5EF2A

Radiation damage to the trap-rna complex: dose (dwd) 21.9 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein MtrB
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5ef2A00
5EEUA 2ZP8A 3ZZLA 1GTFA 3AQDA 1QAWA 2ZCZA 2ZD0A 3ZZQA 1GTNA 1C9SA 5EF2A 5EEYA 2EXTA 1WAPA 5EEXA 5EEVA 5EEWA 5EEZA 3ZZSA 5EF0A 5EF3A 2EXSA 4B27A 5EF1A 2ZP9A 3ZTEA 1UTDA
chains in the Genus database with same CATH superfamily
5JNYB 1QZ1A 2X4QB 3O3AA 4MDIB 2VZ1A 4K9EL 3MXVH 1UWXH 4JREB 4P5TC 5E8PA 1U91A 4ZMQA 2VXTH 3AJ7A 3F58H 1CLOH 4J3VA 2MNJB 3KWWB 5IEHB 3KXFA 5E0FA 2AJXL 3D4GA 1LGVA 3U83A 5D2LE 5KYYA 1I8LC 2JTDA 1XH1A 4TVPD 4Q89A 9PCYA 4QTHB 3STZB 4U4IA 4UTAL 2FZ3B 3HHMA 4LCUA 2K70A 1OWRM 3GXPA 3FT0A 2QQLL 2YAHA 1DUYB 2OR8A 2WXHA 2VDQH 2A6DA 4DVRL 5A16B 5CHNA 1MCNA 1CF8L 3AXHA 3TYGH 2OK0L 1OAUL 3MRBB 3VGDA 1B0RB 1Q1JL 3HMXL 4U1KB 3ZIMA 2VUYA 5DZNA 1MCOH 2FK9A 3KM1A 1OP4A 2F54B 4OZGB 2DJMA 5LKNA 1KNOB 1QW9A 5I1DB 5E6IC 4KKPA 4XOEA 1L7TH 4Y5YC 4F1ZA 2FQGA 1FFPA 5HI4C 3WTTA 5EO9B 4Y4FA 4RA0C 5C3TA 3QORC 5IGXL 1GAFL 1RSFA 4HCIA 4KPHH 3UC0H 1SUJA 1OGAA 1H8LA 1N5YL 2E7DA 2ATKA 15C8L 4XNXL 4I0PB 2R1XA 3BSZL 2VLRA 2D9CA 4IBYA 3SBWA 3GI8L 3QJXA 1VFAA 3EO0B 1NCBH 5DFAA 1U21A 2OJEA 2EUVA 4FTVE 4PJCF 5I75B 3CSPA 1SN5A 5I82A 4LLWA 4X80H 1WYJA 2WPGA 5DGQA 4WY7L 3B2VH 4UQDA 2NY5H 1AD0A 5EU6A 1XIWD 4GQQA 1TPXC 3GJEB 1S3KL 2O5YL 4I3SL 4M5YH 2P5EE 1OAZH 3P30H 4NQCB 5F9JA 4XN1A 4N1CA 3GJFK 4B60A 4JO8A 4IOFC 3RL2A 1D5ZB 3CFCH 4U6VL 5K9JL 4L4VA 2R56L 3EJCA 4JG0H 5T3XL 2IJ0C 3NCXA 4LVNB 3RGVC 1UATA 2P47B 3FHAA 4LPUA 5ELIA 1IM9A 3NIDF 4K3DL 1G43A 2JKSA 1PQZB 1I85A 4GI8A 4P2CG 5IW1A 2WXQA 3EO9H 2N7SA 4WWKD 1FVDA 3CFJA 3NP3A 4RMBA 4Q4EA 4KITB 5FLVA 2CR3A 3BPNB 5CBEB 4PJBA 3EDDA 1SEBA 5DQJB 2DTSA 4E9VA 4XNDA 1MFCH 5GJSH 3WY4A 3UTTD 1U30A 4PJDA 2WBWB 5E1HB 4APXA 4EZJA 3VWKD 4K8RC 3LPFA 4PRPE 3EOYG 3MNWB 2HX7A 4B95C 3NJKA 5F6IB 1OHQA 3SGKA 5CD5D 3CH8A 3K6SA 1RHFA 2EILB 2OMVB 3B7UX 5GISL 4QRTA 4U1NA 5IVXA 2OXGB 3C5JA 3Q9PA 5ADPH 4IDJH 3EFDL 1K2DB 4M1GH 2KDGA 1Q9KA 4Y2DC 5L8JB 3DGGA 1K2DA 4ELMF 5IFAL 3AXIA 1KCLA 4U6HA 3X14B 4OGYH 2FYYA 1CN4A 1ZWIA 2GTWB 2RQEA 2XC8A 3OWEA 4WK4B 1OAQH 5I71C 5L9DL 4WU7B 1MFEH 3MROA 4GKZA 3BIBX 4NNPL 5CO1A 5EUOE 3Q1SL 1CU4L 2DQHL 2G3NA 2KMWA 4PV8A 4YEEA 3ULVF 2EXYC 3RJOA 3DIVA 1ZTXH 4GPVA 1SEBB 4JFDE 5FM5M 3WHE0 2CJ3A 5E9DE 3ILQC 2H1PL 1NBYB 4Q8BA 4YPJA 5ESQB 1I3RB 1KLUB 1A8JH 3ESNA 4F27A 4YBLC 4YK4C 3H4FA 3MBXH 3NCJL 2QLYA 3B3IA 4KJPC 3RA7L 5BVJB 1XGQB 4JCLA 2H7WA 2NXYC 1U3ZA 4ES9A 1MIEH 4XOCA 4EN3D 2W65A 5AVQB 3S37H 3TU6A 4U6XA 3F01A 5TQ2L 1JWUA 2OQJB 3D0LB 1WBZB 2X2YA 1G84A 4A2HA 2Y36L 3PHQB 4NP4L 1HHIB 3X2QB 5EUKA 1TQTA 1ASQA 3HW7A 2EIZA 4ZAKC 3RNQB 3VTMA 3Q6GH 1QZNA 3DJZA 1F3DH 3HN8A 2ZUSA 3QORA 4M7ZC 1UHVA 4OCSL 3GGWA 3U7WH 2YAEA 3RHWK 3KMDA 4NIYE 3KEDA 1KGUA 2Q8BL 3MRHB 1LXMA 4JFOB 2XKUA 3OAWA 3BLKA 2BOLA 2Y5TA 1YEGH 1G87A 4J6IA 1KYOJ 1YPZB 3Q13A 3QIBA 4L3FA 3B9VA 3HI1B 2R1XB 2VDOH 4M6ML 1G9NH 4FXKB 4ELMB 4H0IA 2ILLA 1HH6B 3LV3B 3KPQB 2ZF9A 1KLGA 5IBTL 1B2WH 4GO9A 1R19A 1G5GA 4CSZA 2O5ZH 4R5XA 4ZFFB 4OFYA 3FTUA 2ENQA 5HYQB 2CO3A 1V3MA 5I1DA 3QYNA 5AW4B 1BFOA 2M8XA 4FQ1L 2HX9A 3ULSB 4XNQA 4NQCA 3IGAB 5DQ9B 3TVMA 4XNYL 3WIHA 2CM6A 2OZNA 4PRNB 1N6QL 2I26N 1PBYA 4RMQA 4L8CB 5D7LB 4PCYA 1UZ6E 4G3YL 4Y4HC 3UBHA 3L9RB 1ZHBA 4L8DA 4IYKA 2CO2A 1U8HB 3GUTA 4KK8D 5J5EA 2H3KA 3WNMA 3HLKA 4NPYB 5DA0B 3I02A 2EXTA 5DURB 5EN2A 2G9HB 3CFKB 2XNAA 3AQYA 1XGPB 2V2TB 3S37L 5I5RA 3PQYB 3ZMNA 5IHWA 3ZT6A 3ZTEA 5FUCC 4O58L 3V0IA 2X4PA 1LE9A 1JVOA 4PWIA 4MGXA 1JHTB 1WA0X 2E3VA 5CAYB 5I16B 1ORQA 1KY6A 4M5TA 2Q2LA 1XHHA 2BVYA 1AFVH 2A4ZA 2DLGA 5I1JH 4AL8H 3MXWH 3C09B 3W9EB 3GBNH 4P5SA 3RJDA 5MEPA 2BC4A 3K91A 4UV7H 1INDH 3VH8B 1IGIL 3B43A 5FO9B 1S78C 3N43B 4JO1H 2CGZA 3FFCE 3I3DA 4E68A 3ZL2A 2EUZA 5I1LB 4XC1L 1JD7A 1F00I 1SMDA 5A43C 1U2CA 4E5XA 3DIDA 3ZMEA 4YHYB 3ELQA 3MMEA 1Z9OA 4X4ZA 5IQNA 3O2WL 4YUEH 2GITB 1KCUL 1Q9LA 1KXHA 1CLCA 1G1CA 1YYLH 2IDCA 2Y6TE 3QEUA 4LLMB 4FI6A 3QIWC 3H55A 1H0DA 1MRCL 4OIIH 4QF1B 2P5WB 5LGYA 4P23A 3OHXC 3VG9B 5EOQL 5FGBA 3WS6A 1YVLA 3KL5A 1FBIL 3GBNL 4LEXL 4PW9A 2VZOA 5IP4A 5I73C 5AVSB 4PRDA 1ZK9A 4QRAA 3F64A 5GZOA 1KGYE 3AAZA 1JNJA 5E8NB 3V4PA 4POYA 4POZC 1GSKA 1XIWA 4Z5RA 1I8AA 1MJ8L 2D03L 2NW3B 1UB5B 3A6CH 3ASNB 4BFKA 2CBQA 3NOIA 5D7HA 3MPCA 3S5LA 4K3DH 2JCWA 1T5XB 1AHMA 1WFJA 1KIRA 1X5FA 2VE6A 5DHDA 1FH2A 3FTZA 2EINB 3UTSA 5J6HB 4NKOA 2UWEA 3HZMB 4MFHA 4GRWB 3KVPA 1JCKA 5IWLC 5KANI 2D0FA 4MCYA 4H88L 1FZJB 1CYGA 1IZKA 1FYTA 3TA3D 4F7PB 3DDFA 4XBPA 4LSPL 3QXAA 1QACA 3MAWA 4MD0B 4QHNB 4G9DB 2ADGA 4DK3A 5D72L 3NRFA 5DI8A 5FCSH 1KELH 1CTOA 1Q4NX 1YYML 1ZRUA 1N9PA 4S1RH 2MHAA 3H53A 1WGVA 1OSPL 4GIPD 2WBJD 5BW7C 2ZXCA 2FECL 4Q74A 4XNMA 4K5LA 4N3UA 5F1SA 5F7KC 4ZXBD 3FFOA 3VDBA 1ZLWK 5LGJB 3J7HA 3OJ2C 3X17A 2MH4A 3TCTA 4ONOA 4APQD 1I8MA 1LDSA 1MHHB 4BELD 5D71H 1EDQA 3EJYC 1JTOA 3MNDA 2OTWA 4JAMA 3NZHL 1AGBB 4LARL 2YARA 2X9YA 3C8DA 3BLPX 3QVAA 4J39A 3CN4A 1BHGA 1L7TL 1N59A 3HE7B 3KLKA 1NDMB 3H9HA 