5EEXA

Radiation damage to the trap-rna complex: dose (dwd) 9.02 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5eexA00
1GTFA 4B27A 3AQDA 2EXTA 1C9SA 1QAWA 2ZCZA 1GTNA 5EF0A 5EEZA 5EF2A 3ZZLA 3ZTEA 3ZZQA 5EEYA 5EF1A 2EXSA 1WAPA 5EEWA 5EEXA 5EEVA 1UTDA 5EF3A 5EEUA 2ZD0A 2ZP8A 2ZP9A 3ZZSA
chains in the Genus database with same CATH superfamily
2J72A 2ZX5A 5DMIL 3VUAA 1IAIL 3UYPA 1KJ2H 1MWAL 1RUPL 5C2UB 1RUQL 5C07E 1KTJA 1RZFH 5LNEA 3PHAA 4QRUB 3IMBA 3CFDA 3VDAA 2WQUA 5CXPA 1M7IB 1UASA 1F8TL 3K0WA 4I9WD 2EILB 2WMPB 1JHTA 1QOKA 2QLVB 3OSKA 2WZPD 2AQNA 1MIEL 4F20A 3FT0A 3MRLA 3SYAA 2DBJA 1J8HD 3IDNA 4RFNC 1KBPA 2NX5E 5E2WH 4LGRB 1JGIA 5E70A 1EVTC 5DRZA 4LBAA 2IVFC 5KYXA 3HNVH 2BSTA 4X6EB 5TJWK 1MRDH 3HR6A 4GIAA 1MRCL 4YHNA 3AQDA 4KZDH 2WNWA 1WFUA 5JPMB 3FNKA 2FSEA 4AQ1C 2YOAA 5LKNA 2V5MA 3L1FA 3ZE1E 1CURA 4O5LH 3F2LA 4M7LT 1Y0LB 2E59A 4ZMYA 1KXVA 1GTNA 1H3GA 1HJCA 3OX8B 2JI2A 4PJ5E 3OKDB 4PJEE 1MZYA 2FWOB 4RX4D 3UTSE 3GWJA 1ZHLA 1FFTB 2X2UA 2IAMC 4HX1B 4D9QD 4LVOC 2HAZA 1CFNA 2XTLA 3DBXB 2FT6A 3LVEA 3MC0A 3BUDA 4WSGA 1P7BA 1QFPA 5IBLC 2FL5B 1IGCH 1TF4A 4YSEA 5KN5A 1E3ZA 1XEUA 4JFDE 1VFBB 5T5FA 4LEXH 4MNQA 2XTJD 5CJOH 1WFJA 2GSMB 3QAZB 4PWEA 4OZHF 3BSZH 4LL4A 5F1KC 4BKTC 1Y6KR 3K6OA 1WA2X 3QDMA 4MMXA 5GGRB 4UNVA 5SWZD 2AJVL 3DUHA 1H6FA 4FQCH 1U3ZA 4HV8B 4NJ9L 5K9OB 3LH2H 4WCYH 2ZG2A 2Y3AA 1LO3L 4L4VB 3TIEA 3O8XA 1NJ9A 3GJFB 1Z0NA 3T8XA 4N0FA 2RHEA 5I8EB 4BZ1A 1ZAGA 3CX5K 3EJZC 2IG2L 5DDHB 1L7IL 1U36A 1WZ1L 4ALAH 2IXQA 1NEZA 2IH3B 2Y2WA 5I1KL 1NMAL 3T4YB 2IPUK 5KAQF 1R24A 2ARJQ 4IDJH 4ODXA 1FBIL 5TF0A 2FX7L 3V6OC 3MRJB 3B9DA 2QVFB 3VXRA 1FORL 3LVTA 2GABA 3ZLQC 5IB1B 1MREL 5AW8B 4B9CA 1PKQE 2N0MA 4BSVB 1P4LB 2Y5QA 1E6JH 1TJIH 3C5ZC 3WNOA 5KW9H 1IC5L 4Z7UF 1T89C 4WI7A 2X42A 3FT9A 5C6PB 3OKKA 3UC0H 1ADQA 3BAWA 3GLDA 2HT2D 2DF3A 4FERA 2IADA 4JVWA 2YQGA 5JXEC 4P8QA 2V9UA 1FAKT 2OTUB 4GUCA 1OGTA 4GSDL 3WGUB 3WDJA 1J8KA 2HVJB 2VR3A 4NP4H 1SOXA 4L2LA 2A4CA 3VRLE 4Z7QE 3STZB 4LASH 3K72B 4GH7B 5A6MA 4ONHA 3AG3B 2UX7A 2XN9E 3CFJA 1UWXH 1YY9C 3FHEA 5TD4A 2IBZX 3D85D 4AEHL 3DIVA 2O6DA 2A4ZA 2YA0A 2P7TB 3B2VH 4X8JA 1CU4L 3VI3B 2ICWB 1TKWB 1ZLDA 5AVQB 2PYFA 5HPOA 1PY9A 4DP1X 3U30C 4YDKL 4X6CA 3QRBA 3TO4C 1NEZG 1UXMA 2AEOA 2FRGP 2P8LB 3S0PA 1Z9LA 1OCZB 3FQWB 3IFNL 4WJG3 2WQSA 3P3YA 4Z0BH 1JNHB 1G7IA 2FNBA 3FXIC 5LWYL 3JV6B 3OHMB 2XVGA 1LJMA 1WYJA 4OCYH 5KVEH 4Q56A 2FHFA 3QA3A 1YQ2A 4DPCX 1HYSC 3FRUB 4LRNH 5T3XL 3V6BR 2NXYB 3GI8L 4U6YB 2PO6D 5EBLB 2CU9A 4F7CA 1N19A 2XG4A 3REVB 1S5IL 3R1GL 2QTVA 4I48A 3K6NA 5IBTL 1XIWD 2GTZB 2P43B 4TNEA 3FO1B 3H7BB 1HQ4B 1IC4L 1NPNA 1KLUA 1JZJA 4JPWL 2GHZA 3H3KA 1YUKB 1KJVB 4D0BB 1QLEH 1HIMH 1YEGL 4MLIA 4LCWB 4O2EA 2EABA 3KLQA 2KBGA 4UUJB 4X98A 1P1ZB 3F7YA 2OMXB 4G5ZH 3B2MA 4LPVA 1OALA 1WTLA 3IS0X 3FTUA 1IGIH 1RZ8B 1D7BA 1OE3A 4KO7A 4OJDH 4P49A 4Z9KB 3V0WH 1A4AA 2WBXA 1JRHL 1LWHA 1EGJH 2UWEA 2AK1L 3LKOA 3DVFA 1CIDA 1FZJB 2O61B 1OHQA 1YEIL 3MBWB 3ZRSA 4XNQA 3GMRA 1I8MB 1L3WA 1XX9C 4NYLB 1DBBH 3EBHA 3GSRB 2ID5A 3OKOA 3ZL4H 4Z7UE 4JE4B 4JZNB 1OAUL 3GMOB 4KTGA 5IEHB 1TFHA 1ZLSH 5AKRA 1RLWA 3QJFA 1E6OL 4NHUB 4QRUA 2VW4A 2DDQH 3ZKQD 2IDTA 4EZLA 1L3NA 4DP7X 2CDFA 1CGYA 2I85A 3BZEB 2E6PA 1BYOA 2Q7AA 5MEPB 5FB8A 4AYSA 4DKAA 5C07A 4ZO8A 5BS0D 4R26L 3DGDA 1AGEA 3LNEA 3O0LA 4DETA 4H2AA 2NY0B 1I9IH 1HILB 1MLCB 2OMNA 2X44D 2Z6FA 3PY9A 3F58L 2VMCA 3R8QA 3DNKA 1IAOA 5K69A 1J48A 4Z7WB 1V54B 4W9HC 2QGBA 4N6RB 3IU4H 3G5VB 2FB4L 4G8AC 1IIIA 4IBLT 4KVNH 2Y23A 3DV4B 1BJ1H 1WPCA 4XCYB 1FP5A 2OULB 2HT3D 3U7WH 4GKOA 4E41E 2B2XH 2VJ0A 4K23L 4XCEB 5K93A 3ZZQA 5JW4M 4YHML 3PGCA 4ODWA 2NMSA 2AFNA 5CZRA 5HHQB 3TF7C 3ZT6A 1SLVA 3GSXB 5T5FH 3BWUC 2N59A 3P30L 4LEBA 3UTSA 1HHKB 3HE7B 4WEBH 1SLWA 5EOCH 1JK8A 1XCTA 2BDNH 1N26A 2FLBT 3ORJA 5B1AB 3JWNE 3FSOA 5CKAA 3WEBA 1DQTA 2JB5H 4EEEA 1CXKA 1QABA 2EH8H 2BW5A 5E9DE 1A1MB 4BKLA 3X14A 2ZKXA 2BP8A 4LAQL 4ZS6D 2DKMA 2CO2A 4BZ1H 1ZHBB 3WN5C 2IAMD 5I8EA 1SDYA 4S1SH 4CU7A 4MDIA 3SYQA 4C56B 3HBPA 1RJZA 3RDTA 3QWOB 2IH3A 1WF5A 1AC6A 1GYVA 4GXUM 3NCBB 3T4YA 5IBLD 4WK0B 3M86A 1ZVHA 2R15A 1RJLA 2AXJA 3G04B 2EDMA 1VEPA 2ZNXA 3MXWH 4O9HH 4Y4HA 2A38A 3EDDA 1N0LA 2Q6WA 1T3FA 2IANE 4GP5B 4AL8H 3RZCB 4XPBL 2IO5A 1SJVA 1F1AA 4KXCA 1CBVL 1IBFA 2F7QA 4IJTA 4IBQA 3MO1B 4XI5C 2ZYIA 3BVWA 2OTUA 3LSOB 4YN3A 4H8UA 2P5PA 2HVJA 2JQAA 1QKZL 5FHAH 1HJBC 4LARH 4PRAA 2NY5H 2Z7WA 3H1ZA 5IVOA 3STZA 3HE7C 4EVNA 1FF5A 5BJTB 2EEDA 4G5AA 1T0MA 2YFOA 4QEGA 1UD6A 5CJQH 1XGTB 5GISH 3EAKA 5I6NA 2GCYA 4ZUSB 3C5ZD 4M3KB 2QPFA 1CYWA 2Z8WC 4N8UA 1TKWA 3KEDA 2FDBP 2ZF8A 3V7AE 4X5LA 1CG9B 2CO7A 5C6TH 3T08A 4ODUA 1PS3A 4B3VA 4P48A 4ZOEA 3FB6B 5ACLA 5JXED 5DEFA 4TVPL 4FFZA 3OXRA 3IB4A 4JKKA 3FQWA 4F58L 4HHAA 1FLRH 3JV6A 4KRNA 3SDCB 4KAQL 4A7SA 2DQHH 4PD4K 3OGOE 3MRFB 2BY0A 1P7QB 1QSEB 3BDBA 3NSYA 3PQYD 4DPAX 2BHZA 2CR0A 3FRUA 4HEPA 1YY9D 4U6YA 1WUZA 4L1HA 1GOGA 2K78A 4YDIL 3VXME 1U9KA 1ASQA 2R2BA 4MCYA 4LPYA 5DJ8B 2JJTC 4CMMB 4F3FB 3FQNA 1M7UA 3GXFA 3LMJL 3QRLA 4HD9A 4OBSA 4R90L 2KDYA 5I6PA 3RZCC 