5EF2A

Radiation damage to the trap-rna complex: dose (dwd) 21.9 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5ef2A00
1UTDA 3ZTEA 5EEXA 3ZZQA 5EF3A 5EEUA 5EF0A 1GTFA 1GTNA 2ZD0A 2ZP8A 1C9SA 1QAWA 5EEVA 1WAPA 5EEYA 3ZZSA 2EXTA 5EEWA 3ZZLA 4B27A 2ZCZA 2EXSA 2ZP9A 3AQDA 5EF2A 5EF1A 5EEZA
chains in the Genus database with same CATH superfamily
3OAUH 2ICEA 1DVUA 5E8NA 2ZUQC 4IGBA 3SKUD 3LYRA 4P5KA 5D5MB 2O5YL 1DBMH 3ARBA 3QULB 3WJMA 4DKFL 5CJBA 4HPYH 1AGBA 1CLVA 1O7DC 1CFSB 1AGFA 4AT6A 3FU3A 3KXFE 3QUKB 4J8RA 4ENZA 4QHNA 4OBSA 3PL6A 4B53A 5IB4A 1T1YA 3FONA 4UUJA 2FEEI 3CMOH 4P46B 4XN1A 3U2SB 4HKJB 3QZWB 5B7EA 4G82A 3JYBA 3T4YA 3G08A 4XC1H 1BBJB 3FFCB 3L7EA 4PJXA 2FX7L 4KI1A 2HX9A 1PDKA 5C0EB 2Q3XA 4FQJL 4IMKC 1WIPA 1IEAA 1UM4H 3DTUB 1INQA 4ZRGA 1RUQH 4LKXA 4YMPA 1RUQL 1IM9D 5JIMA 1EWHA 3L3OB 3RVWC 1UM4L 3I9PA 2X3BA 3EO1A 4WWKB 3GSVB 3OGCB 1L4IA 5EOTA 4GKSB 4HKBB 2FX7H 4RX4D 4Z7QF 3T08A 4IKIA 5KS9E 5IW1A 4XC1L 1MVUA 3JUYA 5AVWB 1ODAA 1ZVSB 1KZYA 1TQCB 2VKXA 3HZ3A 3CMOL 3P4MA 5TDOB 3CC5A 4WU5B 2X6CA 3K7UA 3QNXA 1NEPA 5GGSB 4I3SH 1UT9A 5GS3A 4EUPH 2CRYA 4ZMOA 1KGYE 1E4XI 3J27A 1VENA 1BQRA 3HRZB 3L54A 5HHQA 4XB8A 3GT6A 4HPYL 5D96C 3B9KD 3NGBC 1DBML 3V2AR 5F7HA 2F1EA 4N2DA 5MENA 4TLTA 2N3JA 4G7SB 1AE6H 1BQHA 3OAZH 5E94B 3BX7C 4G5ZL 3ZT5A 1ROCA 3VFUB 4Q9RL 4KX9A 4FNSA 5I5IA 3QQDA 1KFAL 2X4UB 5JOFB 4KHTH 1NBCA 4OZFH 4AXWA 5LXGH 2JJSA 2NNRA 5AVVB 3RWFA 3EBAA 1A4BA 3VWJA 5FHBH 5F3BB 1AXSB 1DQJB 3K3QA 3P9LA 4NM4L 5DTFA 1CVRA 3P02A 3QZMA 5ALBH 3QUYD 5GRUL 4XO9A 1MIEH 4GMSH 4PBWD 3NJHA 4TSCH 1XX9C 2I7SA 3OG4B 5D1XC 1FHGA 5ECJE 3WHE1 1RIHL 3QORC 4RFOL 1IGJA 3U0TA 2DI7A 2VOTA 2C3WA 3ZQWA 1KXTA 4JFQA 4PRPB 1NJ9B 5CN2A 3KPPB 4ZT1A 4KRMB 4L4VB 2FX9L 1EAJA 2W9EH 1R3HB 3JWDH 4CSSA 4DH2A 4M8RA 5CZXC 5LBSA 3P77B 5GZNC 2H4EA 4R3SA 3EJZD 3O45B 4JM4H 3U4AA 4AQ1C 3EYSL 5I24A 5C0GB 4GO9A 2GITA 3V4UL 2P24A 2V5TA 4PJFE 4LP4A 3Q8FA 4H8PA 2Z35B 2NZ1A 5D5MA 1TUPA 3HFMH 5T5FH 3F6JA 2NNAB 2WYZA 1YN6B 1ZT4A 1L6ZA 1R47A 1PW3A 3WFHA 4FFYA 1Q9KB 4AQEA 1AGFB 4HCRH 1X5MA 4YDLB 4A04A 1TQSA 1F56A 3VWKD 2IG2L 4ZW3A 3WEXA 1IU1A 4KZCA 4TTDC 4KK6C 1Z32X 3ZY7A 2OMWA 4P2OC 3TBSA 1QRNB 4U1MB 2CBOA 4WQOA 1FG9C 5ITFA 3AGVA 3L9RA 1MCOL 3O4OC 5K5YA 4PGDB 4WI0B 4DK6A 5CEZD 1ZEAH 5D7IF 4ZUSA 4OB5L 5A2LH 4IS6A 4K5PA 5ENWB 5TE6L 4HK3N 5HHNB 3ZZLA 2WXGA 1QR1B 3FS9A 1BQUA 2R29H 3KYNB 4N22A 3U6RB 1BJMA 1EJOL 5TF1H 4A2GA 5ACLA 4LKXB 4L3AA 5C9JA 4AGMA 4UQDA 2F7QA 2UV3A 3LS5H 4MRCA 2VLKA 4RZCB 3L3OA 3GKWL 4PJ7E 3AQYA 4DP0X 4N8CH 1M2VA 3CZKA 1HS6A 3LN4A 5GISH 1SZNA 4K4KA 4NKMA 4R7DA 3EJSA 3G6JB 3PL6D 1H8SA 3O3UN 5LBSL 2BFGA 5FYLL 3IWUA 1DVZA 3HG0A 4H8HA 4ZMPA 1X5HA 2GJ6A 2BWDA 1AGEB 3ME0A 3BP6B 3RWEB 1UB6B 3FO0H 3BUPA 5T3ZH 3UZEA 3PWVB 2EH7H 2FWOA 4LCUA 3MROB 2LGNA 5JDSB 1A6PA 2J56A 4H13C 1HAUA 1EPFA 4KUZH 4WIQA 1MKFA 2V5SA 4F7PB 3ESOA 1UH4A 4HBCH 5GGVH 1E4JA 1CICA 3EYVB 2J88L 1CDHA 4ODWB 3FTVA 4RCAA 2A6IB 3LN5A 4X6DE 5AL0A 3U7YH 1JRHI 3MACL 5I5MA 2XG5B 5FA3A 1UD3A 1DQDH 1FBIL 2VDLL 1I9IH 4WFGE 2WINA 4IBYA 1CE6A 2D7MA 2XWJA 3IXAB 1W6LA 1P6WA 2R0LH 5F8QC 4RQQA 5CO1A 1LNUB 2WBJB 2B0SH 4LDOB 4WW2F 4HHAB 3MDJA 1OOWA 5I1EL 2VC2L 3QO1B 2NXZD 1LWHA 3H3PL 1KV3A 3VRIA 1M9SA 2HMIC 4I18C 1U8IA 1VZIA 1KC5H 4JRXE 3BZEB 2N59A 4YDKH 3EOAB 4CBPA 4XXCA 1DO5A 3F12A 5CWSB 1IAKB 3HE7B 3AXLA 4JRYE 4P4KB 5JHLH 3DX6B 3ARFB 4XAWL 4J2XA 2PYFA 4MMXC 1QG3A 1UXWB 4AL8H 1YUKB 2JIXD 3GINA 4LXFA 1GKEA 1S78C 4JZJA 2J5LC 5DRZB 5DD5L 4G9FA 1MCSA 3DSNA 4YUEL 4MCZB 5I74B 2FEDC 4PPTA 2QL1A 4NI6A 1I8KB 1CGVA 3PS6A 2VMDA 3TBVB 2CBMA 1MCKA 3BVWA 2DQCL 2R2EB 3OC5A 3I75A 3HI6H 3X12B 3UPRA 4RESB 1A6AA 4U3SB 3OJDA 2Y6SC 4N0UA 4GRMA 2OULB 3C60A 5EBMA 4PJ5D 2JJTC 1P53A 1GGUA 2B9AA 2PW2A 4HT1L 2HTLD 5DJAA 4WHDA 3UG4A 4XE0A 3VI4A 3F7VA 4JFOA 2H45A 4JM2D 5E6IA 4JMNA 4K2UL 2WW8A 3V4VH 1KLGB 4FTVD 5F96L 1YEJL 4S1RH 4L4VE 1IGML 3VFPB 3L95B 3E3QE 4K7FA 5HI5C 4DUXA 3GSXB 3F01A 3SQOL 3QDMB 4RZCA 4MFHA 4UM8B 1P7QD 2CPUA 1MN4A 4S1QL 1JPSL 4WFFE 1U4EA 5CSZB 4H88H 4NKDA 4Z7WB 5JW4N 1KIUB 1GVIA 1PLGH 4LCVA 4JGJA 1NC2D 2D3LA 4HIJA 3I02A 3N0AA 2IWGA 2DEXX 1IRAY 3GSQA 4Q56A 3F64A 4ZFFB 2YD2A 1NCTA 3QAZC 4YR6A 4ABWA 4Y4FD 1SQMA 3SODB 2AJ3A 3LQZA 4PJIA 1OCWL 5EZPA 3SGJC 4GEIA 4AEFA 4B0MM 4OD1L 2VQUA 2H32B 1IQDA 1NDMA 2WXFA 1T83C 4C57C 1SNRA 3EBGA 2M1KA 2EIEA 4R7NB 3A23A 4LDEB 4KOBA 4XE5B 1PEWA 4S1SH 3S97C 2X28A 1VESA 2FIKB 1CFNB 5IJBC 4LCWD 4QHUA 1L6PA 1P5UC 4S11A 5D7LB 2HVBA 4XXCC 2P46B 3WD5H 5J11C 1AJ7L 1TFPA 1ACYL 4MDRA 4MJ6B 1FO0B 5C07A 2LU7A 2GSGB 3ORJA 4H8UA 2ORBH 4LHJB 2QGCA 3FTZA 3BQUA 1L7IL 4X0NA 1EFXD 1KPUA 3ZR6A 5EEWA 1NCNA 3P11H 3AAZA 3RGVC 2CGRH 1I85C 1BW8A 1J9QA 2EH8H 4AYGA 4ELMB 1Z9SA 5I19L 4HS6B 1Q9LA 3U9PL 1HI6B 3KNBB 3KG5A 4PJAE 1MHHB 3S7GA 5C08D 3CFTA 5GSRA 4UQBA 5MEQB 3BZEA 2AK1H 4J2QA 5GZOD 3PU7A 5DHXB 4GRLD 5I8CB 2NX5A 2IAMC 1JI2A 5F9WB 4UQEA 3TVMA 4XX5A 4Q52A 1G9NH 4APQC 4JRXA 1N0XL 1GAFL 3QCUH 2BS9A 4FL4C 3X13A 2MHAB 1MJ7L 1S9XB 1EHLH 5JQ6L 1CE1H 4P3DA 5DWUH 4OFIA 5DD1H 3PDOB 