4IMLB 5D7SH 3V55A 3AG2B 4K4KA 1N12A 3O9WA 4JPVH 3MRLB 2JIXD 4BA0A 3BT2L 2GK2A 4PBVC 3DO7B 4S2SB 3MLRL 3RX5A 3DJSA 2P8MA 1ACXA 4S0SD 5D1XA 5EIIA 1JWSA 3RY5A 1EVUA 2A74A 2JELL 1YEDA 2MNUA 2QPUA 4F92B 3DTDA 1MW1A 1UWEH 1JNHB 1GKEA 4A6YH 4YFLF 5T1LA 4QCIB 5BRZB 4BDVB 5H94A 3RL1A 4YIQA 2EEFA 5DJ2B 4JPSA 1A14H 2GK0A 3QUYB 5MEOA 5D1XC 4CBPA 5AB2A 3F00A 2ZWZA 5FHBL 4KUZL 3RY4A 4NKDA 2ATPA 3ILQD 2AK4B 2QGCA 2H0PA 3O9WC 2AJXH 5DA4A 1ZHNB 4TNGA 2ZXQA 4F24A 2X87A 3W57A 4FEIA 3D08A 5E56A 5IZ7A 2BVOA 2ZOOA 3NZHH 1DL7L 1EVTC 1PLGL 4Z7AA 2I9LA 1I1YA 4HUXA 4Y5VA 1BIHA 3QQ9C 4U05A 2XQYA 1R17A 1CQYA 4D7BA 1S8DB 3CFIC 4AE0A 3IJ7A 1OD7A 1U8QB 2WIIB 1ID2A 3GXTA 4HLEA 1QSFB 2KPWA 5KSVA 1KJ2B 1AJ7H 4BQBA 2Z31B 4ZZFA 1MFNA 1F97A 5EORH 2XPGA 1X5GA 1PG7L 4XMVA 1GOHA 3EOAB 3S35X 1N8OE 3NJJA 4OD3H 3LKRB 1VADA 4B9FA 5AOMA 3PE9A 2N56A 3KGTA 1Z9SA 3O4OC 3UIZA 3O2DH 5D8JH 5CEZE 5C09A 2Y6SD 2DQEL 4I8DA 4PJEB 4R7NA 1CCZA 1O9ZA 4XNMB 2ATAA 1GYUA 2R0KH 2DMGA 1BX2A 2P5WE 4N8VB 3CC1A 4HDIA 3ZRSA 4MXQC 5TQ0H 4KHXL 1NSNL 3DURB 4PGEB 4NUGL 3OHMB 2P80A 3CSYB 3CHPA 1LE5A 3D48R 2DZEA 1CD1B 3BEWA 4QAWA 2QHRH 2X4RA 3GSNA 1GTNA 1RJZB 4MCYB 5B39G 4FNTA 1IRAY 3FT3A 3NFPB 2OL3H 4EI6B 1QWHA 5C09D 3HZMA 2VAJA 4BM7A 1LWJA 3T1FA 1XGTB 1ILUA 1OW0A 3JTTA 4XPHL 5GSVB 5F1IB 5IJDC 4Y4HD 2XRAL 2YQ3A 4JRYE 2DWDB 2MJWA 3BVDB 3NFNA 3BVNA 5CR1A 2EKJA 1UB5A 2WWOA 1CGUA 4U6TA 2DQFA 1TG8A 1JD9A 4UI2A 2ZWKA 1IGFH 5FOBB 2WNXA 2IPKA 1R46A 2SODB 4XC1H 1UQSB 1T83A 1WQVT 5EO1B 3V4VL 4FXLA 1BF5A 4DPAX 5G4OA 5AAPA 4JPWH 2VL5A 5AW9B 1DLFL 1HI6A 1ROCA 2IWFA 2YSSB 1JV2B 5EZJB 3UAEA 5BQ7A 2EEXA 1I1AD 3QO0A 3P0VH 4PVBA 2EO7A 5CGBA 5FM5O 3V7MA 1UYWL 2BRRH 4PRIE 4MMYA 3BIAX 2F5BH 2VWEE 2QTEA 3MRIA 3DBSA 3ILDA 4I9WE 3P4LA 1CICC 2QFPA 3VFVA 4BXVA 3LRGA 1QLRA 2A73A 3AS1A 2BY1A 5FW7A 4EAEA 4XHJD 43C9B 4FG0A 4BBWA 3HPLA 4HPOH 4N8UA 4Z76B 1JYVA 3OTTA 1BYPA 1A1NA 2Q76B 4NUGH 5HVGB 2FR4A 5AKVA 2R0ZL 4KHXH 5JA8B 4X7TA 3GMNA 4FQPA 2WVTA 3F3HA 1BBDH 1HQ4A 2YKLH 2ZOLA 2X4PB 1ZLSL 1LE9B 3WO4C 2EDXA 5KYWB 2WXJA 1FE8L 5DD6A 3P4MA 2JK5A 3RU8H 2UUDK 1AGFA 4J6RL 5C08B 1ZT1B 4Z95H 3HAEG 4DWHA 3GZKA 4OIBA 2J88H 5DRZA 3UTZA 2R51A 4O2EA 4KMTH 5HPMA 1FAIH 5JW5B 2UZPA 2DLIA 3V9FA 3SE8L 4BSVB 4S1DC 4L8DB 3CFEA 3HI6L 2YPVH 3JUYA 5AVVB 4XO5A 4E9SA 2HJLB 4ZUSA 2WLIB 1G9NL 4PP1D 3OKKA 3ATDA 3RVVC 1C16B 1J1XL 1EGJA 5DEFA 3WEAA 4E9TA 1G9EA 4J5VA 1IGYB 5ENWB 4DZBA 2DH2A 5DLLA 1GYWA 2YUVA 3CFMA 1BFOB 5ICYB 2WY3B 3GRWA 3ZZQA 5IMLA 1WZMA 3CXDL 1H6FA 5MP6L 1J8HE 2XV6B 3FRPG 3FOLA 2VR6A 3T2NL 1I1FB 3RAJH 4TUJB 1W0WA 1ZV5A 1BGXL 2WBXA 3JWDL 4OQTA 5DR5L 4CILA 1HHHA 5D7JB 1UEMA 2EDOA 1OP3H 5FCUH 4J3BA 5IVOA 2NR6A 4G5ZL 3T3MB 3BUYB 1OOWA 4YSSA 1LWHA 2ZXEB 4Z7WE 4DCQB 4DO6A 2GAZA 2YK1L 3KWXA 1CGSH 3WLBA 2NOYA 2M1KA 1VDGA 4AYID 1WFMA 2ADIB 2KKQA 3AWFA 4HLZG 1A7PH 3MGOB 1JVLA 2VC2H 4ELKB 5B3NA 1YDPB 2PYEE 4M7KL 5JPNC 4DGYL 2IOOA 1CICB 4H2AA 3IJEB 3MLRH 3KDMA 1F02I 3CXFA 4LCVA 4QRQB 1G94A 2BMKA 3TNNA 2AFNA 2EADA 3PL6A 4Q0XH 5I6KA 2LV4A 5EU6E 3RWJA 3SDAA 1NEPA 1V8HA 3IDJA 3GMMB 2YOAA 5C0GA 1S9VB 4NAMA 2OL3L 1MVUA 2K3TA 4LHUB 4FA6A 1MCJA 3BRGC 2Y3AA 2YA1A 2VQUA 5FGCB 3VI3E 1AACA 2VNCA 4PJGF 4X4XA 1IKFL 3K71A 1DBAH 4XPFL 3OGCB 4EKXA 4X6DE 1G4MA 1O6VA 1ZLUK 4XB8A 1NLDL 3SGDI 4OZIF 4R26H 2GUOA 4M1GL 4LNVA 2O6EA 4BH7B 1L9RA 3UTPE 2CDGA 4MXVF 2AAVA 3SO3C 4CRPA 4PJFF 2BHZA 1U3JA 3LIZL 4Y2LA 5IUSA 5BZZA 1GGIL 3MLTA 3P9MB 1Z0NA 2JKXA 3FB5A 3NCWA 3KPLA 4KQ3L 4L9LC 4HIJA 3ZQ9A 3LJ3A 2IQAB 3OAUL 5HDWA 4OD3L 5T1MB 2GKIA 1BXAA 3ZL4L 2PO6B 2NY6C 1PZ2A 3V2AR 1QATA 2QPFA 4R26L 5CJBA 1E3XA 1PG7H 5K1JA 1MVUB 1UM4H 3LPPA 4LEOA 4DFHA 1GGBH 3SPVB 3TBVA 2EICA 3ESOA 5I74C 1FG9C 4X6DA 3VAEA 3ILPB 4KV5F 4OAWB 5IT2L 4X98A 4HKJB 1JK9A 4WWID 3D0VB 3DVNA 2FSEB 1R3IL 3ARDD 1A0QH 4X9FA 1S7WA 3FTVA 2WVUA 4APXB 3G6JF 2YO3A 3DK2A 4Y16B 3FT1A 4FHKA 1KGIA 2QZ5A 3O4OB 3B2DC 2AJ3B 1ADQA 4UINL 4AUYA 3EHBD 1WISA 2HFGH 4X6CF 2ZUVA 4I3SH 1TZOA 2QZQA 1GMIA 3GSRA 2NY5L 2E8YA 5E2JA 4FQXC 3QUXD 4JFDA 5IR1A 2WSDA 4HJJH 3ESUF 2VMCA 4DVBA 1AC6A 3EOBA 3FSAA 2O6FA 2X6BA 5EWIL 3QXTA 1HFUA 5I1EL 1KGXA 3TN0B 2H32H 3OB0H 4J7RA 3X3GH 4A2GA 4ATWA 1PX4A 2J7LA 1ACYL 1MUJA 3MV9B 3HMWL 4QHPA 2EE0A 4E36A 4HK3N 1UWEL 4LGRB 5IMLB 3T6XA 2QFRA 1JHLH 1QOKA 3R06A 3TO2A 2NX5E 5IIEB 5SX5K 1P7QD 1BLNA 2YUWA 1Z0MA 4LVOB 4LEBA 1R33A 5DUPH 4UT9A 5EU7E 3MRPB 1Y0LB 2XWBA 2AXFA 3QFDA 2W92A 1SHXA 2FHFA 1IB5A 1DCLA 3BPLB 3GS7A 3RNKA 4AQ8C 4HOZA 1IIKA 3CFEB 5HYSA 4L3EA 4I0PA 5HPMB 3S35H 5DRZB 3ARYA 4C4KO 4EOWH 2F6AA 2QVIA 3HI6H 1INEL 2B5IC 4UB0L 1FN4A 2YAFA 3L5XL 3P9LB 5GRVL 4YR6A 4TNFA 1P69B 1F4WH 5AOZA 1A2YA 5C3IA 2QDWA 2BS71 4OVVA 1DQIA 3K4AA 2YWZA 1AGEB 1HSAB 5C0FA 1A7RL 2I5YL 4GMSL 4LASL 2L7QA 4TV3A 2FDBP 2BW5A 2HTKC 1ETJA 2W5PA 1EAPA 1BBDL 4PJIF 5F9OH 3HPJB 4BUHA 1N6QH 1T7XA 3FN9A 2VAAA 2DMCA 1OSZA 3KEHA 2WO2B 3N91A 4YSPA 4TF4A 5C0JA 5I1GL 3HC0A 3MC0A 1YEJL 3B8YA 4JANA 5FYLE 2LVCA 1W0VA 2DQIH 2Z65C 4PHXA 2C3HA 4B96A 1OAJA 1WC7A 4QHMB 2CLVB 3KL3A 1PZUB 2WXFA 2PPDA 1RPQA 5T1KD 3PGDB 5CJXA 