3SGEI 3FO1A 3H7BA 4JANA 4DAGH 4ERSL 4PRPD 3RHWK 4BXSV 5C0NC 1L9RA 4QHMA 4H0HB 2F53D 4OZHA 5BVJA 2YPVL 1PG7W 4A7VA 3TO4D 4HXBL 1KJVA 1FZKB 4EAEA 4ZX4A 4YSCA 5LJYH 4OZIE 4LCYB 2GJ6D 1UZ6F 1P1ZA 1EO5A 4TNVK 3E80A 3E3QE 3EO0A 3TV3L 5LXGL 2CHZA 2LQRA 2KZKA 1YEKH 2YPLB 2JKIS 5CR1A 1LO0H 3SDAB 3RGHA 1HYSD 3KE0A 1S9WA 4XR8C 2K4WA 3STBA 5JHDD 5IIEB 1OCWL 1C16B 5GGSB 5FW7A 1U3YA 5KVGE 1EEUA 4F7MB 4U1SB 2VMFA 4N4YB 3VXSB 2VR7A 3KJ6H 3BWAB 5SX4H 4EI6A 2YQ2A 1KXTB 1U91A 3LPPA 1MG3C 2G0LA 4NHUA 3TCLB 1V3LA 5I15H 2YMOA 3FUJA 2YAPA 3L9BA 3RVWD 3V4VB 4WJ5B 4Z7UA 2BPBA 4UM9D 3ZT5A 3GKWH 3U9PH 3SDCC 3R4DA 3X3GH 4JRWA 2X4RA 4HEPG 3BJLA 1HILA 5ETUA 3D50A 4XHQA 2R23B 1MCHA 1H9DA 2Y1AA 4XO4A 1FNHA 1KGUA 4NQCE 4PJFB 3DGGA 4Z95H 3UAJA 4F8QA 1AS6A 1IT9H 1XH3B 3ISRA 3T8MA 2MRYA 5HGBB 5MI0C 4ZMNA 1GJIA 5C0IA 4OGYH 3ECWA 3QQDB 4MAUH 4GKNA 4NZFA 4TSCL 3D18B 4AMKH 1RLBA 3O11A 2I7OA 2YN3A 5EB9A 5TPWL 3M8OH 2J1XA 1TEYA 2BIOA 2VOTA 4ODTH 4ZO6A 4PRNB 4YVNA 4ACTA 5IB5B 3ALXA 1KZQA 5KAQG 1BBDH 1J1XL 4QTIL 4PRHE 1CF8L 3NA4A 1RZJL 1NCBH 3SKNA 4E41A 3PWVA 2APFA 2ALWA 4FQXB 3O6KL 4HJJL 4NDMB 2VITB 3B7UX 2JQZA 4UT9L 3TWCL 1PY0A 5ALCL 4EOWL 4JFEE 5F6HI 4FL4B 5ANMB 5AZEH 2VLJE 1UEMA 2J4WH 2WINB 3UFIA 3G08A 3GZOA 1ZA3B 1UZ6E 4LCWD 1OPGL 4PRBA 4FF9A 1F2QA 4OFYA 4I1NB 1QATA 4PRID 4H5SB 4AQAB 1RFDH 2FIKB 5DLML 4G72B 4MBRA 1DR9A 1WH0A 5HBBA 1T7ZA 4EUPB 3QWOA 3MYZA 3UZQA 4N1EA 5E9DA 2HFFB 4PY7B 1TQCC 5F96H 2WCPA 1X6NA 2NNXA 2N7AA 4EZJA 2G60H 3KHOA 5D7IB 5FA3B 3I9GL 5CMAA 1FVEA 4JMNA 3SGDH 4YXLH 3QNZB 1IM9B 2FX9H 3RWDA 3GBNH 3D3VE 5F71A 3TFBA 3GNMH 4WSJA 3HLAA 4HPYL 1TVHB 2ENYA 3VU2A 3FQ4A 1A9BB 1NGWA 2QKSA 4PGEB 4QRQB 2DKSA 3LSOA 2IANA 1JI2A 3BN9C 5I1CL 4G8FA 1M7XA 4UT7H 4CN1A 1ZSHA 2MTPA 5C0CE 4R8WH 1MCJA 4M29A 2UZIH 1MAKA 3CDYA 4FQXC 4HLJA 4OZ4B 4OGXH 4YSRA 5EZJA 5K9QI 3S35X 4EDXB 4ZAKB 4GP4B 2EC8A 3D39E 1DJHA 3G3LA 4FL4C 4RAUB 4FADA 4BKSC 2YEVB 3QFDB 4M7JH 1E4XI 5IR1B 3HS9A 2EDWA 1CG9A 1IAKB 3JWNG 1L6XA 4FFZH 4XPGL 3S35L 4ZNEE 4XI5D 4DKTA 2X70B 3OGCB 4NI6A 3ASOB 1NUFA 2LFEA 4QJ4B 2ZCKL 4GMSL 4LLQA 4ODSL 3AVEA 5HI3C 2IFGA 2PTTA 1COBA 4Q2ZB 4ZW6A 3JTSB 4DN4H 5IT2H 3HC3H 4M4PA 5C86A 4IYKA 3HE7D 4WEUD 3MRFA 2B3RA 1P7QA 4XN5A 3HE6C 4NBXB 4PJCF 2X1OA 2ENSA 4F15B 1N12A 2CGRH 2ED6A 3FUEA 2VH5L 3N3EA 1B3JA 4M5YH 3OAYH 5JMOC 1XWVA 4IOIB 2ZOTA 1FZOB 2FK9A 3KLSA 1L6PA 3RL1B 1W8NA 7PAZA 4TUJB 1QI5A 1V7NL 2XA3A 3MA9H 4M93C 4TN9A 5ELIA 1CLOL 4AYFA 2CBPA 2FHCA 4I3SH 3ML9A 1ZLUK 2XNAA 3KBFA 3QC6X 1X9RA 2BSDA 3TNMA 3KM1A 5AOZA 3WTXA 3OLIA 1AI1L 1T4WA 2J8OA 3QR2A 3VXOB 4NX0A 3Q2VA 3SDAA 3GMMB 2ZCZA 4TL5A 1FDLL 1U3JA 3QWNA 4U6VL 2B1HL 2QSCL 1BXAA 3RU8L 3IDXH 2X40A 4H8PA 4OJYA 1BIHA 1HEJC 3O3DA 2AJYH 5CEYB 3RRQA 5KUKA 5C0ND 4BH8B 4DN3L 1MFNA 3ULUF 4CVZA 2BNQE 1VESA 4QY8B 4D9LH 3H54A 1T1XA 1ZANL 1K2DB 2JK5A 2EDNA 2JIXA 4HJ0C 5EU6B 3TLRA 3QHTC 3V4VA 3S3JA 5JORA 2D3JA 4YH6A 4NS0A 1RK7A 3WHE0 4NUQA 1S9XB 5KZCD 1PF3A 3OKEA 3QWRA 4TYUA 4ZOCA 1OP9A 4XPTH 2MKWA 3NSDA 2NCMA 3L17A 5D4QA 3RWCA 3S8WA 4NQEB 4F15C 1I7TA 4E9LA 2XCMC 2YAOA 3VI4E 1D5MA 1DFXA 4K7FA 4OLEA 3C8KA 3OVUB 4IMLA 1IKOP 5TDPA 2FGZA 2VN7A 5HHMD 4P2OC 5J12B 2UX6A 1J88A 1XH3A 5DA4A 4BELD 5JHMA 5J1TC 3NSFA 2EDKA 5CLTA 5IGXL 2Z4QB 3WHE1 2G75A 2WXQA 5FFOA 5DD1L 2XC8A 3IRCA 4QD2E 1BZ7A 1ETB1 2KKQA 1OD9A 1QO3B 3D18A 4JDTL 4MNHB 3SDCD 1LQSR 3QCUH 3S8FB 4Q6IA 4B9JA 1PLBA 4KH9A 1NPJA 5CEXA 1M57B 4HKBA 4L8SB 3FQRB 2YO3A 4IEFB 4PS8A 5HGHB 1TTFA 3O3BA 3BVTA 3DVNA 4NDMA 1ZHKB 1RK0B 2BHFA 5K9JL 3RGVC 5J0BA 5BUPA 1BWWA 1M7DA 1MFAL 2MHAA 2RAMA 1A8JH 5EC2B 3TV8A 4PRHA 4ORGA 3JWNH 4J7RA 5ES4B 1LP9F 2FBJL 2F1AA 4TUUA 4A66A 4H5SA 4YSOA 4P2QE 1CTMA 3U4AA 3ZDZF 1BFOA 2FH8A 3D52A 5KG9B 3O45B 2AEPL 3ZHNA 4JFEA 2VLJA 2BVQB 3KDMA 4W9DC 2FWUA 3SE9H 2HFFA 4PY7A 5E08L 4GG6F 3SPGA 3GC3A 5E00B 5JW4R 1HXYB 1ES0A 3DYPA 3BGAA 3D06A 2RQEA 3U82B 4ZFOL 1FCGA 3A5VA 5JNYB 3QNZA 2XZCH 4X5QA 3L6FB 4ONGL 5F0JB 1F1GA 3WLBA 2XZAH 3OG6B 3PWJA 1UT9A 1FO0L 5HGDB 1PL3A 1QWHA 3OKYA 4PGEA 3D0VA 2A6JA 2V5YA 4PJXB 1JZHA 1UZ8A 2Y1ZA 3J8F7 4TUKL 2ZNWA 4U3CA 5JLZB 5L2KD 3IJHA 3WTYA 4LSUL 2BVTA 3NRPA 2GJJA 3FO0L 3WBDA 4Z8FH 4XCCH 1UWGL 4PWHA 1RIVH 2OTWA 1AZVA 3UG5A 5DJXB 4QHKI 1FPTH 1EJOH 4QR7A 4IRZL 4NZUH 1SN5A 1OHZA 3BAIA 4OZ4A 1YHPA 4MA7H 5D1QE 4G3YH 4NN7B 5JHLA 2DKUA 2VSKB 4IHOB 4F7KA 4KKCC 2C3HA 1XFPA 3H2WA 1IARB 4X4YA 3QJXA 4LGSB 5C0CA 2BFVH 2IPTL 5IW1A 3FHQA 2VKWA 3V52L 5INDB 2VLKB 4JPSA 4Y9EA 5E99L 3OGCA 1DYZA 3O3AB 3WFZA 2P5EB 3D39A 1F4HA 3UO8B 3TX4A 4AGPA 3K3QA 4MX7A 1HL4A 2V17L 5F7DB 5FGCB 1ACXA 4P59H 1IB5A 1MVYA 3C60A 4FQXD 1TOXA 2FGWL 4Q7DA 1QX1A 5HHOB 5GHWL 1WCQA 4W9ZA 2V7HA 1HCVA 2DI9A 3L7EB 3MLXH 5LBSA 4G7YL 4QHNB 3RL1A 4ELDA 2R1YB 3B3BA 3KPSD 3DMMC 1JSYA 2VDOB 2YRLA 3VW3L 4HFUH 2NTFB 3NSCA 3AMKA 2O1AA 2MPAH 4BFJA 5F9WB 4HUCA 4GG6E 1J1OL 4ZFGL 1QSFA 1JNLL 5INCB 1KG0B 3BP5B 4N8CL 1LP9B 4YWGL 1JZ6A 2XQBL 3ZDZB 4NGHH 3GMMA 3HE6D 3MRBB 1JNNH 1UWXK 2ZOOA 3E8VA 3F7LA 3GI9H 2JLPA 3VFOB 3IXAB 2JCCB 5CJBA 5B1KA 1BM7A 4XO3A 2QFPA 3UIYA 