1RUKH 1WBYB 3LKPB 3TBVB 1SMOA 4IBUA 3CZSA 4MLSA 3BT2L 1PEZA 3NOIA 3UJIH 1XF3B 5F21B 3TP4A 1MCOH 4GSRA 4WJ5A 4DP9X 4PQXA 4M1DL 1JZJA 1KEML 5D7JA 5EMYA 4L3CB 3T3PF 1DTUA 2VERA 1T5KA 3B2XA 3PG2A 4E9QA 2CM5A 1IEAB 3HHMA 5CD3A 4NQXA 1YLBB 4I89A 4ODWA 4YN3A 2BRQA 4AEHH 3SPHA 4KDTC 3P1VA 4OGAD 4G7SB 2H6PB 5CUSL 3WMPA 4ABVA 4YBLB 1OSZA 4LLAA 1WK0A 3BKJL 5KSBB 3B2VL 3EAKA 1FFNA 5CBAA 3EYVA 1SEBA 3QHZH 3UAEA 4NRYB 4JM2C 3QJOA 3BVTA 2C3HA 1T2XA 2ILLA 5E8EB 2PTUA 1J5OH 1Q9KB 4MXVE 3SBPA 4JKPL 3KYKH 1YYLL 1KDJA 5D1ZD 1LO4L 1S5IL 1E4WL 2VSCA 3H1ZA 2WLKA 3V0JA 5ADPL 1N70A 3GHBH 3GSOB 2GJJA 2GW5A 3C09C 2YGNA 1EANA 1R75A 1AO7D 4ODXA 2R59A 4ALAC 1J5CA 4QO1B 3O4OC 1F4XL 4FMVA 1DQTA 2MOQA 4G43B 1JD7A 1RJLB 5AVUB 1OP5H 2WQSA 4OLEA 3A6BH 5TK4A 4BH7B 3GSNB 4RGMC 2LAAA 2P43B 3DVGA 1BZ7B 1PPIA 4ANUA 5I1LB 3CIAA 1N0XL 1FG9C 2Y7NA 1AR1D 3QS3A 1EZUA 5T1LD 5B39A 4CBZA 3MRGB 4W9EC 4ABQA 1ZVYA 1BZ8A 2NR6D 3KPOB 5D7JB 4LP4A 3HA0A 4YHOH 3LB6D 1QFOA 2OYMA 5JYMA 3GIVA 5DZ9A 4JPSA 1FZOA 1MVUB 5HVWA 5HPOA 3QZWA 1CGVA 1W15A 2LVEA 1CK0L 1CS6A 1JPGB 4GEJA 4HX1B 5IHHA 3Q9PA 1YJDL 3MBED 1CFTB 1IBDA 2YMTA 3NFNA 4MD5A 2J1XA 1FO0L 2YAOA 2ZPKH 1IGCL 3GINA 3GJFH 3O3DA 4M6NH 2ZXEB 5EOCJ 5KJ4A 2Z9TA 1ZA6A 3SDCB 4TSBL 3LKQA 1R3HA 2WO4A 3S34L 4WK4B 3PGFH 4MJ4A 3Q1SH 5C0FB 3O3UN 3A6OA 3P54A 2YFNA 4JDEA 1KGWA 5FM4A 3SQOL 1FORH 4OV6F 4P2YA 5KSAD 5DT1L 5E6SB 1E3ZA 4L4VD 2P8PA 4J4PA 5I6MA 5L2KA 2AJZA 5D5ME 2J5WA 4BM7A 1M2OA 1ZHKA 5A2AA 2ZUQB 1ZS8B 2IDUA 1T4KA 1U30A 4KJPC 3F6JA 4NDMB 5DGRA 2AEPL 1GJWA 5D4JA 2CMRL 4XX1E 3N43B 4JANB 2CPCA 3QCTH 4MNGA 4ZRGA 1DVUA 2JIXA 4R3SA 3GMOB 2I07A 4XWOC 1TYJA 3ME0A 4AGNA 3G5ZB 4GW5B 3GRGA 4PGDA 5LKNA 4U1JB 2BSRA 1KB5H 2X9XA 4Y2LA 2FHCA 5E08H 1Q0XL 4IKLA 1YEHH 5HHPB 3BXNA 1JZ6A 3I50L 3QORC 4JREB 