4LCYA 5CILH 3QZBA 2QSQA 2Y2YA 1RFDH 2WYHA 1OSEA 2HH0L 2VZ3A 4ODHH 3KWXA 4LEOB 4U3CA 4Y5YA 4Z7AA 2B3RA 2CO1A 2IDSA 3SDDB 1BIHA 2ZQKA 3ROOA 2EKJA 4KFZC 4D2NA 4Z7VF 4KITB 3UYRL 1S9WB 4IKJA 4L9LB 4ZO7A 1QLEL 1DJYA 3HR6A 1XCXA 2X2JA 3OKKA 5HHPA 5DHYB 4P2QD 4HFUH 1MCEA 1CG9A 5C0IA 2WLJA 1Q0YL 4J6RH 2DH2A 2P44B 1KPVA 3CVDA 2F58L 5IQLA 3ESVF 4XCEA 4FNLL 4JPVL 3S5LB 2CO6B 3OPUA 4W1TA 5ALCL 3GSXA 3K2UH 5KS9A 2YPLB 2Y7OA 5SWZE 1NL0H 1YY8A 2ENJA 3R0NA 4OW6A 1JNNL 3WNPA 3QVAA 5GGRY 1EAPA 4M7JL 2K4AA 3NIDE 4XWOC 1J1XL 5JO5A 4XBEL 1CI3M 3DX9B 2K7PA 3RVTC 3UYPA 2WXHA 5HD8C 4KAQL 4JFTA 5FDWA 4OZGA 2ZCLL 4QOKA 4PY7B 5D1QD 5KSBF 3FSAA 4AGNA 1I1FA 2GTWA 2J43A 1SFHA 4UV4H 4PRNB 2VXUH 3OLEA 4M61B 5I1HL 1JVKA 5K93A 5F6HI 4DGUA 2MQ0A 2OSLA 1G9EA 2NY4B 2PWGA 3GRBA 4LNRA 3B2MA 15C8L 1KB9K 3H2QA 3WIAA 1CYXA 2H8PA 4POYA 2B1HL 2EDMA 2EE0A 1QNIA 3KPOB 1NCAL 3WFEH 4HJEA 2A74C 4NX0A 4NHUA 4EJ1C 1BD2E 3CFKB 3MRKA 5T1KD 3W3BA 4RGNC 3L7FB 1E9OA 3BDYL 5T33H 2NT1A 3EJCA 4G9DA 3TO4D 2LE9A 1S6NA 3CK0H 4H1LG 2XWTA 5D8JH 4HBQA 3Q2WA 4D7BA 1JV5B 3UBHA 4N5UA 1FIGH 3CFEA 4N0YH 4LDLB 2VN4A 1JYWA 3KPNB 2YEVB 3OMNB 1MJ8H 3JTBA 4EBQH 3QDME 1E2VA 1JF5A 2DBLH 1SJEA 5I8OH 2VLLB 4ODTH 2CKBB 2TRHA 4WTZG 2Z7ZA 1U58A 2R29A 5DD0L 5E2VL 1QBAA 3ETBJ 3H42H 4X8CA 4OZFG 1XIWA 1AGBB 4IHBA 4DN3H 3PP3K 3BHBB 3MNWA 2ZYIA 4IBTA 4MA7L 1N3NB 4U1NA 3B3BA 1RULL 3FHQA 5EC2A 5I73C 1QASA 2PCFB 5JW3H 5KYYB 3FZUC 1T1YB 5IMMA 1BLNB 2P47B 4YGVB 5AOKA 1VACB 1MRFH 1CXFA 2O6EA 3AM8C 1S9YA 2WN3A 2AQNA 4BD4A 3SO3C 1ZA6B 1YNLL 2CBPA 4NGHH 4GSXA 4FFYH 4FLHA 1A9EA 1NGYB 4BYHA 4G8EA 3LJ3A 1JZ5A 1LMIA 4RWHA 5C07D 4WFGD 1E3XA 1YQVH 1T7XA 4HV8B 1YEHL 3T77A 5F70A 3U4EA 1ECZA 1G5GA 4OUUA 1CXLA 2EJ1A 2Z4TA 4FQXD 4HZ1A 4N2GA 2AK4E 2DQJL 3RE0A 1D5IL 3VRLE 3TCLA 1OTSD 4XBGB 2QVKA 2D0FA 4LEOA 3MV11 3FB7A 3PREA 4F93B 3N9GH 5EOQL 4ZDHB 5ID0B 2BS71 2LU4A 2DAVA 2KZKA 2WXPA 1ZHKA 1CLZL 5GPRA 2YOCA 1NDGA 4U1JB 1RZIB 3G6AA 2WZPA 1NCBL 3MRNA 4PTTA 2IGFH 1V8HA 1ZGLM 2C1OA 3TJEL 3ZE1F 1S5IH 2LT9A 1OANA 3RTQA 3WS3B 3DUUB 4WNQB 2X70A 3HMXL 3SKMB 4XI5C 3W9EA 3QQ3A 3O41B 4PY8I 1TVBA 4JUSA 1MCIA 2H3KA 3ZTJH 5I1KL 5C0IB 5JXEA 3VSVA 3MJ9H 4TRPH 1H0DB 3D85B 3EJYC 1ZLUK 4ISVA 1YJDC 1V7MH 4MAUL 3MRJB 3BXNA 1KTKE 3WGUB 3VFUA 5JNYB 5ETUB 1W72L 3LKQA 1EFXB 1Q9OA 3MRRA 4OU3A 2FT7A 3FO9A 5I0YA 2G60H 3GJFK 5FKPB 3Q1SL 4NHCL 3MGOB 5FGCE 3AREB 4PVMA 5TE4L 1TQBC 2BVTA 1OCOB 2PCPB 4M4RB 4U1IB 3GUTB 1T1ZA 3P9LB 1CFTA 4P5MA 4O02H 2AJYH 3UP6A 2PLTA 4FNRA 2GTWB 4N6RB 2FR4B 3UBFA 2XIBA 3PWUB 4JN2B 5IFAL 3OZ9L 3BGMB 4N90E 4WCYL 2O61A 1RPKA 2AXFB 1PZSA 1TTRA 4XPAH 5DT1L 4NN5B 3TV3H 1PX3A 3OMAB 2R56H 2JKTM 4LU5L 1GHFH 5BUGA 3GZPA 5IUSA 1DBJL 3KPOA 3HS9A 4LO9A 2CSPA 2D0GA 5C3TA 3DV6A 3ZYOA 1IM3A 1HCFX 1OAXL 4N2AA 4OCLC 3V79C 1A1MB 4AYDC 1IGIH 4L4JA 3CH8A 4X6CE 1O6TA 1BFVL 4NXSA 3T2NH 4KNUA 3SDCD 4ES8A 3L2NA 1JV5A 1BAWA 4GNKB 3MJGX 4AY0A 4ORZC 5D2NB 3UBXB 4NBXB 3MFGB 2HWZL 4N24A 4OLVH 5CGYD 4Z7VB 4H25A 4JKPL 4GIOA 4PRHB 3EXJA 4HEPA 1PZBA 4RNRA 1E8WA 1TJGL 1C5DB 3D2UA 3DECA 3HBQA 1MCHA 3QQ4B 3L3JA 1W2KT 3WFHB 1BM3H 3MNWB 1KGJA 1KBBA 3KLSA 2WTRB 4PJFB 1E6JH 4QRRD 1SN2A 4OKVA 4JY4A 3IDMB 3Q7JA 2XA3A 2XVLA 4UANA 5SWQA 4D0BA 3CFDB 8FABA 1IGTA 3HMWL 3QZPA 1A3QA 1UEMA 4TL4A 4MA8H 1O0VA 1VGEH 1UCBH 3TZVC 2VT0A 4ZS7L 4WF7A 3HE6A 4NPYA 4Y16A 3QHFH 4AK2A 4G43B 4IBSA 2VZTA 3W38A 5IHZB 4M7LT 4KVNH 5C09A 5DK0B 4XWOD 4Q9BA 2HJKA 3FQXA 3ULUH 4OUUB 3PQYE 4JCMA 4M5TA 2X2YA 5FC9A 5IJVA 2EIDA 1FYTE 2ARJB 1CFQA 1T7VA 5FA4B 2H0FA 1HZHL 2MNUA 2ZXGA 5EULV 1OHZA 4GP8B 2J4WH 3MSPA 4PAZA 5ESQB 5BMFH 1U8CA 3WEOA 1NC4A 4JFXB 4ZSOA 2GCYB 4J3VA 1FVEB 4WK4B 1CFSA 1I53A 1XO8A 3F62A 2GK0A 1WTLA 2VR6A 3LQAL 1HHHB 4OFPA 5E0FA 4ABUA 3OKMB 4J3BA 3DUUA 1KDIA 1YEFH 3SKOB 2ZOKB 2E6JA 4MD4B 4OFYA 3BUIA 1UCTA 2BIMA 3O2WL 3JXAA 1R0AH 2YUWA 1AXIB 4M6NL 4BINA 3NJGA 1WLHA 2ITEA 3I85A 4KMLB 2Z1PA 5C0BB 2XN9B 2FZ3A 2YIHA 1LGVA 3SPCA 3VI3A 3TA4D 4ZX5A 4C58B 1D5RA 1UZ8B 3DA0A 1EFXA 3BUDA 1C5CH 1W8EA 2DQMA 1JXFA 1QHQA 5IG7B 4EXPX 2O30A 4ONGL 3V0FA 1PIGA 3LZFL 1NDTA 3VGGA 1N2RA 1RMFH 2VQ4A 1CE6B 2XWJB 1ONQB 2AK4B 3DBSA 3LIZH 3RPBA 3D4CA 1N64H 1TZGL 3FZUD 3HZYB 4POUB 2NY5L 4WEUD 4X6DB 1KTDA 4XP5L 3N91A 2EACA 4KMQA 5T1KA 1HHIA 2BY0A 3LV3B 4JCWA 3OWRA 4L3CB 1TXKA 1KYUA 3BRGC 1F6AA 3O9WA 3O6FD 5HHQB 3GXPA 1Y0LA 2FNWA 1OTTD 4MD0A 3SIKA 3D87B 3PXHA 5CWSA 1L9SA 1S78D 5FYKE 2JNZA 3Q43A 4YDLC 5CHNB 3LS4H 4F3FB 1Q1PA 5T1MB 2J8UF 4JZJB 5EORH 4QRFA 5IMLA 4ZUUB 5E9DE 2QVMA 2N0MA 1EXUB 1EO7A 1QA9B 2VLRD 1P4IL 4QXVA 4RDQG 2R8SH 4JRYB 3MRLB 3Q8EA 3W0WB 3WAKA 4FNUA 4AEHL 1SY6A 3K4AA 2A4ZA 2XG4B 5DQ9B 3RVXD 1MUJB 3ARBD 3QUMB 2IMNA 5IEKA 5E70A 2Z8VC 3L5HA 1HWGB 3EGSB 1KYDA 1XZWA 5TQ0L 3BSGA 3FPYA 1ZT7A 3ZDZE 5H37H 3U1PA 1JTOA 1J48A 2WZ0A 3CTTA 5HTSA 3QDGD 4ILDA 1S7TB 1JE6A 4YSOA 1XTLA 4BBWA 3CH1B 5LVEA 3LSOA 3VFGL 4DK5A 1E3FA 2H7WA 4NOBA 5C0AD 2UY6B 4D0CA 2MRYA 4LOEA 2JVUA 3MV8B 4GKZA 1JRHH 3BEVA 3RAJL 3RI5F 3GIZL 1FE8L 4MCMA 3ZKND 5CGTA 5JXEC 1XVSA 5KOMC 2W0FA 4KY1L 4Q4EA 5CLWA 