5EEXA

Radiation damage to the trap-rna complex: dose (dwd) 9.02 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
molecule keywords Transcription attenuation protein MtrB
molecule tags Rna binding protein
source organism Geobacillus stearothermophilus
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eexA00
4B27A 5EEUA 5EEYA 3ZZSA 2EXTA 5EEXA 2ZP8A 5EF2A 2EXSA 1C9SA 2ZCZA 5EEWA 5EF0A 3ZZQA 5EF3A 1QAWA 3ZZLA 3ZTEA 5EEZA 5EEVA 1GTNA 5EF1A 2ZP9A 2ZD0A 1UTDA 3AQDA 1GTFA 1WAPA
chains in the Genus database with same CATH superfamily
5IFJA 4IJ3B 4H40A 3P9WB 4OD1L 4PJAB 3QNZB 2OQJB 4Y1AA 4KPHL 4MQ7A 3U7YH 4ODVL 2W0PA 2LU7A 4PIRF 2FL5A 1OTTC 5AZEH 2ZCHH 1PF3A 4U1NB 1SXZA 2WWKT 4JRXE 2DZEA 1URIA 2EIJB 3GSNB 2WLKA 3SDCC 2W07B 3LHAA 1DQLH 5KJ7E 1ZHLA 3B2DC 3MRCB 1QATA 2DWYA 3BSGA 4PVBA 5IJVB 2E76C 2A99A 4WI6A 5E08L 1TSRA 3GJFH 1IGIH 2Y7MA 4XPBH 3PJLA 2VR7A 4TUJA 1UXSB 4L0ZA 3BAYA 5HPMA 1JZ5A 1UHVA 3PQYE 1FYTE 4HDIB 2VN5A 3V0GA 1A6PA 3B3BA 5FR3A 1HHKA 3PWUB 1P7KA 4BUHA 2FGZA 1T1WB 4Q6YA 4AUYA 3JZYA 1W15A 3EJTA 1E5AA 4QXUH 4G9FB 3NCEB 3GJEB 1BZ9B 2YD0A 4PR5A 3LEVH 1JPST 3C5JA 2ZONA 4F7PB 5IB5A 4YX2H 3UC2A 3QS2A 4ZFFA 5MERA 4FXLA 2NZ9C 4HQQL 3KYMB 4APQB 4YXHL 2GEEA 3FF8A 3FQ4A 3BMVA 4JDTH 4JRXB 5D2LF 4JVPA 5E94B 4DESA 3GUTB 3JTTB 4L2LA 2YD9A 1T2XA 2I5YH 3F83A 3A6OA 4RGMB 2X42A 4BZ1H 3QEQD 3HMXL 1FE8L 1HX0A 3I6KA 2E27L 5I75B 3TA4D 1J0YA 1V27A 1E67A 1OP3K 2P80D 1NSNH 1BIIA 2F54E 4HALA 3TBTA 3IJSA 3QQ3A 4KKLD 1YLBB 3HG5A 4AG4L 2NQDA 4QRRD 4U6YB 4ODHH 4DEPB 5CBEB 2JQAA 3O41A 2B15A 5CEZE 1SLVA 5F6IB 3PQYB 1AOZA 5CEYA 4AEIL 1MCOH 1GSKA 1MFAH 4MAYB 2OZ4H 1NEZA 4GO9A 4QWWD 1NCDH 2YLHA 4RLDA 2VWEE 2WVVB 5FXCH 2PYFB 4ORZC 2OMXA 5FUOH 4GLRH 5AB2A 3GSXB 4N1EA 2YJQA 1OP5H 3RWFB 3QUKB 3VH8G 2JJSC 3U7YL 2CBQA 4LSPL 4X4KA 4FA6A 5BXFB 4Y2DD 3U2SB 1XSKA 1YY8B 1AI1H 2C4FT 4F8LA 3S97C 2VLKE 3HMWH 1RK0B 3DVIA 5IJKC 1DQLL 2UUDK 3FULA 4L5FH 5CCKH 4LLDA 5DEGA 3QBTB 4HWNA 3LZRA 4YIQB 3GMLB 4N1HB 2F54B 2PW1A 5E70A 2C3XA 4XPBL 3AM8C 2YARA 3LEYH 3M6DA 3QR1A 1CLCA 4PJGE 5DMKB 2IBGA 3LS4H 3N04A 2WXMA 5E2UH 4MD0B 4MNHB 4B27A 5DHEA 1J48A 3CVCA 4GIAA 1KZYA 1NGZB 3B6SA 3D07A 5D2NC 4ZUVB 3UTSD 1YEJH 4EZMA 4QXUL 5T3XD 5ACZA 2RQEA 1HE7A 1YMHB 2ZE0A 5FDWB 3LEVL 3DDGA 3SBWA 1RZ8A 2OI9B 3VH8A 4GRWE 1F3DH 4BZYA 4DIXA 5JHMA 1R3HA 2OMZA 1CGXA 1MCNA 4YX2L 4CNIA 4ZPTA 3DX7A 2MMXA 1B9ZA 1CF1A 4M43L 3HG1D 4OZHF 1Q9OB 1Y07A 1A3ZA 5G2NA 3MJ7A 4JDTL 2ITDA 4WSJA 3LN4B 2W9EH 2QSQA 1B3IA 2VLKB 4ZT1A 5IB1A 1K8DA 3ZMRA 2H47C 3GXUB 3L2MA 4BZ1L 3IE4A 3VMOA 3AQXA 3LD8B 1A1MA 1NSNL 2EDMA 4MMXB 4OAWA 5EBWB 1QBMH 1AGFA 2WC7A 3QH3B 2IQAA 4NN5B 5D93C 1YYLH 4ODHL 3V0VA 1IFHH 4ZO8A 5E24E 3CVHH 4PJGB 2IFGA 3WNIA 3ZZLA 3MJWA 2HG5B 4P8QA 1JWSA 5IJDC 3ARYA 2WBXA 1MCOL 1MFAL 1NH6A 2OZ4L 3I2CL 5BW7A 3BZFA 1C08B 2CA4A 2MQ0A 2BHZA 1CDYA 4HMCA 5ACMA 5FW7A 3CFDB 5I0DA 1CGVA 4LLMA 3OGOE 5FUOL 1X9RA 2A9MH 1JD7A 3ZOAA 1DVXA 2R27A 3MKKA 4ADJA 1PZ3A 3KMDA 5A2AA 5HXMA 4GRWB 1ZHNA 1RLWA 1FRGH 3P9MA 4I87A 1CD1A 2ITCB 5I18L 4PTUA 1AI1L 5JTWA 1P5UA 2FCBA 1NCAH 2V9QA 4HUUB 5HGHB 3HMWL 2BRRH 3FOLA 2VQ1A 5E8PA 3DK2A 5F9OH 3SYOA 2CLVB 2VSKB 5CCKL 1XGPB 3H7LA 4L5FL 1V54B 3RVWC 3IGAB 3JT0A 4FG0A 3W11D 1VA9A 1SM3L 4PRBA 1TO5A 2ZXDA 3U0TA 1DQQB 3TV8A 5L2KA 3EH3B 3BT2H 2Y3AA 5EO1B 1AHMA 1CB4A 5DHXB 3FUMA 3LS4L 3ARRA 5E2UL 4FG6C 1DVFC 5IMMB 3DVNA 3KPQA 1LILA 2AEIT 2NX5D 1XF2A 2XJKA 4HPOL 5IMOB 5LDSA 3ATBA 4FD0A 2R29A 4N8PA 4HV8A 5EORH 1YEJL 4GMSH 1S9XA 3KPNA 4OZIA 5LB1A 1A6WH 2H6PA 3LAFA 2O61B 5DA4A 5ESVB 4MA8H 1S9YA 3CU1A 1AZBA 1WICA 1ZV9A 2V5MA 1AMXA 3GMRB 4MCMA 1E5YA 2VE6A 4FQXA 1KNOA 1DHKA 2EKSA 3MV9E 1AD0A 2W9EL 4QF1A 4JFXB 4EI5B 1CE1H 1QKZL 1U2HA 1K5NB 4ACTA 1QQDB 5AYQA 4XCEB 5I1KH 3KS0J 1P53A 2EYSA 3MRIA 2ZWNA 1XSJA 4X5RA 4GIPD 5F7DB 2BC4B 1QBML 3FB8B 4PJ9C 4HLZH 3S48A 5KSAB 4HUVA 2OYLA 5A2BA 1YYLL 4LESA 4O2FA 1IFHL 3CTTA 3CVHL 1CCZA 1OK0A 1XQ4A 3D5OF 3WIFB 3C6SA 3WS6C 3C2AH 3IU3B 2B1HH 4JM2D 5HHMD 3FSWA 3T2NH 4Q97A 5FLVA 1I4FA 3DV6B 5JDJA 4JZNA 4FQ2H 1HK6A 4Z3HA 1TKWB 1U3HA 3DJTA 2MQ3A 2IDUA 3INOA 3TPUA 2I07A 2IEPA 4LEBA 4PN6A 4AV5A 4D2NA 2N1TE 3ARFA 4BELD 1E5BA 2FEEL 4LP4A 1EAQA 1JWMA 7PCYA 2OKMA 2ZYHA 1RJYB 3LEXB 3QR0A 4P5TA 1LE5B 1FRGL 4WW1B 4MB1A 3L95A 5I9QB 1HSBB 4XO4A 1DANU 1NCAL 2XNAB 2IOIA 1RVFH 3M7FB 1G7HA 1X5IA 2EDRA 4M8VA 5E4EC 5F9OL 1WV7T 1HQ4A 3MNZB 5CGTA 4Y5XB 3AITA 2Y2WA 1PZCA 3HFMH 4KC3B 5F7WC 1L0PA 2HUEA 5E8EA 1CI5A 3R0NA 1MQ8A 2HX9A 2P45B 3AY2A 3KPLA 3BT2L 4B7LA 1BFVH 3HG2A 2YAEA 4YHOH 4Q52A 2P5EA 4W4NA 2WYTA 1ZAGA 1HWHB 2NY4B 2HFEB 3KLKA 2I85A 1GZHA 3C6LA 1FH5H 1IFRA 3IMBA 3KPOA 5T1KB 2CXKA 1VB9A 1JVLA 3RWEB 4HSCX 1PX4A 2UZPA 1NCCH 4U1JA 4AVIA 2CWRA 1NM4A 1WC7A 1NL0L 5F7FA 5EORL 5KYXA 3ULVD 4DNLA 5ABAA 4FS0A 2EH7H 4GMSL 5KG9A 3IT8D 3L2LA 4NUMA 1A6WL 3LRKA 2WN2A 3LNDA 3DHJA 4MA8L 3MGAA 2WXLA 4HG4J 1NGYA 1DBJH 4HJEA 3AACA 1U8NA 5H35A 3U9UB 3Q2VA 3IAQA 3WY3A 2I9LB 4WWKA 4JFHD 4QRAA 4P0DA 3S88H 4R6UA 4OQTA 2Z92B 1P2CB 1CE1L 3BLKA 3DX3A 4POUB 2Y7QB 4AUJA 5C0CD 1EH9A 2O5ZH 3V4VL 