1A3LL 5FYKL 3MBXL 3A6CL 2KDYA 3KXFB 1I82A 5IEHA 4UINH 4QY8A 5DJAB 4FABL 2H1PH 1EFQA 1QRNA 3AWEA 3D69B 4W9CC 3HCVB 3OLIA 1XD0A 5IMOB 1JHKH 1JOIA 2CJSA 3IETB 2IPUK 1P7QA 4LHUG 3DECA 5EBWA 4GNKB 4U31A 1GRWA 4YLQT 2QPDB 5GGRB 1B88A 1KGCD 3RFZB 1FLRH 1AAJA 4OCSH 4HEPA 3DROB 4HZ1A 1NTDA 1VF5C 3QRLA 4RFOL 5IHUH 5JQ6H 1CFMA 3EDKA 2JB5L 4AIXA 4N9GA 4ZK8A 5F1KC 5CEYB 1I3GL 1ZLDA 4PJEF 2WXGA 3HAEB 1E7UA 3HMWH 5CN2A 3U2SA 3MRMB 2F7RA 2P48B 4HS8L 2BNUA 2Y36H 3LDBC 4NYLA 5ADPL 2YUZA 3LD8B 1HC1A 3FQNB 1KCVL 3LIZA 2XX1A 4MMZA 2WMPA 4N2DA 3MRQB 4QR7A 3V5HB 5C07A 1UT2A 3TBWB 1F2XK 4NERA 1QO3B 3NCJH 3FB6A 5IQ9A 4IGBA 1AZZC 4Z7WF 5IOKA 3VG9C 1Q90A 1BAWA 4BFBD 4WUUE 1U3HD 4RZCA 5F8RC 3RWHA 2D7TL 2HJFA 3WGUB 4QWWC 1NLDH 2FHBA 1BX2B 4N8VA 3I6LD 3PWNB 5D1ZC 1IKFH 2Z92A 5F3BB 1QABA 2OL3A 3QI9A 3T3PB 4GG8A 5D1QC 2RA1A 1I8KA 1J5OH 1Z7JA 1CXHA 5LNGA 2XXFA 4MA3A 4PJFA 5HSFA 5DVLA 3OKOB 5CSZA 3VXMB 1D6EB 1Z9LA 3QIUB 5BO0D 4ODWB 1R3JB 4H40A 2JV6A 1NDGB 3EGDB 2XA8H 4JGUA 1J86A 1AXSB 4HJUA 4DN3L 2EXWC 2C3XA 2B3RA 1I3VA 4JO2H 3FDWA 4IIQB 5HJ3B 3TH4T 2BCKA 4KXBA 3I50L 4GIOA 1N19A 1SM3H 3IS0X 2ITDA 4X80L 5EC1B 1FYTE 4KO9A 4ZW7A 5C9KA 4OF3A 1MRDH 2J8OA 3K2UH 2ZE0A 2ENYA 1OARL 1QBMH 1CXKA 1RZIA 3IDXL 3L17A 1L7IH 3VWJB 4F2MB 2PWDA 1UJ3C 1EHKB 1DBAL 3C6LB 1R5IB 3KWVA 3T6WA 5KOMC 4S1SH 1A25A 2GJ6E 3ZGIA 2ZWYA 2IQ9H 4LBEB 1LO5B 1CXFA 1SY6L 5E6UB 4M6NH 3VMPA 2AK1L 4A6YB 3UG3A 2K4WA 4YK4B 4JQIA 2B15A 2W59A 2PTTB 3GIZH 4G8GB 2R56H 4X8GA 4YHOH 4XVSH 5CEZH 3AU1A 1IE4A 3PCYA 5IJKA 4O4YL 3L6FB 2NY6D 4ZJ9A 1ZAGA 3DX0A 3SDCA 3DUUB 1YAZA 3U9UA 2Z7WA 3UGUA 4FP8L 1QRNE 4IBUA 3RTQB 4L5FL 5LBSA 2CBOA 1MDAA 5DRXA 1PZAA 1OP5H 3WD5H 4K7PL 4YHIB 3WV0A 3HG1E 2UXVA 5IG7A 4L0PB 1LK3L 4J28A 5EIVA 3Q0HA 1ONQA 5CJ8A 5IW3A 4K3JL 3MACL 4ZQKB 4A6YA 1RHHA 1OO2A 2EDRA 5AAWC 4MX7B 2NY4B 4HKZB 2VN5A 5EBMA 4JRYA 2X1WL 4KZ0A 2BSTA 4JY4A 3KLDA 5K9KA 1XSOA 3F7VB 2G2NA 2OTPA 4FQXD 3TPUB 4QI3A 1YYCA 1H9VA 4LLUB 4HC1L 1TZGH 3MXVL 4UM9D 2YD2A 2DQJL 2UY6B 3U9PH 3EH1A 3C5XA 3BCFA 1WBYB 2BHYA 1OAUH 1Q0YH 2HAZA 4ANXA 2OK0H 1IC1A 3S36H 3VYPA 1VZIA 4S1RL 2ZSVA 1FC2D 4KH9A 4K7PY 2QQLH 1KXTB 2F5BL 4MKTA 1IGCL 1AR2A 4F37F 5F70A 3RZCD 2VKWA 3GHEH 2PYEB 4PGZA 2H6PB 3DUSB 5GIRA 4BH8B 4AK1A 3WTUA 4IOIB 4G8FB 3VE0B 3AG1B 4M3JA 1NFIA 3APCA 2CUMA 1WIUA 1AMYA 1P4IL 1IBDA 1ZANL 2H41A 4YO0B 3V5KA 3QI9B 4NRZA 2J1WA 3U9WA 4GKSB 4KKAC 3GBMH 2E76C 2BRQA 3UTSE 3ASWA 4KVNH 2P80D 3IFOB 4NUJA 5T33H 2CXGA 3NCEB 2Z8RA 4OUUB 4X6CE 2EUXA 3PY9A 3REVB 4HZLA 4NUJB 4LZKA 5ERWA 1ACZA 5F7FA 5C07B 4D8PA 2XV2A 3U6RB 2X0VA 3M1OA 3PU7A 4LP8A 4UCFA 4BCZA 1BVLB 2HH0L 4MWFA 4MRCA 4AMWA 2WKLA 3K4ZA 3QUKB 5EULV 1A64A 2XHNA 4HUWB 1N4XL 3ELAT 2QADC 3T2OA 1YMME 3FPYA 1BXUA 2C9XA 4HK0A 2NW2A 2G0LA 5DYOA 3QNZA 4Y2DD 4KK5D 4PFEA 5LDSA 3P0VL 1CURA 2EC9U 5AAMA 1MFAL 4MA7L 1USZA 1O6SB 1IAIH 4F2FA 4ETQB 5IK3A 2J8UA 2NLJA 2VTFA 4YHNA 3SPJA 1C1EH 3JVGA 1BP3B 4P9HL 4V1DA 5I30H 2YZ8A 2JB5H 5D70H 1C12B 2DM7A 3N85H 3F7LA 1EHNA 3NJFA 5ITFB 4AI7A 4P2OB 3RWFB 4Y89A 3S4SG 4LKXB 1ZK5A 1BM7A 3JV0A 4KZEH 1DO6A 2NY3D 3QDHA 5KTEH 4IU2B 1N0XH 3O3BB 5D1XE 2H6OA 4JMXA 5ECGA 1AFVL 2VN7A 3CWGA 4GFXA 4LT7A 1ETZB 1VERA 1TJGL 4HWEL 3CSBA 3SQBB 2RFXB 3CZGA 1KYAA 5IBLD 4F80A 4CBZA 5EU3B 1P7BA 3WN6A 5ID1B 4RRPM 2P9RA 1QTPA 4O58H 3NSDA 2RB8A 4CN4A 1DZBA 4Q6IA 1H6EA 2ED9A 2V9TA 1RJLB 1XBDA 3ARDB 3FUIA 3QK0A 4KWUA 4TQPA 1YEFL 2HKAA 3HC0B 3BP4A 4GSDL 1JFHA 5ILTL 2XN9B 3L3IA 3U79A 1KBWA 2DTMH 1AD9B 2H26B 1U3YA 4LXFA 4NUMA 3C08H 2BP0B 3TYGL 3QDGE 3OKEB 3VRIA 3ETTA 2AEIT 3VXQB 2A2QT 3EH3B 2OMWB 3ZHDA 3WFHA 4KBPA 1IO4C 4N68A 2E9WA 1OZTG 4Z3TA 3VM7A 2R0WH 4HXBL 1ZHLA 4XRCA 5E51A 3MJGX 3AU1B 1MEXL 2DDQL 1MIML 3CLFH 3BGMB 3KLLA 3MACH 1Q8MA 3KYKL 3R19A 4ZYKA 1CZ8H 2ZNWA 1OOAA 3B7RL 5AZEL 5CINH 3L5XH 3NN8B 2XIDA 3DX7A 3VRLE 3ULVL 2EDFA 4AYFB 3VFRA 1DSYA 5B38B 2BVQA 2VITB 4KKBC 3T0VA 3WD5L 4CW1A 3VD0A 3GM8A 3W11D 1NLBL 4YWGH 4AC4A 2CO6B 2YLKA 2NDFA 1CR9H 3FQRA 5HJGA 4PGDA 1TQCC 1A9EA 2W1NA 4UUJA 4JQIH 2Q8BH 3GIZL 1AIFA 2R2HA 2HPOA 1EX0A 5FYJL 1OCWH 4LF3A 3RNQA 1JRHI 5KZCB 1O9WA 2AK1H 3T0EE 1KIPA 1I7TA 5I73B 4U0RC 1HKLL 4NPKA 1MW0A 1RPKA 5L4JA 2XG5A 4HS3A 3RWGA 4KK8C 4XNBA 2QKSA 5GSRA 1M1SA 5F7DA 3PWPA 4XNAA 3KPOA 1FFRA 5KBMA 2FLBT 4MQTB 3HBGA 3GSWB 4ELME 5HP5A 3QZNA 2ZUUA 2K3HA 1SYSB 3RKPA 3TM6A 2Z8WC 5CILL 3TXAA 4E41B 1MCFA 2VSCA 4YPGB 3FQXB 3MNVA 1YLBB 1PZSA 1OCOB 3FU8A 3PHOB 3VXRE 4K7PH 1DQDH 2VDPL 2ZCLL 1F11A 4MXVE 3LNEA 2HKFL 5C7XL 3CCHA 4KY1L 4M4PA 5B8CC 5F1NB 3GXMA 1A1OB 3X11B 3RKDD 4XP9H 4WI7A 4CVWA 3GPEA 4P23D 4UQEA 3C09C 5E00B 4HKBA 2IVFC 2VSMB 3INUL 1RIHH 2JJUA 3ZDXB 2J57A 1WP6A 3S3SA 1DE4B 5JR1L 5ICZA 2I32A 3MUJA 4HFWA 1EMTL 5C0CA 5BO1H 3CDZB 1XGYH 4DT2A 3K46A 5D1ZB 1ANUA 3PNRB 1EWHA 2AVGA 2X3AA 4ZXBA 5EZLB 2NY1D 2ADFH 4KK6D 3CFQA 3EW3B 3QPXH 3MNWA 4G80B 1LEKB 4RGND 1P5VB 2MTAA 2FUTA 1G6RA 1SDDB 1FVEB 3LIZH 1Z5YD 3LVTA 4XNZC 1BD2A 4OR1A 2HT2D 3GHBH 4PBWD 3I2CL 3WHXA 2H0JA 3H7BA 1SJEA 2J20A 4IKJA 4F8OA 1Z2KA 1Z9MA 2XA8L 3B2UD 4ANKA 1CE1L 1E65A 