2W60B 3FTXA 2IF7A 4XXDA 5FO7B 4S0HA 2V37A 3PUCA 3T4AB 4KK6D 1IAOA 2XN0A 5FS5A 1FNLA 3S4SG 4ZPTB 3MRPA 1FIEA 4J3SA 2P5ED 5D2NE 1FYTA 3ZQ9A 4QRRA 2GCYA 3NN8B 4MHHG 5I1JH 4CW1B 1U3YA 2WZ6A 4ZPVB 4ZNEA 4JW3A 2ZTBA 2N56A 3RWJA 4NDMB 3RWCB 5KG9A 2C1PA 5DD3H 3SHSA 1ZKAA 1CBVH 1G7JA 4HD9A 4KV5E 2QLVB 3IXTA 4F57H 2QQKH 1HJBC 1WWBX 2BFVH 3QI9A 4U6VL 2CH8A 3WNJA 1W0WB 4HIEB 4JFDD 3ZTNL 4UM9B 1HSAB 1RSFA 4FX5A 4GSUA 1J5HA 3IFNH 4E0RA 1T5XA 1JMZA 2GJ6E 1J9CT 5CCJA 1XB3A 5C92A 2FVNA 5HHOE 3MOQA 4JFFE 2DBJA 5FWQA 3RGVD 1A6UH 5AYUH 3UZQA 5IESL 3O4LD 1WAPA 1J5DA 1OQXA 3ECWA 3CDZB 4X5WB 2AANA 1X44A 5KVFL 3G5VB 3WFCL 4ZTEA 2VLJA 4PTUA 5F1NB 1HHIB 4KJYB 1EK3A 3ZDZF 3QHTC 1OT2A 5T5NG 3WNIA 2MIZA 5SV4A 2MSPA 2YEQA 1I1RA 3NEXA 3Q1EA 4MJIE 4A6YH 2KPNA 1X9LA 2ED8A 1J1PL 5KJRH 3O6LH 2JJTA 3NCJH 4K3EL 1IBFA 3PQYA 4I18A 1UQSB 4UDTA 1U8NB 1MY5A 2B5IC 4O02B 5JXAL 4NJAL 1AFVL 2R2BB 3TOPA 3VE0B 4RIRA 3QNXB 4HX1A 1PLCA 1BJ1J 3GMMB 1H6UA 1MY7A 2ADGA 5IWLC 4JRYA 1MG3C 4HOZA 4HXBL 2C9QA 3OQRA 3VJ6A 2YSSB 1MI5A 1CCZA 4XPGL 4ZMXA 1VFMA 4ABVA 2DV6A 4PJGF 5LAXA 1RLBA 5KVDE 2VMFA 5IMKA 4KKNA 3MBEC 7TAAA 4DWHA 4MA1B 2CLVB 3BUBA 5L2KA 1NWPA 2QGEA 4LASH 3V6FB 4DGVH 1HQRB 2VIRA 1MNUL 4IRSD 1NPUA 2KZ1B 3MRFB 4MD5A 4WEMB 2I07A 2P52A 1MCCA 3D9AH 5D7KD 4FXGA 4F20A 2DQUL 2GBUA 1MHEA 4LSSL 4PV1C 1WFTA 4RFEA 5HDWA 2A6JB 5LCVA 1MCWM 3GSNB 1JUFA 4HIHB 2Y5QA 2ZX6A 1FH5L 2LLLA 3D33A 4Y1AA 3NQIA 1DJZA 2AQPA 1Z9NA 2X6UA 3FO2B 4YXKL 3F7LA 4XNMA 5KS9B 5L9DL 2X12A 1LO3L 3K81A 3B5GA 3RWHB 3ZZ1A 2R1WB 4ZX3A 2I60L 1Q9WB 4LFHD 1YMMD 2XKNB 1I1CA 2XTJD 4UBDC 4I9XA 4L4VA 5KZCD 2Y5EA 3FFDB 4KO9A 4NNXA 1ORSB 3B3IA 4YHKL 3FNKA 4GINA 4Y5XB 1CDBA 1WHOA 3B34A 4JM2C 5SWZB 2XPGA 2VXSH 1DBKL 1A4AA 1MW1A 2HLAA 3NFNA 3C60B 4HC1H 5EU4A 3H9YA 2X41A 4AENA 3AACA 5E2UL 4PREB 4WHYG 3ABKB 3NIDB 5BS0B 1UD5A 4OLEA 2EINB 4EO5A 1CLOH 3LMJL 2YFOA 2WWNA 3MRDA 2ZYSA 2BW4A 5IBTH 1AD0A 3WXVH 2HVJA 2F54D 1N26A 1U8MB 3NTCH 4YDJB 5GRVL 5F44A 1LWJA 1L9QA 4MXQD 2R9HC 1N0LA 1EZVY 4HUXA 4QGTA 3WEXB 4E9YA 2DWTA 2NTFB 3NT0A 4ODBD 2IWKA 3ZTJG 4BKTC 1RZGB 3HI5L 3MUGB 1I7TA 3BKML 5SWSD 3BAJA 5AW2B 4LLWB 1RJYB 2W91A 1UZ6E 1SJEB 1MFCH 3DURA 5GRVK 4KGJA 3GMOA 1VEOA 3FN0H 5DZPA 2NSXA 3U83A 2HRPH 1U58B 1UWFA 1CUOA 5TQ2H 2Z6FA 2ZCHH 4LBEA 3LKOB 4ORGB 1KSRA 1RI8A 2ALWA 1B0IA 4PRPE 3LRSB 2QADD 4WK2B 4H20L 5DRXA 5LG6A 3TJPA 3LDBC 1J0JA 1TT6A 1K4CA 3ZKNC 5DD6A 3WTSA 1JDDA 4G7RB 4GIPD 1IKOP 3FK3A 5T1LB 1KXVC 3BP5A 2YR3A 5ICXB 3HNVH 3UTTD 4G71B 4R0LA 3EHBB 1HK6A 4FZEH 1YHPA 1U3NA 4NUGH 4NO0A 2WVVB 2ZSWA 3QSKB 3QHZL 3CVCA 3KXFA 5E99H 1QQDA 4HSCX 4BKLA 1B4LA 4HF5H 5DZ9A 2ADGB 4LE8A 2MKWA 5C0BD 3WL9A 5IHBA 2GJ6B 4BFIA 4CUCA 2IPKB 4KI5F 5AW6B 3TA3A 2WWKO 2YGNA 3OLIA 4PRPD 1T0OA 1F90L 5D1ZI 1YMHA 4J3TA 2UWEF 2WCPA 2BY2A 3G6AB 4P3WA 1GGIH 3V52H 3V0AC 2NY3C 4BV1A 2WYTA 3DVGB 1AP2A 5DJ2A 3WS3A 4ALAC 4PRIB 4OAWB 3MRFA 1UXSA 2VB5A 3KPRD 4P8QA 3BAEL 4RISH 1D6VH 1PX8A 4HKJA 5AAMC 2M2DA 4F2EA 3O6ML 3H7LA 4K07A 1D7DA 1JCVA 1U42A 4Y19D 5E6ID 3VD9A 3U7AA 2EXYD 4I87A 4DCQA 3IXAA 1AKJA 4QYAA 2QTEA 5L8LB 4UU9A 3GMPB 3HNSL 3M1BB 4TPRL 43CAA 1F42A 2VUKA 5DQDH 2NY4C 3FFOA 4YDVA 3BVTA 3BGFC 1XCQB 1IGYB 4L8DB 4TUJB 4X8JB 2X4NA 1Q9WA 3QRGL 2V7HB 2XFXA 2YARA 4FF9A 1TF4A 5E4EC 3SDDA 1UWXH 2NXYC 3ZZQA 1E4KC 4MDIB 3MCLL 4P4KA 1S7RB 3IRCA 4CGUB 1FPTL 3L2LA 1TJHH 4AQOA 1NGPL 4YWGH 2MCMA 3GSUB 1DQKA 5HDBF 2WLNA 1QO3B 3OAYH 4M7KH 3WTTA 5HGDA 3ZRFC 5F9JB 4X80H 3DJTA 4P05A 3O2VH 5EZLB 3WEMA 5JIIA 2HX8A 4L5FL 3DRQA 4XO5A 5DHVA 4KKAD 4MJHA 1GJUA 2DH3A 2X2UA 3LAFA 2Z64C 1EBAA 4XCEB 1D9KD 4JDVA 2OMUB 2ZP0T 3U30B 3KEHA 3QJRB 1CQYA 5DJ6A 4IMLA 1WZAA 5FM5M 1P4BL 1B2WL 2DQ6A 2WQAA 1X5FA 1DE4A 3MOBL 4K3JL 3KS0J 3FQYA 4LCCC 1TTGA 2BINA 3I74A 5JOFA 3BJ91 5HDOA 5JUEL 4XNZB 2OQJB 1HQ4B 2JKNA 2XETA 2UZYA 1NGXA 4KKCC 1FNSH 2L7EA 4XN9A 2GJRA 2H9GB 1DLFH 4PY7A 3VXPB 2BMKA 5BJTA 4ZOAA 1Y1DA 1U3HA 5DC9B 3DYPA 4JO1L 1NGZB 3KJ4C 3Q5YA 1B0WA 5DRWB 5F7UA 3ARDB 4X6BB 5JIDA 1ILSA 3HC4H 4WWOA 1XGPB 3X17A 2R23A 2FEJA 4B50A 1IGJB 1DHKA 1BIIB 2UUDK 4EKXA 1J0ZA 2V2TA 1V7NH 4IEFA 5D1ZB 3RDTA 4YHZH 2Z92B 5TE7L 2FJSA 4E9RA 2WNKA 4LHUA 2V0AA 4IJTA 4G9DB 3ALXA 2VDKB 4R7VA 4JRXD 4UOZA 5GS1A 2WO4A 2DLFL 1LHZA 1WAAE 4AZUA 1T5KA 1T7WA 4NKIH 3L3HA 3GHBL 5E6UB 4YBQC 5PCYA 1NANI 2GITB 1ZIBA 1DANU 1R3JA 1URZA 1MFNA 2A6DB 2X7LB 2CBQA 4KDTA 2Z31C 4Q6IA 5AAMA 4KZDH 4MMZC 3D0LA 3HKZA 4YSDA 3S96B 5HJ3A 3LZPA 1MWAH 2Z34A 3AB0B 2ZKHL 4YS4A 2AS5M 2R7EB 5JMRA 3ZO0A 3V5DA 5FKAA 2O6CA 4ADGA 1W72A 2HUEA 1I8IB 4F24A 4F7KA 1K5NB 1H8LA 5EZIL 2OMWB 3PP3H 4FRWA 4ZAKB 5D7LA 3GHPA 2V8MA 3SD2A 3C5JB 3ZQXA 1O7VA 4NKOA 2HJFB 1LDSA 4B7LA 4OFDA 4Z3IA 2DLIA 2JKXA 4LVOB 1QR1A 2GIYA 2VSKB 3ERXA 1WFNA 4LRIC 5F7DB 5KAQG 1IBGL 3TBWA 3D3VB 4WO4A 4ZOEA 4NC1C 5G4OA 1IC5H 2BSDA 3REWA 3KLLA 1T5WA 2D31A 1N5AA 3MFFA 4NN5C 4GG6F 2MTPA 3IDIB 3PNRB 5GRWA 3EFOB 5HGBA 4I5BA 1IVLA 3M46A 1A66A 2IANB 3V0JA 3S98A 1WZ1L 5IJCC 1TITA 3N50A 1AH1A 3QJSB 5KVEH 1A6WH 1TTUA 1OAUH 2ATKA 4LVHC 4PTTB 5KTEH 3ZHLA 4GQ9H 3VXME 1A3RL 