5EF2A

Radiation damage to the trap-rna complex: dose (dwd) 21.9 mgy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
NSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein MtrB
publication title RNA protects a nucleoprotein complex against radiation damage.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Rna binding protein
total genus 11
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 5ef2A00
1UTDA 2ZP9A 5EEWA 2ZD0A 1QAWA 5EEVA 2ZP8A 5EF0A 1WAPA 3ZZSA 2ZCZA 5EEYA 5EEUA 2EXSA 5EF2A 5EEXA 2EXTA 4B27A 3AQDA 3ZZLA 3ZZQA 5EF3A 1GTNA 5EF1A 3ZTEA 1C9SA 1GTFA 5EEZA
chains in the Genus database with same CATH superfamily
3EF7A 2XQBH 3GHEH 3UZQA 4I9XA 3I9GH 4G42B 3VA2C 4LIQH 3B7RL 2G5BA 3NJGA 4AEIL 3IAGC 3CDYA 1ASPA 3OAYH 4NNPL 3A4FA 3AG4B 5CGYC 2FCBA 1BEYH 4OJEH 5D1ZA 3QHZL 5C0GB 5JHLL 4A2HA 4FNRA 4AJ0A 4UM9D 1VFUA 4NZTL 1KPUB 1C1EH 5D5ME 4BBWA 2NY2B 1RLBA 1FRGL 4Y1AA 1PDKB 4QYOA 5IBTH 5JIKA 5CZKA 4KRPB 2VZ1A 3DX8A 3V5DA 5CN3A 2MFNA 3II1A 1TQBB 4MHHG 3RHWK 3HR5B 4JHAL 5GRUL 1E28B 3BVUA 4E5XB 2AP2A 2JKRM 1TSHA 4WJ5A 1KFAL 2F19L 1EEZB 2WBJA 2DQ6A 3O0RL 4LDOB 2GQHA 4XAWH 5D4HA 1JJUA 1BJMA 1MCFA 1QWHA 2BZDA 4YJZL 2B1OA 3RNQB 1LVEA 1CDBA 3M1BB 4A68A 4JG0L 3E8UH 2OLDA 3TPKA 1GHFL 2HVKB 4N0CC 3MV7E 3KYNA 4MRBA 4E9YA 2D9QB 3MRIB 3OLDA 2QQNH 4QF1A 3AJ7A 1ETZB 1MIML 1LEKB 1KV3A 2HXAA 3BC9A 4EI5C 3TNNA 3QJXA 3N44F 1GYUA 3PQYB 4IHBA 4H1LA 5HDRA 1RZJC 3BZ4A 1U3JA 2C7UB 4KK6D 4BFGA 2ZIDA 5TFSL 3FUNA 3NJKA 3QQXA 1FBIH 2CO6A 4EIGB 4UM9B 1TJIH 3V52L 5I1CL 7FABH 3H9HB 2RBLA 4TOYH 4N8VB 1F90H 1KB5B 3QR1A 1EO8L 5DQJB 3VGHA 3WELA 1L7TL 2OSXA 2YGPA 5I9QB 4JMXA 3ETBF 2FBRA 1N5AA 3DWTA 4PM1A 3VXRA 4PJ7A 5B1CA 5E6ZA 3RDTA 2AJZB 4PRPA 4AC4A 2X6VA 1XBDA 3ETSA 2Q8AL 2DH3A 3IJSA 4ZUTB 3I6GB 2OI9C 1T5WB 4ZS6C 3SQOH 1RK1B 1SJHA 1OAUL 3QXDA 1CU4L 4GFTB 4M8UA 3QPKA 4N0FB 1FYTD 3WFBH 4JKKA 1EHAA 1A4KB 1CLYH 4TUOB 5HDWA 3FH8A 1A7PH 3QIBB 2ZXWB 3BKMH 1G9NC 4LL1A 2ROYA 4NERA 5FKPA 2DKMA 5DS1A 3QORB 4CU7A 4GI8A 1FNHA 5FHBH 4L8BA 3N50A 4UZUA 4NPKA 4DKAA 4R90H 4B97A 2FDBP 3VI3B 3MLRL 2ZUUA 1X5KA 2KL6A 2WZ6A 4S11A 3BW9A 3RPBA 3LKNA 