4GSRA 1IM9D 2W60B 3KM2A 2ZX9A 1F3RB 2DQCH 5DEGB 1AXTL 4U3SB 5IHUL 1JZIA 2IIJA 2LVEA 5EU3A 1EV2E 1KGJA 4L1TA 4MZ2A 5BV7H 5CN3A 2GEEA 3MNVA 3QE5A 5B8CB 5KVGH 1FLTX 1KYFA 2XXMB 4L8BA 4QI3A 4TTDC 3V4VH 5IHBA 1K2DA 1KBKA 2WM0A 5EU6A 5GJTL 1I82A 5KSBB 2GEQA 1B4RA 1G1KA 2BP5M 4FYRA 5T1MB 3Q1SH 3B9KA 5IM7B 4LOUC 2J2ZA 4PGCB 4PMFA 5LDSA 1S9XA 4OFDA 4MQTB 4JDZA 2YWZA 3D51A 5I6KA 5JQ6L 2L7JA 3PWPD 5GS2D 1E5AA 1KGXA 2YQ3A 3B8YA 3INOA 3ZE2E 4BCXA 4OV5B 2ITCB 3ARSA 2APSA 3WFEL 1ZS8A 2A9CA 2EYRB 1DSFL 3GINA 4U1MB 4J6RH 4ZI8A 1ZKAA 1CGTA 1KYUA 3IFPA 3P40A 1AOZA 4OJCA 4Y5VA 2WVSA 2Z4QA 4ATWA 2Z65C 1N5YH 4HJ0D 2XFXA 1KCUH 4RDBA 1SZNA 2ZXQA 3ZSTA 3MLTA 5D2LE 1X5AA 4BFEA 2AJSL 1F58L 3ESOA 5F7HA 2HLFC 3RNQB 4JFXB 3QPKA 1LO5B 4F9PA 4L1SA 2EDLA 2DJUA 5FYKL 3MQIA 3F5WB 3GIZH 4XPHL 5FM4A 4X9GA 4NENB 3CFCH 4ELMF 3HPJB 1IAMA 4S11A 3K5RA 1DDHB 4P2OD 4TOYL 3VGFA 5KJRL 3PHOB 4PJCA 4L3AA 5DJDA 4UV4H 5B8CC 1Q94B 2OCFD 1NC4A 5JIPA 2XWJB 4NUGL 2VDQL 3RUGF 3SCMA 4AYDC 3OPUA 1AD0B 2Z31A 4NZRH 1KFAH 1X44A 4IRSC 1U8CB 5BZZA 4GUPB 4Y88A 5ADOL 5DFWH 5KG9A 1A9EA 2CA3A 1V55B 5C92A 3QUYC 3P4NA 2FTAA 1HH9B 2YBRB 4JKLA 1U8IA 5FCUH 4FYTA 4P2QA 1BGXL 2CLRB 4IGBB 4APQA 4DGVL 3DGCR 1G0YR 3EOYG 5GZNC 3NFSH 2JTDA 1IKFL 4GAGL 3RGVD 4DUVA 3NP3A 1D6VH 3L6FA 4FFTA 5BXFB 5TFSL 2MCAA 2DQDL 3LEYL 3U9UB 3T0AA 5GRXG 1CUOA 5L4MA 5IFJA 3LTVA 5KYUA 1JBJA 3EADA 1PKOA 5HHNA 1ED3A 1ML0A 5JLZA 3IKCB 5ENWB 3RE0A 2GI7A 4QRPB 3WEMA 3FCSB 1O5DT 3X1FA 2X0VA 5DS2A 3SGJA 5J6HB 2C7UB 2OI9B 2DZEA 5JHLH 1BDYA 4JFOB 1F4YH 1N6VA 3H56A 2OSYA 4JY6B 4KX8A 1OF2B 1KF9B 1ND0B 1JD7A 3RLSA 1TSHA 1BQKA 2X4SB 3CHPA 1K8DA 5DO2C 5GRJH 2A73B 5LQBH 2OR7A 1P84K 3NCJH 3ISYA 4H1LB 5ISZE 5HDBF 3LIZL 1UB6B 1M1XB 2VLKA 3EW3B 4BJLA 4NN5C 1RIUH 4KVCL 5DC9B 4DO5A 2DQIH 4NO0D 1KPRA 1N64H 4K73A 4FD0A 5I6LA 4JFQA 4JY4B 4AYBA 1W15A 5IHZB 2ZUYA 2NXZD 3UPRB 1TZOA 4Z1PA 3O4OC 1HOCB 2F9BT 2CIIB 2YA1A 1O7DC 3BD4A 1JJUA 4L9LA 5HHOA 3JWOL 5CIPA 5LBSH 4CADB 2G4GA 1A7BA 3ILDA 4QXUL 3L7EA 1KGYE 4KKCD 3AS0A 1LEGA 2OKMA 2XZQL 2N4IA 3U1PA 4JQVA 2R1YA 4LSRH 3VG0H 2FO1A 1CICB 1UB5B 2CE6A 2F7PA 1S9YB 4FCAA 4N90E 4FFYL 1CF1A 1SPDA 2Y9RT 3TYFB 1BEYH 5HY9B 4JRXB 4K9JA 1LP9A 1TZIB 3TBVB 3CFEA 4P2AA 2YJQA 2OI9C 1DJZA 6FABH 4B96A 3S97C 2FWSA 1RI8A 4N2OA 2VWEC 3NJIA 4GG6A 1GZQA 4MRBA 3ARTA 4U3SA 5AVWB 1NL0L 3HEIB 3U9WA 2UV3A 3DMMD 3RL2B 4DVRL 4OLWL 4K5MA 2VCOA 3S4SA 1QRNA 3OR6A 2ISDA 3BESR 1CXHA 3SQRA 3GBEA 3UTQB 4PRDB 4N1HB 4XWOC 4E0RB 5CILL 1A4CA 3BEWA 5IM7A 3D9AH 4P9HL 5KVDL 1QSVA 4L8CB 4N0UB 1IQDB 4MJ2A 2VIRB 1BAFH 1ZSDB 4OI7A 2W92A 4JDEB 4IBUA 2ITDA 4P4KA 3W0WD 1XBDA 3EFDH 2X89A 3T0BA 2PR4L 2DQUH 3ZDYB 4LLMA 2HWZL 4K3EH 2WLJA 3UP1A 3QIWB 2YSSB 3PE9A 2C3WA 4HWBL 4PS3A 3HUJF 3G6DL 4TTDD 5LBVA 3S6CA 5KBLA 4F1SA 1DVFC 1CICC 4WO4C 1QBMH 3QK0A 4LVNB 5CU9A 2DN7A 1SYSA 4PJ9A 1HEZB 4RMQA 5DWUH 5IQ7L 4XHJC 4LOUD 4UV7H 2QHRH 5IMOA 4LCCB 1TTRA 2L0DA 3L1OH 3RNQA 3GBLA 5DQJB 1LO5A 1OAXL 1PQZA 1LLAA 4FG4A 4PJ8A 5FK9A 4RMTA 3S98A 5I8CA 4QGYA 4DP5X 4APXA 3F5WA 1V7MH 3DV6A 4GT7A 2ZPKH 4NQSA 3LZNA 2ORBH 4B41A 1DDHA 1E4XL 3AU1A 3VB8A 3S4SG 3FF7A 3FUNA 3CQQA 1A25A 2BCKB 4GRLC 2XWJA 3GMQB 3ARUA 5JW5A 3K1KC 5I8KL 4DTGH 3CH8A 4XMPH 3SDDC 1Q9LB 3EYFA 1GKEA 3TO2B 4FC3E 5E8PA 3PABB 4X6DF 4GUPA 2HLFD 5F6HJ 4BK4A 1UA6H 3SBWC 3TH3T 4ZS7H 1CGSL 4UIMA 4BFGA 3JYCA 4MNGA 5F72S 4XXCA 3A4FA 4XCNA 1U41A 4KZEH 5IHWA 1IMHC 4WY7L 5IQOA 1HH9A 4BBWA 2CLRA 2XY1A 2D2OA 4IGBA 1MH5A 5D1XE 1XGQB 3VM7A 3QIWC 3DROB 4I0KA 3ULSA 5LHDA 1NKGA 2Y7LA 3L7FB 1GCYA 4MMZB 5DD6A 1NBYB 4OI9A 3IJYA 4JS7A 5BXFA 1WG3A 3ESMA 5JMRA 4DOHB 4N2IA 2QADC 2IF7A 4PHXA 1E65A 4X6FA 3ULUH 3BW9B 1TTUA 1I8IB 3C5SA 4OCRH 4FTVE 4IRSD 1BFVH 4FS0A 3QJTB 3Q6GH 1NGQH 2B39A 3EGSA 3DVGB 3P9WB 1YPZB 4K71C 2LTQB 3NRFA 4FMKA 2PYED 2UXFA 3QUYD 4BXVA 4BYHA 1BD2D 2WYZA 5TTRA 3WNPA 5J6HA 2C7UA 1PLGH 3GSNL 3BUIA 2A3TA 3TJEH 1WWBX 3CFMA 3DJSA 3G5WA 3HUJE 3WY4A 4FZ8H 4FZEL 5D1ZI 1A1NA 1Z9OA 2DI7A 3ZK0A 4LPXA 32C2B 1X5ZA 2A73A 3ZR6A 1ILUA 1U21A 4Y1AD 1UXWB 1CL7H 3PFUA 1ULVA 1WZAA 1F11A 4H1LA 4LQFL 4FTDA 3RA7L 4X6BB 3LPGA 3LKPA 5F7EL 5CCJA 2KYIA 2HUHA 3EZ8A 1JZ7A 1QUNA 3VFTA 3V95A 1OPOA 1NUNB 2GBVA 4I0PA 25C8L 5DFVC 4BA0A 1FGVL 2XN0A 1WVZA 1F13A 4HWEL 5ISZA 4M43L 5ADPL 5CIPH 5BNXD 3ARDA 1OXYA 3FONA 1UD3A 2IH1A 3IJ8A 3O8XC 1SM3H 5T3XE 1GOHA 4KKZA 4DT2A 4ELMA 1YYML 4FXGC 4P2RB 5C2BL 2FYYB 3EF4A 1S7WB 4CU8A 4WLCA 3B8SA 1A02N 4JPIB 1GW0A 1MW1A 3A6OA 4JRFA 2KLSA 1T7VA 3BP6B 5D6DC 1BZQK 3L4YA 3N5AA 3INUL 1F4WH 1JIBA 4UZUA 3RUGA 1EZVY 1F41A 2R69L 3TYFA 3QIUB 1FVDA 2H45A 3M88A 1PFCA 4JRXA 4LVHC 1S9KC 4KI1A 1TZIA 5FUCE 4HIEB 4NKMB 3CVIL 4BRVA 4KKLC 2F8XC 5HJDA 2VLRB 3KWWA 4OFVA 5EZOH 3G9AB 4JM2B 1BXUA 2H41A 3X1GA 3OKNA 3ECBA 4GYBA 2VMEA 1NCWL 3A4DA 2MH4A 1HOEA 3CX5J 4HUXA 4KKRA 2GJPA 4YL9A 3CHOA 1T2JA 4KK5C 2ZX6A 4PTTA 4ZTOL 2AC0A 3K74B 1MW2A 5FGSA 3JZ7A 4C47A 3BWZA 2XX1A 1JZ4A 3DHUA 3BPNC 3LRKA 4PJAF 5BRZB 3UTQA 4X7TA 3W9DB 4G1MA 3DPBA 2GSGA 4BHUA 4TRPH 1ID5I 3Q8EA 1N67A 2WLNA 3F12A 3VFUB 3QCVH 1E9QB 4JDEA 