1QO3A 3KLAA 3R1GL 4K3HA 3D85D 5AZ2H 3WFDH 4G7QB 4L3CA 2AV1A 3SBWC 2E7HA 5I16A 5AZUA 3I50H 3S37H 3NZSA 4WI6A 3C6SA 1L3WA 4GRLA 3BD4A 3GZKA 2WXRA 2D7NA 4LLVA 1A2YB 2P80D 5KN5B 2MEJB 1KB5B 2WKGA 3ASOB 3LPFA 2EECA 3B2UC 2EC8A 2DQIL 1GOHA 5AKRA 3HRPA 2H6PB 4Z23A 5I76B 3QDAA 1JVOA 1RIUH 3QORB 1N19A 1UKSA 1JTTA 3MRBA 2IGTA 4L23A 1DUZA 1WD9A 3KBHE 1MW3A 2XG5A 4YSUA 2VAJA 3K74B 4H8WC 2VL5A 1CB4A 1IQWL 5L2KD 5D71L 4MNGA 1DYZA 2VDNB 3CHPA 3TTYA 3TZVB 2WAQA 5IW6B 1UENA 2IBZY 4NQVB 3IMSA 4CN1A 2CJUH 4LQFH 3QUMA 5IEKB 4PJAB 3SN6N 5CSGA 5DFAA 1I3UA 3LHPH 5E9DB 3JV5A 2BSTB 4G8GA 1DFBH 3MNVA 3ZJAA 1M7IA 4FQIH 2GUYA 3TESA 4HUVA 2WCSA 2OMZB 4LCCA 1RY7B 4MBOA 3A4FA 2YD6A 1IAKA 4XVTH 4HZLA 3CZLA 4A38A 4KH9A 4N9GB 4HXAH 1ND0A 4RAVB 3V9CA 1K4DB 2B3IA 1HEJC 3WLWD 5FLUA 4TOYH 5CBEA 3KPLB 5ADOL 3U36A 1YEGL 2P5WA 5CJOH 3O9WC 4L3EE 1TVDA 2W65A 5CN1A 3WE6A 1KJ2L 3NH7H 4JEGB 2F7RA 2YJLA 4QY8B 4NNYB 5E8PB 2WP3T 3GWJA 3ECUA 4PG9A 4YQXL 4QXGH 1BG1A 4OY9A 4AW7A 3CFKA 3GLEA 1A6AB 5HY9B 4NIKB 2V6HA 2Z8SA 3S34L 5J1AB 3RVVD 1MJUL 4DTGH 1H3PH 2DQTH 1QLRA 3KR3L 3HNTH 3SZ6A 4X6DF 3JWOH 2LOEA 3O45A 3VQMA 2ICCA 3HZKB 3WJJA 1NMAL 1XXFC 1P5VB 4F37F 1LO2L 5SWQB 2NCMA 3IXTB 4UTBL 3C6LC 5I9QB 1BD2D 1KXHA 1V10A 2QQNL 3KYKL 4PRDB 4QJ5B 1BJ8A 4HMCA 2OX5B 2YPLE 3NRFA 4ZUTA 1HU8A 4BZ2A 4ONOA 1UA6L 3O3AA 4JDEA 4TN9A 5JHMA 3H53A 2WSDA 3ZMNA 3HE7D 2F6AA 4QRSA 3TEXA 5LGJB 4PJ9B 4U33A 1FDLL 5IVXF 1RZFH 4GXFA 5FW8A 1W6WA 1TEYA 2HVKA 5ESQA 5I2IB 2IDTA 3WOVA 4YEEA 3QEQA 4BHUI 1ZPLA 3T0EC 5F7EH 4IRJC 3NSXA 3VXRD 2VLKE 1A9EB 1MG2C 4FLSA 1FCCA 2L7UA 3GEFA 4N0UE 1T22B 1RUKL 2VM3A 1WT5C 2G4GA 3HG1A 3II3A 4ENED 4JFFB 2IBZX 2NY2D 4BFOA 5C6TL 1QBLL 1TTBA 3MYJB 1IEBB 1E9PB 3ATFA 4WW1A 1MREL 3E38A 2XVKA 1A21A 2WM0A 1HZKA 1SMOA 5DEGA 4NI3A 4C4KO 4OLWH 5BO1L 4AV0A 3OM3B 4FXTA 4LCWB 2D0HA 5EHFA 4U6XB 3SDCA 2R2BA 3TWCH 3L1EA 5DA4A 4DP2X 1IAII 3Q8AA 4RSYA 3VFSA 3OKDA 1TQTA 3CQPA 4NZUL 5KVDH 4MNHB 4X6EB 3F58L 3AG3B 3B83A 3Q01A 3GMQA 3IK2A 3IU3B 3RVWD 1JN6A 2BLFA 4F8LA 1KTDB 3WTXA 3DMMD 1QW9A 1R3KB 3O3DB 3VWJC 5JW5B 3GBMH 3H85A 3VYOA 5I74C 3GBNL 2BSSB 2HG5A 2YMXH 4TNEA 1AZNA 5KW9L 5F7YC 1PD1A 1HILB 2QFRA 4NS0A 1CFVL 4Z7UA 4AUYA 4KDVA 4DN4H 2YN3A 2KT6A 3VXMB 5FA3B 2LAGB 4FMVA 4MJIA 2BHYA 3T9WA 4LQ1A 1HH6A 2DI9A 5DJCB 3DI2B 2ZG3A 1WBXA 1EVUA 3MJ8B 2O5ZH 3HB3D 4ZUUA 1FNFA 3FMGH 4OQ1A 4JFVA 3GI9H 4IGBB 4H8WL 4EQ3A 4JN2A 2DRUA 1T2XA 2OJZL 1DBAH 4LLAA 3EFDH 1J8HD 1CXEA 1FFQA 3FU0A 1P7KB 1PJ9A 2WBXA 4Y5VC 2APXA 3IS1X 1C7SA 1ORQA 5D7LD 3KH3A 1JL8A 1KJ2A 1JPTH 2CDFB 2F19H 2KUTA 3VXNA 1BOGB 3B8SA 3OHXC 4GW4A 3NYKA 5CLTA 4KK8C 2IXQB 4YFLF 1JIBA 2EIJB 3KL5A 4G72B 5E1IA 3UROR 4DF9A 5E2TH 5C6PB 3ZIMA 2CDEB 5E23A 3THMH 5G4NA 5IQ7L 3V9EA 4DOHE 2Q8BH 4OZ4A 5DJDB 4PJ5E 1JZ4A 2BP0A 2IJ0C 2IDQA 4L2LA 1CTMA 1N6QH 1T66C 3QIBC 4LVEA 2MOQA 5BRZA 2B2XL 1A5FH 1U3HD 1OSPH 4QRSB 1HYRC 3PCYA 1UOWA 5I1AA 1BZ8A 1VRSA 4NC2B 4DAGH 1SHXA 4P57A 1UWGL 5E6SB 4JN1H 4NRZA 3AXHA 4KTDH 4WU5A 3EBIA 4AYMC 4D0BB 5K33A 3GFUA 3NP4A 1OAYL 3LQMA 8FABB 2VDRL 3DURB 1NFIA 5CAYB 3LZNA 4K7PY 4APQA 4WFFD 2CA4A 1TLKA 3MNZA 4IJ3B 1JGVH 1L0QA 3L4YA 2Y06H 4I48B 4Q7DA 4X4ZA 4NZDA 4NDMA 5E6YA 5DRXB 3OAWA 3CXHJ 3VSQA 1BSIA 1X9UA 4E5XB 3ZE0B 4ZMYA 3BSZL 1OIOA 3VWKC 5FYJU 4MCNA 3QI9B 4OCNC 1FHNA 3B7SA 3DPDA 5CZVH 2UXTA 4FXGC 5CXPA 5GS2H 1PU0A 2X4OA 4GG6A 4Z7VE 1FVEA 5A2KH 3FT3B 4WEEA 3FXIC 3L5XL 5SX4H 2A9MH 2BVOB 4GXUM 1M57B 4WSJA 5DK2B 2OL3H 1GGCL 4E41E 1B0GA 3QUZA 4YR6B 2PXYC 2WLHA 5I1CL 1LO0H 3B2VL 3D3VD 1NCGA 2VXTH 2VZOA 2NY3D 5T1DH 2ALAA 3DVNA 4ZW6A 4NQCA 4Z77A 4ZI8A 2XXCB 1WA0X 2YRLA 3TU6A 2G0KA 1S7VA 3AU1B 4UT6H 3GZOA 1UZ8A 3S36X 3VYPA 3RZWA 4XCYB 5HI4C 5TK2A 1WJ3A 2JKLA 5CJQH 3QXDA 2VLKB 1YYLH 5KSAC 4PJXF 2MMXA 1RZJH 3C08L 5E6IC 1JGUL 3O2DH 3NIDF 4X42A 3H2PA 4UT7H 3PQYB 5A7EA 2OR9H 1AHWA 2RQ8A 1MHCA 4L8CB 4O5LL 2N01B 4K9JA 1E5UI 2PWHA 2AJUL 2Y69B 4YHOL 1CXKA 3U4EB 3UBXG 4U4IA 1IAIM 3JVGC 4NBZB 2O6FA 3APNA 4QNPE 2NXYD 2X4NB 4Y4HA 2AEPL 3UCQA 3DMMA 4O4YL 1EO8L 2X4SB 5K9JH 4JY5L 4L37B 3TPUB 1KTRL 4OQTL 4RAHA 2YN5A 1CXHA 4KI5D 4GUPA 3MROA 5JDSA 2CDFA 3VXNB 1ID5I 1IC4L 2W9DL 3ISWA 3K8KA 3L9RB 4HLZH 4X83A 4TQ8A 4OIIL 4OJFL 2EDHA 3GK8H 5F9JA 5C0BE 3FTYA 3MCG1 1K5WA 4R26H 3SCMA 1TYEB 4RFNB 4KKBC 4LCYB 1BAFH 3E6FB 1MWAA 1KTLB 2HMID 1N59A 3GZQA 4X9YA 5D70L 2FSEA 3MOAL 1CR9H 1P1ZB 3H1ZA 4OH2A 3IJEA 5ETUA 3BVNB 2OCFD 1E28B 4YXLH 4XHQA 5AAWC 2K3TA 3PHQA 1TETH 1Q8MA 4H40A 4B95C 4JUTA 1OM3H 5CM1A 4OUOA 4PGBA 3VWJD 5IB5B 4JRWA 1DO6A 4R2GD 2J2ZB 1NCWH 2JIXB 3RLSA 1IT9L 2JI1A 43C9B 5I1DA 1Y7VA 5DJZB 3X3FL 2B1OA 1UXWA 2BVUA 4AOFA 4KKZA 4YX2H 2AFNA 2JWYA 2V2WB 5EBWA 4CU8A 5EU7E 3QJQB 5AVZB 4FQCH 1U4FA 2G9HA 4LSPL 3DXAD 4F5CE 4CVXA 4NJ9L 4CDHA 3C5ZC 4BZ1A 4XMKL 1L7TL 5AW5B 2DZEA 1D3CA 5L7XL 1OE3A 2NMSA 4D3CL 4F1ZA 3POHA 1X5AA 4TUKH 1RK1A 2YD5A 2FUQA 4PGZA 2DIJA 3ECBA 3GM0A 3VX1A 2VDKH 3QS3A 3BE1L 4P23A 2WINB 3CLEH 3WIFB 4JO3H 1FO0L 1GGBL 3HZMA 2A6DA 1DFXA 1T1WA 4M5YH 4EIZC 2JLPA 3VM5A 2WAHA 5A2AA 3KE0A 5F3HB 1UXLA 1LE9B 1WFUA 