2AEPL 3EO9L 3VXSE 4AVJA 5TF1H 3IE9A 1FF5A 1J8SA 2X3BA 3OSKA 5JW4R 4UQBA 4KKLD 3L4WA 3NEXA 4LDEB 4TNVF 4LGSB 4C58B 1LEIA 3O8XD 2R2EA 3E6HB 4P49A 3QA3A 3FTSA 5T1DL 4EIUA 4Z77A 1CFNB 1DR9A 1MJ8H 3BHBA 5EO0A 5TF0A 3X3FH 1I75A 4GLRH 2ZT9C 1BVNT 3MOQA 3NA9H 1JGVL 4AL8L 4O02A 1NCNA 2F19L 5J7CC 5AYQA 4F5CA 5I6LA 3UBXA 1J9SA 3VH8G 4FA8A 4OZIA 5IESH 4PJXE 1FBIH 4KY1H 1EAPB 2QVMA 1LO4L 1MRCH 4OIIL 1DQDL 3IBOA 4J1UA 4EDWH 1NBZB 1E5ZA 5TK2A 1GJIA 2WNWA 1DBBL 3GXDA 2ITCB 3KYOA 4KO7A 2XU9A 1G7IA 4RMRA 3E1F1 3WHXB 3TJPA 4Z3HA 3EO1B 1W0WB 1FNEA 3VI4E 2XTSA 1BDYA 5IMKB 4APQC 5IMKA 3MRKA 3HNTL 3B37A 3OR6B 2EKSA 2YQ2A 1OAXH 1WA2X 3O41A 4OJEH 1OK0A 3SQOL 3ULAB 4PVLA 3VXTB 4HGMA 2B9BA 4WNQB 2VLRE 3SGEH 4AWJC 4ENZA 2WOYA 2H2PD 5C97A 3FFDA 3QEQA 2XUWA 3AB0B 5F3HB 1QR4A 2X3CA 1ZVSA 3CZEA 4Z9KB 1M2OA 4F8TA 4OZGA 1QQDB 1FLRL 4NXKA 5FKAB 2VIRA 1PVHA 2VABB 4OB5L 1QRND 4XMLH 1HIML 4BFIB 5IQLA 1NIEA 5DFWH 9CGTA 5DJZA 1DE4A 4U3SB 2JI3A 4JHVA 1I9IL 3VDAA 2J6EH 4HVBA 5DJDB 3TBSA 1KXQE 5DMIH 1O9VA 3VXTA 3QPQD 2WLHA 2HZHA 4E9WA 2F1AA 4JJ5A 3LZFL 3N1MC 1CZ8L 1JPGB 1S7QA 3OVUB 1F11B 5H2BB 3TFKD 4ZG1A 5F0LB 1S7TA 3ARZA 4LPXA 1PG7X 4JFFD 4UOW0 4V2CB 5C92A 1QEWA 3ASOB 4XZUA 5C0EB 2WLJA 4YDKH 1XB8A 5HD8C 3H4HA 1E9PB 3Q6GL 4ATTA 4NQCD 4MNGA 1CGXA 2WM0A 3FCSA 4KI5F 3MLVL 3MHZA 3UCQA 1U6AL 4NQSB 4X0KA 4PRPA 2BOBA 5IEKB 3ZO0A 2H32A 3LS4L 2EZ0C 5BOPA 2W0KA 1I1RA 2Q7NA 1XBRA 5IMMB 5GPRA 4HPOL 4KJWC 3VJ6A 3PGCA 3E6HA 2EDNA 4Z77B 4GSDH 3S2AA 1XAUA 3DVNB 1YQVH 1GS6X 1KJMB 3E8VA 4HJJL 2O30A 4FFWD 2E4TA 2QKIC 4JO3L 3SKNA 3BFQG 3NJLA 1H15B 3QWRA 1LYQA 5I9QB 1HESA 1A4BA 4JJHA 4NQCE 4LSSL 4OCYL 1M7DB 1K5WA 1ZT7A 5A7EA 2JB6B 5JPMB 3L95A 5C6TL 2N59A 5FWQA 3VWKB 5F1NA 4AJVA 1AXTL 2MPVA 1IFGA 2Y6SC 3MRGA 3H2PA 3OX8A 4XPBH 4TQEL 3T4YB 3U4BH 2AJSH 4ZMAT 3EBAA 1S9XB 1GCYA 2SEBA 3I6GB 5M7QA 2GHWB 4O51A 4UANA 1IMHC 3AGWA 1IEBA 2D9QB 1T83C 2AV7A 3M7FB 2E9JA 3MRCA 2YA0A 3LRHA 1WWBX 1UM4L 3GSWA 2Z34A 1WVZA 1ET5A 3AREB 5AWNH 1JK8A 5GGUA 4WCYL 4I88A 3M17B 1FO0H 3QZWG 5D1ZA 5EWIH 2R69A 4LCYB 3P3YA 5CNHA 1KB5A 2LHAA 1CD0A 3ZYOA 4EI6A 4OUOA 4UAHA 2QSCL 1JWMB 4ODBD 4ODTL 1EZSA 1KSRA 1IC7H 4HISA 2Y07H 1MAKA 3LIUA 2WB1A 2V7NB 2HH0H 2X4TA 2E27L 3RWJB 1VGEH 3VX1A 2V2WA 3D09A 2WB7A 1J0KA 1NGPH 5CD3B 2YFOA 1RK1B 2I9TB 3SKUD 3FHEA 4FNLL 2OMXA 1CU4H 3D5OF 2NNRA 3TL5A 2KLSA 3EAKA 5TQ0L 1XEDA 2NUTB 4JFHD 4M29A 3K5RA 4YHZL 1U8CA 1A4KA 3AREC 1B0GA 3VU2A 4JMNA 4L4TD 1NOAA 1X9LA 2XWDA 3T0DA 4PAZA 3G9VA 4TQIA 5HXMA 4PW4A 1PX3A 4XRCB 4TM9A 4N6RB 1X5MA 5FGBC 3WS6C 1BOGB 2C3VB 4W9ZA 4FZ8L 5HGGS 1AKPA 5ISZE 4TTDD 3OF6D 4WGKA 2C9PA 4PJAA 1KIPB 4QGYA 3SDXA 4G8GE 2FWOB 1PIGA 1U58A 5CP3A 4P2OD 5BXFB 2BOCB 4DP9X 3TURA 3A47A 4XHJC 3ARXA 3U9PL 2OMYB 1B3IA 4PW3A 3IVKA 5DSCA 5C6PB 4N2BA 1OLZA 5INCB 4GAYB 5H4ZA 4AYGA 2CLZA 5KYXA 2C34A 3FHQA 3HI5H 4ZAKD 4HHGA 3VFGH 2ZUWA 2IH1B 2GJRA 1CFSA 1DQQB 2OSXA 2EXSA 5JW4N 1LWRA 3TV3L 1RIUH 2RFXA 4ZMVA 3L3HB 4NENA 3L7EB 2IADB 2B1AH 4Y8DC 2HLAB 1ZS8B 4WJ5B 1KB9K 3LPGA 3NPZB 1GY1A 3P4MB 4Y2OB 1CXIA 4JB9H 2LVEA 1WEJL 3PABB 1U8JA 2P24B 2NCEA 4K5PA 1JF1B 1YEDB 3PWLA 2A74B 4FXGC 4YBHA 4A67A 5L8LB 5IFJB 3QJHB 4DQOL 3MCKA 1TZHA 4JL2A 1FAIL 2NR6D 2OMUA 4GW5A 2A9MH 3LQZA 1A1NB 1PZBA 5DURD 4YSEA 4LBAA 4Y4KC 3E8UH 4XMTA 3O11A 3MLUL 1HHGA 2IMNA 3K6OA 4MZIA 2Q10A 4DEWA 5AVZB 1NM9A 2APBA 3GJFH 4HH9B 1H3XA 1SJHB 4WFFD 1J10A 1E4HA 1OPGH 4H26B 4JY5H 4PJ5B 5E23A 1CLZH 3QUKA 1AR1C 3NCCB 4R0LB 4KFZC 1TVHA 3RFZC 3N43F 4PJ9D 5K1NA 3EJPA 4G1EA 3CFDA 5C08E 2PXYD 3F58L 3P2DA 1Q9OA 2MMXA 4N2CA 3HR6A 4EN2A 1JI2A 3UJTL 2EEDA 4DNLA 2NTSP 4UIMA 3WELA 1Q9WB 3EZJB 3HVNA 4YDNA 3PWJB 4YDVB 3D85B 3NESA 4AIZB 3M6DA 5AB1A 3DO4A 4KDVA 2QKIB 2P5ED 4V1DB 3DETC 4JFWA 4XCEA 2NLJB 2VDQL 4N0CC 4X6CB 1OE3A 2BCMA 3I50H 3KZ8A 1BM3L 4MASA 2VLJD 5B3SB 1THCA 3KPMA 4Z95L 3QNXB 3QNXA 3D3VD 3G5XA 3REWA 5E5LA 4BFFA 1JPSH 4W1TA 3UL4A 2EDKA 4OU3A 1B4JL 1URLA 3QIWA 3TZVD 4JE4B 4H1LB 3DXAE 4NKMA 2XZQH 3SZKC 5GJTL 1A6AA 2Q8AL 2F9BT 3NZSA 2YKLL 1VSCA 5E95B 2UX7A 1FHNA 5DTFA 3B5GA 2XZAH 5IFHL 4FNRA 1RZJL 1NKRA 4FCAA 2CPUA 2QKIA 5HHMB 1MQKL 2F1BA 2YHGA 1U8PB 1T21A 1EO8H 3EJJX 3WUWB 3QDGA 2YPLD 1XR9B 3UXFA 5EN3A 1JRHL 1P5UB 1UXSB 4OV6F 4WJG3 4E9RA 4GOSA 2M2DA 4MDRA 4X4YB 3A3YB 1HDMB 4GY4A 4XPGL 3CMOH 4XVUD 1RZFH 2OKMA 3GSNH 4JFPA 1BQLL 5ACMA 1TQWA 2NY0B 5C86A 3WU1A 4FG2A 4PR5B 3EYUL 4H13C 4G72B 4HT1L 3CVBA 3BZFB 3ZKNC 2MCG1 1FYHB 3FSZA 5JOFB 1JDAA 1NSNH 4DF9A 2ICEC 4G6JL 4BHUA 4AEHL 5FO9A 1G9MC 2Z0UA 1U4EA 2IWGA 3HG2A 1HZKA 3MRFB 1BZ8A 2B4CH 3MGTB 5ABAA 4APQB 3NA4A 3RUGB 3EOTL 5AVXB 4Y4HA 4WW1B 2HT3D 4YXKH 2F18A 4BE5A 2HLAA 4WJ5A 2JLPA 3FN0H 3ZUCA 3GWJA 4BSWA 1EHLL 4MD5B 3L7EA 3MODH 4Y1SA 3V7AG 1JYXA 4BQ9A 3EHBC 4Y19D 1NUDA 4X5LA 4YBQC 4U2YA 1DJYA 3HZVB 4HKZA 5EBMB 1FZMB 5LBVA 4E0RA 5EN2B 5CLWA 5CD3A 1MRFL 3KBHE 3MTXA 1A02N 4JQXC 4NWTH 2X2UA 5I8EA 3TO4D 5MEOB 2FJGA 2GYSA 3KS0H 1S7VB 2WANA 4KK9D 5C0BD 3D39A 3LRLA 1B0IA 2FWSA 3QGVA 1UACH 5E8OB 1FGNH 4QHKJ 3BW9A 5DQ9A 1ADWA 4WW2B 3UTQB 1FNHA 3AMLA 3ULSA 3NAAL 1AGDB 