3QH3A 2KDGA 3HC4L 1E4XL 3A21A 3EH3B 2ZYIA 1ZLSH 5BO1L 1UZ6E 4TSBL 4F2FA 1DLFL 4PH8A 4GUPA 4N5UA 2X2HA 4XI5C 2PCFA 1TO5A 3KBFA 4PLJC 3TA4D 5JW4N 2R15A 2IDUA 1HIMH 2NZIA 3P3SA 4OD1L 1IIIA 4OKVA 4K55A 4NPJA 3TH2T 3TBWB 4IJ3C 4MJHA 3KH3A 1INDL 2J5WA 4N20A 1U8QB 3IDJB 1UHVA 1GYAA 2FEEI 2F53D 1T3FA 3MR9A 3TPUB 4LBEB 2OBGA 4FFVD 3RUGB 4JR9H 3TWCH 4LLDB 2P5ED 2PKDA 5IJCC 3DRQA 5JW4M 1IFHL 3T3MF 5FK9A 1X5YA 3QPXH 2BS8A 1CF8L 2KI6A 1NGPH 4L1BA 3UPRA 4ZXBB 2LVEA 4GAGH 3EJJX 1OM3L 1A6WL 3IMUA 1AZUA 3L3HB 4HXBH 4N2MA 2CRZA 4UQ3A 4X7DC 4CVZA 4QRSA 1F6LL 2Q8BH 3ZQ9A 2R0WH 3QWOA 4QR7A 1HYSD 5EO1B 2BH0A 2VDRH 2GC7C 4M1GL 4H2CA 4LLVB 2VZOA 3GJEA 3DHJA 1FPTH 1JGUH 1ID2A 1MHCA 4P5TA 4ODHH 3B83A 3F7YA 4HQQL 5DRXB 2X89A 2IALB 3PJNA 1TNMA 4LOUD 4AM0B 3FBKA 5J11B 5CF3A 2G0LA 3K1DA 4A7VA 5D7HA 1PFCA 4MDRA 3AM8A 3RFZC 1JCKA 1S5HA 2FJHB 3OPZH 3U46B 2XTJB 4YPGB 1CYXA 1JGVH 2K1MA 3P3YA 3P77A 5E2VH 1XIWC 4Z7OF 4AEHH 1AQMA 4NUJB 4HWZB 5GGRB 1S9WB 4OZ4B 1PG7X 5DMIH 2M1KA 3OHXC 1UOLA 2P5WE 3JWOL 1HINL 1IKFL 1ONQB 4HG4J 3C60D 4WSJA 3ZL2A 4XMUA 4FMFA 2F53B 3D39E 4NYLA 4OH2A 2VISB 2DH2A 4IRJD 4A1RA 1NM9A 3F64A 1E3ZA 4YSCA 32C2A 4WFHD 2W8CA 4JKNA 3K4ZA 1FHNA 4J8RB 4UOZA 3UBXB 2HFEA 4K5LA 2P8LA 4Y2NA 4AJVA 4RNRA 2R29H 1LM8V 3D3VE 4IEFA 4F24A 1HN1A 4JRYB 4NNXB 4F2EA 2DQUH 3ZKQD 1FH2A 4ONFH 1LWJA 1RURL 4Y5YB 3VI4F 3ILQD 2XN2A 4YFEA 1UTDA 3SOBL 4B95C 3JSSA 1PY4A 4LEOB 2DTMH 1THAA 4HKJB 1Z9SA 3WV0A 4NKOB 1R3JA 1E42A 3F01A 4XO5A 4N9OB 4RAVA 3RBGA 3H0TB 1FQ9C 1BBJB 3LH2H 4KNUA 2GI7A 2HUHA 5DZNA 5CJXC 2XRAH 4QTIH 1KCRH 1M1SA 2ZONA 1XMWA 1OCZB 2YGVA 2CIKB 3MXVH 4LPWA 4RGNE 4JFQA 4K73A 1NCDL 4MCMA 3BCFA 4AWJC 5JHBA 2BHZA 4LQFL 3GNMH 3H7BB 2FJUB 4P2QA 2GKIA 1DVFB 3I84A 3V55A 1AR1B 1R34A 3QJRB 1A6PA 5J7CC 4G8FA 1JFHA 3MRCB 3MBXL 1CDCA 4QOKD 1I8MB 4IBQA 3MV7D 5IB1A 1OHQA 2BVQA 4YXKL 2GVYA 2NY0C 2AI0L 4JE4B 1D9KD 3I3DA 2X4NB 4HKZA 1SEQL 4OVVA 3LB6D 3DPBA 4IRJB 3IXAA 2QFPA 3I3BA 1A9VA 4QHKJ 5E1AA 4B96A 3QXAA 3WJMB 3Q6GH 4OLYH 1RJLB 4C4KT 4R8WL 1C8PA 4YHMH 3DMMD 4H0HB 3CHOA 1JF6A 3V4VL 3V0EA 4O02L 1TFPA 2EH7L 1P9MA 1QKZL 1QQDB 4NQVB 3AB0B 3TYGL 2VERA 3VFOA 