5D7LE 1MWAA 2GVYA 4UM8A 1IGTB 4W9IC 2ZKHL 4AE0A 4YLCA 3OAYK 3BCFA 1PMYA 3VQLA 4OT1L 4KUCF 3L3KA 1TSRA 4U1IA 1I9EA 1R3IL 3Q6FB 4G7VL 3WY3A 1MFDL 3ARFA 3KPNA 2P8MB 3NIFF 3NCWA 4UNIA 3TBYA 3EG9B 4MA8L 4O2CA 4XWOD 1NDMB 3X12A 3MOAH 1JDAA 3UO1L 5J11C 4BGDA 3QIUC 2LU3A 3FQYA 4PBDA 4HS8H 5DD3L 1KENL 5E8EA 4LCCA 2OV0A 3SQBA 2KQMA 3WJLA 3T2NH 4WWID 1HHIB 1N3NA 3FPXA 2ZX7A 4JFUA 2BC4A 2NX5B 4GO6B 4LOVA 1IBGH 2ESVD 3O41B 1RZKH 4HT1H 5DO8A 1ONQA 4LF3B 1XSJA 1UVQA 3DSFH 5I5RA 3DUUA 4WI5A 2C9RA 1VKXA 1P4IL 1SY6L 2DD8H 4TQPA 1DVFD 3L3JA 1A5FH 1CICD 4WO4D 3ZE1B 1JXKA 1CR9H 3DXAE 1KTKE 1TVDA 3WEOA 4WKZB 4W68A 4XHJD 3L8QA 1Q9LA 2FNWA 4HAFA 2UY7B 4XWGL 2IV9A 4FQIH 5B3NA 1R3LB 3CLEH 5BRQA 3ZUCA 1KBWA 3LD8C 1RUAL 4JCWA 1G9MH 5IESL 1IGFL 3OXSB 3V5KB 3O9WB 4R6UA 3BEVB 1OY3B 5BOPA 1VFMA 5DUJA 4YHYC 4PJGF 1NC2B 3WG7B 4M6MH 2F08A 5EBGA 5E8OB 1I9JH 2JELL 3U6RA 4Z77A 4GAYB 3DROA 2J88H 1HL5A 4TNWK 4YGVB 5L8KB 4GRLD 4PJAE 1NSNH 3FQXA 3FULA 5ABDE 3ARGB 5EFIB 5AWNH 3E38A 1E0OB 2CJUH 3SDDD 5CCGE 4OQTA 4AIXA 5AL8A 4G6JL 3GSUA 2CBTA 3PV6B 1OGAD 3CPLB 3QIBB 4M6OH 1FZMB 3DVGA 2PPFA 2BOBA 2YZ1A 2AV1A 4J4PC 4HCIA 4ZUWA 1OCRB 3PWUB 3GDCA 1L5GB 2X4UA 4ZG1A 4HK3N 1DLFL 4QNPF 1MCWW 35C8H 3HAEB 1A4JB 4FTVA 4N85A 2QFRA 4XXWC 1J7VR 5ECGA 5GS0H 4H1LH 2FJGB 2O6CA 2QTEA 5BRPA 3KR3L 4I3RH 1UXWA 1R6VA 1LO2H 2QADD 3AREB 4PGBB 3TC9A 2M83A 1RIHL 1PX4A 5E56A 1YNTB 1HL9A 3E8UL 4CGTA 3HUJA 2H6PB 2VN3A 3QXTA 3N43B 3PWLB 4OKVB 4C57C 2WXOA 2JKRM 3O6FC 1AIZA 1NANI 1SHSA 1HXMA 1KTBA 5IW6B 3EXLA 1M71B 3DOSA 1FAIH 3K8KA 3O9WC 4R7NB 3KL5A 5E8NA 4OH2A 1BJMA 2P80A 3E2HC 1S7TA 2EO7A 3M07A 3QCTH 3OHXB 4Z7QB 5EN2B 2ADGB 3BUYA 2DOCA 5I5MA 5AYQA 1Z0MA 1AVAA 2X1PA 3D05A 2C1PA 4LT7A 4XNYL 4EJ1C 5JR1H 2EVJA 2XN9B 2F7OA 2NR6C 1SBSH 2NQ3A 1C12A 3ARGC 5DHEA 5I19L 1M3IA 1S7WA 2ZG3A 2WUCL 5F7BA 3RDTC 2G9HB 3IEAA 4JPIA 3VFVA 1AKJD 2JCWA 4HUMB 1HQRA 3UCRA 5CCHE 2E0PA 2I9TA 3SJVE 2VDKB 2E5EA 2IH9A 4MNQD 4HVBA 4ZRGA 1TEFA 4LCUB 4NQUA 5JDJA 5IFAL 5DFVD 3A4EA 1O9VA 4PJGE 4Y4HC 1T6WA 3O3EB 3QDMD 4HIEA 4NKMA 4QT5A 4X6DA 3RJOA 2VLRA 2ZKWA 5EZLA 4LHJB 3KPMB 4XVJH 1KCSH 2XKNB 3VSTA 9CGTA 1JCVA 1U30A 2MKLC 1KBVA 5KVMC 1URIA 3NCYS 2G5BB 5DUBA 3O8XD 4AG4H 1G1CA 3GS7A 2R4RL 4AV0A 1GSKA 1VACB 2XSKA 3HI6L 4QJ5B 2YUZA 1G9NC 3AREC 3MLRH 4MXVE 1VZHA 3VD5A 1A3QA 5FIEA 4C58B 5HHXH 2BNRD 3FTWA 3VXQA 2F68X 3VXRD 2A6KA 1GHFL 2O6FA 5DMIH 3QYCA 3QZWA 1FYTA 2Z93A 1IAIH 1EHLL 1MWAH 1KFGA 1RUPH 5KSUB 3NFNB 2B3IA 3TN0A 2AVGA 4KKLD 1J5DA 4A2FA 4QNPE 3TBSA 3WTWA 1VADB 4L4TE 1J0IA 3QZPA 1XCQB 3OHXC 1F8TH 1PNDA 4IIQA 1XD0A 4O02B 5CEZL 1KN4L 1UACL 1MIEH 3MACL 2KHAA 3ROOB 1TTBA 5LCVA 5CZKA 4ANXA 3PJLA 4KK5D 1IGMH 4CBZA 1E8ZA 1DN0A 1JGUL 3Q6FA 4OZGF 3I75B 5D7LA 4I77L 3VE0A 1AQHA 2NYZA 3JBG7 1BSIA 3AFLA 5IROA 1H3XA 3FBQA 3NTCL 1VFAA 2PWGA 2WWNA 1MRCH 2GG1A 2JXMB 3B34A 3IDJB 1B4LA 1KBGH 3PREA 2AI0L 3ABGA 4UNUA 1HC1A 4ZXBB 5D9SA 1E7VA 2X3AA 4HH9B 2BSSB 3I2CL 3TJHD 5A3IC 3I84A 4JCMA 1CFSA 2RA1A 1N9PA 4NAQA 4AM0A 4V11A 3UADA 4L4JA 3KDPB 1AGFB 3AG1B 2DPKA 3D1MC 4ZX5A 1WJ3A 2DQTL 3EOTL 4LF3A 4P2RD 4TNGA 2BSRA 1HXKA 2WXPA 1Z1WA 4HUVB 3BGFC 1ZTXL 1CFVL 1XO8A 1MHCB 5EOQL 1M05B 4QLWA 2DTML 3L95A 3QZWG 4E9XA 2Y5TA 2UY7A 3QIUD 3O2WL 4OZFA 2L7UA 3C2SA 3EXJA 3NZ8B 4HIJB 2HT4C 1GCFA 2AJVH 2Y07H 5I6OA 1IZJA 4NJ9H 4OBRA 5JPNB 3U4EA 3DXAA 1J5IA 3BEVA 4Q58C 2RFXB 4IRJB 1UEYA 1LO3H 2AKRA 5E6ZA 5KBNC 3AB0C 4HMDA 1RL1A 3KHQA 4YX2H 2AANA 2IG2H 1L7IH 5IF0B 4X5XB 1WZ1H 4JB9L 4YGVA 1G7JB 5I1KH 1NMAH 4OQTH 4X9BA 1EEQA 2FX7H 3NQIA 3TXAA 4KROB 1FORH 4GLRH 1E27A 1MHEA 1SN2A 1MREH 5B38B 2CLZB 3HB3B 3QIBA 1E42A 1JI1A 1T1WB 3TEUA 5BQDA 4AOFA 3VWJB 1QYGL 4PJAA 1A3RL 2NLJB 3UAJC 1IC5H 3GZKA 2VISB 4QHUA 4B9GA 1X5HA 4HHGA 2NW3B 4G8IA 5KYWB 1L5GA 1E9PB 2PP9A 3VFRA 1D9KB 1ZPLA 2ZUSA 4DGIL 4IOFC 4GSDH 2FJGA 4OKDA 5HGAB 5C07D 1KNOB 5F6IB 3V9EA 2AP2A 4YFLI 3FUHA 2OMZB 1OL0A 3QXDB 5JXAL 4OZFG 1MI5B 4K5NA 5F89A 1LK2A 5AVXB 3ZX1A 2OSWA 2Q2EB 4AEHH 3QNYB 3G7TA 1JPSL 5CFHA 2NNRA 2NY1B 3Q3GB 2EIDA 4NPYA 5JPNC 2NX5D 3FFCE 1KB9K 4IRJC 2BWQA 5AW4B 4U0QB 3RY6A 4NXKA 2WB7A 4D8PB 2QL1A 4BIKA 5EEWA 3V6ZB 1EXGA 1ETZA 1WRFA 4JO4L 5TF1H 1B0RA 3IFNH 4LQ1A 1YYCA 1A3LL 3JWNC 2BY2A 3N85L 5GRUL 2OJZL 4PJ5D 2G5UA 5T3XH 4ETQB 2GIMA 4FXKA 3ES6B 4NM4L 1QZNA 5E1QA 5ERWA 1DBJL 3UTSD 2ATKA 3O6FD 4J3BA 1FIGH 1S5IH 3HZMB 1UYWL 4BH7A 4KDVA 5IBTH 3VSUA 1FV1B 3EYVB 4WU7B 1IC4H 5D70L 4LE8A 2F1BA 1NGZA 5MERA 1A7PL 2WBJB 1MFVA 2PXYC 4JPWH 1KPUB 1Z5LA 1D9KC 4JFDD 2G5BA 2LW3A 1YEGH 4I0CC 4JAMB 4KRPB 7PCYA 3BKYH 2ZWZA 3GRWL 4PJGA 4YUEH 5IMKB 3TVMA 1NLBL 3T0VA 3ARGD 3RDTD 4RFOH 1JRHH 3ILPB 1CO1A 4AIOA 4GQQA 1P6AB 4I5BB 1YEIH 1J18A 3K2MC 2P49B 3NIDE 3L48A 4FJZA 3PUUA 5KOVC 3ZE0B 5D72H 1L9OA 3C6LC 5DZAA 2VSMB 4Y4HD 1G7HB 4OZIB 1RVFL 3CGTA 4OCXL 1VADA 1E6OH 4JG5A 5EO1A 4BGLA 2EACA 3ARWA 1B2WL 1U8NB 1Z9PA 5LCVH 3PGDB 3AG2B 2UVFA 3IETA 3ROOA 2H26A 4KJPC 2H2PC 1MFBH 4RISL 3ARED 4R26H 3MRIB 3C6EA 3VA6A 2HN7B 4ZMXA 4HISA 2L7QA 4FQJL 1RV6X 3MU3A 4OGQC 5I0VA 3BP7B 1CDIA 1QHPA 3BH4A 