1UA6L 4CMMB 2VB5A 1HXMB 1W8OA 2FJHA 3QZWB 3HHRB 4UU9A 5HHXL 1E2ZA 4KUCF 4AM0B 1V05A 2JXMA 2AK4D 2E4FA 1CGTA 4PJ8C 5I6NA 2APVA 2FBJL 5JHMA 2Q87A 1JPTH 2XKSA 3F7RA 4NC2B 2HRLA 3V8OA 1NA8A 3EGXB 2AMGA 5LNEA 2CM5A 3QNYB 1AJ7L 1EH9A 1YPZA 1U9KA 4UV4L 1T0PB 5DJ6A 3BDYL 1I8KB 2CGRL 3GLEA 2BERA 1JGEA 3FOMA 1D9KA 4BQ8A 2EDJA 2OL3B 4UM9A 4HBQA 1I8MB 4BZ1L 1F4AA 2R69H 3MV9E 4ODXB 3L45A 2UZIL 1RU9L 4JZJA 4ZPTA 4F9LA 1H15A 1V27A 1FA4A 1GZQA 4CNIB 3HZKA 1HNGA 1QO3A 4XOAA 4GRLC 1AVAA 1C5DB 4ZODA 2DL2A 1JWUB 4C47A 3PFQA 1A6AB 2PW2A 1FPTH 1CI5A 5J1AA 4H8PA 1SRDA 4PRPB 5IEKA 3BP6A 4HPYH 1MPAL 4I4WA 4WFEE 1JZIA 1PKOA 4HMDA 5ES4B 5JXAH 3G5VA 4R7DA 3UTSB 3ISYA 1NPUA 2Q2EB 2X44D 3OXSA 1E67A 2KL6A 3QHTC 2Q0ZX 3X12B 3OG4B 4K3EL 1OAKH 4X8JA 3ZTJH 1S7TB 2MFNA 2WKGA 3HRZC 1XGUB 4OZHB 2FD6H 2E9IA 4TUKL 2JIXA 5D7JC 2WO3B 4D9RE 5EBWB 1IGMH 4R90H 3EYOB 4ZFGL 2WXPA 1OCZB 2LFEA 3RUGF 1M7DA 2W9EH 4OFVA 2ORBH 4CSSA 4MZ3A 3L48A 4XI5D 1BFVL 1QSED 1DQKA 3RZCB 4A04A 1AY1H 4X83A 1NMCB 5K39A 5AW5B 4ZX5A 4ZFOB 4EBQH 3QB7C 4Y4KB 5SWSB 3VFMB 1B6DA 2CLVA 4GW1A 4LVEA 3V0WL 4KVPA 1TQCB 1HJBC 5DSCB 3V4PH 4K71B 4Z7VA 2HG0A 4Q9QL 3KR3L 4NN5B 2QBWA 2J43A 2OP4H 3CAFA 4PY7A 5GQBA 3KJ6H 3C6SA 5F3HA 5GISH 1T1WA 1XL6A 4R2GB 4MNGB 4JUSA 2O5XL 2OX5B 3RPKA 4WF7A 1UKSA 2JMRA 2WCGA 5CUSL 4UT9H 4YOKA 1AGEA 1HSAA 1U3HC 1QLFB 1U8JB 1AGCB 3MO1A 2BXZA 3ZTJG 4Y1AA 3NJXA 4PJHF 2OULB 4MA1B 1RUAL 4FQCL 3LEVL 3TN0C 1Q0XL 1IAIM 4P46D 1IGIH 5DZOA 3BH8A 5I26A 4OZIE 3VW3L 3QCVL 2L7JA 5F9JB 4NS0A 4GRLB 2VKXA 4HW6A 5INCA 3O0LA 4LSQL 1AZVA 4I3RH 2J56A 4X6FA 2EXWD 3THMH 1L9NA 4E9QA 2WNGA 4Y9EA 3K1DA 4N3TA 4ABUA 4HSQA 2UZYA 4YDIH 3EKCA 1PMYA 4HJSA 3TZVC 4AT6A 4L8CA 2HTLC 5CZRA 4OF8A 5D1ZI 1KTLA 1YAIA 3NSJA 3NZ8B 4UT7L 3WFBL 2FWOA 4R4FH 2I60H 4PGBB 1E4WH 4G71B 5EFIB 2PO6A 2RCSH 2XBZA 2B0SL 4JFEE 1XF4A 1WZKA 3E9UA 2WZAA 1FNEB 3O3UN 5DO2C 3BJ91 3L1GA 1UM6L 2WD0A 4LK4A 2AXWA 5CZKA 4Z8FH 1TTRA 3WOVA 2RTTA 5KVDL 1GYAA 2IFGA 4PGCA 4W9IC 4L29A 1UD8A 3GI9L 4JZNB 3RIFK 4I1PA 3WNNA 5KG9B 2WOBA 3DOIA 4QXTB 4RX4A 4QEGA 5SWSE 3V6OA 5IB2B 4XBGB 4J3OC 2RD0A 2BNRA 2WBJB 2Z7YA 4QRPA 3WIAA 4B50A 3KCWA 3JWNG 1FNAA 3AG4B 1SHWA 1X6NA 3WFCL 5JPMA 5D7EA 3LXCA 3K72A 1RK0B 2BP8A 1RK1A 4MHHG 4TLTA 1J1XH 3FZUC 4LHUA 2I9TA 4FFTA 4J8RB 2CE6A 5BS0E 2LR4A 2WVVA 4YJZL 3P4NA 5K33A 3V52L 1JZ6A 3UO8B 3G6DL 1RD6A 4NAQA 5ALCH 2XBTA 3PQYD 4TKWA 3QUYD 3P4NB 4OGXL 4MAZA 3VGAB 2BZDA 2CO7A 3COOA 5GGSY 4F33A 3ZTDC 4KVCH 3EFFB 4YHLH 4TTGA 4IU3B 5CU5A 2PWGA 2RBLA 2YSTA 3NDZE 2GHZA 2UX6A 4NM8L 1I8LA 3BT0A 3FB5B 3FAXA 1TZAA 1XGQA 4QNPF 1SDDA 2X53A 4KROB 2BDNL 5C0RH 5JHLL 4W6YB 1HN1A 5ESQA 3UAFA 3PG2A 2SEBB 3I6GA 4OIFA 5HYEA 5KOVC 4DZ8B 2B1HL 2MQGA 5JNYA 3T4YA 5K9QI 1T1ZB 4NZFA 5FO2A 1I1FA 1HXYB 3IWUA 1TLMA 2R27A 3SYQA 3UEZA 4A7TA 2NNAB 4TYUA 4ZOCA 3S34H 4KDTA 4H0HB 5D2LF 3S2CA 1HSBB 5IB3A 3ZDZE 1B2WL 4I0PD 3RPIB 2XACC 1LJMA 4FQIL 5JW3H 2HFEB 2I07B 1AIFB 5F97E 3G5WA 4GKLA 4QXGH 4W9LC 3MUY1 2QSVA 4Z0XA 3OSVA 3V6ZA 1LILA 3FO2B 1J5CA 6FABL 4KXAA 3UZEC 3PL6B 4D3CH 5HGHA 4BFIA 3EYQC 3SGEI 3T8MA 3TEWA 2YC1B 4GAJL 3A4DA 3NRQA 2DV6A 1A4AA 4GUPA 5DVNA 3VG0L 2IQAA 5HY9B 1E6JH 1IIIA 1UD6A 3FB7A 3L3JB 4I77H 4L1HA 2H32B 1FL3A 3DJRA 1QSFD 4U6YB 2C1PA 3SBQA 4JPWL 4DZ8A 3DX7B 1T22B 3RZWA 3SZ6A 4ZYKB 3OLEA 5E2VL 3NSYA 3CE1A 3RE0A 3MRKB 4LPCA 1A22B 4WI2A 5DHMC 4CMHB 3UO1L 3X3GL 1TQVA 3FH5A 5E6YA 4JFDD 2YPVA 4JLRA 2G4GA 4JHWL 1PIFA 3GMNB 2XTJD 3D9AL 2N7AA 2R1YA 4JEGB 1I7TB 1UM5H 2Q6WA 2VR5A 4K8RL 1E3ZA 1SOSA 5EMYA 3UBXB 4OZIB 3QDJE 4RGNE 3RVXD 4NJAH 4LCWA 4QRQA 4NQQA 3ARDA 2YRZA 4DGIH 2A73B 4U0QB 4ZUTA 2VSDA 4OI8A 3P9WB 2IDSA 1XCQA 3OMNB 3HKZA 4NP9A 3K0YA 1R3IH 1V10A 2ZOKB 5AW2B 4NNPH 2N0MA 3IE4A 4NQDA 1P0SE 2N1TE 1KENL 1OAQL 2R0KL 5CBAB 1GGTA 2CA4A 3T0WA 5C2BH 1UKTA 2DQUL 1J87A 2VUOA 4HMEA 4QXTA 2VXVL 2OJEB 4JHUA 5CJQH 5CP7B 3UPRB 5GGQL 3OAYH 3ARDC 4L29B 3EYVB 3HRPA 3RVTD 2G75B 4X8CA 4LKXA 3ABZA 3WEOA 4RGMB 4QJ5B 1HHJB 1SMOA 3S8WA 1BD2B 1V55B 1G6RB 1OGAE 4Y4FB 2ZG3A 5F7EH 5J1SC 1U8IA 2QSTA 3IFPB 1LO3H 1Z5LA 1IM3A 1FGNL 5HYJE 1RMFL 1GHFL 2J5WA 1G7MA 3IRCA 2PYFB 4D9RD 1OF2B 3MBEB 2Y5QA 1EO5A 1F90L 1NCBL 2F54D 4NQDE 3W81A 1H3GA 1LVEA 2H26A 4EPSA 2NY2B 4CC1A 4D2NA 3HPLB 5JHDB 4RA3A 4YNYB 3CZSA 4S0TD 3K6FA 3OKKB 1A9BA 4R7LA 1G6RH 4GO6B 4ZO9A 3BHBB 5J06A 2DIEA 1SOKA 5SWZE 4YGAB 2J4WH 4IKKA 2VW4A 2VDRH 5E6ZA 5KSBE 3VXNB 1ETZA 4O02L 3S3BB 2B59B 3CFCL 4U6VH 5K9JH 3BAWA 5EDSA 5L4MA 4LCIH 2ENPA 2JK5B 2J6WA 1NANI 5TE4H 1IARB 4K7PX 2R83A 3RX9A 2WLYA 4NN7C 2DYPA 1SJEB 2R4RH 1A14L 2G9KA 3CFUA 5BZXA 3VB8A 1A7PL 4DP7X 1JGUL 3US0A 3JSSA 5JO5B 1G7PA 1W6WA 4RGOH 2YGPA 1VRSA 1TJHL 1X5JA 2Q20A 4PJXF 1TTAA 1HZHH 1RUKL 2Z35B 2B5IB 4G5ZH 3SY6A 2PW1A 4PS8A 4G8IA 3RX7A 4KDWA 3DO3A 2J21A 3JWDH 3BGFB 3NEOA 5CN1A 5DR5H 3NACH 5JPMC 4MD4A 4K2UH 4MJIB 3JZYA 2C9VA 4KHTL 3HZ3A 3HVDA 2F8XC 4KQ4H 5GGRY 1YMMB 2YEZA 5K39B 2D3NA 4HH8A 5I0DA 5B3JF 1IQWL 2YAPA 1VIWA 4RQQA 1KOAA 1S7VA 2Z31C 1TLKA 2TSBA 3H2QA 4OBSA 4WTXA 3PAVA 2DM3A 1L3WA 2DN7A 2VL5B 4OI9A 2FLMA 3P3SA 1H8NA 