3UADA 3QO1A 3MXWL 4TS6A 1BVZA 1SPDA 3EYQD 2R7EA 1M9WA 1UXMA 4P5TA 2WOBA 2FBJL 2B59A 4BSJA 3AU1A 1E4KA 3ZK0A 1A0QH 2H6UA 2K6ZA 4Z5RB 1CN4A 3PNWA 3MV8E 2DLEA 4OKVB 5I28A 3BISA 1KTJA 4OCRL 1FCGA 4ODSH 2K45A 4OCSL 4PHXA 2CK0H 3C5JA 1NC2B 1MCPH 3FRUA 1OAZH 5A3IC 3ATDA 1Y6MR 4G7YH 2E7DA 3ARTA 1X6NA 3OXSA 4NZRH 3TN0C 1LO5A 4OJCA 3RVUC 2BNQD 2QMKA 4NZTL 2KLSA 4PGCA 1CLYH 5KUMA 4H2CA 4PTUB 5F1NA 4ZFFA 2IQ9L 3WAJA 1FN4A 3AG4B 2X0UA 1DL7H 2FIRT 2X4SA 3UZVB 1WK0A 5DUPH 1NPNA 1QEWB 1NCDH 5EU6E 1BLNA 1FAIL 4JQXC 2DOCA 3L4XA 5KBDA 1P7BA 4JNXA 4PVBA 4GI9A 5EBMB 4X6CF 1G7LA 3CZJA 1G7MB 2LLNA 5EO1A 3QUZC 3FU5A 5EH1A 1AHWC 3LKNB 3RFZC 2Q2LA 3CPUA 4K94L 5DC0A 3AREC 2IANE 2J3SA 5FAAA 3GD1C 3HHRB 3V4PH 1KLGA 3MREB 3GSOB 3LKSA 5KBMA 5H94B 2QZQA 5BXFA 1AZVA 4JPWH 4NNPH 2A77H 2YO3A 3DOSA 2YS4A 2YSSA 4FQXB 1GH7A 2FZ3B 1UM5L 2XN9A 4AJ0A 4BFRA 5BV7L 1AXTH 1EX0A 2FSDA 4TVUA 1Q1JH 4UU9B 1P1ZA 2PXYD 3MHZA 4ES9A 2VO5A 3KJ6H 2BIPA 3F7YA 3P3SA 1OAKH 4I89A 4KHXH 1IGYA 4KWUA 4KPHH 4I9WE 5FYJE 1CL7H 1HAWA 2KDGA 3B7YA 5F0JB 2X44D 5D1ZC 3C5XA 4G42B 4GOSA 5A43C 1VKXB 3BLKA 3C2SA 3UH8A 1MLBA 1BF2A 3O3EB 1YQ2A 3TH2T 4RFEB 2A6JA 3CLFL 3O0LA 5KSAD 4PJXB 2GY7B 5DZNA 2HT4D 1O9ZA 1AYRA 3WDHA 1KCSH 1QSFA 3LEYH 5EZLA 5JNYA 3CXDL 4HJUA 4PLKC 4BQ8A 2OZ4A 1J5OH 3MMEA 4KZEH 1FZKB 3CN1A 4XN4A 2Q7NA 3WLWC 4UT6A 3Q9QA 1N8OE 3UTTA 1R33A 1CGSH 2OK0H 4IMLB 1XH2A 3P0VL 1MVUB 2X4RB 2YHGA 4Y7OC 5JOPD 4JB9L 5CBEB 3DETD 3Q6GL 5IBLD 5D55A 5I6NA 4PN6A 4JR9H 4DO6A 2ED7A 4A55A 1W0YT 4N4YB 3QPXL 5B7FA 3VI3F 5I71B 3K0YA 3H8NA 1GOFA 1T6BX 1SVCP 2XY1A 2ZX5A 4WHTA 3A6BL 4OI8A 1GZHC 2FH6A 2ED6A 3FQWB 2P8PB 2ZYHA 5FX3A 2ZWZA 1U3HB 3OMZA 4CA4A 1MUJA 3KNBA 3U1SH 4NQXA 1EZVX 3ARDA 3IGUA 4DHLA 4L05A 1BQHB 2IQAB 1XR8B 4QUOA 3BD3A 4WUUD 5D6DA 4GAJH 4Z5RA 5DEZA 5HD8D 4CC4C 1JPFA 5D1QC 1PCXA 4BSWB 4HUXB 4NLAA 4FABH 4QO1B 3ML8A 3TIDB 2ICES 2C9PA 1HEZA 1EAPB 1BMZA 4AG4H 3K2KA 5IQOA 2DLGA 4P23C 5KBLA 3PGFL 3QQXA 3W39A 3SYPA 1BOYA 5HDLA 4FTVB 2UYLA 5LKNA 1HWWA 4FULA 4X9GA 3LHAA 3V6OE 2VWEC 1GZQB 2WWKT 3BMVA 3NZUA 3IU4H 1UYWH 4HSAC 4XXDB 3RKDD 5KS9F 2Y7SA 3DHMA 1IBDA 3VI4E 2KDYA 4UNVA 1KENH 1FF5A 4OGYH 3QG6B 1YNTF 5INCB 3JTTA 3UTSB 1R5VA 2QVFB 3TJHC 2FO4B 2V7NA 4IIZA 3V5DB 1K2DB 2XZZA 3GDCA 1B9KA 5HHPB 2J8UE 3MU3A 2WVVA 1I8IA 3W0WD 4HVBA 2F53D 1I3RA 4HCRA 1OCCB 3OB8A 4PV8A 1EMTL 4ZAKA 4AE0A 3B56A 3DYMA 5DR5H 3TNNA 1LJMA 4L0ZA 4FQQA 5FHAH 2BNQA 1QUNB 3QEGL 4N8VA 5J6GB 4FP8H 4Z7WF 2OP4H 1MFBL 2BCMA 3OBAA 4B9KC 1IVTA 4C4UA 3GM8A 2APBA 5F21B 2A83B 2E7MA 3QEHA 2P7TB 3UIZA 5D4JA 2GJZB 4D8PB 2CQVA 2XWBB 5AAPA 1YMHB 3MFFB 3AQZA 4IBWA 1F4WH 1G9HA 3IB4A 3IMTA 4N3UA 1QFWL 4R0LC 3K4ZA 4K5MA 1CFMA 1U3JA 2DJMA 2ZOKA 1JVLA 3VI3E 3V7AE 3BQUD 1PFCA 1TKWA 1ZDQA 2F1BA 2MTAA 2H3XC 3ARVA 2QR0B 3DMMC 3IKCB 3N1QC 4WNSA 4DW2L 5ID1A 5IR1B 2WUBH 1A7NH 4U49A 4A6YA 3MRHA 3IETB 1R3KA 3O3DA 3O6KH 2W92A 4H0HB 1JZIA 1U8PA 3MODL 3MTRA 3FQUB 5E9AA 2F54B 4ELKA 1MFDL 3AZUA 4G1MA 3UABA 5K59F 1KT2A 3B2UD 3KYAA 4YDIH 3RX7A 1G6RH 3V0WL 4L8DA 4TUJA 4LPTA 5I16B 2YUZA 3APDA 2PXYA 3L7FA 1QHOA 4NC1E 3B1UA 4S0TD 4UQ3A 1KCVH 2A9NL 4GRLB 3ZMRA 1M2VB 3QORD 5DVLA 1WFIA 3AITA 1UD6A 4FI8A 1J1OH 1REIA 1F8TL 5GS0H 1GY1A 1PF3A 2R1XB 4Z0XB 2AEQL 1A4KA 1F58L 4RMWA 3HB3B 5DUML 1G0XA 1J0IA 1M6UA 4UMSA 4CVZA 1IARB 1M71A 5FUZH 3GNMH 5EU6A 5LLIC 1SOXA 1UWYA 5B8CB 1PG7L 2DWDA 5DDHA 5ECGA 5E9DD 2CJTA 4J3OG 1TIUA 4XCCL 3RKPA 2MPVA 4H8QA 2AXJA 5J12B 1N7MH 2BERA 3SDDD 3LPPA 2IEPA 3IDXH 3QISA 1H0DA 4FYSA 3N43F 2VDML 2JI3A 1F4YL 1WBYA 5D7LE 3WFBL 3WUWG 3R06B 3RY6C 4AW4A 4F7PA 3MRQA 3NSDA 4XOAA 2Y6TE 5DMJB 5CFAA 1HQRA 2WTPA 3DVIA 3SEPA 1JWUB 4OGXL 4DPCX 1U8HA 2I69A 3VB9A 1U8KB 4P2OD 3CDCA 4OZ4B 1CBJA 2NDGA 3MLTA 3DO7A 5HI3D 1GTFA 4PGEB 3UDWC 3CSPA 4DP5X 3PF2A 3AABA 4UIKH 4W9EC 1CDJA 6TAAA 4Y2DC 4DKEL 3WE1A 4X6BA 1RZ8B 5IB2B 1JPGA 4QRPD 2AXFA 2R23B 3GKZA 4PJ5B 1NKOA 3DLQR 2EDYA 4KXCA 5INCA 4G8FB 1G9MH 3DV6B 2V7NB 3LB6D 1NFIB 1ORSA 2QTVA 3B3IB 1MAML 4ZXBD 3UTOA 2YBRB 4ZQKB 2OW7A 5SWZA 4XRCA 1OARL 2C4XA 4PP1C 5D93B 4K5OA 5I6MA 5GS1B 3BP7B 4P59H 1WA2X 1H15B 3G5XB 1LEKA 5K1VA 4P9ML 5FO7A 4G83A 5CEZL 4HKZA 3HE7C 3QIUC 2Y5TB 3W5MA 1U91A 2ZXDA 4GYBA 1NBVH 3EHBD 3QNYA 4PRHA 3QPQD 1YYMH 4BHUA 1A7PL 5D1XE 2VR3A 1SEQH 2BDNL 5SX5K 3CSFA 4FXKB 1BZ7B 1S7XA 1C1EL 1YZZA 3GEWB 3CFQA 2VDOB 4GXVH 1SBSH 4AKPA 5IHUL 4FTVE 3FT3A 5TGBB 1HSBA 3ZE0E 5IGXH 2VJXA 3CZFB 5EF0A 3IJSB 1DQIA 1RH8A 1SLWA 4LSVH 4KNQA 5MEND 1VFOA 2CUHA 1OB0A 2GIMA 3VQ2C 5DYOA 1IGTB 3VI4B 4KGLA 5A2JH 4EEEA 2B1AH 4PIRF 4LBEB 3VQLA 3QJVB 1TZAA 2EDRA 4HIEA 5DLMH 1P7HL 3HUJA 4C59B 1PG7W 1PMYA 4UV7H 1KCUL 4IU2A 4QD2E 3X11A 2FK9A 4NB7A 3OJMB 3RURA 1BBDL 2X4UA 1A4KB 3T5WA 2C9AA 3UBXA 1EVTC 2ATKB 4YK4C 3T8XA 4H25B 5IBUG 5KVGL 3FT2B 2PPCA 1IKFH 3DIDA 3GSQB 2EDLA 1AXSA 1IGCL 4Y88A 3ARDD 2X0WA 3IEAA 3VGDA 1OP5H 4R90L 2UZIH 4KI5C 5C70A 3FOLB 1I9EA 3IU3A 2Y7NA 2W0KA 3FCTA 1GCFA 2IH3A 4WV1A 3VI3B 1HHKB 1XSIA 3LEVL 4K3DH 3A21A 2HG5B 2H6PA 1BXUA 4JPSA 5CKAA 5IG7A 4QHUB 4K71B 3VE0A 4OCYH 1OP9A 3D3VE 3EO9L 