3POCA 1F58L 2LU4A 5I1KL 3V4LA 3SY0A 4OIBA 1W72H 3L4CA 1RKRA 5AW3B 1A9VA 2E8ZA 1NJ9A 1T1ZA 4RGND 4K7FB 4YDLB 1KBBA 3FOMB 2C7UA 3IM1A 4GI6A 1FDLH 2FJSA 1KCKA 4KJYB 4TNGA 3HE6A 4U1LA 3KLSA 5GIRA 4ODBD 2EO9A 3C2AL 1DQDH 1I85C 2B1HL 3KHOA 3FKUS 1ZLUK 4Z3EA 3T2NL 1MZYA 2BMKA 5IR1A 3L3GA 4FQ2L 4ICXA 4WNSA 4WQOA 4JFFA 2NXZD 4P23B 1OTSC 3C5SB 1QEWB 5FO2A 2BVPA 4OM0H 3BWSA 1MFNA 2OX5B 4WO4C 4X98A 2APFA 2DQFA 3MMEB 5TGBB 4B41A 4E9QA 3ALWA 3L16A 1A2YB 5I6LA 5C0JB 1OGAA 4I7ZC 1NAML 4AL8C 4DKFL 3FQUA 4LCYA 4Y5VA 1IUZA 1MHCB 1ZK9A 2VT0A 4DKEH 3FMGH 2WLIA 1QRNA 2Q86A 4HK0A 1NUGA 2R56H 4RA0C 3WL9A 3HFML 3ATDA 3CZNA 5FYKD 3WCYA 3IJEA 2NY2B 2VZVA 4FXGC 3KZ8A 1BFVL 2QGBA 4YHOL 2WP3O 2V2XA 4GRLC 4I18A 4A7VA 3UTQB 1IGJA 4N2MA 4A2EA 2WINA 4H26B 3DMMC 4P5SA 3S35X 5J8OA 1TFHA 2LQRA 4M03A 1NCCL 5I8EA 4XNBA 4JPIB 3L4XA 1NQBA 2EH7L 3ROLB 4FNSA 5JHDA 3RGVD 1TQVA 2YSSB 4HEPA 1AD9A 5A43C 2W91A 1DBJL 1T5XA 3ZKXC 3SE8L 5JOFA 2V5YA 1UVQB 1NCOA 1P7QB 3QIUC 4DOHB 2BNUA 1E7VA 3BPOB 2PO6D 1KC5H 4X6BA 3TIDA 1M7DB 3S88L 4CW1A 5I16A 1TJIH 1A6UL 2Z7YA 1WHOA 2O5ZL 4L8SC 3RDTD 1OLLA 1BD2A 4XVUC 5LGYA 4H25B 1W72L 3MRGA 4H2AA 1EVTC 3BIAX 4JFPB 4FEMA 4DFIA 2OMWB 3PWNB 2DI8A 4UTBH 1OGSA 1FDLL 3ROOB 4IS6B 2P1YA 4BCZA 4MJ5B 5AOKA 4XBGB 1P1ZA 2Q8BH 4QRPE 1VADA 3PGCB 1DQDL 4U2YA 3VRLE 1GGYA 5K69A 3FL7A 4ZOAA 2XWDA 3N44B 2APVA 4XX5A 1I7RA 2JK5B 3MRPB 5D7IA 4HCGA 5BVJB 4NAMA 4OM0L 4PMEA 5GGUA 4DEUA 3FHQA 1QO3B 4IHOA 2W5PA 4JKPH 4G9DB 5A2CA 4K7PY 1K4DA 4R7VA 4X8GA 4FLOA 1QVOB 1KN4L 1JWUB 2WLZA 3PP4H 3QXDA 1G4MA 2IAMB 3O3DA 4LLUA 4Z3JA 3TT3H 1U8QA 4Y9EA 4ELME 1LE9A 1DUYB 1FAIH 1R5VA 4DKEL 2ERJC 2GJ6D 1T1YB 4NBXB 3QIBC 3CFIC 1HXYA 3FMGL 4JREC 3EJCA 3BKCH 4TM9A 1H8SA 2N4IA 2R56L 3BESR 4TNEA 4JY6A 1P9MC 5SWZD 3KPRB 5IBTH 2Y0SA 3NSCA 5LLIC 1R9FA 2P28B 5C0GA 1QABA 4P46B 3W0WE 3HPJB 2QPUA 1G7LA 4N85A 1FSKB 2BVUA 3WOVA 4A7TA 1RJCA 1BFOB 4K2UH 4LHUG 5GGSY 3LDBB 3WJLA 3VYNA 2VN3A 5I1AA 4G6JH 3SCMC 3B9VA 1UXWB 3T0ED 5I6NA 2CUHA 3DO7A 4F8PA 1XF4B 2C9VA 3P4OB 2J21A 5CEXA 5TF0A 1LD9B 1IBDA 1A47A 3BCDA 3UAAA 2YXFA 4P9HC 2NY0D 4NKMA 2SEBB 4UOJA 1KC5L 2KPWA 2BIHA 4PS3A 4EIZC 3GS7A 3TNMA 4S1QH 3MO1A 2TSAA 2YO3A 4YDJB 3F64A 1WG3A 4MJIA 5AFAA 5HVWA 4L9LB 2EUZA 3CDFA 5IB2B 1S2EA 4UTBL 1T22B 2FEJA 4J2XA 1AANA 3H7BA 3EBHA 5J6HB 3W0WB 3O2DL 3G9AB 5FUZH 1BJ1H 1NWPA 4I13B 3FB6A 2YGQA 3KAAA 1JGEA 5KUKA 4FQHA 1NCIA 2ZOKB 5JUEL 3MROA 1GYUA 4LHUA 2W38A 3NAAH 2ODHA 4MFHA 1P1VA 4FFYH 4KUCD 3H56A 3IRCA 4KX7A 3Q7JA 3T2PA 2MCG1 4IOSA 1IZKA 1PYWA 4J23A 1FFQA 3QJFB 3TBVA 4GSRA 4OGAC 1JK9B 2WQUA 2PPDA 2G2RA 2WLJA 1YMMA 2ZUYA 4OCYH 5AOJA 3O9WB 1KIQB 5E8DH 4JLRB 4U1MA 2HB0A 4WFHE 3PP4L 3ZKMC 1IC1A 1EXUA 3MR9B 3TT3L 4QRQB 5BRQA 1FAIL 3HG4A 4P4RA 2EYRA 5JXAH 3QQDB 1KPVA 1CTOA 1O5PA 2BHYA 3BKCL 1MWOA 5J56B 2P8PB 3P0VH 2HVKB 5FECA 3B7UX 5IBTL 4C8XA 2CIIB 3T6VA 2XXCB 4JFTA 4I85A 4HAKA 4JZOA 1DJGA 3O0RH 4BH7A 1U93A 1U8HB 4AE1A 1AG6A 2PYEE 1JZFA 4ZTEA 1FF5A 3FFDA 1W8OA 2BP8B 2DRUA 4YHNA 5T5NG 1BJ8A 1H15B 3OAZH 2COQA 3QCVH 2G5BA 3VWKB 1F4YH 4K2UL 2EIZA 1JZHA 4MMZB 2YWZA 4L9DA 2F1BA 3IKCB 4XMZA 4A7GF 4NSKA 4BFBD 2JCCF 3E0GA 4IRSC 4YLCA 1DE4B 1SYVB 3DJ9A 5IHUH 2D9QB 2RJMA 2VXTH 3QI9A 5JZ7D 5D6CA 1M7XA 1MQKH 3K3QA 5D1XE 4QRTA 4TULH 4JO3H 4YNYA 3S3BB 2E3VA 3OKDA 3AB0C 4N2BA 1JTOA 3ABLB 4X8JA 5IQOA 5EOTB 1O7DC 4B50A 2P43B 5JXEC 1CD0A 5MENA 5JPNC 1RJZB 5B4MD 3TWYA 4EIBA 5HDLA 4ERSH 2Y7SA 4XBEH 1WVZA 3DYOA 4GT0A 4HWBH 3Q9PA 3N44F 4XBPB 4HU8A 5H8DA 3T2QA 2CDFB 4Z0XA 3KYOA 4GNKB 1IC5H 3PL6B 5C0AD 3VXQB 1ND0B 4LCCA 1ORQA 2CGRH 5FO7A 4P2YA 4RIRA 3RBGA 4GB9A 4KUZH 1ZWIA 2PYEB 2NYZA 5IBUB 1IKOP 2QSTA 3KPSA 3SOTA 5HHOE 4PYHA 5TTRA 4L37A 3V7AE 5CHNB 2OW7A 3NAAL 4XTRD 3WMPA 1X5ZA 3LIZL 4IRJC 4JAMB 4HIIB 4HPYH 5HYEA 4LHQB 4HS3B 4Z0BH 3KNBA 4Y88A 1NC4B 3VXOA 1SXBA 4JUTA 1GS8A 1V10A 4G6KH 3BUYB 3BQVA 1L3WA 1MDAA 2XPGA 4FN0A 4OUUA 3LQAC 1I31A 1OY3B 4P2OB 4AKQA 4OCYL 3I6SA 2WTRA 5CFHA 3DSFL 5D1XB 5E8DL 2DM2A 2VERN 5I82A 3SPCA 3VJ6B 2NSXA 4BXVA 2ZOTA 3MYJB 4DN4H 3QFDB 5IFAH 1XZ0A 3C8DA 4D0CB 3F8UB 5JXAL 5FOBB 4X83A 5F7LB 1SF5A 3VRLF 5BUPA 3P0VL 4AGMA 2LU3A 1Q90A 3NRPA 3TJHD 3L3DA 3ZR6A 4UIMA 4A2LA 3O0RL 4PJFA 3WAKA 5HYIA 4NM4H 5JLZA 4WWNA 1UOWA 1IM9B 3D09A 1RUPL 4CVWA 5E6IB 1V7MH 3CC5B 4NB7A 1C16A 1YPZF 4GUPB 1S9VA 3QCVL 1X5HA 3S5YA 5HHOB 1F4YL 1S9WA 3EO0B 4PS4H 1U3JA 1B6UA 4OF6A 1DVSA 1UA6H 4ZMLA 2GTQA 2CKBH 1BSIA 3KDPB 3N91A 4P06A 3SO3B 4ELMF 1B4JH 1WWAX 1JZIA 5IHUL 2BNQE 1JZDC 4WWPA 1KEGL 1T89C 4PY7A 5CLZA 4N2HA 2QR0A 3K8LA 1C5DA 1FLRH 3Q8BA 4LVNC 3UMTA 1G9EA 1MQKL 4N9OB 4RFNB 2C1OB 1I3VA 5E1HB 5CJXC 1CG9B 4A6YB 3C9NA 4TULL 1WQVT 4JO3L 5KSBB 5C9KA 5T1JA 4XXCC 1ZJAA 5F1IB 3S8GB 2J1XA 4L3EE 3O6FC 4OF7A 2ZXGA 5HYJE 3OR6A 4HETA 4I4WB 4XBEL 4OJDH 3W9DA 1B9KA 5HGAA 4HWBL 3GKZA 4JDZA 4N8CH 1QWNA 3CCHA 3BZ4A 3PP3H 3MRHB 3PDOA 3T6ZA 1IC5L 1RK1B 2NQ3A 4L1TA 3ULUE 2O6FA 4KUZL 3WJJA 3EO1A 3BQUB 4QOKB 1DQIA 3KDMA 4MCYA 4AXWB 1WEJH 4LU5L 2VZTA 1SXNA 3MRJA 3HBZA 4KK5D 4ZFZB 2QADB 3PJNA 4HPYL 4DHLA 4AYFA 4Z0BL 3S3JA 4KBPA 1ASOA 2BVTA 1D2PA 