5IFHH 2E6QA 1ZPLA 2IPKB 2YPVL 1CK0H 1P2CA 1ZA3B 5EC2A 3RIAK 4AIEA 3VACA 2G3XA 2F53D 4AL8C 1FG2B 4JKPL 2EXYD 3X1EA 4U4BA 1LD9A 4N86A 5ANMB 4MCMA 5DJYA 2P8PA 3QCUH 5IF0B 1A7QL 4AM0A 4Y4HB 3WY1A 4OM1L 3P77A 1PAZA 3POHA 5JUEL 3QULB 4Z78B 3APNA 2F2HA 5FYLH 3BDBA 3ZDYF 3VGAC 4F7CA 1RUML 4PBDA 3U9UB 1BWWA 1H3VA 4KC3B 2D2CC 1FZOB 3QUYC 3QUZA 4MA8L 1S8DA 3N44F 3FN3A 5LQBL 4ZW8A 4XMWA 1E40A 2D03H 4M3KB 3S4SA 4TLUA 4QRUB 3N42B 4M1CD 4K9EH 2HVBA 4JZJB 4ZPTB 5LO7A 1J0HA 4ODXA 1F3DJ 1WRFA 4JDTL 1JSYA 2AS5M 1UD3A 1R24B 1AY1L 1J12A 1YNTF 5E4EB 2FB4H 4QOKA 2GEEA 3AC0A 2PXYA 1TQSA 4FS0A 2BS9A 4PJ9A 1W91A 2GSGA 1Z9SB 2WCSA 1EQWA 1QBBA 4RETB 3FQWB 5LBSH 1F45A 4JDZA 2NZ9C 2PWFA 4FGMA 1D5MA 3EGXA 3QCTL 4R90L 1ZT4A 3T0EC 4QGTA 4HS6B 4WW2C 4DTGH 3QCUL 5DWUH 1CG9B 5KSUB 1KZYA 3E8UL 4PWFA 2R15A 3V9CA 4JJOA 1U8PA 2NY7L 5DJ2A 2H0EA 1VEPA 1OIOA 5D1QD 5IG7B 3DWTA 4FQ2H 3S7GA 4C83B 3VD7A 1TJMA 5I18L 3MQIA 3UTQA 1VA9A 1H3WM 2XXCB 3B6SB 3GSVB 3H8NA 2XX0A 2FL5B 2Z6FA 3ZJAA 1UFUA 1DJXA 2YFNA 4DUWA 1Y1DA 4DN4H 3EHBB 3KPMB 2IC2A 4HUWA 4RAHA 5ABDE 1NDMA 3H9HB 3I75B 4P2AA 2E56A 3CVIL 3NTCH 3GM0A 3BOVA 3ISWA 3W38A 3R1GH 4JFED 2EH7H 4QT5A 3VRLF 3NFSL 1ESOA 3F6IA 5C09E 4ANVA 5ID1A 1NIAA 2E5EA 3AAZB 4G7SB 1E7VA 4L9DA 1ET8A 5I8KH 2ROYA 3O2VL 4YDVA 4BZ1H 2BY3A 3WUWA 5HYSG 1L0PA 1NCCL 4JE0A 4W9GC 5H94B 1BA9A 4TOYL 1PLAA 4PCKA 2H2PC 4A2FA 3TWCL 2X40A 1PZ5A 1U4FA 4MQ7A 2IWEA 2UUDH 1ITCA 2NY0C 5DQDL 5H35A 4MJIA 4QHNA 3BJLA 1FYTB 2KS0A 4Z7OE 3PFUA 2EVIA 4F9LC 2IAMD 1OE2A 1WD9A 3BZFA 3PQYE 4HK0B 4JL1A 1DN2A 1GCFA 3D25B 4BFOA 2JCCA 1L5GA 3AMKA 3MLPA 1KIRB 1JTPA 5L6YL 4PJFB 3ZKMD 4C55A 5JO5A 1QKZL 1OKEA 1QFWM 3S5LB 3QPQC 4DKEH 4GQ9H 1H6TA 4I48B 4GP4B 1WZ1L 5I8KL 3Q5OA 3TFKC 32C2A 2YD6A 4XN8A 4YXLH 2Q7YA 2LU4A 4LCWD 5BMFH 4GQRA 1LO3L 1AOZA 1EAOA 4MB1A 2P5WA 1AI1H 2AQRA 2E7MA 1J88A 2H9GB 2NZIA 1NMAL 1BZ9B 3HJ0A 4U3HA 4JANB 4NRZB 1EHLH 1MFUA 4X6EB 1MWAB 4XX1G 4N24A 2EYSB 3L7FB 1NFIB 2NSMA 4PJ5D 4YO0A 2YD4A 4XXWC 4PJHE 3EOTH 5CGYC 3PJSB 1RH8A 4UOZA 5K1VA 5TQ2H 1PNCA 1Y6KR 2YRPA 3I3BA 3ORJA 2MNWA 4FFWC 5AUMA 4GFTB 4MNQD 1AHWB 1N0LB 1G9MH 1IBHA 4AEHH 3HA0A 1NOLA 3LXUX 1JZ2A 5AKSA 5E94A 1SFDA 4KRPB 2Z93B 1MREL 5HYQA 3L3DA 4RFEB 2NYYC 2R23A 3T0EA 2LAAA 3KPRD 2BIQA 1U92A 4GIAA 3CPLA 4ZRGA 1ZTXL 1DDHB 5FF6B 5FKPA 2IADA 2ALWA 3QJRB 4NM4H 1NCJA 1J5HA 2AQPA 3WIHH 1WSST 2FO8A 1MFDL 4Y5YB 4ZS6C 1XTMA 3DSFH 1ZEAH 4XPGH 4XP1H 4ALAH 4YX2H 2OSWA 4HU8A 5I17B 4JW3A 5I66B 4GRWE 2XNAB 2WUCL 2Y7QB 3FB8B 4HXAH 5CMAA 2HLFD 1RV6X 3VA2C 4QJ3B 1QEXA 3R8BB 1MH5A 4UM8A 5E9NA 3CUPA 4DUXA 5DRWB 2EE3A 3R06B 5IIEA 2VXQL 4GMTL 4QRUA 1RUMH 2H3NA 4Y19E 1PCSA 2VDMB 3F83A 3SY0A 4EXPX 2K7QA 1W72L 2DQTH 4NUQA 4F91B 5I1KH 2WQXA 1FNGA 4L4VE 5AL0A 2L0DA 3DC0A 3QEGL 2BWQA 4XBEH 3HS0B 5I28A 2DQDH 3IGAA 4JFZH 1A7QH 3FNKA 1F56A 2ZCHL 3QHZH 2D8KA 4GXUN 1AMXA 4WWPA 4DVBB 2W65B 1MF2H 4JFDB 3SDCB 2N1KA 3VQ1C 2AQ3A 4NCC2 2I85A 1DFBH 2Y9RT 4XXDA 2IFFL 2AV7B 3MRCB 3SY0B 4UTBA 1RULH 1PU0A 4W6WB 2W60B 2F58H 5DD1L 4WFGD 2LGNA 3PQYA 4K94C 1MW3A 3CFKA 4UOQA 4WENB 1KACB 2CNYA 1LO5A 5T3XH 1QR1B 4U0RB 2B08A 1Y6NR 2NX5B 2D7PA 2WUBL 5BQDA 5JZ7C 3BEVA 5IM7A 2VM4A 4OFPA 3MYJB 5DD0L 1CFBA 2DL9A 2WNKA 1N3NB 3BD4A 3BSZA 2IOIA 2V7NA 2KI6A 5I6XC 1OAZL 3P30L 3VTAA 1KEGL 4M56A 2Y7MA 4HCRH 3RWCB 3SQRA 3KCPB 4TL4A 4FMFA 4EIZC 1U58B 4KO5A 1NCHA 3B2VL 4NHCL 4PLJC 4UWQB 3Q44A 4L3AA 4OD2B 2DLFL 5HDLA 1IC4L 1HHIA 4KVCL 1ADQH 3WSQL 3TEZA 1O75A 1VGKA 1JK8B 2ZQKA 3QJQB 2ZOTA 4HJ0C 5GGUB 3V4LA 1MI5E 4M1CC 1SN0A 2ALAA 3RIFF 3RY6C 4BV1A 1N2RB 4Z7VE 2EH8L 5DZ9A 5A2LH 3FTGB 4OM0L 3GB7B 3SCMD 3RGBA 1J8HD 2MQ3A 3EBHA 4QYOA 4PJFE 3HC4H 4S1QL 4F5CE 1BG1A 3ATAA 2ZUQB 5GGRA 3W0WA 1QWNA 1NBYA 3BAEH 1HH9A 5EIQA 4NGHH 2Z8SA 3HCVA 3BAJA 4LQ1A 1DCEA 4BYHA 1R4XA 4OLVH 2ZUQC 2YD7A 3IPEA 1IGJA 1S9VA 1WDAA 2WHVA 4FX5A 5DK3A 3P1VA 5DEZA 4OLWH 3VI4A 4KO6A 3FO0L 2VN6A 3IDUA 4WW2F 1QAWA 1A7NH 1F42A 3W11C 3TBVB 2MOVA 1ZE3H 3DGGB 3VVWA 4ONGH 2XPZA 1UXLA 4IMKA 1OB0A 2FH6A 2KZ1B 3GTVA 1J8KA 3FQNA 2E7LC 4LSRL 2XG4B 4Y1AD 3GMOB 1DVSA 1DVQA 1L9TA 2IG2H 2PTUA 5HI5D 5LBGA 1AIZA 4LVNC 2VABA 2NZ1A 4XBEL 4PJGE 3K6SB 4NO0D 3VWKC 5M95B 4P57A 3QDJA 3P9MA 3KGSA 4C8XA 3Q01A 4PJ9C 3BKCL 3FUFA 3UTPD 4B0MM 3QDMB 1E8ZA 1CLOL 2JKIS 3QPXL 3WLWC 1NCDH 2NNFA 4L1LA 3M8OL 3VQLA 3JQOB 1BFSA 4XCCH 1TO4A 5EFIA 5BO1L 1CDJA 3SGDH 3IF1B 1ND0B 3DETD 5DJDA 2VLLA 1KNOA 1RIHL 3Q6FA 2ZXBA 4KZDH 1DBKH 3AT0A 4MMXB 3LNIA 1JYNA 3ERXA 4LSTL 1O7SA 4OV5B 2FIRT 3EYFA 2YR3A 3MJ7B 5CUSH 2W0LA 1NKGA 1QVOB 1KXVA 3NZUA 2QSCH 1F1AA 5T3ZD 3SO5A 1EZUA 4FNQA 1BFTA 1BLIA 1IKNC 4JFVA 3WG7B 1TZIB 4PJIA 2EP6A 4PB0L 3VUAA 1JFQH 2WQRA 3KBFA 4JHBA 4JZOA 2C1OA 2GW5A 3LEYL 4WKZB 4XP6L 1VJSA 3QI9C 4ZUWB 4P59L 4WSJA 4PJ6A 2YQGA 3X1BA 4HQQH 2V5MA 3ZHFA 5HHVH 4FTVB 3S9DB 4YR6B 2P7TB 4XP1L 1KDIA 2AJSL 2OX5A 3TFBA 1P5VA 5E70A 4TUOB 1WBXA 3F7YB 1RVFL 4NBXB 4LPWA 2DJUA 4Q7DA 4A7QA 5JQIB 1D5ZA 2JKWA 5F96H 1FFOA 4RBPH 1TQBB 3HR5B 3TGXA 3RNKB 1KLFA 4HUCA 3MUHL 1PSKH 4FERA 1NH6A 3QFDB 4LIQH 4YWGL 5ACLA 3E1ZA 1L0XA 