2JXMA 1EA9C 1XGUA 4XMKL 3CVCA 2KMWA 5F7KC 2QZQA 5SWSE 5JIHA 1MCEA 1P5UB 2Z8VC 3NZUA 4U33A 1N68A 3L45A 1KLFB 4NCC1 3CDGB 3ZKMC 4EI5B 4F57L 5K1NA 1B88A 5CFAA 3KD4A 2P1YA 2VN5A 3QP3A 5IWLC 5D6CA 1E4WL 3UZVA 5DUPL 2A9ML 4PJIB 2D9QB 3SPVB 4HUVA 4NQCB 4UT6A 1YJDC 4OZFH 2CDGB 4AH2B 5I73B 3B4NA 5D7HA 3MV01 1PPIA 3LZLA 4OD3H 4NIYE 1T20B 4V33A 1FG2A 3NZ8A 5FLUA 2E9WA 2EIBA 4P5TA 3QORA 4UT9A 2F5BH 4PMEA 2RFXA 5EIIB 5A3ID 3HC0B 3RVXC 4LAQH 3Q1EA 1KJ2L 3NJJA 4MAYA 2PW1B 1RZFL 4RGMC 4IS6B 1CZ8L 4KY2A 2ICWI 5G55A 3GZQA 1FC2D 3MX0B 4FLHA 1KGCE 2JQMA 4LDLB 1ODAA 4XGZB 4AM0Q 3HIZA 2GI0A 2JB6B 4WGWB 1WK0A 3HRZC 3NN8A 2A7BA 3FTSA 3QZBA 5T1KA 4PJDE 3QUZA 3L4CA 2YUWA 1IL1A 2WD0A 4HWZA 1SF3A 2GJZA 5TDOB 3MTXA 2VB5A 5H37A 4ESKA 1P5UC 4F92B 2HT4D 1MJUH 1CDHA 4YR6A 4NT6B 3VWJA 3HNVL 2PWDA 1XH2A 1FNFA 2DWYA 1ZS2A 4X42A 4XPBH 1CBVH 4EI5C 4DCQB 4KZDL 3HFML 2FVNA 3WJJA 2O5YL 4I18B 3UJTH 5KYWA 4O5LL 2BRRL 3BAEH 4U1HA 1QPXA 2Q87A 4FAAB 1YCSA 1H5BB 1KDIA 1FRGL 3S3SA 1A6AA 2XPGA 2EYSA 5HGAA 1JWUB 1YA5A 1QKZH 3OL2A 2YPKB 1ECZA 4L3CA 4GUQA 3WEXB 4MJIE 3D3VB 4Q6IC 4Y4FB 4OZGA 3V8OA 2IC2A 1OANA 3BH9A 3OJDA 2XBTA 2P47B 4HPOL 1RAMA 4G6ML 2AK4A 1XQ4A 3DSNA 3UAJD 3PPSA 1JWMA 3ZZ1A 5CJOL 5AYUH 4WIQA 3BHBA 2GT9A 3EFFB 2DW5A 3BSZL 3D4ZA 4HS3A 4TVPH 2AQTA 4IOFD 4LFHG 2O6EA 4GJTB 5C09B 1IBYA 2ZX8A 4OLXL 1ZCRA 5A2IH 3KS0J 4KAQH 1L0QA 2XZZA 4OLYL 3CU1A 1GIGH 5T1LA 4DP8X 2QT6A 3B43A 1X5JA 4ETQA 1C08B 1CDYA 5DS8B 5F7AA 4E41D 1MG2C 4YDIH 2P5WB 3IAPA 5EWIL 1SJMA 3HZMA 1UGNA 2XFGB 3QRGH 4KRMB 5EF0A 3U25A 3CVHL 2P24B 2YGOA 4R90H 4WU7A 5HVHB 4ERSH 1ZVSB 4I18C 3GZPA 1CS6A 2LHAA 1J86A 4M7LL 3ABKB 1H5BC 4X7FC 4HXBH 5IG7B 4AZ8B 5KW9L 2C5DC 2C1OB 3ZL1A 3T1FA 1QLFA 3KYAA 3TV3H 3LX9A 1DZBA 1BP3B 4M3HA 5DGQA 3UC0L 3VXUB 5ITBL 4AGQA 2IBZY 3V4PB 1DJSA 4FN0A 4J2QA 5E9DD 1ZXKA 4FFWD 2XY2A 3BZ4B 4QYOA 5FX3A 3SN6N 2WY3B 1VIWA 1I1RA 1MHPH 3MJGX 4YDZA 5FKAB 3TTSA 1N70A 1WHPA 5ICZA 1FFPB 3L1EA 4OB5H 2PXYD 4ZSOE 4LKXB 1TQWA 2YXVA 5IVXF 3B2VL 3C12A 1G6RB 3RWGB 4UAHA 3N0AA 5D7JA 3DUSB 1IEBA 3MRIA 5JIDA 1A7QH 2IAND 4W6WB 2GBAA 3NJFA 1NDGB 2UXGA 4Z0BL 5D5MF 3DURB 4JN2B 2F74A 3C60C 3FQ1A 3C6LD 3PXHA 5KVEL 4M00A 4LRIC 2WP3O 1Z9MA 2W65A 4Y5XA 2RIKA 3CSYA 3FSAA 3S5LB 1TETL 1MUJA 1NBZA 3DTUB 1MCSA 1S2EA 4XMZA 4K4KA 3AY2A 1KLFA 1YMME 2J12B 1WWCA 3FO9B 5E6YA 3AT8A 4YHZL 4XVUC 1CD9B 2DQFB 3SGKC 4KJPD 2H2PD 5SWSA 1EHXA 1KIQA 1TYJA 5FYKE 1MWOA 3EUDA 2CUIA 3KPTA 4FKEA 4UT6H 5C9JA 3S3PA 2WAHA 2GB2A 2H4EA 1EVUA 3QUKB 1CGWA 2HTKC 3BOVA 3ZBMA 2Q76A 1J1XH 4G5ZL 1CF8H 1EMTH 2A6IA 3GM0A 2X0UA 2EDBA 3MGAA 3O6KH 2F58L 4FX5A 4LHUB 3T2PA 4HJJH 3PIQB 3MJ8B 2WIIA 2CPCA 3CSBA 4WVRA 4UT9H 4ES8A 1PVHA 1CK0L 2EKSB 4RBPH 1WITA 2DWDA 1RP8A 1WD9A 1F42A 4G42B 2Y22A 3IPEA 4H8HA 4MJ5A 2PWEA 1OPGH 1X4ZA 3T3PF 2WXJA 4ZODA 4IS6A 3VXMD 2OR8A 3I74A 3MX0A 5DLMH 1OGSA 1J9TA 2DDQL 3MROA 4WWPA 3KPOB 2ZXEB 1AYRA 3GSWA 3B9KC 4F5CE 2KC0A 3ARBB 1J0HA 4NNXB 1JK9B 1V3JA 1CFTB 1KLGA 5DK0A 4G71B 1JF1A 1SQ2N 2X3CA 2I69A 3G5ZA 5FOJA 4R97C 5TDOA 3I9GH 3WHXA 3W5MA 1CD8A 3LPOA 1L6ZA 1R3HB 4NT6A 2ZSVA 3N1GC 5ITFB 1MNNA 3KPRB 2OXGB 3QI9B 5KBMA 4HPYH 3Q8BA 3IU4L 4LPCA 1ECYA 1EO8L 1U3HC 2ZOLB 3C6SA 4WNQB 4YIQB 3I6LE 1I4FB 5ESQA 4K5PA 3WNKA 5I0YA 1KEGL 2X1XR 1CQYA 1FO0A 2JIXD 1UD5A 2PPEA 1JHLL 4B60A 2B20A 5IVXB 4RNRB 3AJ7A 5D5ME 2XXFA 2YPKA 2DM3A 4JEGB 3QO0B 4Y5YA 4Y19E 3UOAB 3N41B 1P2CB 3QWRD 4PV9A 3BIKB 3QH3B 3SPIA 2VLLA 2WYTA 4PP2A 4ONOA 2LE9A 5DC2A 3VXNB 4AIZB 4IRZA 4OLVH 4FNUA 3KPLB 4WEBL 4DKEL 5ID0B 1DLHB 5B39B 5J89A 3SYOA 5DWPA 2HP4A 1BAWA 3JWDL 4XPGH 3W1ZA 1I3UA 4M1GL 2VZSA 1R3JB 3MRGB 4GMSH 1JGDB 4ODSH 4YXHH 4UMGA 4PQXA 2Z31C 5JHDE 4U6XB 1OSZB 3WELA 1HWHB 3RYMA 2OMWB 4EE2A 3ARBC 4UU9B 5D1QB 2W9EL 3P02A 4U1GB 4GKSB 4HZAA 1BXVA 2DLFL 4LNVA 2ICEA 4R4FH 4ENEC 1K4CB 1RZPA 2XJLA 5KJ4A 1MCRA 3LN4B 3IYLW 1OP3K 3T2OA 2I24N 2P24A 1H3PL 4APQC 2H5UA 4QF1A 3T3PE 1AD9A 4O9HL 4G7QB 1V7NH 3KWVA 1CLOH 1AGDB 3T2QA 4PRHD 5HPMB 1DVSA 4LEOA 4NNYA 3RKDC 4XMWA 3RTQB 5IG7A 3S8GB 2LLLA 3QJVB 2FWLB 5JW4Q 1ADQL 2C1OA 4MMYB 1YEJL 4I1RA 2G2RB 4N2GA 4A2MA 3DRTB 1U58A 2GUOA 2X1QA 4XTRC 4JRYE 2MNUA 3V4PA 3L3IB 4JFED 2VLJD 3L3OB 2UYLB 1FDLH 3T6XA 1QG3A 3NQKA 3T5WA 2PETA 4U6VH 3BZ4A 2W91A 2B1HH 2QSCH 4LARL 4H8QA 3SGJC 3W81A 4PW9A 4Y16C 3IE4A 1F6AB 1IM3A 1N10A 3K6DA 2OMBA 5JUEH 5GGVY 1INEL 1A6WL 4DN3H 1QVOB 5FOBB 5GISL 3ZSSA 2NY4D 3DKHA 5HHPB 1DANT 2WTRB 3KPQA 3MV9A 4PBVC 4R4NC 1WEJL 3OWRA 1ZANH 4PG2C 4XE0A 3E9UA 3QPQC 3WJMA 3NJMA 1I1AB 1PLCA 5D1QC 1M1SA 2EP6A 4U1GC 3D3VD 5F7WC 2BS71 1NDGA 4V1DB 4NRZA 4RFEB 4ZSOA 3UAFA 5C0EB 4JN2A 2QQQA 1JMZA 4C4KO 4NWTL 5JHBA 5DZ9A 3H9SB 4UYQA 3S5LA 3VYPA 3IMVA 5TK2A 4CKVX 1AQDA 2IJ0C 5DJ0B 5E0FA 5IGXH 4BK5A 4GUOA 1IEAB 5C0CD 5BZWA 4YZWA 5DD1H 3RTQC 4JQVC 1SXNA 2PNDA 4HSAC 3HC2A 5DVNA 5CSZB 2P8PB 3CZSA 1OT4A 3QEHA 4JDTH 2YJLA 2VXTL 3OZLA 1EK3A 1TQBB 1CD0A 2CCWA 3ZE2B 2X6BA 3N91A 1K72A 3D39D 4Z7NE 4F7TB 5H4ZA 4ICXA 1BM3L 2NUPA 3L3OC 1D6EB 1YMMA 1AH1A 3E6HB 3QUXA 1FNEA 2B9BA 4PG9A 5F1SA 3C60D 5DMKA 1YEKL 1JOIA 