4G6KL 4B9GA 1ZT4B 3L9EA 1V8HA 1JPSH 2PCFB 5I73C 5C0DA 4C56A 3OHXA 4P49A 4FFTA 1KPRA 1NKGA 2YD7A 5HDBE 2NR6C 1QAWA 3ZE0B 4DN4L 5MEQB 4L3EB 1PY0A 2FNBA 2G3XA 5MHSE 5DMJB 5C71A 1JZ6A 5D7SH 4AOFA 25C8H 5HYJB 3STLB 2CD0A 1T83C 2X4OB 5DC0A 3L7FB 4MLIA 1AZUA 4U3SB 4WNQB 3QARA 3HZKB 3TV3H 4XWGH 2PWEA 2H7WA 5AL0A 3OB0H 1HL9A 4PG2A 3H9SE 2EDNA 4ABWA 4YSEA 5FC9A 2ZKWA 2EXYC 2A6JB 4NM4L 4RGOH 2OTPA 4C4BA 5HJ3B 3F7YA 1D9KA 1VZHA 1V7ML 5MEPB 4Y4KD 2ZQKA 2YD4A 1TR7A 1Z5YD 3EYSL 1HS6A 4PS4L 5FYLD 1JK8A 1KJMB 4P5MA 2WO2B 2XTJC 1Q9WA 1G7IB 1UA6L 2CKBL 3P2DA 3H2WA 1B4JL 1OGTB 3RG1C 2VR8A 4MKMA 3BW9A 5AAMC 3NTCH 2VXQH 5SV3A 4ENED 1L7IH 2HT3D 4KKQA 1FLRL 2ZXWB 3ARZA 1BZ8A 4Y4HC 2QVFB 1D5ZB 1MLBB 4RMQA 2QELA 1ZY9A 5DHMC 2AQNA 3ML9A 2FX8H 1TEFA 5I1HH 2FK9A 5HDBB 1QR1A 4AMKL 3IF1B 4M3JA 1M2VB 4MAUH 4LSSH 1ZKAA 1ZLDA 4FJ6A 4GW4B 4B6ZA 4HUKB 3BUPA 4MRBA 1H9VA 4N8CL 5DD1H 5CILL 3UZVB 4WV1A 1CT8A 4GJTB 1AY1L 2BSTB 4Z7UA 4CBZA 3CDCA 3KLLA 3MBEA 3OAYH 1FHGA 1I7UB 3RUGE 3H9SB 1B4LA 3UYPB 1PKQE 2ZUQC 4LBEA 1DYZA 2BFVH 3OKMA 2TSBA 2X9WA 4X9FA 1OTUC 3SDDB 4BFIA 3F65A 2DBJA 4WI3A 1HIMH 4M6NH 3V4PA 1H5BB 1FVDA 3SDXE 4NKDB 3N40P 1WEJL 5I5RA 5IJCC 2BZ7A 3B9KD 1S7SA 4FF9A 4IK7A 3RKDC 2A73B 3RWHB 4IJ3C 5I74B 4Q9RH 3RZCB 3VXNB 4TQPA 5E9DA 2JJTA 5JO5A 2VXUL 3E3QE 4FLHA 5DD3H 1JPSL 2QFRA 1CDJA 1DEEA 3DX8B 3PHQB 5ESAA 1WZKA 4QHMB 1KXTA 5D7SL 4JZJA 1EHAA 1EAOA 1UD2A 25C8L 1Y6NR 3RVTD 4U31A 3FTYA 1BQSA 4AVHA 1XCQA 3U6RB 1G7PB 4OZFA 1E4KA 4XE0A 3L3JA 2XWTA 2MSPA 2DIEA 3POHA 4OR1A 3QUGA 4XWGL 3TV3L 4F7MA 5C9JA 3RUGB 5CD5D 2WWNA 1LO2H 3MRNB 3T4AA 5KOMC 2AZAA 4RGOL 3UJJL 2Y6SD 3VXRB 2JIXA 4F57H 2D0GA 1CBJA 3ZK0A 1COBA 3SDXB 3QORD 1G1CA 5H37G 4D7PA 2R51A 4RCAA 4JCWA 5G55A 1ZTMA 4IKNA 3QFJD 2BVOB 1AXSB 2XWZA 4U6HB 3NK4A 4Y4FA 4GP5B 3NTCL 3B9EA 1JPTH 4IIQC 1L7IL 3B5HA 2EH8L 4J3BA 4DP8X 2BZCA 2GJZB 4LCWE 4N26A 1AGCB 3WNMA 2QZQA 1OB1B 4DP1X 1I82A 2FX8L 5I1HL 4F9PA 4APQC 3IFNH 5D4QA 3OSVA 3T2LA 1EFQA 1BW8A 5AOMA 5LNEA 4LSSL 4WTXA 1WO2A 3KLAA 4AM0B 3WE6A 3NGBB 4RGMC 2UZYA 3VRJA 3HG1E 3TTSA 1T1XA 3AUVA 3UZEC 2LLLA 5HP5A 4HFWA 3R1GL 4Y9CA 2MJWA 3Q44A 3IDYB 3LY6A 5DD1L 5KVGH 3TASA 2IDQA 1CDCA 1EEUA 1TQBB 4F37K 3VXUA 1FUNA 4QO1A 4YHZH 2QV2A 2DWTA 1Z9NA 3B83A 5DQJA 4DEPC 3EH5B 4M6NL 4N9GA 3WNLA 3HB3D 5BJTB 4PJ7A 3KWXA 5H37A 4MAYC 2Z91B 2EUXA 3MV8A 1N3NA 3GMNB 3QDGA 3UROR 3QUYB 4JHUA 5IF0B 2Z6FA 2DY2A 4Q9RL 2LTQC 2XXMB 3INUL 3VW3H 1NC2A 1ZDSA 5JDSB 1AHWB 4Y0GA 5DD3L 4HX1A 5BQ7A 1WT5C 3DIDA 4GQPH 2UYLA 1DVUA 5EEWA 4JDVA 3QXTA 3BZEB 1J5IA 1LEGA 5I8OH 1HSAA 3G5WA 2BXYA 2Y69B 5CU5A 2F08A 5LCVA 5IWLA 4NOFA 2OMNA 5KZCB 1A6VH 1S7VB 2NYYD 4I0KA 3WMSA 3DUUB 4RNRA 5C70A 1JV5A 5JIPA 4J3OC 4W9HC 3O45B 1NIFA 2FEDC 4LIQH 3VGGA 1JP5A 2FZ3A 4FMVA 4PJHA 3E8VA 5A7EA 4G80A 1NMCC 1PTZA 1Y0LA 3FT3A 1J9QA 1NDMB 1VACA 3QG6B 1RSYA 2QQLH 4F57L 5L6YH 3BVXA 2FJHB 5EF3A 1U8KA 1K9TA 4KQ0A 3OHMB 3FB7A 4Y1AD 2V9RA 5HDBF 1YYMH 3M1BA 4G7SB 4YL9A 1JXGA 4ZK8A 3HHMA 1OOAA 1P4LA 5HDWA 1JPTL 2OW6A 2C5DC 3VI4F 1EMTH 3CU7A 3KGUA 5AVXB 1I7TA 2OI9C 2JKRM 4IOIA 4HVBA 1R3JB 4ZFOL 2M2DA 3S9DB 3C8HA 1TO4A 4AMXA 2EILB 2X6UA 3ZMNA 3OLEA 2QKIA 1JUFB 3FYIB 4WJKB 4U1IB 3GJFB 5BS0D 2X3AA 4MWFA 3U82B 2DL2A 3NSDA 4NNYA 5KVGL 3R8BB 4BHUI 3RNQA 1EBPA 2EO7A 2DJSA 3W57A 4JFYB 2YPLD 2X4RB 2OMYA 4RRPA 3WGUB 3HOGA 5ICXB 4J5VA 4YHZL 3BVUA 3DARA 5A16A 4DUWA 3RTLA 2OYPA 1HHGB 5IW1A 5SV4A 4P2QE 3ENEA 3GFUA 4Y16B 4PRHA 1A25A 3MGOB 2O6EA 2W60B 4TNVK 3TFKC 1JFQH 3V0AC 3LZQA 4ISVB 2GEQA 4QHNB 3VW3L 3SJVD 3MI6A 3IXTA 5C6TH 1ETB1 1TITA 3W5NA 2NW3A 5E4AA 3EGDB 3H2PA 3RWJA 5I8OL 4ZTOH 5EOCJ 1VRSA 3IDMA 4I88A 5I6XB 4LZKA 4M7ZC 5AOIA 2GC7C 1O6SB 3N40F 2Z3FA 3N0AA 2D8KA 4O02H 2NY3B 4RX4D 2WQAA 3LQZB 3SDXF 5JOPE 2QGDA 3B5TA 5IGXH 3DROB 4LL9A 3ZDXB 4XMPH 3TC9A 1L9OA 1QBAA 4QGTA 3AXIA 3GF8A 4LIQL 2VJ8A 4OLYH 3OR7A 1FHNA 1LO5A 1XR8A 3ZYJA 2EDYA 2Y3NA 3ZXAC 4BM7A 1NPUA 3EOAB 4QXGL 4NO0D 4BWWA 3TPKA 3TF4A 3LKRB 2QQLL 5L6YL 3SPHA 1EDHA 2O72A 2VMFA 3O8XB 4R84A 1JI1A 4HKJA 4OJAA 3H8NA 1YYML 2AABH 4K3JH 1IGTB 1RERA 1MUJB 5TQ2H 3D4CA 4EI6B 1NBQA 1CLYH 3CSPA 2YA1A 3EOTH 4OGZA 5CGYD 1YNTF 3VD7A 4D9QE 4J3TA 4PJAA 4KZEL 2KKQA 1SJEB 2OQJA 1OQOA 2HLFD 5AOLA 1GPOH 4YBQD 4U1HB 3TWCH 4Y5YB 4B0MM 4FCAA 4QHLB 2BY2A 3WSQH 2WN3A 3VGAB 5DGRA 1JGDB 4I3SL 3GUFA 5BQDA 3K2IA 4U1NA 4F2EA 2R4RH 4NPKA 5JHLH 4P05A 4FAAB 4EI5C 2NNCA 5T3XH 5IFHH 3GSNA 3P30H 3F5WB 3RURA 2W07A 3U6XS 5KVEE 1YEDB 2V33A 4FDWA 1ZGLM 1I3UA 3K46A 1A1OA 3RPIB 2YUWA 4EUPA 4L1LA 3ABKB 5KSAC 2DLGA 3TOPA 2IH8A 4R3SB 1S78C 2VIRB 4LEOB 2X09A 1YYCA 1UXSA 1I1AB 3R7RA 3FTWA 2DN7A 3NSFA 4FYQA 5EFIB 4FQ1L 4M5ZH 4XMXA 4TS6A 3IN0A 1SXAA 3PWUA 2LT9A 3LOWA 1UB5B 3U7AA 3VFWB 5EIIG 2C9XA 2PW2B 2VDNH 4PJ5E 2WQXA 3ESPA 5K9KB 1I9RH 2AP2A 4AH2B 2VXSL 4POYA 2R0LH 4GP4B 2X88A 4G9FA 3GRWH 2FD6H 4FULA 5GRXG 3GJEA 1BZ9A 3PU7A 5C6TL 3TVMA 3L3HA 2VRAA 4TLTA 4FJZA 2XN0A 4F7PA 3J7HA 2BVQB 3IDIA 4ZTOL 4YHIA 1JBJA 1H3GA 4KU1A 1L9MA 1WAAF 4W9CC 4UBDD 1EEZA 3KYMA 3VG0L 4APQA 3B8YA 2GK0B 4OM1H 3BZ5A 3Q43A 3GUTA 3JTTA 4O02L 5EF1A 