4C59B 4XMPH 1S7QB 1QR4A 1FLRL 2BP3A 1LP9B 1KGYE 2G3MA 1J0JA 2AAVA 5HYQB 4JO3H 5L0QC 3BGAA 3CZUB 5F7LB 1NAMH 1H15B 4LMQI 3UX9B 3FOLA 3VFUA 2A9NL 4EIUA 1DQMH 3SKNB 3POHA 2Z64C 1E43A 5F1OB 1TIUA 1EHNA 4FE9A 1KB9J 5GIRB 2MSPA 5CLZA 2QHLA 3ARQA 4KJWD 1I7UA 3CD4A 3TOPA 6FABH 2WTOA 2IAMD 1HH6A 2AITA 2WBWB 4N90E 3SQRA 1SXZA 5F7DB 3SJVE 1MPAL 3FULA 2ICEC 4MJ5A 3D87B 1JNLH 4H8VA 4RGNC 1CXKA 1Y18B 1HHIA 2J6WA 4QWWC 3FO2A 1FIGH 2ED9A 3FRUB 4QOKB 1Z5HA 2YPLE 1OW0A 4JFED 4HETA 3S6CA 4CAGA 4OFQA 3S3BB 2J3SA 4PN6A 1UEYA 3W11C 2B4CH 4A2GA 5IB3A 3NZ8B 2V37A 2WYHA 1TUPA 2PCPB 2J88L 4PJHB 2WAHA 4DTGH 2L7QA 5JORB 2MCPH 3ASNB 1EHLL 3NIFF 2A6DA 4BZ2A 1GCFA 2JFCA 3K6FA 2Z7WA 2DQHL 4KFMA 4U6YA 3ATAA 5HJGA 2QELA 3BH8A 4MZIA 4YHKL 3HZ3A 2GT9A 4FERA 2R59A 1KZYA 2OXGB 5C0AE 3MRNB 3WHXB 5CILL 1CFNB 3RX9A 5KBMA 1XMEB 3SB3A 1IGML 3X1EA 5B7MA 7PCYA 1KMGA 2GBVA 2VR4A 4IBTA 4LSUL 3LS4L 4J2QA 5EU3A 5GZOD 4F37F 3GUTB 2IAMB 1ZSDA 5EZLB 1NEZG 5E9DB 3PXHA 4XOEA 4BQCA 5A6MA 1XH3B 4MMXB 1MNUH 3D0AA 2ATKB 5EU6B 4F9LA 2NPLX 3FPYA 3VWJA 3P2BA 4TPRL 5TE4H 2JCCB 4JFEB 4PLKD 5B7FA 5HPOA 3QXVA 3BAEH 4ZPTA 3BZEA 1T7YA 3FRPB 4J3UA 5T33L 5A2KH 2DQDL 1KY6A 3EYQD 4LBAA 2EDWA 4G5AA 4CW1A 5KVDL 1E6OH 1YDPB 3EO0A 3VFMB 2HTKD 3K4DA 2JJTA 1FNSH 4P23D 4QRRB 4EN3D 3L81A 2I27N 1DUZB 4HS3B 4FQHB 5DVPA 3APFA 5I15H 3IVKA 3MJGX 4L4VE 5LNGA 4GKNA 3BUYA 4GKSB 4IIQC 3W82A 2X4OA 4IRSB 1XZWA 1H0DA 1ZDSA 1KNOB 2E46A 2OYMA 4WY7H 4NOFA 2ZXEB 4M5YH 5I74B 3VRJB 2FWOB 2Z35B 3W81A 3O2VH 1VKXA 1N3NA 3P02A 1MWAB 5DJAB 1JG9A 3FO9B 5E6IB 2UY6A 2H1PH 5HYSB 1FN4B 2BRRH 3HLKA 1ILSA 4MJ4A 4KU1A 4XVSL 5AZEL 1L9MA 4BKLB 3N1PC 1G7IA 5C86A 1J86A 3IGUA 3D3VD 4PJIE 3FCTB 1HQRB 4PJFB 4TNGA 2B39A 5JXEA 4NT6A 2XQ0A 1NA8A 4PJ5E 2H26A 3KDMA 2DN7A 4A04A 1LO0L 3D2UD 4APXB 3ML9A 4HMDA 4FF9A 4UTAL 1DN0B 3PGCB 4U0RC 4Z7AA 1PAZA 3EOTL 5JPNA 3QEQA 4E9VA 3QIUC 2F5AH 4U1NB 1LE5A 2ZUWA 2BW5A 2GJ6D 5D9SA 5AAMA 4EN3B 4KMTL 1BWWA 5GJTH 2DQGL 3L3GB 3MA9L 1IGTB 4FOMA 4OZGB 3ZT5A 2FLMA 4FXKC 4ELDA 4W9HC 2HPOA 5DJCB 3V7AG 1CGYA 3KBEA 4YBQD 1SY6H 2ZP9A 3HNVH 3FONB 4L37A 4OFVA 5AW9B 1WGOA 3F05A 1MCHA 1JHLH 1KGIA 1NIFA 