4ALAH 5IFJB 4IBLT 5C2UB 5F9OH 4I0PA 2JK5A 4OLXL 2GSGA 4UCFA 3SZKC 5GRXG 3BW9B 4G6ML 3ZDXE 1X9RA 3R19A 2XQBH 2VLMD 1P5UB 2GI0A 2BX5A 1X5LA 4K7PX 3GMNB 1E28A 3VO0A 3QB7C 2JTDA 2X1XR 3Q8CA 3N44F 1JPGB 5E4AA 1SJHB 3EIFA 4XP1L 4RLDA 4XWGH 3TO4B 1MF2L 2VIRB 5FIEA 4DUWA 2GK0B 3E8VA 2VDMB 3RHWK 2BHFA 5DVKA 4B9JA 4AIZB 4M00A 2OJ1A 1C16A 2BVYA 4HZLB 4PSPA 2DWSA 2PYEB 3MBXH 3T1WA 4LAQH 5J3HC 1GS7A 1UEYA 5T1MA 1K4DA 5LBGA 1F1DA 1TFHA 2X6BA 1G7QA 4A67A 3U36B 1V54B 2V9UA 1DQTA 1WBZB 4F1SA 1V27A 3BO8A 3EJQA 3AS3A 4LP5A 4RRPM 3DRQB 3ARBB 2ADFL 1JNHA 3KPSE 3JT0A 4TV3A 2W88A 1QFUH 1KBGL 3HHSB 3LZQA 4MA3A 5A16A 4X9BA 4OBRA 2VMEA 2IH1B 3L81A 2CDGB 3C5ZA 1E4HA 4NAQA 1MSPA 3WUWB 1WWCA 5F6IC 2XPGB 3ZKQD 2ZJSL 4PS4L 1S7SB 5B1BB 5IREA 1S7TA 4Y1AE 1ADWA 1BBJA 3L7EB 2ZXQA 1H3GA 3S4SB 5F3HA 3W9DB 2DMCA 4Q4IA 4ZTPH 2EABA 2HT3C 4D8OA 2DW5A 4L9LC 1GZPA 1KB5H 2H0EA 2X3CA 3A6CH 3MGTA 4IDJL 4MQSB 1NGQL 4OCXH 5FGCB 5HI3C 5KJ4A 3MCKA 4WU7A 4AI7A 2YXVA 3T71A 3WI9A 5J57B 3O0RH 4Q9QH 2FLBT 5GGTH 4LK4A 1XGYL 1RZGA 2Z92A 1CICB 4BWUA 4AMXA 2XY2A 3B7UX 2HVKB 4L3EB 1Z5HA 4FN0A 2XWCA 3MLYH 2IAMA 5AOLA 2BPBA 4HWBL 2X89A 3OXSB 2DYRB 1S7QB 4M5ZL 1FI8C 3FO1A 4KVPA 1A25A 4JO2L 1FZOB 3J7HA 4JPIA 5E95B 5HGAB 5I17B 1OAQL 1JDAA 2FJFA 2AMUA 5EO9B 5F89B 3PWJB 2QADB 4XP6L 1LNUA 4J4PC 5H37G 4KXBA 1IEBA 2BIOA 5T1LA 3JSSA 3S8GB 4N8PA 1FWXA 4NHUB 3QIUD 3UMTA 1P7QB 2XA8H 1HSAA 3D50A 4G6JH 3N1FC 2Z9TA 4K8RD 1FORH 1PEZA 2FX8L 4YSEA 4JQIL 2WIIA 2W1NA 2COQA 2DL9A 3FCBA 5FO8B 3IDGA 3VD7A 2GT9A 5FYJH 3EYUL 4M48H 5CMAB 5D1QE 3QCTL 2PPDA 3HPLA 4X5WA 5EUKA 1HKLH 4B9FA 3FF8A 4N1CA 2HFEA 5B1KA 3ULSB 3BHBA 4GO8A 4PJGA 4NQQA 2A2QT 2IAND 1ZS2A 1FFOA 3UPRB 2YKLL 5FCUH 4I3GA 3CVIL 3EJJX 2HT4C 1RUAL 3DV4B 4EN2A 1A7OH 2DIBA 3EH2A 4ZTOL 1D5ZA 1U2CA 1UQSA 4AWJC 2F8VA 2NY0D 3TEYA 2ENPA 4XNZC 3QH3A 4LLYA 3KLAB 1WAAF 3X1FA 4P9HH 5IBUB 1XCTB 1X5YA 2NY7H 5EU5B 3C8DA 1AO7D 4M62H 3D08A 4KNSA 5BZWA 3SO3B 4UT9L 2MPAL 4X5LA 5AVRB 3CG8A 1ODUA 4LCWE 2DWEA 3DXAE 3EDJA 1X3DA 5JPMC 4HUMB 1GGYA 2CNZA 5CLYA 3KYMB 4LAJH 2XTSA 1GC1C 2A4CA 3QS2A 25C8L 2X4RA 3TYGL 3UG5A 2Q8AL 4IRSB 3N04A 1UD8A 5IMKB 2QVIA 4UT9A 2C3HA 3MRBB 1UM6H 2JV6A 4GW4B 2IOIA 2XNAB 4B3EA 2MFNA 3T8VA 5LQBH 1USZA 3H0TB 3V10A 5I1IH 1GSKA 4NFDA 1FSKC 2HSIA 4IRZL 4KK5D 4X4MA 5AUMA 5I75C 1D5BB 3KPQB 4Z78A 2NR6C 3PHSA 2YSTA 1URLA 3ILQD 3NFPA 2VAAA 2AQSA 2KQNA 4UOW1 3W2DL 2AJ3B 5EU3B 1NEZG 1JGLL 4YSPA 4UINL 4XVSL 3PABA 3PV6A 4UBDD 3UGUA 3QDGB 4P2YA 5E03A 5ESAA 4HS8L 3WXWL 3S36H 5JHBA 5F1IA 1JPFB 4TTGA 1S9KC 4M3HA 3JVFC 2F8IA 3SGKA 3HG4A 3UO1H 5EMYA 3QZOA 2H41A 3OR6A 1P4UA 3C60D 3Q2CA 2UYLB 5CGMA 2DQDH 1TEGA 3KPSB 1RUML 5AVYB 3MLPA 4Y5XA 1HINH 1WZLA 3CFCL 3G5YB 1FO0A 3EOYG 5C08A 2WGNB 4ZAKC 3NFNB 2GY5A 4PW9A 2EKSA 4OM0H 3RDTC 5BOPA 4S1DD 1TQBB 2AJXL 2DQGH 4MNGE 3BZ4B 4RMRA 4ONFH 4FQXC 4MXQC 5ACMA 1I8UA 4ZFOA 3TBBA 3TP4A 1D7BA 1T03H 3E9TA 4W68A 2JQMA 1P7QA 3WN5C 2L0DA 1MPAL 4LSTL 1D5XA 4JG1L 2ICWJ 4L8BA 4DOHB 4CL7A 4JG0L 1QLRB 1W91A 4MYPA 3SKJL 1FC2D 4M1GL 4ERSL 1BEXA 4FHBD 2ZX8A 2MCPL 2AJVH 2RR3A 1J9RA 3OVUB 4FFZL 4EPSA 5IVZA 1CZ8H 1PIFA 1RJYA 1YEEL 5TPWL 4ZUTB 4O2CA 3ZDZB 4FYRA 3S96A 2P7TA 3C9NB 2Z4QB 4U1HB 1MFAL 5GIRB 2P3YA 2C9XA 1BFTA 3RU8L 3BQUC 2ZAIA 4U0RB 1IL1A 3QUZD 2WO2B 2UWEA 1Y6NR 2VR8A 4CN6A 1G1KA 2UZXB 1WAAA 1FC1A 3HS0C 3ARFA 2AV7A 4JY4B 4N8UA 3I9GL 4AQ8C 1OE1A 4X99A 5F1OB 2ZUWA 3U6XA 2RD0A 1XIWC 1TENA 1ZMYA 3ECQA 1MHCB 5DHYA 4L8CA 1Z1WA 1U8PB 3EUUA 1XB6A 4KTGA 3WELA 4KKLC 4ZK8A 1G43A 4KMTH 5IMOA 2YQ2A 1HC1A 3TA3C 3HG1B 5KBNC 3HCVB 1AD0B 2Q87A 5E5MA 3T0XA 3M17A 4DKDC 1JZFA 3SOTA 3GBDA 4NWTL 5D1ZD 3BEWA 3ULVD 1OKEA 2X05A 4TVPH 1GMEA 2VLJE 4Z0XA 2Y0SA 3IMVA 1JXKA 2F54E 2A9DA 1HWHB 1BGXL 5DURD 1WQVT 3P73B 1JK9B 1S3KH 5D1QB 3SGEH 1XF3B 2NLJB 1S3RA 1WEJL 4BH7B 12E8H 5I19H 4GAFB 4TSBL 1ZLSH 3SCMB 2NZ9C 5AFAA 5AB1A 3IAPA 1GS8A 3HN5A 2IH8A 3A47A 1ACXA 2ZAGA 3ESUF 3JVGA 3GMQB 3V0IA 5BVPH 1CD1A 4AM0B 1QBML 1WBYB 2APTA 2X2IA 3QDJA 4PJAF 3RL2A 5HHOB 2R69A 2YAOA 3BOVA 5A2FA 4OLYH 1FYHB 3MRQB 2Y4SA 5JZ7D 2ZX7A 4GUOA 3ETBF 2F5BL 4LRNL 4DGYL 2EAEA 1ES0A 4FCHA 1HNYA 2A1WL 4PB9L 3UBXI 2RFXB 1WS8A 2O6DA 1JFHA 4PVNA 1D7FA 1IC1A 2ZP8A 3U9WA 4PRBB 2BRQA 4KJQC 5ABZA 4P2QA 2W8CA 2GC4C 3LQZB 1IGFH 2HLFC 1L3NA 1TTFA 2CO4A 1IEHA 4Z95H 1BX2A 3AVEA 4W4OA 2YUVA 4GKNB 4ZXBC 4K9EL 4PHZA 1JNJA 4F8PA 2E7BA 5D2LA 5EF1A 3KMDA 1RHHB 2VDLB 1KJ2B 1U6AL 1UXSB 2VXQH 4XX1E 5HYSB 4RMSA 3EZJB 4KKCD 4I4WB 4DSYA 4XOBA 1S9YB 3K8LA 1A6ZB 1NOFA 2KI6A 1DSFH 1NCCL 3MO1B 5ILTL 3X3GH 3KPLA 1EGJA 1WFMA 4PLNC 2YKKA 3INUH 5C07B 4WEBL 1T89C 2WO3B 3HJ0A 2F7OA 3WIFA 4XPFH 4JKLA 3RKDC 2QJDA 5B1AB 4BQ6A 4JGNA 4JHUA 5T3XH 3W39B 5EB9A 3MLRH 1U91B 2HKHL 5DJYB 5K69A 3AAZB 1UD2A 1E3ZA 4XO8A 5GSVB 3GI8H 3PP4L 1VB9A 4F92B 4Q2ZA 2VM9A 3HFFA 5DMGC 4N2OA 3UJJH 1SN5A 1KN2L 2J12B 1JHLH 5J1AA 1NCHA 3ISRA 4JHAL 3S2AA 1FFPB 4PJIF 4RMVA 1AI1L 5JHDB 3S8WA 2C1OB 4KRPB 4Q6YA 4EE2A 1I3GH 3EGXA 4NO2B 3DTXB 4ZUWA 4LPYA 4J4PA 4X99B 2NUTA 3HS8A 3S5LG 4PJ8D 3MLZH 4N2NA 4YSCA 4N5EC 5IFHL 