4AKOA 4N0FA 1LEIB 4LSDA 4X98B 1QHOA 4RNRB 5SWSA 5C71A 1GZHC 1DEEB 2PTVA 3CZKA 1OV8A 1T04B 4IKNA 4BSVA 5JXEA 5GGSB 4N20A 2VZSA 3RVVD 4D7PA 5BJTB 4XCCL 4CL7A 3IDYB 2IH8A 4DP0X 3U36A 2FWLB 1QFPA 1JN6B 4YHKL 4MBOA 3QG7H 4PQXA 5F8QC 1F0LA 2QQKH 1G7JB 1X3DA 4LLQB 2F5AL 5KW9L 5JDJA 1UJTA 1E2WA 3QUMH 5EEVA 3N1PC 1O7VA 5FUCE 2VZVA 4NQXB 5C0RL 3KLHC 3TWCH 3WNPA 2GG1A 1HL8A 4ZS6D 2X09A 5J12C 4K15A 2BLFA 3GLZA 3FT9A 1NBZA 3HBPA 4OW6A 2MSPA 5I8CB 3HG3A 4YHLL 3HE6C 4G7YH 5CZXC 1MFCL 1SNRA 5HGAA 2Q76A 1ZDQA 4ZX4A 3K7UA 5E8PB 3TO4C 5CLZA 3U7AA 4ZXBB 1P6FA 4MDIA 1DVFB 1YY9D 3OGCA 5I74B 1B0RA 5EIIG 1T1YA 3ZBMA 3ULVC 3H1ZA 1UCBH 4V33A 1MY7A 4ADGA 5CHNB 3ARTA 4GS7B 3S3CB 4Z7WB 1VFBA 1YNTA 3FT3B 1GGCH 3NFPA 3O6LL 1QP1A 4F33B 4U2ZA 2HSIA 4B9PA 2HMIC 3QA3B 4ENED 5AENA 4OI7A 3RDTC 3VXUD 1F3RB 1KJVA 1W80A 1IVLA 4WEBL 5F21B 1OTSD 5CD5C 2ZG2A 2BMKB 3TNNB 5B22A 3IJEA 1NPJA 3T04D 1E0OB 3F85A 3TH3T 5KN5B 1JZ3A 1KIQA 1EFXA 5C8JA 1UA6H 2WQ8A 4NWUH 3SDYH 3WY2A 1WICA 2GC4C 3Q3GA 2W94A 3FQXA 1U3NA 3MNVB 3LH9A 4M6AA 4X9YA 3SN6N 4PMEA 1ACCA 1T4KA 1YRKA 1P84K 3OMIB 4NQVA 5CGTA 2DIBA 3DSNB 1PKQB 3M86A 4WWOA 3GKWH 3N0AA 3VFOA 3BSZH 4JCWA 3N9GL 2QDVA 4IIQC 3T4AA 1ZMYA 1U2HA 4OZFH 5JZ7D 4NKIH 4P5RA 1ETB1 4M48H 4X2UA 3WEXB 1BVKA 1HXMA 2IBZX 2QR0B 1QUPA 4G59C 5GRUL 3CXHK 4I18B 2FRGP 5ETUB 4NZUL 3O2DA 3ZDYE 5G4MA 3NA9L 5E5RB 5F88A 2EDLA 6PCYA 2NNXA 2FCBA 4WFHE 1UVQA 2FJGB 4YDJB 2WZ6A 1A4JA 3SBRA 4CA4A 5HHOD 5GRXG 1TNMA 3LEVH 3EUDA 2WLZA 3BFWA 3WMSA 2GQHA 2MIZA 3QP3A 4ELKA 5IQMA 2GSMB 3TIDB 2OZ4L 3MGOA 1GW6A 3UPAA 4AQ8A 3GRWH 4CGUB 5HGBA 4OT1H 5C9JB 1DQMH 4PCTA 4PSPA 4GKNB 3SQBA 3OC5A 4C4KT 4R97C 1EGJH 2FEDD 2IBZY 1ZHLB 4WI4A 3O3BA 3WMPA 5DD6B 3UC2A 5E2WH 4Y7MA 3B8SA 3L4VA 4F15B 2C4FT 4ONFH 3TBTA 2YD5A 4QKXB 4MZRA 3VRJB 3SE9H 1F4HA 5D1XB 1ECYA 1YNKL 4KGJA 4P2RB 4YHNB 4HGWB 5DJ8B 5T1JA 4XP4L 1TO5A 2AV1A 4ZOAA 1Z3GL 1DVFC 5GHWH 1MHEA 4ZXBC 3QUGA 3BAKA 5DRNB 2A7BA 2D7MA 1ZDSA 1OCCB 2DQJH 5T5FH 4DGVL 3CLEH 3MOAL 2XN9A 3L3IB 4GAGL 5KBKA 3KHOA 4F9PA 3BZ4A 5J6GB 2XN0A 2AJUL 3P4OA 4BFJA 1MH5B 2J5LC 4KZCA 3H42L 5K5YA 1SDYA 5AZUA 1ZEAL 1BIIA 3SE9L 3QUXB 1T1XB 1CO1A 2R8SH 1GYCA 5D7KD 5FFOA 3QQDA 4ZD3L 1QNZH 5D7LE 5AEAA 1NIFA 4BFEA 3FO1A 3A67L 4Q2ZB 1EGJL 4JQVC 1QFWI 1MCPH 3ZHKA 5C7XH 4NZ8A 4A7VA 1HOEA 1XCTB 3CC5B 5BRZA 2H1XA 4K3EH 4UNIA 4G9FE 5DTFB 4XCYA 4OTXH 5EU5A 5GZND 3GJFB 5DD3H 1DBML 1NFDB 2EYRA 2ZD0A 3NSFA 3AY4C 4J2XA 5ACZA 4GW4B 5H37H 4HUMB 1NGQH 3D8MA 5GIRB 3MJ9H 1QLEL 2YD0A 3SDCD 5KAQG 3G6JB 5FB8A 1EJFA 1RIUL 1AI1L 1SBBA 2P8LB 4X6EA 5MEQB 3F5WB 3VFGL 4PVNA 1CE6B 1QSEE 4FJZA 1QLRB 1C5DA 3VXUA 5AALA 1GGYA 5FPIA 1MXGA 2GJZA 4P2OC 5EU7C 4ZAKA 4PJHB 2A99A 5DLML 4OJCA 4BKSC 3PIQB 3WFEL 1UWGL 2V9RA 3RJQB 4KKCD 4M8UA 4Q58C 3TESA 4FXKC 5INDA 1HAWA 3SKJH 4NX0A 3GLAA 4FLOA 5IKCA 1BMGA 4JFSA 1T7ZA 4G6FB 2YMTA 3BPLC 5C1MB 5I71B 5HDBE 1XGZA 2PO6C 4UILL 4XE0A 1P4UA 2YSSA 4TNWF 1GC1C 4JM2B 2LLGA 1Q9LB 3VXPB 1TCRA 1E27B 3OXRA 3K2IA 5CINL 5E03A 4H26A 2IF7A 1FFNB 1WEJH 3MZGB 3OC8A 3ZUNC 3OF6A 4LPYA 2A6JB 4KXDA 4HH9A 4XBPB 2BY2A 3DUSA 2F68X 2WW8A 2FNWA 2ID5A 2UXTA 3H85A 4KXZI 4L8BA 4U1JA 2NTFA 3ZOAA 4E2OA 2DQUH 4QHLB 4F2ME 3ILEA 4MAYA 4QRRD 4IBQA 4WEBH 5MEQA 3S96A 5F7YC 4QD2E 3DIFB 1UASA 3RYMA 4ZBJA 1UCBL 1D6VL 1ZPUA 2J8UE 3MFFA 4OKVA 2DTML 4HWZB 3WDIA 3V0DA 3BKML 3U6RA 1RJZA 4LAJH 5ICXB 4JCMA 3ZTNH 1PY4A 3TA3C 4EUPA 2WGXA 3WN5B 1ED3A 4WHYH 1ZVNA 3ULUF 5BZDA 5LXVA 3TYFA 3HC4L 4S1QH 1ZHNA 4BINA 1R0AH 1BEYL 5F7EL 1X6LA 3QR2A 1BPLB 3AXLA 2JQAA 2IALB 3D3VB 1UH4A 2YPKB 5FEBA 2PPAA 3CVHB 2Z4TA 1UGKA 1FO0L 1S7SB 2GT9A 2YAMA 1P1VA 4MDJB 3IJHB 3IJSB 4IOIA 3VTTA 4WTZG 3MMEB 5D1ZD 3A4AA 1DLHA 1CQKA 3F12B 3PNWB 5AVRB 2NY1B 1A6PA 5KSBF 3LKOB 5DJ0A 1X9RA 5EZPA 1A4CA 3ZY7A 1S4IA 2ZTBA 4NHCH 5D7IF 4RFOH 4ENEC 5L2KB 1Z9NA 1QFUH 4UIKH 1VACB 2P44B 5BRZE 1KEGH 1NCAH 1PZDA 3VXSB 2ZSWA 3VYOA 4HT1H 1OTTD 3L6FA 1AXSA 1LDPH 3BH9B 2CKBB 1XL4A 3LOWA 4Z7UF 2NY4C 4A7GF 3AM8C 2KZBA 4IEFB 2F53B 1EXUB 2AJYL 4F1SA 5A2IH 3BUBA 2D7OA 2ENSA 3ESMA 5EU4B 1ZXKA 3TBTB 4UMGA 2EDEA 3GLDA 4FQIH 4WV1B 3ZT7A 2ICWB 5GGVY 1EERB 3D18A 1X5HA 3RVWD 1JTTA 2VLMD 2BINA 5D9SA 3CGTA 4OJAA 4QNPE 3L1OL 1RZIB 3O8XB 3VWJA 2WSPA 3L3KA 1FO0A 1KN4L 4JN1L 4AVHA 4OGAD 3O3EB 1P5UA 4XWOD 1S5HA 3ULVE 4OCLC 3FT4A 1RIVL 4GXVL 3PUCA 1TFHA 2HKHL 1YEKL 4E42A 1K4CA 3R4RA 5JHLH 5F72S 3UPCA 4HUNB 5AB9A 4NC0B 2ADGB 3ECWA 3WS3B 1CFVL 4KNQA 2CU9A 1KBBA 4NO0A 2J72A 4OFDA 1T0NA 2AQNA 2YEQA 4N0UE 3RTQA 2A3TA 4NQEE 1ZGLM 1I9JL 5I75C 2V2XA 5A2CA 2Y2TA 4BGDA 3US1A 2WP3O 3C75A 4LLDA 3QIUA 3WL9B 4PTTA 3B4NA 1JUFB 2FO1A 3VYNA 1I85C 5DD5L 4BZ2L 4DQAA 2XZCL 3AITA 5L8KB 3B9KA 3TTYA 3O45A 4FYTA 1ZA3A 3HNVH 1P2CB 2XV3A 4QIRA 3TJHD 3TPKA 4LQFL 2ZKMX 1M7XA 1AKJB 2Y7OA 4EKJA 1QRNB 3D69A 3CX2A 3DI3B 4YBLB 35C8L 1NPNA 4YC2C 1NCAL 3MV8B 3GIVB 4YDMA 5CKGA 5E2TH 1BJ8A 4WHDA 1NC2A 4NFCA 1KFAL 1EFXB 5LAXA 4YBQD 5C8JB 3S88L 1P4BH 1T0MB 1YEEL 4OFKA 3ZZ1A 3SPCA 3NPSC 3SQOH 1G4RA 5L4FA 3UYOD 2GIXA 4A39A 4Y5XA 5T3XD 5FWRA 3FS9A 3MRMA 1NUNB 2I60L 3A22A 3HG4A 