3SBWA 4AKOA 4W6WB 3QXDB 5ALBL 3ASOB 1TVBA 1NCJA 2X6UA 3P3SA 1HSBB 5CCKH 3ECBB 2DQHH 2P48B 4RBPH 2QADC 1BZ9B 4O00A 5IQ7L 2COQA 1HI6A 5I6PA 2PXYA 3IFOB 4LRIC 1TJGH 2QLVB 1E50A 2FX8H 3VDBA 1F0LA 5KYUB 3LSOA 4AQ8C 5JIPA 4QXGL 4ZUSA 1DN2A 4YXKL 1OAQH 4FFYA 4YHZL 2FWSA 4UTAL 1MFMA 1XEDA 1DQQB 4LSRH 3VXUB 1IGTB 4PLOB 1OL0A 3MLTB 3ASWA 3E3QC 3VFUA 3BP5B 1ES0B 3BCFA 4H26A 4Y88A 3RBSA 3H7BB 1M6OA 4PGCB 4UT7H 4AQEB 2ATPB 4XPTL 3WKYA 1C5BH 1TU2B 2Y4SA 5L2KB 3H9ZA 1YEHL 3GSWA 5E08L 3OX8B 4EKJA 3HFFA 1AR1B 4YHYB 4M62H 4OF8A 1T7ZA 3U79A 3C6SB 3T77A 2DKMA 4GSXA 5BOZG 2CBQA 4YDJB 2QSQA 4GB9A 4WKZA 5DRXB 1H0DA 5EUOB 5J13B 2P7TB 4BUGA 2FJGA 4MXWH 3MV8A 2F5AH 4MFHA 3PDGA 5F9JA 2JLPA 4NQEE 2OXHB 1U8CA 2CUMA 4OCWL 2O93L 1CICA 5EO1A 5IG7B 2AK1H 1BP3B 2VN5A 3BSHA 3V4PB 4OCYH 5B38G 3PL6C 5B7FA 5L4JA 2DQTH 2ATKB 4G5AA 1OD9A 3ULAB 5DFTA 4NAJA 2W95A 2D03L 2XV6B 3Q5TA 3N91A 3IDXH 2NT1A 2DICA 4QXVA 4AQ8A 5ITFA 4J4PD 3ZTNL 1UASA 1G43A 2Y1AA 3CFTA 4HH9A 3P69A 5I73C 1SQ2N 4IRJC 4YS4A 1D5ZB 5I24A 1CFNB 4R90L 3MHZA 4TUUA 2FX7L 3ZKXB 3K72A 2G75A 4N0UB 4HHAB 4XBMA 5H8DA 5BZDB 4W4OC 5ICUA 4BK4A 3OZ9L 5KSVA 3NIFF 4ZMQA 4B97A 4PJDF 1E5UI 1YN6B 3R18A 1UZ6F 5FFOA 4J3WA 1QACA 2MKLC 3KPSE 2DQGL 1YAIA 4R96B 5GGRY 4GUPA 2BC4A 4WW2C 1KTBA 2B4CC 3NMEA 4QJ5B 4ZS7L 4URTB 5ANMA 5JPNA 4JRYA 3VFGL 1ZTXL 1AXSA 1ACZA 3TH4T 4KNUA 4EUPH 3D4YA 4KX8A 4BQ9A 4H1LA 5CBAB 5JUEH 4HSQA 4LNVA 1M42A 3A6BL 2H1PL 4QT5B 1KTDB 1ZOXA 1KBVA 4L1HA 1ZPLA 2G5RA 4YHYC 2ORBH 1F4XH 3MLSH 1DCEA 1KCRH 4J3OH 3QWOB 4Y19B 2MHAA 4MMZB 1KJ2A 3VD2A 4U6HA 1HOEA 2R56L 3D6GA 2C9AA 4N2CA 1FA4A 4PWGA 1A8ZA 1JNNH 4R97C 3VXMA 5HGHB 1E4WH 3C6EA 1LO4H 4JKMA 2AS5M 3H6JA 5DVNA 4MNHB 1KEGH 1AD0B 3V6BR 3MV8B 5DJZA 1GOHA 4PB0H 3BPCB 3VACA 3AADB 1XCTA 4HU8A 4MAUH 1EDYA 3NEOA 1AGDB 