4QGYA 2DMHA 5IOPB 4MVBC 4OCWL 2PKDA 2W0FB 3K5RA 3WIHH 3L3HB 4Y5YB 1GKOA 5I30H 3G5ZB 5EOCL 1IO4C 2MOVA 4IMKA 4IOFD 1RJZB 1QKZL 2X4TB 1AS7A 1AQKH 1F4XH 3MRRB 2J5LB 1YECH 2AF2A 3V8CA 1E5CA 4D8PA 2PO6D 2ITFA 1ZK5A 4MMXB 3ZKXC 1JK9A 1XV8A 4AYEC 5T3ZE 1N6VA 3QUXD 3EOTH 3ZSTA 1UWEL 3L1OL 3W81A 1YYCA 1U8OA 3UTQA 3VFVB 4I2XA 4M1DL 1BXXA 4LIQL 4PR5B 2R59A 1E7VA 4HJ0C 2O4EA 1OF2A 4RSVA 2CO7B 1FJ1B 1U92A 2J1XA 2VDPL 4IGBC 2FHCA 4MBRA 2AABH 3MA7A 4O51B 5CU9A 1WIUA 5D1ZA 4KX8A 5I23A 4E0RB 3JWNH 3M7OA 1CPUA 1VFAB 1Z3GL 2EE6A 1ZHNA 3GJEB 2WMPA 2G3XA 5FW7A 3FTUA 4GQZA 3QDJE 3UYPB 2R0KH 4QRTA 1B88A 3VFWB 1BWMA 3SGJA 5C0AB 3PWNB 3EH5B 1I1FB 2XRAH 3NFSH 2G2RB 3U7WH 1T83A 4MXWH 1F6FB 3G6DH 1OB1A 4PRNA 2XI9A 4AZ8A 4QHMB 3SBWA 1QSEB 3EF4A 2NCEA 3TURA 3T2OA 4A7UA 4AV4A 5JXED 2VLJB 3VXTA 1DVFD 3MNMA 1KEML 2RCSL 4EZKA 1T2QH 3MV9B 4DERA 1JSYA 2BK8A 4KJYA 3FH8A 3S3SA 3HLAA 1NSNL 4DT2A 4XO3A 1WD8A 3TPUA 1K8DB 4Z3HA 4WKXA 1G1OA 3PWPD 1H3UA 3QIBB 2D3JA 4OV5B 2IBGA 4AIZA 4XNUL 3VRJA 2W80C 4FTDA 1BEYL 1P84J 3R06A 3QR2A 1FGVH 2NW3A 3UAEA 3FULA 1GRWA 3MLXL 1DUZB 1TMCB 1NGWB 4F33A 5C0JA 4GI8A 4Y16B 2QPDB 2JB5L 1ZLWK 5JOPE 2C3GA 5LHDA 3EJZC 4WO4B 2MKLC 1KTCA 4ODVL 2FLRT 1G4MA 2C34A 1HE8A 2QMJA 3UO8B 2F0CA 1KG0A 2E76C 1Z3RA 4PRIE 1RVFL 5EC2B 4DVRL 3D5OF 2ZSVB 4JLRB 2NZ9D 7FABH 3BVNA 3WUWA 1CD8A 1DQML 2P8MA 3FHAA 5LAPA 1ZLDA 2P5PA 4PP1D 4LLDA 3F04A 4PJXE 5IB5A 2W07B 3GSWA 3FRPA 3W9DA 2KH2B 1TJIL 4FXGB 3ARZA 4TLSA 1AY1L 2WNGA 2AVGA 2HFFA 1INEH 4N2LA 1T04B 4YHYC 32C2B 4GSDH 4BH8B 1ND0B 2X1PA 1X5IA 4P04A 3L5WB 2YGQA 3CHRA 3NP3A 3SKNA 1O5PA 1PFOA 4KTEL 4Y1AB 4PP2B 2HA1A 5DS1A 1ZXQA 2I9LB 5FM4A 4MJ5B 4E9VA 4ZG1A 4UMGA 4L3ED 1NMBH 3QNYB 3ZHDA 1A8ZA 5SWSB 4R4FH 3RTQD 3QORA 1SY6H 2FH8A 4FJZA 2YPVH 1IIIA 2IDCA 5D7IE 2YXWA 1ILUA 4Q0XL 2D7QA 1UH2A 3UJIL 3LTVA 3WN6A 1RK1B 4APQB 2X70B 3F7RA 1CIDA 2Y9RT 2ZWSA 3FU7A 4FFWD 1XH3A 4J4PD 1ONQA 2AK4A 5CJXC 5BCAA 1Y6KR 3U1QA 4YHML 4WUKL 1XB8A 5HHXH 4BK5A 4XCNA 1QTSA 4EKJA 4FQQB 2F53E 1KNOB 2D3NA 4Q89A 5I15H 4JQVA 3LV3A 4FCAA 4D9RD 1R19A 5JHDE 1YEDB 1UKQA 4Y2LA 4AQ8A 4JPKH 2GJZA 5KANI 3GRWA 4NYLA 5KYWB 1J05A 3C09B 3WSQL 2WMPB 2OCJA 3ASWA 3MBED 4EUPA 1N0LB 3PHOB 3SYOA 3MA9H 5CHNA 1LK3L 4WY7H 3GGWB 4FG4A 4WUUE 3TVMC 3ULAB 2PABA 4LLWA 1GY2A 4BE6A 4HJSA 4UB0H 2V3FA 2VDOH 2G30A 3TT3L 3FT2A 1U0QA 1GJWA 2DM2A 4NNYA 3BZDA 2YAQA 4U1KA 5CEYB 4FA7B 3FQUA 3MUY1 1E42A 2QV4A 4X8GA 1KEGH 2Q6WA 4LLUA 3GDBA 5CCKL 5DMIL 4XPHL 2J8UB 4MVBD 5TFSH 4PWFA 5CD5D 2GK2A 3BKYH 4PWGA 3SOBL 3VXUA 1I7ZB 1IFHH 4XMLL 3WIIL 2YD0A 2R0WH 3LDBB 5LCVL 3IRPX 1OP3K 1LDPH 4RAUB 3VH8A 2NRDA 1BZEA 1PKQA 2DJSA 2X4PA 2YWZA 4OD3H 1R3LA 3WY3A 4X7SL 4XNYL 3F7PC 1K3ZA 2PO6C 2VJ0A 4X4XB 1EDYA 1RZKL 1ULVA 2BNRE 2B4CL 3QCVL 5F6HJ 3DX8A 5HHOD 1KG0B 1R24A 2J6EL 2VMJA 2M83A 1IAOB 1CC3A 1JHKH 5GRJL 3A4DA 3BIKA 1WVZA 3L4VA 4K23H 2YEZA 2IPTH 4JREC 1R5IA 1TJMA 4MJ2A 4PRIA 1HIML 1A3LH 3B5TA 3PJNA 4CW1A 1DEEB 2APWA 1A22B 2J73A 3B5HA 1N5YL 2WZ5A 4JFPB 4JFWA 2X9WA 5CIPH 1C16B 2EXSA 3OJVC 1YEIH 1TLMA 6FABH 2E8YA 4BH8A 4X50A 2QHRL 4ABQA 3D25A 4UNUA 2J21A 4HJJH 4XPTL 3DJRA 1SYSB 4IHOA 3ALWA 5IT2H 2QADC 2Q10A 5I73B 3DHJA 4D9LL 5JR1H 1HYSD 1SUHA 4X5RA 5GJTL 1G0YR 3NCYS 4LCWA 3N6YA 3U25A 3ZO9A 3NUKA 4IOIB 3PDGA 3TT1L 5CEXA 2X4QA 2DDQH 5BV7C 4TULL 5GZNA 4MDIA 2OMVA 4RMQA 3RWDB 3QDGE 5G4MA 3MLWL 1EHNA 5IK3B 2Y07H 3ILEA 4ACTA 4QI3A 4M7LL 2HT3D 4ZFGH 1EGJH 1L9TA 2K9FB 4A2EA 1SF3A 1HL4A 1ICTA 3D69B 1TO5A 2ADIB 4M02A 3LEXB 2H32H 4KUCD 1NPJA 1AHKA 1EZLA 4AYFA 5BZZA 5EEUA 1ACZA 1JERA 1J11A 3GO1H 2GB2A 3VFTB 1IBYA 3H9SE 2OA9A 2Z1KA 2VLRB 3GRWH 3KLQA 3BWAA 1UJ3B 5G5DB 3BKJH 1G1CA 1U9KA 4LPXA 1MI5D 4FQLL 3VG0L 3PUUA 4YHLL 4N0CD 4N2MA 3QNZB 4R7DB 1KMGA 3ARUA 5BO0D 3GGWA 2QSVA 4PRHD 3NZHH 5CKGA 3H9SD 1QYGH 4OM1L 3RX5A 4AITA 3SY6A 4PBDA 5H8DA 3EG9A 1A3ZA 2D9QB 4ZNEE 3VWKA 5MEOB 1IILE 5E0QA 3C5SA 3QRBA 3V8OA 3MV8D 1SRDA 1YNKL 2ZXAA 5LAXB 2EYSA 3P1VA 3BZFB 3PY9A 3NCYP 2RALA 4F3FA 1GSMA 4GH7B 3ARWA 1HDMA 4D7PA 2JFCA 1VPOL 1M7UA 3KH4A 4BDVB 2YAPA 2ZXEB 1TNNA 1Y18B 2F53B 2P8LA 5E2WL 4XVJH 1EXUA 3FYIB 1VADA 1PKQB 3LCYA 3KLHD 5IVNA 2QLYA 4WGVB 3DO3A 1CXIA 4N87A 4ANUA 1NOLA 4GT7A 3HCVA 1JZ7A 4GW1A 1QWUA 4LL4A 3ZRSA 5EEVA 4F9LC 1OY3B 3RRQA 3Q05A 2KYIA 1AR1C 2K8MA 2Y1ZA 2LTQB 4YHIA 4JQIA 2WLYA 1NLDL 1X5JA 3LKPA 3HIZA 1UWXK 1CF8L 2B77A 2HCZX 3QFJE 1KGIA 3V6OA 3VRIB 5I1AB 2LFGA 2BOCB 2O1AA 3FCTB 7CGTA 1IV8A 3HG1E 2L04A 5K9OA 3REVA 2AAAA 1F4HA 2GBTA 2DIEA 2Z31B 1DSWA 3N42B 2VSCA 4PJGB 5EO1B 1N68A 3L4CA 3UXFA 4XXWA 5FR3A 5GHWH 1ZS8A 1EXGA 3N06B 5L0QC 2NXZB 3Q6FA 3BEVB 5LGYA 4XBPB 3T3MF 3SE8H 4JFPA 5CJXA 1UOLA 3PGDA 1OGPA 4R5TA 1VEPA 1I9RH 4LESA 2NY1C 3BKCL 4I0PB 3IJHA 5DF0A 2Z3FA 1MHPL 4E5XA 1SDDA 2KERA 1YJDH 3MV9D 4J1UB 4KKPA 5F7DA 1GR7A 4FMFA 4E2OA 4MQXC 3TVMD 3FTWA 4DP8X 35C8H 1RURH 1KT2B 1ZAGA 1UVQA 4OSUH 2C9UA 4JVUA 4RGOH 3P30H 3IDIA 3HVNA 3ZR5A 3U0WH 2JQAA 4DP6X 1S8DB 2CXKA 1IBHA 3K4DA 3EF7A 4JMXA 4BFGA 3IBEA 4UQ2B 1VA9A 1ADQA 4G5AA 2R1XA 4N0UB 4NQDB 2BVOA 1QX1A 1A14L 1BXVA 