4BA8A 3K46A 1CICC 5AL0A 1SXNA 1PY0A 2AEPL 1FZOA 4NN5B 4HZLA 5F7EH 3U25A 5EF2A 4R0LA 5D2LE 1KG0B 3OXRA 3IJ7A 1H8NA 4Y89A 4HX1A 4U49A 5T5FH 1SYSA 1TMCB 1MEXL 3TO2B 1YYML 1RV6X 2VMDA 2K3HA 1E9PB 3LNEA 2DM2A 4LAQH 4R5VA 1DE4A 5LGKA 4M43H 1JZ3A 1YEEL 3WO4B 2R8SL 2E6QA 5EZPA 1WO2A 4X80H 3UBFA 2CJTA 1SBSL 2WZAA 1X7TA 1Q9KA 4M5ZH 2R0KH 5L2KB 4XOCA 4RAHA 3IFOB 5JUEL 5F1IA 3VXSA 2ITDB 4LHJB 3SKJH 5G4OA 5F7YC 2CUMA 3CVHA 3K80A 2DM3A 1VENA 2I69A 1HHGB 5JNYB 1M1XB 2KT6A 3PJSA 4P46B 2FHCA 1M6OA 4N2IA 4WAFA 2GJ6B 4N90D 5IB2A 1ET7A 4AITA 2QR0A 5FW8A 1AD9A 4NQSA 3SJVD 5CD3A 2XWJB 1E4HA 4JQIA 1HXYA 4L3EA 3UL4A 1LE9B 2KH2B 5KS9A 1H6EA 2QDWA 2WIIA 3AT9A 3P4LA 5I1GL 4X9GA 2OR9L 1A6ZA 3O3UN 3VXMA 3IT8D 2YPLD 4GRMA 4GPVA 4ZOEA 2LTQC 5B22A 2OL3H 1QFWI 2CDEA 3BUQA 5F7UA 3VI3F 5EEUA 4QHLB 2I7OA 1C16B 2EXSA 3OX8B 1B0RB 1BWMA 3VXPB 3OR7B 5DS8B 3OKYA 1NEZA 2BP8B 2WAQA 4YHZL 1Q0YH 4TQHA 3SDAC 1MQKL 3D18A 1Y6NR 3MCKA 1YEJL 2O1AA 1BIHA 2OJEB 5FYLL 4MNGA 5I28A 1V3LA 4P2AA 1A14H 4XHQA 2X6MA 5FXCH 3QIWD 5E8OB 2NNXA 3TA3D 1PKQE 3VMNA 4AMXA 3IETA 1AIZA 3LRSB 2YXVA 3RI5F 1E67A 5E6RB 5C0AD 1IC1A 1UD5A 3B37A 4U1LA 1WEJL 4AYGA 1B0GA 3FTGA 2BERA 4TF4A 3RUGF 4HS8H 4U05A 3WFCL 4BZ1L 4HUVB 1QBML 3DURB 5E2TL 3PGDB 2QSQA 4K5OA 4H8PA 1R3HA 4BEIA 2V2TB 2J1ZA 3ESPA 4G1EA 4WLCA 5GISL 5IQNA 3OKNA 5DJ8B 2EC9T 4N5ED 2E47A 5ICYB 3QCVH 4RGOH 4QGTA 3QZWG 1KLUA 4Z7WE 2XQYA 3QUMA 4LP5A 3ZTNL 4KO9A 1KCVH 4WI7A 1XF5A 2DIEA 3PP3H 2VYRE 5HHMB 2ZWKA 2OM5A 4H0LC 2X7LA 4XVUC 2R0LH 5E00B 1ZV2A 2HLFC 1OCWL 2G9HA 5HHXH 5K9OB 1FLTX 3EJZC 5A16B 2QKIB 1NGQL 3CBRA 4FNTA 2DEXX 4CILA 1IL1A 1WHPA 4J4PC 5DZOA 1LMKA 1IO4C 3QIWB 1EA9C 4Y1AE 3BH9B 3TA3B 1MH5A 1JPFB 4L4VD 5ILTH 3FYEB 4N0UA 5FM4A 1F4WH 3ARFA 1QVOB 5DK3A 4AV5A 4PRAA 2YQ2A 3AWGA 5BRZE 2KLTA 1UKSA 3OKEA 1A7NL 2FEEL 1ASQA 2GB2A 3NCYS 3ME0A 4FP8H 2PYFA 5DJXA 4EI6A 1CWVA 1NFDE 4YGAB 4F15C 5I1JL 4NQUA 3WN5B 1JPTL 2ZJSH 5F2FA 2Z92B 1IUZA 3TVMC 1EJ6A 4NQCA 5K33A 1Y1UA 4F58L 1FZJB 3DX0A 1JHTB 2DBJA 1WBYA 4MNQA 5IY5B 5LGJA 2QVTA 2WBXA 2XG5B 3FBQA 3U6RB 4YBLC 4PJ5D 2XPGB 2ZCHH 5F1NB 4CL7A 3B1TA 3WOVA 3CFJB 4ELMA 2AKRB 4IK6A 