3MBWB 1RP8A 1HHGB 4ISVB 3PPEA 1M7IA 1PLCA 3EGDA 5F2FA 3WTSA 1NEUA 2CRIA 4LL4A 4NKOB 1O0VA 4ODWA 1T1YB 3B7TA 2R4RL 5DQJA 3STLA 2Z4QB 1N64L 5C0EA 2J6EA 3LH2L 3AUWB 3LHAA 5IESL 1I3RA 3QQ3A 1ZS2A 1IFRA 3LNGA 3L2NA 4CC4A 2LU3A 2OXHB 4XOBA 1URIA 5SV3A 2UYLB 4AMKH 3L5HA 3OJDB 2V4LA 2PCPA 5T1DH 3IAGC 1ZS8A 4C4UA 1AHWC 4AXWA 2CJUL 5E8DL 1AYRA 3GI9H 2FECI 3V0EA 4P5TA 4QHMA 5J9PB 4NJ9H 1XGPA 2UZXA 1BCIA 4Q14A 4FZEH 3GK8H 1LQSR 4Z7QF 3UERA 3CQFA 1ETA1 5BJTA 1Y7VA 1QNIA 2ZCHH 1MJ7L 4JS7A 1N6VA 4Z3GA 2R4SL 3CSFA 3FU6A 4HALA 1IILE 4A2MA 2DQTL 3LSOB 3WE6B 2DBLH 1CICD 5E2TL 5DHVB 1IM3B 4WRLA 4M61B 3TVMB 3X13B 2B8OT 1ASPA 4M7LH 2QLVB 3SODB 1JZGA 3VX0A 3IFPA 3KNBB 5EZIH 3HE7C 5I76A 1NKOA 3GMLA 5JHBA 2BX5A 1ZJBA 1H9DA 5MEPB 4NFBA 4WI0A 3X3FL 3O2VH 1K3ZA 3H56A 4H20L 3JVGC 5JXEC 5KBNC 3T8XB 1DQLL 1WFTA 2XWEA 4GBXB 1L9QA 2ZIDA 3C9NB 3KPSD 2PO6D 2F58L 5DD1H 5C0CD 4FQJH 1IGTB 1MFDH 2E86A 4PJDE 5AD0B 2CHXA 2F1EA 4Q0XL 3IK2A 5B1JC 3HUJB 4XP9L 5F96L 2CUHA 2ADJA 1PD1A 3L4YA 1BLNB 2NT1A 5SWZB 3ECQA 4FOMA 3MCLH 1ZLVH 4ODUB 7PAZA 2P46B 3QEGH 4EZKA 3KLAB 3BQUC 3KLAA 2AABL 2IDUA 3LSOA 2OAAA 1JERA 4WI9A 4LMQE 5JIHA 4N4YB 4TULH 4HIHB 2HKHH 2X70A 2BVPA 3BE1H 3IJYB 4OAWA 2XWTA 4S1DD 4XNUL 3OKYA 4NO2A 1L4IA 1GC1H 2NY3B 3IMWA 1SXBA 3MX0B 2CUIA 1IT9H 3WI9A 3ZYZA 4NBYB 4WCYH 4ZFZA 4FQHB 4WVRA 2OQJA 3AZUA 5ISZD 3Q6FB 1LTXA 4G8EB 4P9ML 2K6WA 1F6FB 3A67H 3M17A 3TZVB 2AXGA 3MRJB 4GLRI 1KMGA 4TSCL 1W72B 1FVEA 1RK7A 5TGBB 1E30A 4XVTH 5K93A 1HEJC 4G6AD 1KTKE 1FFPB 3IGKA 3K8KA 2AJYH 4X9HA 5E6RB 4UDTA 2WINA 2AJ3A 4R4BB 2C1PB 1SFHA 1AQHA 3IXAB 3TH2T 3FB7B 3L3JA 2UV3A 1CR9L 3QDMA 4NZTL 3L4XA 4AYDC 5LJYH 3K71B 1T3FA 3QUMB 2VO8A 1A8ZA 4H5SB 1JK9B 4MA8H 1YJDC 4UV4H 3C8KB 2A6DB 5H8DA 4AEIL 1T7WA 3ILPA 4KNSA 2OR9L 2RMNA 1G6VK 4U6HB 3TN0D 3GMOA 5ESAA 3ZRFC 3ZR6A 3U6XA 4M02A 1F1DA 1JGDA 2FBJH 3KPTA 3WIIL 7PCYA 1SVBA 3LS4H 3CDCA 5C2UB 2R2BA 5ITBL 4HXBH 4N2AA 4Y19B 4ACPA 3S8FB 3KLSA 4QRTB 3X11A 4D0DA 4YVNA 1JE6A 3CCHB 3K3QA 1HKLH 1AG0A 5E4EC 5F0MB 3ESPA 2LLNA 1QSZA 1VFUA 2PCPB 1TYEB 3OJDA 4KAQH 3FCSB 2X0UA 3QG6A 2X89A 4DCQA 3L4TA 3VI3B 1HWWA 3EGSB 4JQIL 4AENA 4PCSA 1PS3A 2VOTA 3Q2WA 5BUGA 1KIUB 2CIIA 3ARFA 3ZE2B 1NGZB 1QA9B 2NY2D 4BEIA 3HZYA 3ARGC 4JRXA 2YEVB 4NZRL 3BDYH 4PV8B 4D8OA 4ISVA 3V52H 2JJTC 4XWGL 3CVIH 2RIKA 3G9AB 4F7EA 3MRRB 3GO1L 4FF9A 5C3LD 3KYKH 2XLLA 4XMLL 3QQ4B 3ZDZF 3N9GH 2R2BB 3LKPA 4YXKL 2G3ZA 5EOCL 4ZOEA 3LTVA 1BQSA 4N25A 1E8YA 1J8HB 3GKWL 2P52A 5B3JE 5K59E 5FYJU 3KCPA 3GS0A 4GS7C 5DQDH 3V0HA 5IVXB 2DWYA 1NINA 1D9KD 2A4CA 3SE6A 1G7LA 3H6AA 1MLCA 2P5EB 4MZ2A 3OQ3B 3RWDA 1UACL 1S5HB 3FXIC 1NCCH 2VO5A 2ZX8A 3ARQA 3BUYA 5AG8A 4XN5A 2DKUA 1YEIL 3SKJL 1KGWA 1J9QA 4KTDH 5KJRL 1SQ2N 3UP6A 3LKSB 3DV6A 4LSUL 2WINB 2BWIA 4BWWA 1KDJA 2CWRA 2FJUB 4P07A 3I6KA 4F37K 4FL4B 3WFHB 4BKLA 1EEQA 2LTQC 1W9XA 5F9WB 3NZ8A 4JRFA 4HG4J 1A65A 1OGPA 1TPXB 2NNCA 2R39A 2F61A 4JFFB 4LSQH 5F7LB 3ZQWA 4ACTA 4HOMA 4M8QB 1XXFC 2LU5A 5EOTA 4KKZA 4ZO6A 1AD9A 2K1MA 1T7YA 2W0FA 3EADA 1FH5H 4P05A 3DX6A 3MX0A 4OCWL 4P3DB 3DX1A 3QDGD 1V7ML 2ESVB 1NM4A 3FT4B 5BOJA 1I8IA 5CS7A 1TZ8A 1I9RL 4HGKC 5I0XA 3T8VA 1B4JH 4YQXH 4KH2A 1F6AB 3VFSB 2DLEA 5HJDA 2ADJB 1MCPL 4U3XA 5EEZA 1UADC 2OMZA 4LSVL 4F3FB 1TJIH 2FT6A 4L9LA 1KBPA 4YSTA 1A5FL 2QADB 3D3VA 4KX9A 3DNKA 1MCSA 2WLLA 1MCQA 1S2EA 1T20B 2VLRB 3N1FC 1AO7B 4OF0A 1KCSL 2ZYSA 4IEFA 3J27A 2IANB 1D5BB 5J13C 1TUPA 1F18A 3HTLX 5L0QC 4KOBA 3TWYA 1M4KA 4WWKC 3B5HA 5CWSA 2HLFC 2DQFB 4PJ7B 1DVYA 1LEKA 4HEPG 4ICWA 5E94B 3O0RH 4XCFL 1JXFA 4DZBB 1MQKH 4NQUA 3CNKA 3RTLA 3EUUA 1LMIA 4ALAL 4DGWC 3NJHA 2VXSH 2OW7A 2YBRA 1O7DC 2GTZB 5E1AA 5FYLL 1CLZL 3IU3A 3WIHL 2XZQL 4XVTL 1NC4A 2F74B 4FULA 4QHKI 4EN3B 2TRYA 5GS1B 1AOHA 3ARBB 3AS0A 4IOSA 2NDGA 4KUZH 4FQQB 2A77L 1CBVH 2QGEA 2V5TA 1A6TA 2GJPA 1MWAA 4O9HH 1HEZB 3HS8A 4M4RA 3CVHA 1DVTA 3PDOB 3FSOA 2HKFH 1DTUA 2LAGB 2H9GA 2PPCA 2IAAC 3STZA 1LK3H 3IDIB 4CU7A 1TJHH 3E6FB 4PGEA 4OLZH 2YPLA 4WHTB 4P5TB 3AQXA 5J9PA 1OAKL 3RPBA 3O4LE 5IB4B 4ZPVA 3BVXA 5FDWA 3D34A 4FYSA 3PHOA 4F8NA 4OJFL 4HPYL 4BK8A 4YPGA 5BRQA 1PAMA 5DK2B 4XE5B 5KEZA 1G0YR 2BSEA 1B3JA 3QQ3B 4HG4K 3FTYA 4R8WH 1ZVHA 3CDYA 2AQTA 4ABWA 4UQ9A 4OBRA 1B6UA 4JZJC 3BGAA 5JW3L 2XG5B 5JLZA 4QUOA 1FIGL 1A3RL 3BUQA 2H2SC 3IXTB 4PWEA 3D06A 2HFFB 1R47A 4Y5VB 1J7VR 4LOUC 4HCGA 2GEQA 1MNUL 4Y5XB 1UTDA 2BY0A 2WQAA 43CAA 5HVFB 3OAZK 5JHAA 1T2XA 2KPNA 2QV2A 3FUHA 2AEQH 5BQ7B 4OSUL 4Z3FA 1VCAA 2W91A 4UM9B 3B7SA 4G6KH 4GXUM 4NHUA 5E1QA 3SDYL 5KSBB 1OT4A 3BISA 4G6AC 4RRPG 3U7YL 3VD5A 4Z23A 4LAQL 2ATPB 4JB9L 1VADB 1IFHH 4OZGF 3K6NA 1YPZE 3QWOA 4G43B 4ZAKB 2BFVL 4XODA 1XSIA 1FYTD 3TA3A 1LL1A 5HBBA 5E2UH 1Z6JT 5DDHA 1JPEA 3FUNA 3NFNB 3PAUA 2HWZL 3BWZA 4KQ0A 4L4TA 3J2PA 3ZW3A 1JUFA 1J9CT 4YHIA 3HI5L 2Z0BA 4NQEB 4AM0Q 5JA9A 3DTXB 4OLWL 3C08L 3G5YB 5J6GA 4H8VA 3IMUA 4QKTA 3BW9B 4OLVL 5ACZB 3OKEA 3B1TA 3VRIB 1HVXA 1YEFH 2X4RB 3GSNB 3VXQA 5MERA 4YVUA 3B5TA 4OF5A 1U3HA 3WJLA 1GZPB 1I3UA 4MJ4A 2VN4A 3BGFC 5GS1C 3BKJL 5KVFE 5C7ZA 3D9AH 1K4CB 3PRZA 1MELA 5BV7H 3T1WA 4NT6A