1D5MA 4HJGB 4QLRA 3R4RA 3FDWA 4ZXBD 5HI5D 1EFXB 3KWVA 3NIGE 4IKIA 5EPMB 4XMPL 1G87A 2VDKH 1WBYB 4J3OG 3OM3B 2N0MA 2UZIH 3ES6B 2DWEB 4MNQA 5E1AB 2OULB 3LHPH 2HLAB 4U6YA 5D1QD 1SEBA 1AZZC 4A04A 4KJWC 2G75B 1WA2X 3FO0H 2GFBB 3ARBC 4NX0A 2YC1B 5KYNA 1AIFB 2AABL 4M00A 4K3JL 1INDH 4V2BA 3MJGX 5EIIA 1F0LA 4OJFH 2BINA 3KPPB 1OQXA 1CLYL 2AXFB 3GSXA 4Q14A 3RX9A 2H26B 3ECWA 5JA8B 3TZVD 2F1EA 4M6ML 4JO1L 3QUKA 3RWFA 3B43A 2K9FB 1GPOL 1NCTA 2WW8A 4JUSA 3TWCL 2ZUWA 5BXFA 2A3TA 4MS6A 1SY6H 1YY8A 2R4RL 5JHLL 3TO4B 4V1DD 2IPUG 5T3XL 1E5ZA 5FGBC 5IFHL 5L2KD 1IIIA 3FTZA 1RK0A 5D8JH 2O5NA 3P30L 3VACA 1KSRA 3NIGB 1MKFA 1KBKA 4EQ2A 3G04A 2F54A 1QSVA 2K6YA 3SBQA 4R96B 3TEWA 4L4TD 4NDMB 1IMHC 2Y72A 5DJ8A 1ZS2A 3UX9B 4KNSA 4NI6A 4Z7WB 4GG6B 3CDYA 2Z31B 2A0LC 2CLRA 2QT6A 3KL0A 1LNUB 3KCWA 1U4EA 4F24A 4TLUA 1UZ6E 2Y9RT 5AAWC 4KVPA 4PM1A 4K3DH 4P23C 3NSYA 2GTZA 3NA4A 5CINL 4Z18A 5B1BB 1CLZH 4QRUA 1OTTD 5AYUH 1JI2A 1EBAA 3GRWL 2FD6L 4M62L 1YMHA 3MLWH 2WWOA 5FDWA 3RVUC 3U0WH 1FFPB 4PVMA 3V4VB 4C83A 2FBRA 2ZUXA 4K71B 1Q9OA 4ZMOA 3FT0A 4OM1L 1JPEA 3CWGA 1T0NA 2VLKA 2DI9A 5KW9H 5I19L 4HOXA 5I76B 4KHTL 2JKSA 2XZZA 1QSFD 1MCQA 3TA3B 3ZSSA 4E0RA 2IAAC 2VDKL 1XGYH 2UZIL 4MMXA 2VLRE 4JM2F 5EBWA 3QH3A 5EEVA 2ZCLH 3LHPL 2ZP9A 3GC3A 2ARJA 3V10A 4N8VB 4ZO6A 2HA1A 1UADC 2QDVA 3CGTA 2HG5A 3FO0L 1KGCD 3Q5YA 4WFED 4G59C 4HZLB 1C08A 3KCPA 1OV8A 2L7JA 1BWMA 4QRSA 4OJFL 3CFDA 5K39B 1NAMB 1NFDF 4XMUA 4FC3E 4NT6B 1G0XA 2NZ9D 5DJ0A 3RILA 4LDLB 3SGKA 1E3XA 3Q2CA 1NBYA 4MNGB 4PRIA 2ZXCA 3TEYA 2AW2A 2WNGA 2D4DA 3HFFA 4NI3A 1N8ZA 3CFBB 3K6IA 5EUOA 2ITCA 5E51A 1FJ1A 1LO0H 1SY6L 1A3QA 3BPOC 3ULVH 3B9DA 2B1AH 5ANME 5HGHA 1CL7I 2ED6A 4IBQA 2PLTA 2TAAA 5D8JL 3WENA 2CLVA 4CMHC 3ESNA 2P5ED 2BVYA 2HFGH 1AR1B 2HKFH 3C6LD 3VGFA 1LDSA 1U2YA 5E7BA 1OZUA 5IROC 1REIA 1II4E 2VLRB 4F8TA 4XMKH 1I8UA 1RMFH 1WDAA 3ZYZA 3OG6B 1MNUH 3D18B 4A7QA 4X9IA 2JKTM 1J5OH 2BRQA 2P8MB 3TBCA 5IMMA 3LZNA 4Z95H 5B39B 4YGVA 5IMOA 4LASH 3WN6A 4K3DL 4IU3B 1ZEAH 1QLEH 1DQKA 3ECVA 1CLZL 3I6GB 4NWUL 1IFGA 1Z9SB 2X53A 3FZUC 4PRPA 4WWKD 4XODA 1VGEH 5AYUL 4DH2A 1CIUA 4PSPA 1GCFA 1I1RA 2WBJB 2O61A 3L1GA 2CCWA 3U0WL 4X99A 4PIBA 4BFKA 3NRFA 3CFEB 4PJIB 4PEEA 1ECYA 2NNRA 5IV2B 5F9DC 1W72B 2I9TB 2IAMC 3B7SA 2Q6WA 5C0EB 4LRIC 5KBPA 2IPTH 4JFXA 1YEKH 5ANMB 5AUMA 4F8OA 5KW9L 5DK3A 1GJIA 1K5NA 4BFOA 4AI7A 1QQDA 4XCEA 4K0OA 2NSQA 2EDLA 3C60B 1M9WA 1XGYL 2KLSA 4M5SA 1KACB 1PY9A 2BC4A 3FB8A 3NSXA 2ZCLL 1MH5B 4P46C 2I26N 4PWKA 1E30A 4KKPA 4HSQA 4ZSOA 1DVQA 1NBCA 2ZWYA 1MY7A 2ZX5A 4XVSH 1AQ8A 4E9TA 3VFTB 5AW5B 2OP4H 3JQOB 1AH1A 1SEQH 2UY6B 1E9OB 5C0IB 3DV6A 1FIGH 1R3LB 1F4WH 3D25B 5A6LA 3VYPA 5FYKH 5KN5B 3SKNB 5C2UB 5I1EH 4QRFA 5IEHA 1XGRB 3ZJAA 2EECA 3NIGF 1TZIB 3CDZB 1T03H 2EACA 1HFUA 3LEXA 3HZVB 4GSXA 1LE5A 4BDVA 4WW1A 5AB9A 3U2JA 3P69A 2FO1A 3ULVL 1HSBA 4I0PC 3FPYA 2XNAA 2B1AL 1K4CB 2P5WA 5J6GB 1DFXA 3Q06A 3TLRA 4UQDA 1AKJB 2F0CA 4OV5B 1H9DA 3BDYH 3ZTNH 4Z7OF 4Y5XA 3UG4A 2HFGL 1PZBA 3AS3A 2R7EB 2HKFL 1JXDA 3DHPA 3EHBB 1RHHA 1WTGT 3LNGA 4XMKL 2MOVA 3MUGA 2H2SC 4G8GD 3D69B 1MNUL 5KSVB 5C0BE 5CP7B 2WB1A 1J5OL 3BCFA 4UDUB 2AF2A 3DSNB 1R34A 1FL5A 5F93C 5T1KA 4MDIA 4LASL 1GKEA 3E2HC 4JHVA 3F7PC 4JL1A 1ZEAL 1QLEL 4PJCE 5CCJA 3NCWA 5GZNC 3HTLX 2IPUK 4GKSB 4A2GA 3BVVA 1VGEL 1PLAA 3B56A 5D70L 5IUCA 2BO0A 2RIKA 5PAZA 1IB5A 3RVXC 3U46A 3S4SB 5C0FB 1AZNA 3UPCA 4Z6AT 3EBGA 3O9WC 1MOEA 3EFOB 5HHNB 2J4WH 1X9UA 3U6XA 3H42H 4WGWB 3IFOB 4PJXB 3QZWA 1JYXA 1OL0A 1E5UI 1ET7A 2IPTL 1P2CA 2AJZA 1K5WA 4AT6B 2Y7QA 5C08A 1SGKA 2G2PA 3P11H 4DVBB 3MOBH 5B3JE 1N19A 4LLQB 4BSJA 4FG6D 1EV2E 3FOMA 5B3SB 2IWGA 4KJYA 4JRYE 3WDHA 2DDQH 3P02A 4IBLT 4JDEB 3I85A 1BOGB 5KTEH 3Q3GA 5T1LA 2F8OA 4DPAX 1TEGA 1OANA 1MCWW 2OP4L 4HJIA 3VWKC 1G6RA 2DQTH 1SEQL 2IMNA 4JK0D 2Q20A 2BFGA 2VGLM 3FYEB 1FIGL 4MMZC 1F4WL 5JYLA 4KKBD 4QHUA 4B9FA 5I1EL 2WMPA 3S35H 1S9KC 1W0WB 4Y9FA 2GG1A 5TGBA 3MMEA 1T03L 2F53E 2WIIB 5GISH 1KG0B 2B9BA 5C0JA 2Y22A 4CDHA 2G0LA 1PIFA 2KC0A 2XRAH 3HHSB 3HUJE 3FUIA 2AVGA 2ZAHA 3CZSA 1BDYA 3QXAB 4G8FA 1A7NH 5AB1A 1HCFX 1HYRC 1MHCA 2J3SA 3AQDA 3LNEA 4IDJH 1EXHA 1SQ2N 3FU6A 2UWEB 4PJ9D 5FM5O 5D5MF 5I5IA 1ZGLP 4DCQA 3BDYL 3ZTNL 5K9OB 3OMNB 3CN3A 2AJVH 2DQCH 4HBCH 1CICB 4WKXA 4HSAC 1Q1JH 3DI3B 4OLVH 4PGEB 4RISL 3RIAK 3D30A 3PWVB 1PZ2A 4KVNH 5I0VA 3QAZB 1UZ8B 4H26A 1GR7A 1LDPH 4BA8A 3E6HB 1JRHH 5KVMC 3BLPX 4UQIM 1FNGB 2OL3H 4XPFH 4JPIA 3K6OA 5T5FA 4FX5A 4XZ4A 3MJ9A 4GEJA 2NY6C 3ROLA 1MVUB 1KJ2H 5F3FA 4AW7A 1IBGH 4E41D 1TZ8A 2H3NB 2E7DA 1NOAA 2YSSA 2DMKA 3ILPA 2F53B 5IQMA 1NLDH 5D1XC 2VDRH 1QFOA 1BJMA 2EDBA 3HUJB 3EOYG 1UVQA 3D3VA 4MJID 2J4WL 2QVMA 2VJ0A 3WIHH 4CVXA 3FUHA 5CMAB 1ZGLB 5HYSB 2XY1A 3IGFA 4X5XB 2AHIA 4ZX5A 2NTSP 1LGVA 1MFCH 4GSDH 3V5HA 5HVHB 5I6KA 4NZFA 1HILB 3QEGH 3MOBL 4H25A 1XXDC 3L6FB 4JFPA 1FZKB 1TTBA 1AZCA 3BYTA 2VC2H 3ROOA 4IS6A 4WUUE 2AC0A 4YXLH 3ZO9A 4XBGA 5E6IC 1UOVA 3ME0A 3SOBH 5A2KH 2YPVA 4Z1PA 5JR1H 2G0KA 2MHAB 2DQTL 3IPBA 3QDMD 2DWXA 1B90A 5DHDA 2FQDA 3QEHB 2QGCA 1AACA 1WIPA 2VR6A 1IEAB 4R4NC 1TZHB 3MRPA 2WLLB 2A6KB 