4N8UA 3L3JA 1Q94B 1OTTC 5G4NA 1KCLA 3E9UA 3OKMB 3ML8A 3HMXL 2NW2A 3ARZA 4KPHL 5KYXB 5TH2A 2Y72A 5D1ZC 2YAFA 3JUYA 1QPPA 3CZFA 2K0RA 3L9EA 1E9OB 2DMHA 4K15A 4DK6A 2W0FA 4W9ZA 4FLSA 2M83A 4KO7A 3VXRE 4PJ7E 4AK1A 4B7LA 5JHLA 4PRPE 2OZ4L 3EYOB 2DD8H 1RMFH 2P24B 4KTEH 4WHYH 5BRPA 3MO1A 4L3FA 1N8OE 4OUUB 1IT9L 1DEEA 4YE4L 3NFPA 2CNYA 5IHUL 2I32A 1DBAL 1FZKA 4GQ9L 4MMYA 4RIRA 4WK4B 3V9EA 4P3CL 4M7JL 4FABH 3EYFA 1GJUA 3BSZA 4ODBD 1IQDA 5DT1L 2N1KA 5DRNB 1TFHA 1TLMA 25C8H 2NT0A 3ULVL 2WBJC 1U8HB 4Q4IA 4JPWL 5EOCH 2QMJA 3ROOA 1NMAH 2GTQA 1ZGLM 4MXQC 4XMKH 3HZMB 3C5JA 3UGUA 3T04D 1MNNA 2EADA 1LP9F 1F8TH 1U8IA 5DC4B 2JJSC 3WS6A 1A7OH 3GMQA 4O51B 4X6DA 4Y0GA 3QEHB 2J25A 3EGSA 4MCYA 5IR1A 2J5LB 1RY7B 5KW9L 1E4JA 1RIUH 1YECL 3FT2B 2B9AA 3WIFA 3ZZ1A 1SDDA 1HCVA 3BI9X 1NDGB 2E0PA 4KXBA 3ABLB 3Q1SH 1G7MA 3PHSA 4Y5VB 1ND0B 5EOQL 3W9DA 4AI7A 5BPPA 1UOKA 1G7QB 5E1GA 3R4RA 4NP9A 1JK8B 3I85A 2PW2A 4M93B 1A9EA 1T1ZB 4IOSD 3UTTA 4H8UA 1UT2A 2ZWYA 5T1MA 3ZDYB 1G7JA 3HB3C 4AGPA 4H44C 2EC8A 2WBKA 2J1XA 3L54A 3C9NA 3GSOB 4G7VH 4HEPG 1P5UB 1RZFH 4JFDB 4OM0H 5KSVA 3BHBB 3N6YA 1AHWA 4QCIA 5H4YA 1TTAA 3QUXA 1E9QA 3AY4C 3QJHA 4ZMZA 3GSXB 5I73B 4KH9A 3RDTC 1BQRA 4PJHF 4GSUA 3FO1B 5BCAA 3DX6B 4AQAA 3ZHFA 2OTPA 1B6DA 3ZRFC 1OL0A 2FK9A 1T0MB 5K9QG 3HG1D 5CN2A 3HKZA 3OB0H 3N55A 3HS9A 2X4QB 1X5LA 4U1MB 4ZUUA 2CK0L 4W81A 4D94A 3FTUA 3WTXA 3BWUC 1D6EB 3QZWA 4GG8A 5CINL 3TT1H 4NQXA 2CKBL 3CDZB 1TJGL 4QYAA 2IFGA 1DO6A 1DJIA 1QTPA 2BSBA 3KL0A 3LKQB 2Y36H 5GS0L 2ZPKH 1AOHA 3S36H 1TVHB 1HL5A 2CQVA 2YN3A 2MMXA 2SEBA 2FJGB 4WU7B 3L3OA 5B4MD 2N0MA 5F9JB 3L6FB 1X4ZA 3O4LB 1HNGA 4LNRB 2ZE0A 2XA8L 4QJ4B 4P04A 2VN5A 1JF1B 4F2MB 4DFIA 1G7LA 4FZEH 3V6BR 4RFOL 3DJRA 3LN4A 1HSAB 2QVKA 4OGAC 3HRZA 4FNLH 4Y1SA 2AJXL 3Q8CA 2NLJA 4FRWA 3UZVB 4PI0A 4TMPA 4XC1H 3T2OA 3EDFA 1WBXA 2GAZA 2WQRA 3RWHB 2Y23A 3RYMA 1MJJA 1TU2A 1DP0A 2YD6A 4HS6A 4Y2OB 1A66A 4X8JB 3WNLA 2UYLB 4P4RB 1XV8A 3HG1B 4ZTOL 2WVSA 3SDDA 1E90A 1T1YB 3P11H 5E56A 3VG9C 3QQDA 2KZWA 3EYSL 3VFWB 2AJVL 2QSVA 3WJJC 1HHJB 3IFPA 1AO7D 2VT0A 4QRUA 3MV01 5KSUA 4B3VA 4BK4A 4Q56A 1DBKL 1F41A 1MHHA 1RH8A 4X4MA 3PHQB 