3GMNA 3B2VH 1RZKC 5IK3B 4A6YH 5D72L 1N8ZB 5IVNA 4JPVH 3VWKB 4XC1L 3HLAA 3VSUA 1HJBC 4J12A 5CUSH 2Z0BA 3QDGD 3RWJA 4DK3A 3K6SB 5I0WA 4JQVC 2VLJE 4FNTA 2EAEA 3IJSB 3GUTB 3HBZA 3VE0B 3IMUA 1RUQH 1A14H 2QJDA 2V9UA 4KXCA 5FKPA 3F12A 4LLMA 3AXLB 3TGXA 3DSFH 4P5KA 2X4TA 1F13A 5FCUH 2FT7A 1VFUA 3ZDZE 3DUSB 4OGYL 1HINH 1FGNL 3G3LA 4U1NA 4X7CC 5E94B 4BRJA 1AMYA 1YUKB 4PWFA 2BM3A 4ODTL 5F9OH 4BFRA 4PJBA 2E8ZA 2FH8A 3GKZA 5EU5B 3HAEG 5F8RC 2ICCA 1WIUA 5EC1B 2BNRD 3BC9A 4OCRH 5JOFB 4Y16B 1NC2A 1AI1L 1X9LA 4BK5C 1ZTXE 2WN2A 2PTTB 3N1MC 3ALXA 4KJYB 4DGWC 4UBDC 3FB5A 1DQDL 2WWMD 3U9UA 2EDXA 3P0VH 4PS4L 2EC9U 3EF4A 3GJFB 3DKHA 3Q8CA 1G1YA 3IWVA 4M7LT 3ZL4L 3GBNL 5KVEL 1P84K 4IU3B 4B53A 4F7PB 1T2JA 4HGMA 4KJWD 4NIKB 4Q9QH 3V7AE 4FCHA 5D7EA 3SZ6A 5PAZA 1URIA 3B9KA 1IX2A 1VPOL 4L37B 2QPUA 3B1TA 3GBML 5GHWL 3H9HB 5CJBA 3GPSA 3VYOA 1CICC 2X4SA 1AO7A 2CXGA 3APNA 5IVZB 2WK2A 4Y4FC 5LGHL 5JO5A 1E8WA 3MA9H 1F41A 3D39D 1WEJH 4XNBA 2Q3ZA 2V2WB 3GSNH 4PRHA 1A5FH 4DP1X 2H32B 3ZE0B 4NNXB 3STLA 2IC2A 3DYPA 1INEL 4FEMA 1E5YA 3HC4L 1HX0A 1MHCA 1OGSA 3PWUA 3ARGB 4IDJH 3CJJA 4JFFD 4JFEB 1MCNA 4D0CA 1I8LC 1L0XA 4TYUA 5IFJA 3NA9H 2Y7QA 4MB3A 1G9NC 2VDNL 4MCMA 3V0IA 3QJXA 3TPUA 5JHDA 1SYVA 3CFJA 5JXAH 4IMLA 1KBPA 1CTOA 1J0ZA 2Y1YA 4LB8A 5DQJB 1NUDA 3IXTB 1W6LA 1W72B 5MEOB 2ZWLT 1CL7L 5C09E 3HE7C 3GMMA 2Q8BH 1QSEE 1GPOH 1OP5K 4F5CA 2AFNA 1LO2L 1DQJB 2ZKWA 3WTXA 3RQ3A 4N2EA 5B4MD 3S36X 4AXWA 2RA1A 2FO8A 3WJJA 5HI4D 5CKAA 1EZLA 3D2UB 5EUKA 1QQDB 3PABB 4QJ4B 5E5RB 1IGIH 2ZF9A 1P7KA 4WUUE 4PHZA 2Y0SA 3MRGA 5F96H 2V7HB 2OMYA 5HY9A 4JZNB 4EXKA 3MRLA 3WS6A 5I1AA 3P3UA 2G30A 5LGYA 1L7TL 3P4OB 3I75B 1NOLA 2D0FA 4MBOA 4ERSH 5E1AB 4JFZL 3O3BB 1Z2KA 4LKCB 5E7BA 3MNVB 3ILEA 2FQGA 3SCMD 4Q4IA 3H3BC 3WE6A 3C8KA 4JFTA 2GT9B 1YECH 