4PMFA 3S35L 2X40A 4UNUA 4CDGC 4IMKA 4BV1A 1AXIB 1Q4NX 3F58H 4G9DA 3VFMB 5GISL 1CFNB 4RESB 2DD8H 1KN2H 3UIZA 3G6AB 4J7RA 1SUJA 1VFMA 1QVOA 2FIKB 1IEBB 2XRAL 2XQYA 3D85D 3RIKA 1RURH 4WEMB 2PTVA 1JWUA 1A7NL 4IDJL 4IBWA 4Z3IA 5I1DB 2R2BA 2XFXA 2X28A 3AREB 4WZ9A 4UZGA 3EUDA 1T1YA 2P8LB 3IJ8A 4FA8A 3BWAA 5D7LE 4AQAB 3HI1B 2J8UA 3TCTA 2GSGB 2AJVL 1NMBH 2DQCL 4X8CA 4JGJA 5DXWA 4HBCL 3KPRA 3BP6B 1DFBL 3V0WH 3NN8B 1HOEA 4N2KA 2ESVB 1Q1JL 2R1WB 4L1SA 5J7CC 4ANWA 4MCZB 5EBMA 2YZ1A 4TPRH 4FHKA 4CN6A 1T5KA 1X5FA 3BQUC 1OTSD 4KVNL 2CJ3A 3U36B 2VUKA 4LP5A 1W16A 2ZNWA 1S3KL 3B8SA 1BFOA 4UB0H 4WO4D 4BQ9A 4MD4B 3IETB 1LDPL 2A9AA 3PHAA 4UOQA 1JRHL 3M86A 1VENA 1ORSB 2OL3L 4S0SD 2K6ZA 4XPFL 3RTQA 3F7KA 5ILTH 5DJ6B 3SGDI 1Z3RA 1KJ2L 1YN6A 5F1OB 1IBGL 1JZ7A 3QPXH 1NUFA 4DK3A 5C07E 3P4OA 3W37A 2WZPD 2X4UA 1OCCB 2IOOA 1LD9A 4NNXB 3X13B 1NLDL 3GSOA 2VDRL 1AHKA 2CO4A 4H20L 2KQNA 3WIHL 2SEBA 2A74A 4MA7L 4XOCA 4CBPA 3PUUA 1RAMA 4MXQC 4H8HA 1KGWA 4EI0A 3JWNH 5DUPH 1RULH 5AW8B 1MFCL 5J1AB 4GSDL 5HHPB 1G5AA 3OMIB 4NFBA 5IIEB 1T21B 3QWOA 3EJQA 4ZAKA 2Z0UA 5E2WH 4WHYG 3EXLA 3QEGL 2WKOA 1G7MA 4L9LA 1QHQA 4LNVA 4PJCF 1K2DB 3DMMD 5E6SB 3PXJA 1T22A 2VC2L 3ULUC 2OMUB 4YK4C 3W0WA 5J6HA 5EDSA 2JLPA 4WFFD 2AANA 5T3ZD 1RP9A 3VE0A 3O4LD 3SOBL 2VABB 4UOW1 2ZOKA 1QRKA 2K8QA 4MZRA 4KTYA 3HLAA 1ZTXE 2VAAA 2DEXX 3EKCA 3L9RB 4FRWA 3QIUD 4XO8A 4TXVB 4X7FC 5DTFA 3X1BA 4MTMA 2CQVA 4L4VD 1QEXA 3QJFA 3F58L 3KLDA 1JK9A 5C07B 2DD8L 3VDCA 5B3JF 5BV7C 1UKSA 3AS0A 3PWPB 4YAQB 1KIQA 1RURL 1UH3A 4XVUD 4JLRA 3A3YB 1QFWM 2ZNXA 4G8EA 3QUMA 1JZ8A 3MR9A 2PP7A 3DGCR 3BN3B 5GS1C 1UACH 3QQDA 5CD3A 1XL6A 2RAMA 3ARDA 2HJLB 2IDTA 4BQ8A 4EDXB 2VOTA 4UTAH 3V0WL 2CIIA 3ZZQA 5I75C 1QA9B 1CF8H 2ADFH 4I2XE 4TPRL 2GSMB 2YAHA 3WY4A 1BXVA 1X7SA 3P9LB 3SDDC 4OTXL 1SLUA 2BP8A 5C1MB 2CKBB 3GINA 5IBUG 2ZX9A 5H2BB 1H15A 3OG4B 1W6WA 2DEWX 4UB0L 3HUJF 2J6EH 4L8CB 3NCFB 4LVHB 3IKCA 3NPSB 4KRPC 5GHWH 5ILTL 1NMAH 1ZA3B 3OJDB 3O3UN 1ZDQA 4G7QB 3RZCC 2YEZB 5KEZA 1CXLA 1S7WB 2NCMA 3QIBD 5D71H 1BVNT 5TDPB 4ES9A 2L7EA 4NLAA 5EOTA 3B34A 5DUPL 2DMHA 3QJTB 3F04A 1RJZA 1RULL 4ZMTA 4PBXA 1MVFA 4KRMB 2Q5BA 4UZSA 5DHVB 5E2WL 5AL8A 2OXHB 2R9HC 1VZIA 4XCNB 1KXQE 4XBPA 3L48A 1U8PB 2WQRA 3ARUA 3VXQA 3PL6A 1QWUA 4I2XB 3QQ9C 3ZL1A 3AUWB 2ADIB 4XOAA 5D7JB 3SCMD 2QDWA 4OCMC 1CFQA 3QNYA 3FQ1A 3V7AG 1MZZA 2ZUTA 1FNFA 2Z8VC 3MX0A 4NO2B 2FAUA 4HIIA 1FC2D 3DVGB 1NC4A 4MZ2A 1W8EA 3REVA 2Z1KA 4LSTH 1AYOA 3E3QC 4P2OA 5DLMH 4A37A 5FYLH 3KJ6H 2OMBA 3SB3A 3MYJA 1Y6MR 2W0FB 4HKZA 4WNJA 3PIQA 4ZW8A 1XV8A 3ZE1E 4Y2DC 4AIOA 5FOBA 3ZTEA 2FGWH 4JQIH 1KLFB 1ACXA 3WN5A 3Q05A 4R2GD 3NEXA 2K7PA 3IDYC 1E43A 1UGKA 1CLVA 4FLSA 4UTAL 3NUKA 1TQBC 4JJHA 4N6RB 5FLUA 2IQ9H 3QUXB 5H94B 2DYSB 5C8JB 1CF8L 4QR7A 4CSSA 1IM9A 4AWJC 1T66C 1EAJA 1PEZA 3Q1SH 4FTVD 4ODTH 4Z77A 4R83A 1NLBH 3D0AA 4KO7A 2EABA 2IXQB 2J6EL 1BECA 1KLUA 4JQXA 4FHBD 4XNZC 2DQGH 4JPVH 5GHWL 1CGWA 3WDIA 4OZGA 4M1GL 3QUYC 3GBEA 4U1SB 4MQ7B 5I71B 1JYWA 4LPYA 4X4XB 1UD8A 3K2MC 1WD8A 4C4UA 2DJMA 2FL5B 2QLYA 1A4KB 2L04A 1CG9A 5D71L 4A6YA 5KSBA 2XACC 4IIZA 3JUZA 5IHLB 3QPQC 4KI1A 5BRZB 5SWSE 1E4XI 1OD9A 3UAEA 1NCWH 2DIBA 3UG5A 3ZE1B 3BH4A 2YXMA 4I4WA 2K4WA 5ICUA 1FP5A 1ZHLB 5FYKU 4MVBC 4PGJA 2HSIA 4LSVH 2WTPA 2APTA 4LBAA 4QGYA 3IMRA 3IN2A 3QIWA 4TSCL 3MRHA 1YJDC 1CXFA 3BX7C 4NJAL 5J5EA 5D7EA 1O5DT 1H8LA 2WCGA 3BPNB 5HPMB 3NMEA 4P2RD 1HI6B 1Z9OA 2AVFA 4QOKA 4IRSD 4ZW6A 5IB4B 1QTYT 1HHKB 5KOVC 2JQZA 5E9DD 1TQSA 4AXWA 1IKFL 2IJ0C 1C12A 5BOZG 2VXVH 5ALBH 4AGNA 3O3EB 3VYOA 4L18A 4J3SA 1MVYA 5J11C 4YFLI 1OZTG 5GGQL 1OP3H 4PR5B 4NQSB 1UT2A 3D0LB 3P4MB 5JXED 1ZT4A 5IB5B 5TFSH 4LSTL 3ESUF 4G72B 1JVKA 2D0HA 5MERB 2BNRD 3N43B 5FYLL 5ISZD 5IY5B 2ADJA 5CR8A 4B5EA 1HEHC 2HMIC 5SWSB 4UAHA 5MEQA 1IC0A 1EO5A 2DKSA 4EKXA 2FGWL 5HYJA 3STLA 4JQIL 2RALA 2X4OA 1OARH 4KAQH 3ARSA 4U3SA 2E75C 3QQ3B 4WNQA 3HZKA 3LCYA 2IQ9L 2JJUA 1QYGH 2X41A 5HI3C 3HRPA 3CSYA 1WF5A 2A6JA 3FFOA 1LQSR 4IRJD 4NP9A 5HJ3A 3Q1SL 1FNSL 3QRLA 5A3IC 5MEPA 1FV1B 5EZJA 4ODTL 4YFDB 1NLBL 1SN5A 1NEZB 1ZT7B 1UG9A 4XRCB 4UIKH 5HTSA 1NUDA 2HYMA 8FABB 1KJMA 1QFWI 2UUDH 4WVRA 3UYRH 1G7IA 1QSED 3SZ6A 2AGJL 4J8QA 3Q13A 3C09B 4BD4A 3GEWB 4N2EA 2YQ2A 1XB6A 1BAFH 1CQKA 1QG3A 1ZK5A 2ZZUT 1M05A 3ZO0A 3L17A 2NNFA 5EF0A 4DGYH 3NJXA 2BS71 4GOSA 1MLBA 1WSST 2CCLA 3E9TA 5I6XC 3BDBA 4HUCA 4YDMA 4B9ZA 5I1JH 1F1GA 3EFFA 3JUYA 1B0IA 1IGML 3IF1A 4NQTA 5BCAA 2Y06H 4WI4A 2VDPH 4GW4A 5KYYA 4LLDB 5DEGB 4JFDD 3IBOA 1DO5A 1T7YA 2L7QA 3MV7A 5F7EH 3AXLA 3UZVA 2WNKA 4KXBA 3UO1H 4RZCA 2LR4A 2ZG1A 2PXYB 1KCRH 3H9SA 3KYNA 2DLFH 1T5WA 1QPKA 3SDDA 1SFHA 3JWDC 5E5RB 1DJHA 5EG6C 1H5BA 2WLYA 3G9VA 4EBQH 4NKDA 4X7TB 5CKAA 3SD2A 4ZDHB 4JGMA 3SYPA 4U2ZA 4WW2B 5IEKA 2FT8A 3F7QA 1ROCA 3CQPA 1A8JH 4JM2C 3OXSB 3RWHA 1KT2B 4N6QA 1RZ8B 1ZE3H 3RZCA 1U8MA 3U48A 1R3HB 5TFSL 3O6FD 2R4SH 3DX7B 1BYNA 3V5KA 3NYKA 2C9UA 4OH2A 3RJOA 2ITDB 3DX8A 1MHPH 4OF3A 3PHQA 4FKKA 1TCMA 1K8DB 2V5RA 1PU0A 5AWNH 1MCIA 3UIYA 3V52H 5IHZB 1BZOA 3BXNB 3MUZ1 3CK0H 4LEXL 3MRRA 1OARL 4KAQL 3WY2A 4OAWB 2AEQH 4FFZA 4K5OA 