4LHUA 4M02A 3HS0B 4RESB 5K9JH 4PR5B 5M94B 3T6VA 1CXIA 5HJBA 1MFAH 2K3HA 3NJLA 5D2LB 5EUKB 1Q1PA 3AC0A 5AAWC 3NBNA 3RURA 1KCVL 3MJWA 3MRRA 4ZX6A 4NKDB 3EYOB 2Z0UA 4LO9A 2FBJH 4QRRB 3QXUA 4P3DB 4GFXA 3L4WA 5DMYA 3UEQA 2MQ0A 4CGUB 2AEPH 2O5XL 2HTKD 4XO8A 3IAQA 1HWGB 4N2NA 1QPKA 3GKWL 1CE1L 2YD3A 2YAQA 4GW5A 1CFTA 4R5VA 3P73A 3HBQA 1XMEB 4Q6YA 2QDWA 1H6EA 3UYOD 1R34A 1ZK9A 1G7PA 4XP1L 5ITFA 3KPRA 4CC1A 2OXGA 4ONGH 3H9HA 43CAB 1HCYA 3MAWA 4N6QA 3GGWB 4WNQA 1FO0H 4E5XB 2QMJA 4Z95L 4G9FB 2BVPB 1I4FA 2L7EA 1RK1A 1DEDA 3HVDA 5E6IA 4TUKH 2Q20A 4OGYL 3B9KD 4TUOB 4MAUL 3FO0H 1RU9L 5I9QC 3Q2WA 3BZDA 4PWKA 4W1TA 4AMKL 5HDRA 1UWGH 1P2CA 3RKPA 4OGAC 2BNQD 3NIGF 3QH3A 4KMQA 2FR4A 2XA8H 4IRZH 4PJ8C 3GLEA 3HS0C 2AXFA 3QR0A 4KQ3L 3UJIL 4ODTL 2B0SH 2XN1A 3VXNA 3B5HA 4AIZA 1BBDL 2Y2YA 3H4HA 4XXDB 3VNZA 5JO5A 3QZOA 5D5MA 3ATAA 3QFJA 3GIVB 2OX5B 5I1LA 1MJJB 2CR3A 4Y19A 1MFEH 1UFGA 3DX3A 2YGPA 1BHGA 1U3HD 4LLVB 3V2AR 1BVNP 3V52H 1MVFA 2FO8A 2CALA 1JPFB 4XN1A 4ZQKA 1R3JA 5AZEL 4FEMA 1P4BH 2J4WL 4JO8A 4ZO7A 5I1AB 2I27N 4UOQA 5E5MB 2WNGA 5KS9E 3V6FA 1A14L 2V17H 3LNHA 3VMOA 2DJSA 5ECJE 5I0WA 1ZTMA 1NH6A 4OIFA 1UZGA 2HPOA 2FGWH 4NZ8A 1J5OL 4J3SA 4ZUUA 3V0GA 1S3RA 4YBHA 4B50A 3EBAA 1YRKA 5B7FA 3BI9X 3LN4A 1XSKA 2YN5A 1BJ8A 2R4SL 3L9YA 1SYVB 4G7YH 3R06B 4UILL 2BNUB 4ZK8A 1FUNA 3ETTA 1OVZA 4KO9A 3FRPG 4WKXA 3FTGB 1BW8A 2I5YL 3IGFA 4YHPB 2ZUUA 4ZZKA 1TO5A 1AGDA 3VW3H 5EEZA 3TM6A 3MGTB 3VD2A 4MA3B 2MNJB 3SCMD 5DJYA 1EH9A 4YDLB 3ZHDA 1I3RB 2Z31D 4MMYA 3RBSA 2G2RA 4ZFGH 1VERA 1JNLH 3KGSA 3QT2A 3HI1B 4N8CH 5BUGA 4YWGH 2NY2C 2VSDA 3GXIA 1S3KL 5E95B 3NA9H 1JN6A 2VDPB 4ENED 2DQGH 3DBSA 5HHME 4F91B 4LBEB 3HG1B 4FJ6A 1PY4A 4UT7L 2CKBB 3SY0A 4P2QD 2ZG1A 2V9TA 2UZIL 5IHUH 4APQD 4JRYA 4AMWA 2J1ZA 2WANA 2HLAB 1DUYB 3FU9A 1H6TA 2DWEA 5HHPA 2B1AL 2WTRA 4QMEA 3RKDD 1M6OB 2BVUA 3C5JA 4JPQA 3A4AA 4G80B 5GJTH 2Z3FA 5DU7A 4PI2A 1FIEA 1JZGA 5GJSL 1O6SB 4J39A 2D9CA 4M7JL 3UP6A 1I1AA 1G7MA 3ULUD 4XTRD 1QTSA 3NIGE 2OMYB 2PABA 3D48R 2IQ9L 3BPCB 4V1DA 5B3SB 5JQ6H 4NQDB 2JSFA 5DZLA 1VGKB 1L7TL 4GW1B 4PJHF 4Y16D 3DDFA 3GLZA 1FYHB 1QPPA 4KPHH 3WFEH 4YK4B 3TBCA 4A1RA 3F64A 1AHMA 4F8OA 2E3VA 8FABB 1GRWA 5F7NC 5IB3A 2Q1EA 1JPTH 2DMKA 2VZ3A 1D5ZA 3H0TA 4EN3A 3VYOA 4HWBA 5HYFA 3J27A 3TA3B 3L3HB 3RFZB 4MCNA 3QPQD 4Q89A 4ENZA 3O3UN 1ILSA 1T1ZB 1E4HA 2WQWA 3MA9L 4X9FA 5D1QD 4GAAA 5DJ2B 4WZ9A 3MR9B 2A74B 4F37F 2X4TB 4I3SL 3KNBB 4QKXB 3UTTE 1UCBH 1D6EA 3D33A 2CO1A 1KC5H 2M1KA 2PCPB 3B3IB 2JLLA 4G6AD 4PY8I 3CBJB 5F0LB 2K6WA 1FFRA 3CFKA 3F7VB 3MMEA 3L5WA 3WIHA 4F8TA 4KQ0A 4TOYH 5D7SH 1CGVA 2Y4SA 4YSTA 3RWIA 1N59B 3IMWA 4JZOB 3RPBA 1BBJB 3IDXL 5I74B 2XWTB 4NUGH 2UZPA 3S9DB 1BQRA 2AJYL 5CGBA 1MCDA 2CO4A 4QRRA 5HYJE 4GG8A 1FJ1A 1Y1UA 1F4XL 2DMBA 1PIGA 2RACA 4BINA 5ADOH 4HIPA 1KOAA 3BE1L 3SE3C 1EHNA 3CXDL 4OAWA 2DS4A 2ICWJ 4WAFA 3GKZA 2DLTA 2NY6D 3WLWC 3P54A 3QDGB 1BGXH 3SGEH 2B16A 2HJFA 4DGVH 3MOBH 4OCLC 3KYNA 2BFGA 4GAGH 1IKFH 4JE0A 3UC2A 3H53A 3CX2A 5F7MC 2AF2A 3LQAC 5TFSH 4DSYA 2DQDH 3AS2A 3GGWA 5CCKL 3RFZC 3L9EA 4N2DA 4KK8C 3HBZA 4TNFA 3T6ZA 1QRND 3FH5A 4JFTA 3PNWB 4TNVF 1OM3L 2Q2LA 2R29L 3CZNA 3K4ZA 2CR6A 2WO4A 3L2LA 2LU4A 1OWWA 5FA4B 2CDEA 4NQXB 1G87A 5AKSA 1Z7JA 3BLKA 3WJLC 5MENE 5I5IA 1KBBA 1U2CA 2XUWA 1AJ7H 4E9TA 1WBXA 2N3JA 4HIQA 3GSNA 4S0HA 1NCAL 1XF5A 3WL9B 4JHBA 1L9SA 3GIVA 3DX1A 2CRIA 4JJ5B 3AY4A 5I74C 4XN8A 3V0VB 1NFDF 2XKSA 2YK1H 1HZLA 4LPWA 2VLME 3WFDH 3Q01A 4KVCH 4PJ9D 5D96B 4P46B 5I1AA 2ZYSA 3OKLB 1Q9KB 4NOBA 5E1GA 3F65A 4LDEB 5IB2A 4HIHA 3WOVA 3HCVB 3DO4A 1V5JA 4QRAA 5F88B 1TEGA 3EO1A 2Q7YB 4PJ8D 15C8L 2YFNA 4X4ME 4ADJA 3JWOH 1SVCP 1QLRB 3FZUD 1SOQA 5KS9A 4QXUH 1R17A 2W59A 4PWJA 4HF5L 1UWYA 1D5RA 4JFVA 5A6IA 1QR4A 2OQJA 1WISA 2VQUA 1T7YA 3KLHD 4K8RH 1IFGA 1INDH 4TQIA 4RA3A 3MODL 1J05A 3H55A 3S5YA 1XZ0A 3E6FA 1FL3A 2XZAL 1UCTA 2R2HA 3DJRA 4JFHE 1YNKH 2A1WH 1Q0YH 2VC2B 5I71C 5D1XC 1AO7E 1K5NA 3SDXF 1NEUA 1TENA 3TESA 4D9RE 2R69A 2CJ3A 1Z2KA 2PTVA 5F93C 4LBEA 4G1EB 4U1NB 3T65B 3HG1A 1KGIA 2F7RA 5L7XH 4Y9CA 4Z8FL 3A21A 2Z91B 3VH8B 1NL0H 1P7KB 1OD7A 1EJOL 2HKFL 3LN9A 1CMOA 1XZWA 2DH2A 4CDGC 4DVRH 2NRDA 4OLWH 1W0WA 4G3YL 3DC0A 5T3ZL 5HI5D 5IUCA 4WFGE 1M6OA 4UF7C 1EUTA 4XB7A 5BW7A 1T0NA 3TP4A 3ZO9A 1S5HB 3WTVA 1O6SA 1EDHA 1H8OA 2O30A 5CILH 5KVDH 1E28A 2NY2D 5CEZE 3BPCA 3RWJB 1GS7A 4LB8A 5HI4D 3TCXA 1RUKL 3FU8A 3IJ7A 1VGKA 3TCTA 3FT2B 2YEZB 4HIXL 2BZCA 2DLEA 2R7EA 4UQ3B 1I1CA 3ENEA 1L4IA 1VDGA 2PR4H 1NFDE 3FAWA 2H9GB 4KTDH 4LP5A 5GSVA 3AGVA 2E7MA 1N4XL 1QWUA 1YN7A 2BZ7A 4U6HA 5F1NA 2A83A 4HWBH 4MQ7A 3G6DH 3O4LE 4PGDA 4POZC 4JFPB 5GS0D 1FSKB 3MLXL 3BO8B 4B9ZA 4Z7OF 4UI2A 1T1ZA 2EH7L 2A74A 4BFIA 4DW2H 1AZCA 3CC1A 4BZ2A 4I0PD 1OAXH 3UL4A 3V0AC 2LLNA 3CG8A 2W07B 3EGDB 4XP9L 1I8LA 5ISZD 3IPBA 5CP7A 2CM6A 1ZTXE 5EBMB 4WSKA 3WIHH 3ARDD 3DX8B 2GBUA 2WO3B 3T4AB 2PPAA 1BQHA 3GI9L 4K9EL 4Q74A 1U8PA 1CPUA 1E4XH 5G5DA 4J3OG 2C9UA 2FZ3A 1S4IA 1OT1A 4JZOA 5D93B 4ZNCD 1J5HA 3RAJH 5FUCC 5KSAA 3RPIB 4WFFD 5DZVA 2EEXA 4HXAH 2VR8A 5JDSB 3W2DH 1NFIB 4AXWB 3SDXE 