3BKYL 4UM9A 4Z3IA 1R3LB 1CLZL 3MRHA 1AP2B 1W8NA 3QDMB 4JL1A 4LLYB 1F18A 4G8GA 4WNQB 1MKFA 4B7IA 4LHQB 4YAQB 3GI8H 1EX0A 3GSXA 4ODWB 5LXGH 4YSSA 1F58L 3RNQB 3ZHLA 2C5DC 3GRBA 1OOAA 3KPMB 4JQXC 1HN1A 3BN3B 4YHLL 4MNQA 4WNJA 1KXTB 2J1WA 4F91B 2BWDA 3MLXH 2WBJD 3NVQA 1RZ8B 35C8H 4L37A 4DPAX 4MKTA 1S78D 2VLKE 4OD1H 3BGFC 3DHPA 25C8L 5EBWA 2AV7A 2GJZB 3C9NB 3NPSB 4PV9A 4TRPH 3P4NA 4PGBA 2E7MA 4YE4H 5FA3A 1QAWA 2Z7UA 1GC1L 1T6VN 1T7YA 4F33A 3FUMA 4Y2DD 3WNJA 2AJSL 2BHUA 3BKYH 4AY0A 4GINA 1TF4A 1IL1B 15C8H 4M6OL 4F2MA 1V54B 2OL3H 1TVHB 4S10A 2C1PA 3DVIA 3G6JF 4BUHA 3EGXA 2X4UB 4FXKA 1GYUA 1NMAH 3X3FH 4LEOA 1S9WB 3DJRA 2C3VB 1W0WB 4P46D 1X5GA 4PRAB 1OP9A 2XZCH 5CGYC 5BZZA 5IJCC 2HLAB 2WMPA 4JFPB 4LL1A 3P02A 5F96L 4RSYA 2PETA 4G2AA 3W57A 3O4OB 2R0KH 2R51A 4WLCA 1A3RL 2W9LA 3JWOL 1IAIH 5D8JH 5DUMH 3LNGA 2YAFA 4JFED 4QRTA 3VTMA 4FXKB 1MRDL 3QO0B 3BH9B 3T1FB 5F7YC 5E4AA 4AYEC 3IN2A 1SFDA 3H8NA 4RAVB 3WHXB 3D8MA 2NNFA 2QQKL 4P4KC 3GTVA 4E9LA 3T3PE 4TUOB 2GSIA 3VWKA 1X44A 3B1UA 3MRQA 3MRRB 5DLLA 2ZCKH 2WTPA 2P5WB 4TNGA 1QSFA 4EO5A 3SDDD 5A2CA 5C97A 2BY2A 1GZPA 2VXQH 4RX4A 2BW5A 5EO0A 5FYJE 2YUZA 4G9FA 4ONOA 5K69A 1D5IL 4G70B 2VLRD 1S46A 3Q2NA 3ZE0E 3CDGA 2LGNA 3GEWB 4AYBA 3HC4H 5FLVA 3DX8A 3PV6A 4KMLB 3GHEL 3EH2A 5FM8A 1E0OB 2EIBA 1A5FL 2QELA 2Y06H 3BGFB 5AAWA 3L3HB 1FJ1B 4FXGC 2B59B 5JOFA 5E2VH 3MUGA 1EEQA 4WDIB 3NPSC 1HCFX 4NJ9L 5EZLA 4PJXE 1RK7A 5F7DB 5IJDC 4JN2B 4XI5D 1OKEA 5DMIL 3OG6B 2L0DA 3M1OA 4RH4A 1CL7I 5CWSB 4EF3A 5FO8B 5I1KL 2N56A 4DKDC 1PD1A 3ZO0A 4N3UA 2CXKA 5BQDA 5JMOC 1L9SA 4BBWA 4U6YB 3MV11 3SGDI 4P06A 3OAYK 2PWEA 3W1ZA 1QHQA 3LRSA 1GZQA 5TE4L 2EKSB 4R7NA 1BMGA 2JJUA 3C2SA 3MLVL 1LO5B 2ARJB 1ZTMA 4RMWA 4FZEL 2I9LA 3KXFD 4PS4H 4PP2A 3ULVH 4MMXC 4RMVA 4IKKA 3V6FA 2FRGP 5KSVB 1DQDH