3OR6B 4YO0B 1VESA 1RZKL 3ULUL 1N7ML 1TYEB 5DWUL 3KNBB 4JRFA 5T1KA 5BRZD 2B59B 4ETYA 3PS6A 1KULA 1P4LB 4P5TC 2R1XA 2X4SB 1NCTA 4P2QE 5DJ6B 1URZA 3VRIB 1AJ7H 2F9BT 4GAFB 4AL8C 5I6XC 4LSQL 3SSGA 2F61A 3ARED 2I9LB 3WTWA 1GC1L 1WZKA 4G7YL 3FMGH 2GSGA 4GRLA 4RMTA 5JW4R 4UQ2B 4PJFF 1WWCA 1PYWA 1YSOA 3QQ4A 3Q5YA 2LABA 1WRFA 1TTBA 1A2YA 3BVWA 3N9GL 3WFDL 5LQBL 4PWFA 4UINH 4CC0A 3GMMA 2D4FA 3VRLF 4UB0L 5IEKA 2GK2A 1DN2A 5KBPA 1DQVA 4EDWH 2WVVA 4AIOA 2FJFB 4LGRB 4XVJH 3IJHA 5E7FA 5H8DA 5KZCD 3KG5A 4OZGF 3WKPA 2J8OA 4ZJ9A 1HT6A 3GXFA 3H3PL 4QKXB 1BF5A 2QADC 3TFKC 3WMQA 2VW4A 1B2WL 5A3IC 4Y2DD 3U0PA 2COVD 1AO7B 2XG4A 3ETTA 5IQ9B 4TL5A 5GZNC 4JPVL 1NPJA 3FB6A 5JW3L 4WKZB 3VXRD 2BS9A 2IMMA 4JN2A 4BV1A 4E68A 3D85A 3HHRB 2F2HA 3VXTA 2IV9A 4I4WB 5M7QA 3RAJH 2NY7L 1NGXA 1F0LA 2XU9A 8FABA 5T1DL 4AT6A 2FRGP 1D5ZB 2X2YA 4JFOB 5HJ3B 4AIEA 5I71B 1DVSA 4ZYKB 1HJBC 4J3OD 4FQLH 5FWQA 3HHSA 3AREB 5DU7A 1I9JH 2WTRB 1PKOA 1IC4H 3I6KB 2NXYB 4OF6A 3VB9A 3PF2A 4ZMNA 1CE1H 3NCBB 1I1FA 1GMEA 3VFTB 3A4EA 4UI2A 3QDGB 4OAWB 1QO3A 1BFVL 4JO2H 2PCXA 1ZLVK 2NMSA 1BM3H 1H9DA 2JIXA 4TQEH 2EIZB 1BVKB 3W39A 1YN6B 2KLSA 5LG1A 3RZCC 1K5NB 4LVHC 4M6NH 4H8WC 5D1QA 1F6FB 2JWYA 4N1CA 3LZNA 4HF5H 4FG4A 4PS7A 1SLUA 2GIXA 1WE5A 3IJYB 3CSFA 3MNWA 1CE6A 4Y2DB 1MVUA 4JDVB 1P9MC 2PYEB 2B16A 4JBSA 3CSYB 4P9HC 5L4JA 1T7VA 1WZ1L 4G8EB 4PB9H 3V4VA 4DAGL 4O02A 1MCCA 4KHTL 4JLRB 2IDQA 2I9TA 4PS3A 4R7XA 4AZ8A 4JZJA 2ZOUA 5HD8D 3ALWA 1WA0X 3NBNA 5DRZA 1OTUD 2OJZH 1NOLA 4HBQA 5K59E 3IPEA 2JKWA 2FL5A 4AYSA 1F1DA 3ECBB 4X98A 3RIFF 5GGVY 3SDCD 3QNZA 3VXQB 1MVYA 2NY3D 3IKCB 4WHTB 5KYUB 2CH8A 5E7BA 5KVGH 4OCRL 1MFEL 1YQVL 3BQUA 1BVLB 5F9OH 2FT7A 4OQTH 1OW0C 5INCA 3CSPA 1A3ZA 2XZAH 1XF4B 4PEEA 3LEXB 3S3CB 1N26A 2X89D 3CUPA 2H45A 3QZBA 2IVFC 3KM1A 4LLWA 4HGWA 4XP5H 4NSKA 4CADB 4OLVH 4U3HA 2BFVH 3SKMA 3HUJA 1MAJA 1RJYA 3L48A 3GJFH 2LU4A 2YBRA 4K8RD 5L2JA 3SCMB 1W8OA 2MQ3A 2NDFA 1E6JL 3QWNA 3TCLB 1N2RA 2CMRH 2Z1KA 5FCSH 3V4UH 3V0WH 4YDZA 4X6BA 3MVSA 4QO1A 4PJGB 1HDMB 4K4KA 4RMBA 5T3XE 4IQHA 5E6SB 2ETWA 4L8CB 3TIDB 2E27L 4RX4A 1PNDA 3BP5B 3L5WB 4Q0XL 4CVUA 3S8FB 4P49A 4DUXA 5IMKA 