5L8LB 4RGNE 1DQQA 4JY5L 4QAWA 2NOYA 1D7CA 3V4VL 3ROLA 3I02B 4GEIA 1CGSH 3PDOA 3EGXB 1A4KA 5KTEL 3Q1SL 2UZYA 3EDKA 2H0JA 3TN0C 4WY7H 1P5VA 3QJRB 5HYJA 1IKNA 3Q2NA 1Y6MR 2O72A 3CN2A 3D2UA 3QDGA 4PAZA 3K6SB 5DHVB 5E9AA 4ZDHA 4N90D 5FUOH 2HYMA 4IIQC 5EBWA 3ILEA 2QPEB 2Y24A 4KWUA 2EXWD 2EIMB 4FDWA 3HG4A 1MY5A 2AGJL 2WQVA 1FCCA 5ILTH 2J21A 4YL4A 2OMUA 1MNUH 4TLUA 1DZ0A 1WBYA 5A16B 3FU5A 5K1VA 5K59F 4XPFH 4X4XA 4CNIB 5AD0A 3P9LB 3DYOA 1F6LL 1UJ3A 2JH2A 2HX9A 4IMKC 1OTUC 3L4VA 3MA7B 4F2EA 1NGXA 4ZFZA 3WLWD 5DVPA 1BQHG 2C3XA 5IQ9A 3GSNH 1MCFA 1ZJAA 4KI5F 4RRPA 1QFWI 4NPJA 2DQEH 4RBPK 5K39B 1T7XA 1JUFA 1WE5A 2WLLB 4PJHA 5BQ7B 4Y9GA 2Q86A 2X4OA 5GRZA 2FHBA 4Z7OE 5MENA 3KXFB 3BPOB 4KK8D 4LQFH 1HH6A 3VDCA 3HR5A 3QJHA 2B08A 4X80H 5F7EH 4P46A 1NBVL 2AV7B 2K45A 3MCLL 4AKQA 4KV5E 2XYBA 3FMGL 4I2XB 3EOBB 2FUTA 2I9LB 25C8H 4NZRL 1EJFA 1EX0A 2A77L 3FU7A 1G9HA 1FGVH 5IK3B 4DPRA 5ADPH 2PCXA 4M43H 5F88A 4JLRB 3NUKA 2Q7YA 3V10A 4F8NA 1O6VA 1THAA 2FO4A 2GAZA 4J8RB 2F0CA 4AKPA 5L0QC 4P2CG 4TSAL 3CDFA 1LNUA 3LCYA 1E50A 4Z6AT 1YYMH 5C2BH 2ADIB 2J5LC 5CBEA 3MGOA 1LE9A 1OZUA 1X5IA 2LU7A 5IZ7A 5AB1A 4JGMA 4KOBA 2DMGA 3DOHA 3WS3B 2DLHA 2R69H 2DY2A 5C0BE 3VFWA 4H8WH 1A8ZA 3UBFA 4FHBD 4RRPG 3CVIH 5FDWB 1QEWB 4FQ2H 3T65A 3P3TA 4JK0D 3L3DB 3RY4A 2IALB 2OMTA 1BPVA 2VDLB 3EBIA 5IQMA 1AO7A 2Z91A 4RAVA 4J3OH 3SJVB 5CJXC 4ZTOH 5DHYB 3IDUA 5KWYC 3EYQC 4G59C 3MUZ1 4NC2B 3LJ3A 2YIHA 1R0AL 4NEHB 3NCJL 4MQXC 5D2NE 5LAXA 1ZOXA 5D1XD 3C9NB 2QZ5A 3TONA 3ZL2A 1QFUL 4L2YA 3OBAA 3NVQA 2OS7A 4B0MB 2ZYHA 4QOKB 1N64L 2ENPA 3US9A 2ZKHH 3VGAC 5DJAB 3TT1L 4EN2A 2R1WB 4OT1H 4FTVD 2H9GA 1KTLB 1WS8A 3MUGB 3DPDA 3VGDA 1BVZA 3CHQA 1ZY9A 4G7VH 1R3IH 3ARZA 5LBSL 4DNLA 1MFDH 2GTQA 1CGXA 5E1HB 5DQ9B 4MA8H 1NFDA 3UO1H 3VG0L 2UZXB 2V8MA 4W9EC 1INQA 5EIVA 4BZ2H 3JTBA 4ODVL 5DD3H 2E9BA 1KENH 5E94B 4XCFL 3ABZA 2DJMA 5IVZB 1LEKA 2H32A 3O4LA 3WO4C 1LDSA 2VDMB 4GLRI 4U31A 2ZE0A 2EEBA 5I16A 2Y69B 3BN3B 4K07A 2QEJA 5DZPA 6FABL 2KERA 4CW1A 4M48L 5E1AB 1P4IH 1Z9SB 4N8VA 5DJCA 5I8OL 4POZD 3TVMC 2CGZA 2IPKB 4P3CH 2EQDA 1XD1A 4FXLA 4POUB 3RPIA 5I6XB 3MV8E 2OYLA 1A7RL 4AXWA 4KITB 1ETA1 1YQVL 3V8CA 4PJBB 5C0AB 5EUOB 1XR9A 2EDJA 3I02A 4K0OA 3RWEA 5JTWA 4BSWA 1U8HA 3RVTC 1RUAH 5T3XD 5HDLA 1D2PA 1S46A 1JZDC 2GIXA 5LAPA 2V8LA 4B9FA 5IOPA 5IESH 1IGFH 4KTYA 3FO2B 3S36X 3MV7E 3WMSA 3UBXB 1P9MA 3SDXA 2LLGA 3K6SA 2A9DA 1HK6A 2CHXA 3PUCA 1D5XB 3F7RA 4MA1B 3UGUA 4OF6A 1VCBC 3IGKA 2C3VB 3S36L 3F7PC 2E9IA 3EFDL 3AM8C 1T4KB 1UD8A 3P4LA 4M7KH 4K3EL 3QDJE 1MIML 3FK3A 3FTZA 1KTRL 2ZD0A 3EHBB 4TLTA 4G6JH 3QPXL 2C7FA 1LEIA 3VCLB 2SEBB 1MPAL 3NCYP 3ZDXE 3CXHK 2LABA 1XGRB 2GHWB 1W6LA 4Z3JA 3P9MA 2HRGA 4UV7L 5F2FA 2QHRL 3TN0D 3VVWA 1DLFH 4R0LA 1JDCA 4YHKH 2W0FB 3EYSH 2W38A 3W9EA 4LLDB 2CO6B 4FG6C 4G6FD 2GY7B 4N8VG 4WWKA 5FR3A 1O5PA 3S48A 4MDRA 3L13A 3KR3H 1GGUA 1ZE3C 5C8JB 5D7LD 1CDGA 4Y8DC 3E8UH 3WNNA 3WIAA 3DX4A 3CU7A 1SJEB 1TQUA 3H8NA 4I4WA 3LXCA 1KB5A 3U1QA 1MCQA 1RZJC 3EOBA 3B1TA 1OTUD 2I9LA 3G6AB 3C08L 4WUUB 2HFEA 5IK3A 4DHLA 4BDVA 5GS1B 1OOAA 3LYRA 3GRBA 1KZYA 3FQTB 5KSVA 4XNDA 4P5TC 4NO5B 2F54E 4MA1C 4HETA 1LXMA 3SPJA 2V2WA 3A3YB 3QULA 4MAYC 1IJNA 1Y18A 2C34A 4XH2B 2MNWA 1N8ZA 2ZOKB 4XOCA 4HLEA 1J0YA 1H0DB 4GKLA 4UINH 4BFOA 4YQXL 1TTAA 1I85A 3STLA 2KUTA 3ZRFC 3CZEA 5EA0H 3L9RB 4G8GB 2WUCH 1RZGB 4AY0A 5FGBA 4L3EA 5EHFA 5F97E 3BXNA 2OMVA 3FT4A 3GSQB 3L08A 2VC2H 5DRNA 4M61B 3V0IA 1P1VA 3F8UB 1SOKA 4R4BA 3OJMB 3WS3A 5EDXA 5IOKA 3G6JE 5IFAH 3D25A 5IV2B 1U8JB 3KMDA 3QQ4A 3GT6A 3LN5B 4P5MB 1JCKA 1NGQL 4A6YB 2IH8A 1QEWA 1OE2A 3B7TA 3SO3C 3DXAD 3L3DA 4U1JB 4NCC2 4GO9A 1N2RA 1OB1B 3D6GA 1N5AA 1X5YA 1BZDA 3FOLB 2R4RH 4WO0A 3PYCA 4XBEH 5C0BA 1R5VB 5AW3B 1PLGL 2GBTA 2YQBA 2H3NB 3OF6A 3PDGA 5DHYA 3TJEL 3SE4A 3GRWA 4FZ8L 3JT2A 2QVMA 5C9KA 1N18A 1ZWIB 5FO8B 1U3NA 2J8UB 3QEQA 3CUPB 4M4RA 1GHFH 5I2IB 2VXSL 3C9NA 1EHLH 1MFUA 1ORSB 3JVGA 5GS1C 2ZWSA 1XF3B 1ORQA 4G43B 3VFNB 3RIKA 5JQHC 3QXVA 4QOKA 3UGEA 3X11A 2KZ1B 5D2NA 4AZUA 1A6TB 1KN4H 1UACH 5CEZH 1NGPH 3MACH 2R1WA 3V0FA 4OD1L 2HJLA 4GBXA 1OAJA 4B27A 3PWNB 1F6FB 2QKIA 3O0RH 3EYQD 5GZOC 4I77H 5KVEE 2XWBA 1SM3L 3RIFF 3FS9A 4JFFE 4KUCD 2QQKL 5BOZG 1XL6A 2CIKB 2VDOL 2WQXA 4MQXD 4XAWL 3T9WA 1RSFA 2UZXA 2ZCLL 3HKFA 3TPUB 4LAJH 4RIRA 2R59A 2H32H 4S2SA 1RMFL 2AI0H 2Z92A 4Z76A 3BPLC 3PP3H 4G7SB 3N1FC 5IVZA 1XAUA 2HX8A 3WUWA 3G9VA 1D7DA 3I2CH 1F4WL 3OQRA 1BVOA 2WZ5A 2XTJB 2J56A 3SB3A 4YLQT 5IEKB 1R5IA 2NYYC 4DVBB 1F3DJ 1NCCL 5SWZB 1NWPA 3U0TB 5D1ZA 4RMWA 2DQTH 3I6GB 3EOTH 5EZOL 3U7YH 4F9LA 3QEGH 1TPXB 4JQXA 1CFVH 3SKMB 5EOQH 4HWUA 1NAMB 4FYSA 2DTMH 2MSPA 1S7XB 2WGXA 2WLMA 4PGJA 3TEYA 3O2WH 4WRLA 4JX0A 5C0AA 2VL5B 2GFBB 4Y2OB 4DJMA 5BZDB 3SEPA 3BH8B 3IJSA 1I7UB 2KZBA 4GIOA 3LS5L 4AK2A 4GEJA 4A55A 3T77B 4HOZA 3MV8A 2DYPD 3UBXA 4FGMA 4Q52A 3G5YB 3L4TA 4CVXB 5DF0A 4FJYA 4JB9H 1T4KA 2ADJB 5D7JC 5DEZA 4ZFQA 3TVMD 3D4CA 1DO6A 2OW7A 3NK3A 4A67A 4PLNC 3T04D 1EXUB 1AIFA 1GS6X 2PP7A 1FFQA 3WUWG 5CHNB 3VCLA 3RVTD 2AAAA 3ZU8A 2EUVA 1TNMA 1QYGH 2E56A 3BRFA 1MVUA 