4OVVA 4IRSA 3D51A 3OV6A 5AZEL 1QFWI 3LVTA 3RVTD 5DSCB 3WDIA 1LMKA 4PW3A 1H3WM 3T4YB 5JORA 4M7ZC 3ZHKA 4LBAA 4UF7C 5AWNH 4NZJA 3BO8B 4Y4FA 3IN0A 2AV1B 4GKNA 1RKRA 2CRZA 4LEXL 1F4AA 4GG8B 3IGAA 4J5VA 4A2FA 5EU3A 4ZD3L 3ARGC 2Y23A 3MLVH 2D7TL 2NNXA 3LKRA 3KS0H 2OI9C 4TLKA 5I76A 5IEHB 2OTUB 5I5JA 3OKNA 4G7VL 3ZU8A 4YHNB 3ZDXB 1Q0XL 5HHVL 3RIAF 1CGTA 4AGOA 3TWYA 3HE6C 1ZXKA 3KWTA 3TZVA 4BKLB 5GGSA 2J6EA 3L4WA 3KPSA 4Y4HB 1DBBL 3C5ZD 3SDYH 2AJSL 1GZPB 2GFBA 4PJAA 3NABH 4IK7A 4DZBA 3IFLH 3B6SB 4ZO8A 3BCFA 3OC8A 3K1KC 2H32A 4YLQT 5MENB 3QC6X 3BZ4A 2FQDA 3IJYA 4PJ5A 4WFHD 4HETA 2EC9T 3MV7B 1JF1B 3MJ6A 4O02A 1AP2B 1MH5B 2VITA 5GZOA 3US0A 3MI6A 4KX7A 1HYSC 4WJG3 3PXJA 1MFVA 3B9DA 1D5XB 4IIQB 4X6CA 4D9QD 1EZSA 4N9GA 3ECBB 3V6BR 1IFGA 4OF8A 4U2YA 1KTLA 2XCMC 1FZOA 4JPIB 2JI2A 2BXZA 3BPNC 1MEXH 3U6XS 4YE4H 1J5IA 4HYTB 1DJWA 1THCA 2QEJA 2K6WA 1JTPA 4JZNB 2Y36L 4JZJC 4QT5A 2D03L 2OTPA 4P2RD 5TDPB 3RPIB 1AANA 3EYFB 1ZJAA 5AW7B 3LD8B 1SLVA 5IHLB 5AOZA 2CZNA 2V7HA 2XFXB 1VZHA 1DUYA 4A63A 5A40E 3GMRB 3QUMH 5I6XC 3FSWA 4GAYA 3BSZA 3UC0H 3CDGB 2I07B 3TH4T 3WJLA 1XIWD 4HPOH 4HHGA 2J44A 4UIMA 1I3RB 2KLRA 5EBLA 5EN2A 1XF4B 3BJLA 1OCZB 1VIWA 4IGBD 3GSUA 3S35H 4X6FA 3SE9H 2D7OA 1XL4A 4R3SB 4CDGC 4KO5A 4HUNB 1QUNA 3TF7C 3P9MB 2R0ZH 1KCRL 2ZKXA 3P4OB 1E4XH 3O8XB 1NEZA 3BVXA 3SQBB 3DOHA 2VXVL 2Y72A 2XZCL 5GZND 4OZHE 2XKNA 4JDVB 4YNYA 5DGQA 3V6OC 3VXSA 5I9QC 1E67A 1ZT4B 2NYYD 1PKQE 4QRTB 1VCBC 4G11A 3S6CA 4U7KA 1E4XL 5ICYB 5L88L 4HULB 3UYOD 2FB4H 2Q1EA 3ARED 4U6TA 4KQ0A 3SE9L 3IKCA 4JDTH 2C9RA 2E75C 2AI0L 2YK1H 3S35L 4PJHE 1X7QB 4CSZA 4KRNA 4MB1A 1RP9A 3P73A 5D1QA 4KQ3H 4J3UA 2HPTA 3N85L 2QSTA 4XH2B 1G87A 3KHQA 4WSKA 3OAZK 3PAVA 3UC0L 5BJTB 5C0AE 1KPVB 3KWWA 2VISA 1XEDA 1K8DA 2EEDA 4YC2B 3RUGA 1CURA 2D03H 4YDJA 1YY9C 2Y36H 4HFWA 2CMRH 3DOSB 1QSEE 3GIVA 3HOGA 1H6EA 4YE4L 2XZAL 3IFOB 1IMHC 5CUSL 4NQSA 1B4JH 2R1YA 1E5AA 4N2KA 1FNGA 5E1GA 5BQ7B 1P4LB 2CIKA 2G5RA 3WNMA 2AQTA 5FDWB 4HG4J 3QDHA 1S5HB 6CGTA 3N2JA 1A7QL 3MLSH 1MLBB 2VGLM 3L3KB 3C6LD 3I6GA 4NKOB 1ZHBA 3K6IA 2WQRA 3VXRE 1HZLA 4DESA 4H26B 5C0CA 5LXVA 4H7VA 4PWEA 1MCWW 2XV2A 4NQDE 3QIUB 2EEXA 2GJJA 4R97B 2AJSH 4NBYB 1G7MA 4QXTB 3FL7A 1QTPA 1JFQH 3F8UB 4XO4A 2VITB 4AGQA 1C12A 1E43A 4BE5A 3N1PC 5HYSA 3MLTB 2EYTA 3CFEB 2YD8A 1Q0XH 1A6ZA 4NCC1 3T0ED 4PUBL 3KPNA 3TZVD 2I9TB 4G7VH 5JIHA 5B39A 4KQ4H 1PBYA 1WCBA 1ZD6A 2WN2A 1ET8A 2D7TH 1ED3A 1J8HE 3MUZ1 3O3BB 4ZD3H 4C56D 4BSVB 4WHTB 4AQAA 3QZNA 1PTZA 1WUNT 2UX6A 4YE0A 2R27A 4LEXH 4UQAA 2FATL 5DJ2B 4NQXB 2JLLA 3IGFA 3WKML 5IMMB 2F61A 4F7MB 1NAKH 1R75A 1PZ2A 4Y19A 1S7SA 2E74C 5D2LF 5IIEA 1U41A 4QHLB 5EBLB 5EN2B 1H15A 1LEKB 1CDGA 1E8YA 3G5XA 5AZEH 4BZ1H 4OI9A 4RX4A 2P80A 1NCUA 2GBAA 1A14H 5CP3H 1KNOA 4MJJA 2X9YA 4XN8A 3MRCB 5I0ZA 3P9MA 4GBXD 2ZCZA 4J3OD 1BVNT 4W4NA 3KLDA 1SXAA 1XD0A 3T6QC 1PZ3A 2G2NA 2XOTA 3MMEB 3HE6D 1JHTB 1MRDH 3BLPX 3T2QA 5KYWA 4KJPC 3FQRA 1RURL 1YDPB 35C8L 4Y0GA 4HWBA 5AALA 2YD3A 4UWQB 5BOZG 3P0YL 2B16A 1RJZA 1YJDL 3LH2H 4YSAA 1MHPH 1AMXA 1TZHB 1U8LA 3MJ9A 2IAMB 1FZJB 3BT2H 3FSVA 3S3PA 4MMXA 5MP6L 4MNGB 1IZKA 4E9WA 4HJ0D 1TZOA 3PGCB 3S48A 5I8EB 1FFRA 1E8ZA 1TVBB 4NUPA 5DFTA 5GHWL 4O00A 2V17L 3ES6A 3BH4A 3TONA 1XT5A 5IMOB 5CD5C 5J89A 3DVFA 4WKZA 2OJEB 1QW8A 1KN4H 1MQKH 5D7JA 4OFYD 3VFPA 3M17B 2F5AH 4XPBL 3D4ZA 1KJ3L 4D0DA 1INDH 3EKCA 1ETJA 4FQ1H 4N85A 1GIGL 1OTTC 2BVPB 2EDDA 1JV2A 3CVHB 5DQJB 1QZNA 1I8LA 3GJEA 1FNGB 2HN7A 4ANVA 2WIIB 1RZ7H 1XH1A 1RZKC 4MS8C 4KK8D 2BMKB 1DVFC 4NP4L 1QFPA 1M42A 2WQSA 4HQQH 5CJ8A 2PPEA 1Y07A 3PJLA 1ITCA 1BPLB 3GXUB 1NAML 5LDSA 3KDMA 4OT1L 4V2BA 2OS7A 2QQLL 5ABAA 1JYNA 2EICA 1YNKH 3P0GB 2EIMB 3GSNL 2B14A 3MV9A 2YEZB 3ARBC 3DDGA 2P42B 4DEUA 4WFED 2BNRB 1MCQA 3Q3GA 3S5YA 4LHUB 3FT4B 5EA0H 4DKEH 2ADYA 3VA2C 1OSZA 3NCWA 5K9QG 1A6VL 3FQNA 4KKQA 1PY0A 3O6FA 3RY6A 1KJVB 3RDJA 3NZHL 4ZQTA 5PAZA 4XMVA 4BK5C 3V6ZB 1BCIA 2VDQB 5JHAA 2ZYRA 2PPFA 4YHLH 4CSPA 3VG0H 1Q72H 1SBBA 2QKSA 4BZYA 3CSBA 1TQVA 3ZVVA 5EU6B 4P5KB 1FNAA 3BKJL 4K94C 2FL5A 1KPUB 2HKFH 4P9HC 2AQ2A 2IC2A 1TNMA 2DWEB 2PWEA 1AHMA 4HEME 4X9IA 4XNXH 1SOSA 3GO1L 4CVUA 4DQOL 3SPVB 1W72B 2ZAHA 4J6IA 2BIIA 3ENEA 4HGMA 5AW1B 4POZD 4RGNB 4YH6A 5GSRB 3SY0A 2YGPA 3VGAC 4G6FB 1TKWB 2MOGA 3VXRB 2EDQA 4J3XA 3QYMA 2R15A 1A1OB 4IU3B 4M7LH 3NQKA 3TVMB 3WNNA 3ZTDC 2Y07L 5GGRA 4QJ4B 3MLWH 5AUMB 1ADQL 3IETA 4L8SC 3X13B 3L3GA 4TULH 5H2BB 3QIWC 3VACA 3NPSC 2P5WD 3TT1H 3T65B 1W15A 4ONHB 2PN5A 4HDIA 4AQ1A 3OB0K 5F7KC 3S88L 4LZKA 3CX5K 2WQUA 2GYSA 3SKNB 2CLZB 5HGBB 1H5BB 4PP2A 3LB6C 3C87A 1SF5A 4DK3A 4DVBA 4XPTH 2Y7LA 4TF4A 1WISA 2V33A 3TEZA 4EIGB 1I1AB 2OBGA 4FFWC 5HI4D 3ESMA 4U1LA 3H9SB 2ZG2A 2MNJB 3BAIA 3FH5A 3V0DA 1JZ2A 2WVSA 3P3RA 43C9A 1N5YH 1A7RL 2J57A 1ZIAA 4NN6C 1A3LL 3NAAH 3O11A 3V9FA 4I3RH 2IPTL 3TX4A 5TD4A 3MGTB 2EKSB 1T6WA 2ZT9C 1CK0H 1M3IA 1JHKL 2OJEA 4XCNB 8PAZA 2B7DT 4JO4H 3C12A 1TZIA 3G9AB 5C2BL 1KB5A 4P5TC 3RTLA 1CU4H 1HDMB 1V3LA 1S4IA 5C07E 3ABZA 4AMKH 5IY5B 3QC5X 2B4CH 2H0PA 3QCVH 4GMTL 2XJKA 1Z7JA 4QWWD 2IFGA 5HVWA 1U8KA