2DMCA 4D94A 5L2KE 2IQAB 2MOQA 1P5VB 1QYGL 5FYJE 3RUGA 3V0VB 1UM4L 2CR3A 3MRNA 3N1FC 4HD9A 4RSYA 4ODXA 4DTGL 1IGYA 1I1AC 4EE2A 5ITBH 3VXRA 2V0AA 2EE6A 1X7QA 4UIKL 4J4PA 4HCIA 4NC0B 3UYRL 4CILA 2EVFA 2NT1A 3DRTB 4JCMA 3O0LA 4OZIE 3ZE1F 4ETYA 2XXFA 1Y1UA 1HHJA 3A0OA 4U0QB 1M6OA 1BAFL 1SDAB 2NR6D 1XB8A 4BE5A 4MBOA 4KKZA 1ZHNB 4TUOB 4CU8A 4DGYL 1G1OA 3K4DA 1TYJA 2MNWA 3VFUB 5DQ9B 2ADGB 1AGCA 1KXVC 1I8IA 1E90A 1P5UB 5IVZA 5IQ9B 3OV6A 4JJ5B 1BYOA 2W65A 5I1JL 5E23A 1IM3B 2VQ1B 3FOLB 3Q8CA 5E8PB 2Y06L 1IJNA 1QUPA 3BUIA 4AM0A 2EXYD 4HKXA 4AGQA 4PLNC 2H32A 4FQPA 2XBTA 4PRBB 1JOIA 1LK2B 1AGBA 4X6EB 1MJJA 2O30A 3UO1L 3UTZA 4DO4A 4PRHD 2GCYA 2VUYA 3UEZA 4M7LT 5EZOL 2CA3A 2DLFL 2OSLB 2XTJD 1FGNH 2VKXA 4BH8B 1OSZB 3F00A 3P1VA 4RGNC 3KPQB 1JVOA 2HJKB 3N43F 3RKPA 4EBQL 3W39A 3LNFA 1TYEB 5BJTA 4QRRB 2KYIA 3QXWA 4PVLA 4BUGA 4B96A 1S5HB 3L4TA 4X4MA 1KGCE 1B6DA 1S9XB 2C3GA 3CPLB 4GBXB 2H6PB 4XPAH 5IF0A 4FL4B 4AIZB 5I8CB 1B88A 1HL8A 5JDSA 1S9YB 2DM3A 3QE5A 1AHWA 4S1DC 2R4SL 3DIFB 1U21A 3KBHE 5E0FA 5IHWA 3GBDA 5F0JB 3DTUB 3CH1A 3BZEA 4O02B 2VKWA 4K94C 1S6NA 3FH8A 3VQ2C 1VPOH 1WFTA 4AENB 1MHPL 2EKSB 1AD0B 3HMXA 5HDRA 4QF1B 3C2SA 3EF7A 1GRWA 4MMYA 4GKNA 3V52L 5EIQA 5EU6E 2B4CC 3SN6N 5CAYB 5JOEA 1LEKA 4JW3A 3CK0L 1OTUD 2WK2A 3SDAC 1WBXB 2AEQL 4HUVB 3O45A 3T2OA 2A6DB 4O2FB 1D7CA 2BW5A 2JXMB 4DAGH 3H3PH 3C6SB 4NXSA 3GWJA 1UFUA 2LAAA 4NGHH 4U1GB 1NDMA 2BSRA 5EOCH 2AQPA 2QHRH 5ITBL 1JHLH 1EZUA 1U92B 2E9IA 2YRZA 5DJCB 1CFSB 1K8IA 2FJHA 2Z31C 2CLZB 4NRZA 3OPUA 3VXSD 4RVBA 3VGDA 4YOKA 2I07B 4AQEA 3ARFB 2GY7B 2KQMA 1TQTA 4MXVF 3ZL2A 3S5LA 4P5TB 4EVNB 1P7HL 1UJTA 2DLEA 3HKFA 5GSVB 1V05A 4OGQC 4YEFA 1R3JA 1IO4C 2F74A 4WEEA 3QFGA 4K71C 4QHKJ 2PN5A 1OAKH 1AQDA 1HQ4B 1JUFA 4U1IA 5EU6B 4XVOA 2A4ZA 1R0AH 4IJTA 3HNSH 3GJFA 4CGUB 2LE9A 4HS8H 3TA3C 4LMQI 3GDBA 5E8EB 3V79C 4NIYE 4WEBH 1FL3A 5EZPA 4JFYA 3KPLB 2X4RA 2BIQA 3W9EA 5DS8A 1RZJC 2W0KA 1XD0A 5ICXA 5K1VA 4KNQA 2AERT 1FGNL 3UTTA 1TUPA 4RDBA 4N1CA 3FS9A 1HHGA 4P07A 3HR5B 3KPOB 4Y16A 4JFFE 4U1JB 2W60A 3CHPA 5KG9B 5BMFH 4YLBA 4P59H 1E65A 4XPAL 1RUAL 1QTSA 5HGGS 3MBWB 4ISVA 4APQD 1OGAE 4JRXD 4WTWA 4Z7QE 2UVEA 4LVOC 5ADOH 4U05A 5I6MA 3EGDA 3B7RL 1OP9A 4P4KA 5IJBC 2E6QA 2Y1ZA 3WUWA 3K4ZA 4HEMA 5HGBB 5E5MA 1BM7A 3SGJC 4BZ1A 2JQMA 1WGOA 3AQYA 3EH1A 1ZLUH 1O6SA 2XKSA 3IFLH 1X5AA 3I84A 1QRNE 2FTAA 1F4XH 3K80A 4X0KA 3SY0B 4YLQT 1JXJA 3LQZA 4B7IA 3I9GH 3ZE2E 3VD5A 2OR8A 3IMUA 1YEEL 3DROA 4V2CB 4XOBA 3ZIMA 2C7UB 1FYTD 3PQYD 5CS7A 2VAJA 4X7EC 2ZPKL 4U1LB 4PJDF 3QUZA 4MAYD 4WK0B 5FHAH 5GIRB 3H3PL 4PCTA 4DAGL 4F2MB 3EOAA 3LPGA 2V4LA 2OZ4A 2RGSA 4NGHL 5EOCL 1F2QA 3EZJB 4NQXA 2QHRL 1VDGA 3LKRA 2E6PA 1T7VA 4B9KC 4PRAB 5FYJH 3O8XA 1H3VA 4YC2B 1EIBA 3BPLB 3LKSA 5LJYH 1CDBA 5DK2B 1XX9C 2BVPB 4OF8A 1ADQA 1IGTA 1SXSA 5JHDE 1H0DB 1MUJA 4Z7IA 1RJLA 4FTDA 1UOKA 4JHZA 4EI6A 4XAKE 2VZUA 1MWAL 5B3NA 1SJEA 1BG1A 3BKMH 4PH8A 3CE1A 3FT2B 3O81A 4LCYB 4Y5VB 2HN7A 4Y5YA 3T0EC 4XMWA 5JIKA 1LMKA 4EF3A 4ANKA 1JGDA 4J3OD 3OZ9H 1OAKL 4LFHG 3PAVA 3ZTJG 2FEDD 2F54D 4MHHI 1BD2E 3CBKB 2WLIB 3ZZ1A 3ARGC 2Q86B 1R0AL 2NY0C 4LK4A 5AW1B 3AY4A 3HNSL 3WL9B 5CJ8A 3F5WA 4HS8L 1OM3H 3ZVVA 3IRZA 4FXKC 4Z7NE 5CEZD 3G5ZA 3BRGC 3C60C 2XWRA 2AQRA 4L0PB 4WEBL 3RPIA 4UT9H 4OZIF 2FVNA 2FH6A 1J1PL 3WJMB 3ZDYE 3KEDA 3L3KA 2GI0A 4R3SA 5ETUA 4YFLF 2Q8AH 1TMQA 3TN0B 1IGJB 2WINB 4PD4K 3SKJH 5GGTA 4JHBA 2QPEB 2XPZA 5E1QA 4B60A 1TNMA 1WBZB 3CZLA 5D7IE 3ZGHA 3SQOH 1UB5A 4AY0A 3VFWA 5BO1L 2PW2A 3I6LE 5BMFL 4BFFA 5K9KA 4P59L 4AH2A 4K9JA 2ZUSA 2E7LA 4O2EB 4N8UA 4KNTA 5JOFB 5EA0H 1S4IA 4ZX4A 5ADOL 5IVXE 2VLKD 2IGFH 3ARVA 1BVNP 3WUZA 5D6DC 3RY4A 3BN9C 4QRBA 3TIDB 3CZEA 5INCA 4CW1B 2WWMD 1S3RA 2IWEA 4DGVH 3BAIA 2GK0A 4AYEC 2L4OA 3VDBA 1BD2B 1IE4A 4DW2H 1F4XL 1H6EA 3L5XH 4HJGA 3ZKNC 3MRGB 3I9GL 4OSUH 2X1OA 1DQVA 1EFXA 3L4YA 4A2MA 3KEHA 4MAZA 5DURD 4Z7NB 3UACA 1JZGA 1WBYA 3EHBC 3T1FB 5F3BB 4JFVA 3ES6A 4UT6H 5FHAL 5E1AA 3VU2A 2WTOA 2AQTA 2XVBA 4NO5B 4LSRH 1BXXA 1D5RA 2C9RA 5FEBA 8PAZA 3MA9H 4B97A 4WF7A 4APXA 4EN3B 2YC1A 1KY7A 3I75B 1AIFA 5C3LD 5D7IB 5AW9B 5L4IA 5GGUB 3BJLA 3K71B 3KPPA 2J57A 4MJ2A 3D39A 2H26A 3CFTA 3GJFK 4ZOBA 1NOFA 3BKML 4FFVC 5IVXB 3QXDB 1L9NA 4U6VH 1EPFA 1U8QB 5JZ7C 3UAJA 3OZ9L 1R5VB 2XYCA 1FBIH 3C5ZC 3TO4A 1J8HB 2IMMA 4X9GA 1PPIA 3D51A 3GSRA 1D7DA 3QO1B 5KANI 4JY6B 1OM3L 3LXCA 4AC4A 5GZOA 2R8SH 4OQTH 1QX1A 1XT5A 1OXYA 1QZNA 2X4TB 5B4MC 2X2JA 4UT9L 5C0CB 1KCBA 1G7LB 2AXGA 1L9TA 3RFZA 1NICA 2Y36H 2Y4SA 4P57B 2Q8AL 2AJXH 3TYFB 4H44C 3SKJL 3AMKA 1X5KA 3HS0B 3PF2A 1QLEB 4N8VG 4RETB 3GS4A 3OC5A 4Z7WA 4GG6A 2P52A 2P47B 3ZR5A 1RZ7H 1VF5C 5GRUH 1KENH 3SQOL 1ZOXA 1D3CA 4WSGA 3T0WA 1NZRA 3DO7B 4G5ZH 3LN9A 1JERA 4B9JA 1YMME 2GB2A 5EA0L 4TOYH 2NXZB 4OKVB 4EI5D 1WH0A 1TG8A 4CKQA 3BFOA 3QJQB 4BRVA 4R7NB 1QOKA 3VXTA 4FYTA 3V4VA 2IFFH 1A7QH 4AQZA 4HJ0C 4DGVL 1HXMA 3HE7B 3Q5TA 4R90H 3TNMB 5KSAD 3H1ZA 1QUNB 3L5XL 2Y7NA 4DW2L 3ZHNA 2ZYIA 5I76A 3SYQA 4OSUL 2P7TB 3V6FA 3EBIA 3DUHA 2HXAA 4GY4A 1OP5K 3H7BB 3CN1A 2C9SA 3QQXA 4UT6L 2CK2A 3V5DB 2XI9A 4IBVA 2J5LB 2PCYA 3CN2A 