2MQ0A 1WVZA 1JD7A 2AXGB 2ODHA 1S9VB 3OJDB 1QFWL 2X3CA 2HP4A 1NGZA 5HHOB 3Q13A 4JY4A 1LO2H 3X1GA 3B9KA 3MAWA 2VSMB 5AG9A 1CFBA 4XX5A 3SDCB 2APBA 2DKSA 3A4DA 5IMLB 2ICWB 2W81C 2W5PA 3NQKA 3MJ8B 5D72L 1KEML 2DQEH 2ZUQC 3HE7B 3VWJC 1G1KA 1M7UA 4JM2C 5KAQG 2RACA 1QZNA 4OIAA 3TZVB 3CLEH 4XNQA 3BUPA 3U7WL 1ZIBA 4EOWH 4NFCA 2CO1A 4HPYL 5I16B 4PY8J 4AJYV 2VXQH 2VL4A 4HK0B 1IE5A 2RB8A 3T6ZA 2PTTB 4HLZH 3ARDA 3LXBA 4FCAA 4P2QD 1FGNH 3HS0B 2FSEB 1L7IH 4FN0A 2BY1A 3NJXA 4NEHB 2I85A 2V9RA 1TVDA 2ZKMX 4KI5E 3SO5A 2SODB 4J3TA 2JK5B 1XCWA 3TBCA 4OTXH 1DO5A 2Y7QB 5EZIL 5I8KL 2JELL 3LV3B 1EZSA 3DV6B 1R24A 1WISA 1DVUA 3MRPA 5LXGL 5F70A 4JN1L 4XBMA 3GC3A 3NCYP 4CA4A 4JL2A 4OLZH 4KKPA 3FQ1A 1MHPH 3LQZB 1T1WA 3KYMB 4TTDC 1FZMB 2BX5A 1OY3B 2XWTA 5EZJB 2XXFA 2A9AA 4RWHA 4OCWL 4XNZC 3BDYH 7TAAA 3VXSE 5I1IH 3TH4T 5JXEC 3S96A 3VGAC 4LSRH 3LPPA 3MRRA 3P4OB 2GYSA 1U93B 3VXNA 4G1MA 5HHNB 1I3RB 1II4E 3G5WA 3TU6A 4FQIH 4LCCC 3PV6A 1FV1A 3RJOA 3K6OA 3JTTB 3ROLB 1UD8A 1BEXA 2H9GB 4L3EE 1WZMA 5KS9E 1TXKA 4UTAA 5EC1A 5AAMC 4LHQB 4PJ8A 5IG7B 2DDQH 4PSRA 3VXME 1Z1WA 1KBGH 3BPNB 1SXSA 3GHEL 3QWRA 3NPSB 3MXWL 2CXKA 2YAQA 3X1FA 3ZK0A 2MHAB 2J8HA 2RQEA 4KI5C 3VD7A 1HQ4B 3U7AA 3X1BA 4FLQA 3FT3B 5ID1A 3OKDA 4G8GB 3MSPA 4GO9A 5HTSA 4ERSH 3MBWA 3DSNA 5J57B 4MNGE 2GCYA 2H6UA 3ETBJ 5CP3H 2O6DA 3CN2A 2MNWA 5E4EC 3ZTJH 4XCCL 3ZDYF 1HXMA 3ISYA 1IX2A 5CIPA 3VMOA 1F58H 4Z7QB 4NRXA 3O9WC 5ESAA 5BZXA 2A73A 1CFTA 2OMTB 1WBZB 2DOCA 3OMIB 4Y19A 2DEWX 3V79C 4LFHG 5BOPA 2XFXA 4ZMAT 1AFVL 1HX0A 4YHOH 4TLKA 4XODA 1OARH 3IRZA 1KACB 2NY5H 2WOYA 2C9AA 3MFFB 3NH7H 4PWIA 3WUWA 3LZOA 3E8UL 3LQMA 3CN4A 1JXJA 4FQJH 4NZUL 5C0IB 1NAKL 3ZIMA 4AKPA 2QQNL 1N19A 4HXAL 4XMWA 5G4MA 1ED3A 5FKAB 1CLOH 2A1WL 5IFAH 4WDIB 2N7SA 2Z31D 5DJDB 4X5WB 4P2OD 3CFEA 1T66D 4M7ZC 4IBUA 3GHBL 1XXFC 3SBQA 4LHUB 3T2NH 3MRFA 1BGXL 1IAIL 2KDYA 3SDYH 3KPOA 2YXMA 2QBWA 1CFVL 5I2IA 4HAGA 5IVNA 3KJ6L 5FYJL 5ERWA 2R27A 3GYRA 4FJYA 4X4ZA 5FUCE 4BE5A 7FABL 1S9KC 3VXUA 3MLWH 1J87A 2EO9A 3SEPA 4F8NA 3L95A 4N0UE 2VLKD 3WDHA 3B6SB 4XPFH 5T3XD 3L17A 1M7DB 2KBGA 3S5LG 1FL5A 4G9FD 4O2EB 2PCYA 4UQBA 3EOYG 4X4YB 4YUEH 