4YSQA 2WBKA 5J1SC 4Y5XC 2XTJC 3THML 4WTXA 1MHHB 3QDJA 1GC1L 4YHIA 4HS8L 4UZGA 3ZO0A 2FATL 1BWMA 3D85B 1KEMH 2MCG1 2VERN 4CN4A 2W0FA 3T2NL 2YXWA 3IDGB 4CVUA 5J6GA 4LLDA 4DGIH 1OARH 4MDJA 3EH4B 2BIMA 2OSLB 4BK8A 3SYPA 3T3MF 1MCPL 4L4TD 5JXAH 5EO9B 2YAFA 2WO2B 3KGUA 4KTEL 4LLYB 4YDVB 5SWQB 5M7QA 1SJEA 1KB5H 3UYRL 1A5FL 3MBEA 4L8DB 4X7CC 1JPSH 4KXZH 4NUPA 3M17B 4JQIL 5L9DL 1C9SA 4G7RB 1XXFC 4XN2A 1ZMYA 1B0GA 2XV0A 3OKMB 4UOW0 1QI4A 3RWFB 4YDJB 3UBXG 1A22B 1RZIA 2PO6B 4AQ8A 2R0WH 4NO5A 3BZFA 1G9ML 1PYWA 3B7SA 3QVAA 1HHGB 3MRQA 4FG6D 1XIWB 4YFLF 1T2QH 3LKSA 2XPZA 2ZOKA 3T0EE 4P04A 1A3LH 3N85H 3IWVA 5HYQA 1GGBH 1IBZA 1I9JL 1AHWA 3VXRE 4G8GA 4WW2B 4ICWA 2HCZX 2OJZH 4HUUA 2AZAA 2FJFB 2J88L 1DSWA 2RD0A 2YUVA 4UOW1 2F54A 4M61A 4NM4H 4AKOA 1B3IA 3VG9B 5C0FB 1UYWH 2CJUL 1DJXA 1U93B 2RMNA 1BG9A 4FQHB 4EBQH 5D70H 1U8LB 3CVHA 3E0GA 4V2CB 3DHPA 4MB4A 5EOTA 4A6YA 4P5TD 3QORD 1A7PH 1E30A 2OXHB 3M45A 2K1MA 5ACZA 1G9EA 4MAYD 4HUNB 1OB1A 1M53A 4ELKA 1J5CA 1SHWA 1I3GH 4PV8A 3GRWH 4I87A 4KY1L 1NLBH 2H3NA 1QA9B 2VQ1B 2VZUA 1G43A 4LFHD 3LXBA 5T5NF 2P48B 4PVBA 5I1DB 4FA8A 5ICXB 2WZPA 1X7SA 3HZKA 4Y5YC 1DQDH 4I3RL 1PD1A 1J8HA 2GC7C 3QUZD 4PIBA 4DWHA 5BS0B 3CUPA 3COOA 1AAJA 5I2IA 1YDPB 4HAGA 1ORSA 1RVFH 4OCXH 3VFNA 3F6LA 2YZ8A 1S8DB 4B9PA 2CXKA 1HNFA 4XZUB 3IXTB 5CO1A 3A6CL 2JJUA 1MQ8A 3BUQA 4WV1A 1GZPB 5C08E 2CRZA 3K7UA 4RISH 2TSAA 4B95C 2Y06L 3PWNA 4HBCH 4ZFFB 3QCTL 5AVYB 1JPEA 3QJSB 4BV1A 2AAVA 4G9DB 4PHZA 4RX4A 1NCHA 4FQJH 5JR1L 1TJMA 2BIHA 1TU2B 3T3MB 4XMKH 1LE5A 3TPUA 2OAAA 3NCCB 4M8VA 2Z7YA 2I07B 3FB7B 3LZFL 1XF2B 2YAMA 2AK4D 1XGYH 2ZAIA 4L9DA 5AW7B 3WNJA 4YNYB 3D69A 1QFWL 4JFFA 4DH2A 4FI8A 3K2IA 4F57H 4Q97A 1ZV5A 5DJZB 3MCG1 3QSKB 7TAAA 1YMHA 2I25N 2RR3A 2YHGA 1PD0A 1LWJA 2UWEE 4QXVA 5DUPH 2A9MH 4JKWA 4ZPVA 5GZOD 3QO1A 2YC1A 4WK2B 4XRCB 3SKMA 5B3JF 2NT1A 3FFCD 3F6JA 2IAMB 5HVFB 3DJZA 4LVOB 5T1LD 4HJGA 4QPEA 1S7QA 2HKAA 1A2YA 5HHXL 2GFBA 1VF5C 1WAPA 4DP2X 1LQBC 1JHKL 5DYOA 3KS0H 3AAZA 2JJSA 4QXGL 4XB8A 1F3JB 4XP6L 3OPZH 3VGEA 1IGJB 1SVBA 2NYYD 1CZ8H 3MJ9A 3NJXA 1AG0A 1MY7A 2HT3C 1SLUA 1S78C 3HG3A 2VDQB 3OR7A 1AC0A 3IS1X 2WVVB 3TBTA 3BGMA 1IGML 5B4MC 5AVRB 3B2UD 1NOLA 2JKNA 3MSPA 4RZCB 5CHNA 4XE5B 3IVKA 1CN4A 5C0DA 2EVGA 1OIOA 1OKEA 2X9YA 3ZHKA 3KYOA 3VI3F 4RQQA 4P0DA 3AT9A 5F3HB 2CD0A 2NYKA 1NKOA 4JGJA 1KBGL 4NUMA 1B9KA 3HFMH 2O5YH 1S7RB 2HRLA 4NSKB 4YHLL 1CLZL 1KCBA 2BRRH 5TE6L 3IDGA 4Y0GA 3C5ZB 1FRGH 2XVKA 1I75A 1ZIBA 2OSLA 2E27L 1HHJB 2OL3B 1UXSB 4HJIA 3BP4B 1U95B 5D7JD 4ZS6C 2VN4A 5HVGB 4GW4A 1K8IA 1RHHB 4QTHB 4CC4A 3P0GB 1BLIA 3LQZA 4LLYA 3I3DA 3QUXC 2I60L 5SWQA 5E23A 4MD5A 4KO6A 4HPOH 1EERB 2WGNB 4G6MH 3W39B 5C7XH 4L4VE 4XO5A 3UROR 5I1GH 3PQYB 4X7SL 5H35B 4KHXL 5J6SA 3FT3B 1WWAX 4AE1A 1DEEB 3GMLB 2J25A 5FYKU 2OR9H 1MFCL 2Y07L 1NGYB 4NRXB 1HHGA 1XIWA 5TQ0L 4YE4H 2WSKA 2FJHA 5B3JE 5SWSD 4OLXH 1WSST 4PRPB 1NICA 1QSZA 1ROWA 1YZZA 4MD0B 1XSIA 3IJEA 2F53B 1UA7A 3U30B 5EEXA 4OLYH 1QNZH 4YX2L 3CNKA 1BLNA 3TO4B 3PL6A 3BWUF 3TF4A 3WENA 5DZNA 5GGUB 1CFMA 2GJ6B 1SEQL 5EWIH 4OQTL 5I17A 1WT5A 3T0EA 4EF3A 3CVHH 3P1VA 1U93A 2EYTB 4FQHA 1OP5K 5JHDB 2AJZB 1AACA 5IBUG 2FBOJ 2J1YA 4M7LH 3AW5A 4QXTB 4P3WA 3BD5A 3LNIA 3BKJL 1B90A 3V9CA 3M1BA 3WUZA 1E3FA 4ZZFA 5ITBH 2H6UA 2GK0B 4Y2DA 5E6IC 1E4KA 1QA9A 2VQ1A 4GAJL 5EC1B 4H20H 1KXQE 2OP4H 5T33L 3DTXB 5F7YC 2WHVA 4X5WB 5AVTB 4UM9B 3R0MA 3OC8A 2X4PB 2BOLA 4QRTB 5B1JA 2HVKB 4Z7WF 4NQTA 1F4AA 1QAWA 3HZVA 3S2CA 3TL5A 3KYKL 1KGCD 3NFPA 3X2QB 1J1PL 5MHSE 1QR1B 2Q8BH 1SDDA 2R0ZL 3LKNA 2X5PA 4XZUA 3IRZA 1R46A 3IXTA 4N25A 4DZBA 4WF7A 4K2UL 4KRLB 4YBQC 4TNWF 1KIPB 3P11L 1CD1A 2VE6B 3MNZB 4KGLA 2E8YA 3LZOA 1ROCA 2X1WL 3SBPA 3EJPA 3EBGA 2D7NA 1KYAA 5TF1L 1TZHB 5I1IH 1AKPA 1FGNL 1DBMH 1EEYB 3D30A 3IFOA 4HUKB 1TU2A 4P4RB 1FN4B 4FLOA 3MRPB 5C08A 4J8QA 4F80A 5F7LB 3T6WA 3BWSA 4OZHE 4QCIB 3NPSB 2J44A 1TETH 4OD2B 3FB7A 1WC7B 2IBGA 1R5WB 3IMSA 4ZPTB 5DJ6B 3JWOC 4YNYA 3D8MA 4LPTA 1N7ML 1NLDL 1FIGL 4U05A 4MJID 3CV5A 4ZUVA 1BF2A 4YHZH 4NJAL 4ZO9A 4AQ1A 1QTYT 2UUDK 5DJZA 2HTLD 3NJVA 5F7FA 3SKOB 1KELL 2EE0A 4HCGA 3FSVA 5TE4L 2CBMA 2X2HA 4XRCA 3RVWC 4NPKA 4I88A 5DVLA 1IE4A 2IAMA 3BKYL 4PRIB 5DS1A 4YUEL 4JR9H 3S96B 4QRFA 5BVPL 1NANH 1T5WB 2F58H 4F1ZA 2KH2B 3IDMA 1ZHNB 4RFOL 4BQBA 2XIDA 3IF1B 1CK0H 1IGYB 3L3GA 2IWEA 5AUMB 2QDVA 2F2HA 1FHGA 4GY4A 1JS4A 1UG9A 3BDXA 4PCKA 5D72L 2ZOWA 1IGJA 4QJ3B 1HN1A 2ZJSH 4H8VA 1XB3A 3P3SA 1M7IA 5LCVL 2DTSA 2WMPA 3WN5B 4Q0XH 3ALPA 1O9ZA 3OD3A 1MFBL 1OO2A 4IJ3C 4YSUA 2FEEI 2K3TA 4P9HC 5GRVK 1HI6B 4S1QH 1EJ6A 3CD4A 1YG9A 3NPSC 2V6HA 1TTCA 1SRDA 4X6EA 1IM3D 3UEZA 1URZA 2XN2A 4P5RA 3NP4A 3IT8D 5JPMA 1EO8H 1S7RA 1EFXD 1KEGH 1UQSB 1OM9A 1Y0LA 3D08A 3GBML 4EN3C 1E40A 1JHLH 3OX8A 3ZHLA 4XBMA 1T89A 3OKDA 2H8PB 2OL3A 1S78D 1UXSA 2FWOA 1CQKA 1EAOA 3BP4A 1U95A 4JN1L 2X05A 1YYLH 2GSIB 1LILA 1RHHA 4NZTH 3VO0A 2H0FA 2WSDA 4HX1A 4QTHA 5JXEA 5B4MD 3DBXA 1J9SA 1HSAB 2EDEA 4NERA 4A39A 2FL5A 1MCBA 3GK8L 3LNDA 1VFBA 4UQAA 2WVTA 4DKEH 4P07A 3PQYA 2IWFA 2VGLM 4OD3L 4YJZL 4KFMA 4LKCB 3JWDH