5J3HC 4J27A 4Z7QF 4LSRL 1EUUA 4N8VA 4LHUB 3RL1B 2XN9A 3DRQB 1A7OH 3MA9L 4P99A 3LPPA 3U30C 3A47A 5B39G 4CC4A 2VLJE 4IKJA 4FEIA 2GITA 4UYQA 5JMRA 5K39A 1URZA 1WS7A 2WGXA 1UKTA 4ELKA 1BF5A 1NAMA 2DWSA 3TBVB 3HG0A 4E42A 3ZE2F 4KOBA 2I69A 3U1SL 4MNGA 5CLYA 3MV9D 5I66A 4I48B 3CG8A 4U1MB 1UWEH 2XQBH 3L4ZA 1ECZA 1M57B 2DV6A 2BY0A 3CFBA 5MENE 4OFKA 4U6VL 1F6FB 2YOAA 4P4RB 2EYRB 1YN7B 3WEBA 4PW4A 1FBIL 1KTCA 3J8F7 3FONB 1HZLA 4I1NB 5HVHC 1SHWA 2ZTBA 2R8SL 1FCGA 3AG2B 4OQTL 1KGXA 2J71A 4X7DC 4JZOB 1OK8A 3ARBD 1AFVL 1U93B 2Y36L 2D73A 5T1KD 3APDA 1UT9A 5DO8A 4DETA 3VI3B 4YHNB 3KPSE 4HOZA 4KRNA 2AJXL 1IAIH 3D18A 2D7TH 5JIQA 2WSPA 2AXJA 3EJSA 4RRPM 1U8JB 2P8MA 3AT0A 4W68A 3SDYH 1RZ7L 5B39A 4XN4A 4NSKB 1BZ7B 1KENL 5GRUL 4NZUH 3O3BB 3JV5A 2VLJB 3F84A 3FSOA 5EMYA 5K9JH 1DN0B 4IU3A 3I6GA 4G5ZL 3NIFE 3QI9B 4ZUWB 5D6CB 2FYVA 3WG7B 4TOYL 2WBJA 3REWB 3RL2B 2ODIA 3T3PE 4W9GC 4X8JB 4PJIA 3CFEA 1WJ3A 4FNLH 2IFFL 1A7QL 3ZDYF 2PWGA 4Z3FA 3QYCA 3KGTA 1W72A 2WUCH 4R90L 5C0EA 4N2OA 4MJ4A 3WY1A 1PKOA 2N59A 4PHXA 5ANMA 2TRHA 5LWYL 2NY5H 4Z0XB 5D7IF 4BWTA 4LCCB 1ORQB 4ZQKB 3WBDA 3EYFB 4RIRB 4X9HA 1A7RH 2AKRB 2GJ6B 2PETA 4B9YA 2A0LD 2D0FA 5GS0C 2IANA 1UENA 1MH5A 4OBSA 1FFTB 1SDDA 3KPSB 5SWZB 1RZQA 4P23D 2ZP0T 4BFNA 1R75A 5HY9A 2EADA 5A7BA 3QDHA 4KH9A 3VFTA 1A7OL 1Z1WA 3QZOA 1A64A 5J1SC 3FTGB 2DM7A 2UY6A 3J2PA 3MJ8B 4RDQG 5HSFA 5C0IA 2EVGA 5G4NA 1R3LA 3KNBB 1MCJA 3CC1A 4HIXL 3VXOB 5KN5A 4HLJA 4NQDE 4LHJB 4OUUB 3OKOA 1TZIA 1IKNC 3GXTA 3U83A 4TL5A 1P7BA 1UWEL 3S4SG 1WZAA 3B2PA 2XQBL 2J2ZB 4NPYA 5HGDB 4WENB 4LLAA 2ZWSA 3SYCA 4PJEA 2BH0A 1K4CA 5J6GA 3HC2A 1XF5A 4D8PB 5I1GH 2JB6A 2QHLA 1PZAA 4A1RA 3BGMB 3HZMA 3CFCH 1R47A 1V55B 3NZ8B 2R7EA 4JN1H 4K5PA 1KCSH 3NCBB 1MJ8H 1IEHA 1U2CA 2HCZX 2QFPA 1ZANL 3G08A 4ABUA 3D69A 1IAIL 2D7TL 5CP7A 2J5WA 1TQCB 1QW8A 2NY1B 4JFUA 3SDYL 4UDUA 2IDSA 3HPLB 5J9PB 4NZUL 4AX3A 5IUSA 4JNXA 3CIAA 4AYDC 5K9JL 4BKLA 2WANA 3BP7B 5IG7B 2QR0B 1P7QD 3TGXA 4EIUA 4NQDB 4LSUH 1HNYA 5FF6A 4G8IA 2YKKA 2VITB 1T7XA 4C56E 1TVHB 3OB8A 5E6YA 3C9NB 4WTZG 5C0FA 4Q4EA 1J11A 1E9QB 3IDNB 4TTDD 5HVGB 5KUMA 3COOA 2HPTA 4PJXA 2DAVA 1PLBA 2WUCL 4IEFA 5BZWB 3MCKA 4K9EC 5IROD 4NM8H 3HBPA 5IMLB 4UTBA 3T6QC 4AT6A 2QSCH 1KPUB 2FR4A 1VCBC 2WXPA 5K33A 3UPAA 3O2DA 1MI5A 3PDOB 3Q8FA 4DVBA 4ZUUB 3KVPA 1VAHA 1A7RL 4GS7B 4LLQA 3PXHA 3B7TA 3FW6A 5A2FA 3EO1B 1Q9LB 5F7NC 4JDEA 1BOGA 2FBOJ 3FZUD 2C7FA 4OCXL 5HDQH 3MRJB 3CXDL 2VRKA 1F42A 2X6AA 4AYFB 4YHYB 3NPSC 1RIUH 2YJLA 2BIMA 3L4VA 2X2YA 1AZRA 5FB8B 2ZWKA 5B1KA 1W0WA 2IAMD 3D2UD 4C56B 2LGNA 2PR9A 2WIIA 1OW0C 1RV6X 2J1YA 2VL4A 4WTZA 1MHEA 4FMKA 1R33A 3WAJA 2AK1H 3HHSA 4WK4B 1J87A 1MPAH 1ZA6A 2W59A 1ANUA 5ACLA 5HYSG 4JGUA 2UWEA 5CXPA 4P46D 3UTPE 3S5ZA 2WYHA 3CFCL 4QRPD 5JW3L 5ALCH 1CICA 2OS7A 3JYBA 2A1WH 3ZHDA 2B59B 1KCSL 1MJ8L 4UI2A 4PGEA 3VTMA 2O93L 1UH4A 4KK9C 2DBLH 3ZMEA 5D7JC 1HWGB 4ZUSA 2XWXA 1SDYA 3VWJA 4P5MB 1DVZA 4AQ1B 1XEUA 2ROXA 5ANHA 1Q9WB 2OCCB 5EEXA 3WEOA 4YEEA 1XH3B 3E6HA 3BW9B 3PJSA 3HB3C 3V6OA 4H0GA 3SD5A 4LSUL 1MVUA 3JVGA 5T3ZH 2O5XL 4BA0A 2H3NA 3DYMA 3OSKA 1T7WA 2VLMD 2F53A 1WTLA 3LV3B 4N0CD 5JPMC 2Y5EA 3O6KH 3QA3B 4HWZB 3BI9X 5T5NF 2YEVB 1EK3A 5CMAA 5FYJU 5HYSA 3LKPB 4MQXD 4X5XA 3CDGB 4NM8L 3WNNA 2ENYA 4FQJH 3AROA 2QSCL 1BZEA 3IMWA 2JF1A 3TBYB 4MQSB 3S36X 3W0WD 2H2SD 2YXVA 2JKJA 1U58B 3L6FA 2BOLA 1FZKA 4XPGH 3QUXC 4BGLA 5LQBL 1MEXH 3NIFF 2CO7B 4BFIB 4IGBC 3ECQA 3V4PB 1EXGA 1FVDB 3LIZA 5D1ZI 5G5DB 4E9WA 5GZND 2JMRA 2VB5A 2Z4QA 4X4ZA 3T3PF 5HDQL 2IADB 2MHAA 4KK8C 1TEYA 2A83B 1S7SB 2V5SA 3PHOA 1LP9F 3HIZA 3BZDA 3QEHA 3RVXD 1RIUL 5EC1B 2WM0A 3BUDA 3O9WD 3L9BA 2WLLA 5CJOH 1BF2A 2NUTA 5GGSB 5I71C 2WKLA 3VFMA 3DX9B 3NDYE 4ETQB 4ZNCD 1CFNA 2H2PD 4PJFF 2N3JA 3G6AA 3VQ1C 2AK1L 4WU7B 2FIKA 1IEBA 3VQLA 1JFHA 1MPAL 4XCCH 2R2HB 5IHBA 4LKXB 1FG2B 1QTPA 3BGFB 4F3FB 1ZV2A 4AL8L 1G9MC 1MHHA 2W1NA 3GBML 3AREA 4OZFB 3I3DA 3NCXA 2P8LA 2XWTB 3VAEA 2GSGA 3VXUE 4YE4H 2BCMA 1YUHB 4TV3A 5ALCL 3VWKD 3NN8A 3HCVA 2ESVA 2ZCZA 1T2JA 3BPNC 3ILDA 4GQZA 2JIXB 4OFDA 2DBLL 3BKYH 3SE9H 4PJ7E 4ATTA 3MUUA 4DQAA 4S0TD 3U36A 1OPOA 4PBWD 3MV8E 3IETA 5FO9B 3QDGE 4Z76A 1NPJA 5DRXB 1ESOA 5GRVK 3BVNB 1IBZA 4XO3A 4L29B 5E0QA 5DJ6A 4WFHD 4MGXA 2X4NA 3QISA 5T3ZL 3FN0H 2EUVA 2Q9OA 3NJVA 5LBGA 3MOQA 4NNXA 5E8OB 5DWUH 5E6ZA 3O6KL 1XIWA 2F8VA 5AVZB 2IH3B 3KLAB 3AG4B 4A7UA 4HWBA 1TZAA 2UZYB 4TUUA 1T1XB 4P9HH 2FNWA 4FQJL 4HFWB 5KYWA 2DLTA 5J1AA 5HHPA 3C75A 5IIEA 1T21A 2FT6A 3S96B 2PYED 4YBLB 1TQWA 2D7OA 4PJHE 1UCBH 3VXUB 4XPGL 3I9AA 1GZQB 1IT9H 1RIHH 1K2DA 1MEXL 3UPRB 2Z65C 5DQJB 5B1JC 2IWFA 2OMUA 3FFCA 4M7LH 1U8LB 3JWOH 4N9GB 5AVVB 1NIDA 4BINA 2VABA 1CN4A 5CSGA 3FSVA 5CIPH 3MV8B 3QZNA 3QDGB 5F9WC 1BQRA 3KJ4B 4P2OD 3VVWA 2VDOH 2EIMB 4U4IA 4ZX3A 5D1XD 3C09C 1HU8A 3PXLA 5CJOL 2HT2C 5LVEA 3BHBB 1UTDA 5G4MA 1PX3A 1JNNH 5AZ2H 1KY6A 1XB3A 1YPZA 3ARXA 3L4UA 3PWPA 4WLCA 4M6OH 4GXUN 4XCCL 4ZD3H 1W8NA 3HVDA 2QVTA 5E1IA 5GS3A 1UCTA 4MJHA 3PUCA 1JV5B 5EHFA 1IM9D 1VSCA 2ZUVA 5TDNA 5E6ID 1RH8A 2YRBA 4YE4L 2FZ3B 2VO8A 4G80B 5HHOD 4LDOB 5DJXA 2B08A 3FT3B 4J28A 4ACPA 1AOHA 4OD3H 3BKYL 5D96C 3P9LA 1WLHA 2E86A 4PRHE 3IMSA 2XZCH 3SE9L 3GLZA 3WTUA 2CKBA 3DX2A 1WFUA 1H3WM 1OSPH 5I2IB 4OFYD 2HT4C 1YG9A 4L8CA 5F96H 4NAJA 1YA5A 4W70A 1FVEB 1E40A 1P4LB 4S1RH 2YA0A 1UQSA 1GGBH 3OJDA 1ZA3A 2HRGA 1UJ3B 3N41F 3CFJB 4Y9GA 1KCVH 3SBWC 4Z7UF 2D31B 1Q9KA 1ZLWK 3FN0L 3GO1H 4IOIB 3WFDH 4E9YA 2EVHA 3DK0A 2Z4TA 5FUCE 1S7WA 4KV5E 5GPRA 5F7KC 5DWUL 5TDPA 1VGKB 3FN3A 2X87A 4P9HL 4YDKL 2W95A 4MWFB 3WMQA 4NNYB 5DHVA 2OZNA 3SE4A 2A9NH 4U3CA 3UOAB 2OXHA 2W80C 1N2RB 3BQUD 1EDQA 2OMYB 1CYWA 3STBA 4J3UA 1IT9L 1RIHL 4FYSA 3TS8A 3MTXA 2VN6A 1IAKB 3S37X 5HHQA 3RWIB 2QQKH 1C9SA 4M7LL 4Y19B 3B1UA 3U2IA 5IW1B 2QADD 4N0RA 2ADIA 1N0XH 5F7UA 1KTLB 3RA7L 1OAQH 3NJLA 2BNQD 5BW7C 5D1ZB 5JYMA 4UILL 4XNXL 3VSUA 2LLGA 2VDOL 2FO8A 3JZ7A 1CK0H 1GHFH 4CAGA 3DVGA 4KRLB 1ZJBA 3IXTB 4HLEA 1C8PA 4X6CB 4AMWA 4L3ED 4LGSB 3QFJB 4X5QA 3CBRA 1JNNL 4F7TA 5HYJD 4LPVA 4W4OA 1G0DA 1P5UC 2WXFA 3LQAH 4KO9A 4ZD3L 2EVJA 1C1EH 2W0FA 1FGVH 2WBKA 5G4OA 1MXDA 3ULUD 4KO5A 4JR9H 3QJUB 4X6DA 3U4EB 2H4EA 1XR8B 2E7HA 1BPLB 3KLQA 4NHCH 4N6RA 2EUWA 5H94A 5B22A 2X2IA 1BLIA 4FZ8H 5C8JA 3ET9F 2BZDA 3FQ2A 1NCGA 4S2SA 4OD3L 5IKCA 3NH7H 2XZCL 3MLYH 4HK3J 1V7NH 1OSPL 5KS9F 2R23B 2IXQA 5F96L 32C2B 3MXVH 4S1RL 4G9FE 4MD5B 1DZ0A 1GGBL 2QBWA 3LMJH 3WFBH 1VEOA 4U1SA 4N0UB 1KCVL 1UM6H 3IJYA 2R0ZH 3WFDL 3A4FA 3PRZA 5MHSD 4JFEE 4X4XA 4GXUM 1A4KA 5TK4A 1AS8A 3EBAA 3F3HA 3UAFA 4X42A 4FQXC 4R97B 4XPHH 4KX9A 1MCCA 1YNKH 2Y5QA 5BRZA 2A6IB 4PJ7F 2JI3A 5SX5K 3H9SD 3O6MH 4L8BA 1FWXA 4HOMA 1M3JA 3HG3A 2A9NL 4KZ0A 1WP6A 3SDDD 1A1OB 1FLTX 5CFAA 4EUPB 1ZLVH 1FORH 4MNQE 2WXNA 3II1A 2H0EA 43C9B 1RUKH 3WHXA 1AIZA 5DRZB 2QQKL 1ZPUA 2BWIA 4IW4C 3NJGA 1H6FA 4KRPD 4YSPA 4U1GC 1I8KB 1HI6A 3APCA 1N0XL 3DXAE 3QNXB 5IB4A 1OAQL 1NEZG 3RZCD 4H88L 5SX4H 1ZVSA 3MKGA 1U3HC 3BE1H 1TCRB 5ENWA 4F93B 2UXFA 3ILQC 2GC4C 3O3EA 5EN3A 1ADWA 4CKVX 1TZGH 1CK0L 2GHZA 4HKBB 3ARFC 3EDDA 4HC1L 4CL7A 1V5JA 4NQSA 4M93B 3TYGH 3TVMB 3L3HB 3D0LA 4CN4A 3P4MA 4MA1C 4P5TC 3IDIB 3DKHA 4N2AA 4YHIB 4JFEB 4MJJA 1U95B 3G6JA 1C8QA 4PJHF 2WHVA 1EEZB 3B7YA 3MV01 4WI7A 2R9HD 3LQAL 2CPCA 1C1EL 5SWSA 1FGVL 1D5MB 1JYVA 3D4ZA 5DUMH 4B53A 1GY2A 1UA3A 2CHXA 2IH1B 2KZWA 1M56B 2IBZX 3DJSA 3DA0A 2J25A 3QQ9D 2BSSA 1GS7A 2X5PA 4JR9L 3VXMA 3M8OH 5DU7A 3TCLB 3VXRD 5ABDE 4FG4A 4XNUH 4MNQB 3VX1A 2JTDA 1KULA 3NJKA 4J4PD 4FZ8L 5CF3A 1SEBB 1WHPA 2FX7H 2YK1H 5B1JA 2OMTA 3Q01A 4PD4J 5E5UB 1GZHC 3C6LC 3NH7L 3MLYL 1FV1A 3DXAB 2BIPA 3RU8L 1V7NL 1ZT7A 1AKPA 2AK4A 3ISRA 4XRCA 12E8H 2VH5L 5EIIB 2LABA 2HUHA 8FABA 3BOVA 3MXVL 2RMNA 3LMJL 3WFBL 1LYQA 3CLEH 4ZFOA 2DQJH 2VQ4A 1A4JB 2R0ZL 4PGZA 2VSCA 1ZXKA 3A5VA 2FO4A 5AZEL 1L3NA 2ZCHL 4WWKC 4RWYH 3GI9H 4XPHL 2AFNA 5CLWA 4C54A 1IZJA 1YNKL 4N22A 3ZLQC 4XNAA 3O6ML 4KGLA 4Q9QH 5EF2A 4PI2A 2YGNA 4OCWH 1T66D 2R39A 3G04B 1FORL 4LPWA 4JO5A 4IYKA 4YXKH 1IGIL 4KZDH 1RUKL 3HE6C 5DJ8B 2PXYA 5F72S 3NJMA 2CU9A 2R1XB 2CRMA 1WPCA 3FUDA 2CLRB 3QUYD 2NZ1A 3MV11 4YC2C 4X7TA 1DDTA 3FHEA 4NO0B 1DQMH 1Z9LA 3BPLC 4WK2B 3BE1L 2GTZB 4WW2A 4ZDHA 4CJ0A 4W9KC 4ZW7A 4QRUB 1HEZB 4Z5RB 3AC0A 1TZGL 4LCWD 5F9JB 1NGWB 2XV2A 2DTMH 3HKZA 3K4AA 3Q0HA 2ZAIA 4PRIE 3BC9A 3OXSA 3IDJA 3QO0A 3QPQD 2QKSA 1KT2A 4UWQB 4XC1H 4DKTA 3OB0K 1XBRA 4L1HA 4LP8A 3VG9B 5E95B 4HJTA 5EUOE 1RUQH 3OXRB 1U33A 2CMRH 4Y5VC 4C83B 5KZCD 2HJFA 4MVBD 2BDNH 1Y1DA 2AQ2A 4KXAA 1T0NB 4PB9H 2I5YL 3ZUNC 5DUML 1NCNA 4QAMB 5KJ4A 4X8XA 5IHZA 4E0RB 3BXNA 3GIVA 3A4DA 1GGTA 2GQHA 3PYCA 4PI0A 4ZMPA 3VI4A 3GSNH 1DUZA 4XNUL 1P5VA 2Z9TA 4PJAF 4UQ3A 2E47A 4L3CB 4LPUA 2FX7L 2YK1L 2ARJB 4QXWA 1X3DA 3NJNA 4I18C 3GSVB 3U4AA 4PJBB 3ZQWA 3O11B 1KDIA 1NCDL 1KJVB 3CH8A 3KCPB 12E8L 3M46A 3DECA 3ELAT 4QRSB 1MWAB 2BXZA 4RMRA 3DRTA 2WWKO 2MIZA 1T04B 4PRPE 3SPVB 2H9GB 5DJ0B 5DR5H 3TJEH 4F15B 1AQHA 2FIRT 1NBYB 4PRIB 4IMLB 1HNFA 3CLEL 1PW3A 2QMJA 2DQJL 4ICWA 4RMSA 3SPIA 3DX1A 5KJRH 2Q2EB 2HMID 1N8ZB 1AYRA 1PD6A 2YHGA 4TUOA 1OAXH 2ZT9C 5EUOB 2EE0A 2HRLA 5DQ9A 2ADGA 4MZIA 1FJ1B 4KQ4H 4Y9BA 4RWYL 4XXWA 3GI9L 2NPLX 1MFUA 4ZOEA 3BYYA 5IQ9A 4JJ5A 1CGUA 3EJYC 1IM3A 2GSIA 3A22A 4HP5A 5HI3D 4CMMB 2OAAA 4Q9QL 4GT7A 5C0RH 5B8CA 5E00B 1DVYA 2CPUA 2CBOA 4OCWL 5LGHH 3PNWB 3LKOA 4BCYA 4QJ4B 1YEHH 3K0YA 3L3OB 1EANA 3ZT5A 5A3ID 3TH2T 3MLSH 4IRZH 1LK2A 3ML8A 4X6EA 4Y16D 3VD0A 4OUOA 5DK0A 4KZDL 2FLMA 4OI8A 3LEYL 3QEQA 4ZSOE 1UM5H 3DUSB 2OSLA 5GRJH 4BH8A 5B7FA 1OSZA 2PTTA 2P80A 1CUOA 4HXBH 1RIVH 5DJZB 2HJKA 4YGVB 3CN0A 4NZRH 5A2LH 1T4KB 3D08A 4QRRA 1DQML 4EN3C 2B16A 5C0ND 1S5HA 2FHFA 1IGCH 4HHAA 1JF6A 3HA0A 4OLXH 4PRPB 3RE0A 3CPLA 4U7MA 2DTML 5JQIB 4GBXA 2C3WA 5AG9A 4XC1L 4AIZA 3Q6FB 5I28A 5I8CA 4ATWA 7CGTA 3QWQB 4KKBC 4V33A 4X99B 3MRKB 3DIFA 3O4OB 1GOGA 1RUQL 2NY3D 2EE2A 2CMRL 3AT9A 4O02A 2DQIH 2BDNL 1JZEA 1C5BH 2NY5C 3MZTA 2Q6WB 2P5WE 4AENA 3WFEH 5AUMB 1A0QH 4NYLB 4UZUA 3PABA 4GRMA 1TMCB 1O9ZA 4E9RA 3GSUA 3Q2NA 4FQCH 1ED3A 1WBXA 4HUWA 4V1DB 3GSNL 3NCYS 3BWUC 3SIKA 4P2QD 1A6AB 2A6DA 2JXMA 4ZSOB 4J3OH 1CS6A 1S7QB 4ALAH 4X7SH 2V7HA 4O51B 1BEXA 1U92A 4OB5H 4L4TB 1A5FH 1VIWA 3QDAA 1CFSA 5DJCA 4E68A 1TLMA</