3MACH 2DBLH 1KXVC 4O4YH 3D51A 5D7IA 4NKMB 4J3WA 3X3GH 3LPWA 3WEXB 3PY9A 4ABWA 1DQLH 2NYYC 3B7TA 3WFBL 4NQCE 3V4PL 1CLYL 3V7AE 5IWLC 3ARSA 2CLZA 2WIMA 4MNQE 4U1HA 4BZ1A 3TO4B 4HALA 2GJJA 3UJTH 1EPFA 3O11A 4ELME 1DVTA 2V3EA 4ZUWA 1KCUH 3RWEB 1OOAA 5CBAB 2Z31B 4FTVA 1ZHBB 4GG6B 4P2OB 2R1YB 1VCAA 3DUUA 3FUIA 4M7KH 2Y07H 3QI9B 3WS3A 4KZDL 1MREL 1O6SA 3B8SA 2VH5H 2P26A 3GMOB 2FB4L 5HGBB 1YJDH 2VERN 4HSCX 4IMKC 1P69B 1F3DH 3JWNE 3S5ZA 3STLA 4ZNCD 2GPZA 1JPSL 1CGSH 5J5EA 1OSZB 1USZA 4W9DC 1QTSA 4XMLH 2VLKB 1TJMA 1HHHB 2WQWA 3GUFA 2BPBA 2PO6D 4UU9B 3W2DH 4Z7WF 1FUNA 1UENA 2WYTA 4G9FB 4D8PA 3BVNB 3LRGA 3IDUA 3E1F1 4FQ1H 4HU2A 4LKXA 3ARFC 3ISWA 4IRZL 3UEZA 5KG9A 2CR0A 4LLMB 4Y4HA 2YGNA 4NS0A 4F5CA 1YCSA 4XCFH 1DQTA 4PJEB 1CI3M 1GGUA 2H6PA 2YA0A 2YARA 2G60H 4KUCF 4WWPA 1RUMH 4Z95H 2IBZY 1Z7JA 3KWVA 1IVTA 3FCSB 4NO2A 4U1GC 1M05A 1X9QA 3RDJA 3A6CH 4YEEA 4DESA 5AW1B 1ACYL 4X6DE 2Q8BL 3L08A 4F33A 4GQZA 4D0BB 2P1YA 3VXSD 1UD3A 2BNUB 2AJSL 3D4GA 4MDJA 3GM8A 3Q3GA 5EO0A 4N2DA 4ORGB 4Z0XA 1J1XH 5BV7L 5IHZA 1SVBA 3K6DA 4ABQA 4NUQA 5EPMA 1IEBB 4EZLA 4DETA 5I30L 1LO3H 4FLOA 2HZHA 4PRDA 4HIPA 2IXQA 1MXGA 3JV4A 4Q9BA 5FA3A 2PUQT 3UTTE 5AVXB 2YBGA 1NFDF 3PWJA 3RGVC 4L3ED 1XR9A 5EN3A 2GITB 3OPZL 1Z3GL 3KXFD 5D70H 5D7LA 3HMXA 2F7PA 4LXFA 3DX7B 3KPPA 4AEHL 4AIZA 4B9GA 2PO6B 1XR8B 4QRTB 5DMIL 4XBGB 5JR1H 4NO0B 1TETH 2CR6A 4U4IA 4XMTA 2HT2C 1NMCB 2F8IA 3DHPA 3AADB 5CSZB 1OGPA 1X4XA 5HYJA 3OGCB 1D7DA 1IEAA 5GSVA 2ZXQA 2OZ4A 3ZQWA 2CRIA 3FU5A 5A6LA 1FFTB 3VXOA 3DYMA 5FGBA 5GS1A 1DANT 3ARUA 1KJVB 2VSCA 4HIJA 2PR4H 3BP4A 4OU3A 4B7IA 4A66A 4LLUB 1A21A 3OWRA 4PJDA 4UT6H 2X1WL 4EDXB 5C0CD 3TCXA 4XB8A 2RFXB 3WS6C 2AZUA 2J1KA 1AQ8A 5DD0L 2QSCL 5CJOH 1AKJA 1ASOA 3KYKL 8PAZA 2Q7YB 5HGHB 3MRKA 4LCYA 1NUNB 5HGGS 2DKUA 2LAAA 4HLJA 4KRNA 4WNQA 3Q8FA 2FHBA 3Q6FA 4PGDB 1GPOH 5IOKA 4J3OF 4HWBH 5ADPL 1DJZA 1WDAA 5FF6A 1S7WA 2ZOLA 2V2XA 4ZK8A 3GNML 2FQGA 3KXFB 3MREA 5JYLA 3PIQA 3AUWB 4KKLD 3F3HA 3MLUH 3MA7B 4TUKL 4D7BA 3TJEH 4L0YA 4NN7C 2E59A 3GKWH 4V1DD 3S5LA 1R47A 3FFDA 3MCG1 4PW9A 2X3BA 3ZBMA 3GMRB 4AYDC 2CIIB 4GS7C 2BY0A 1MRFH 4YAQA 1AHWC 3QAQA 5GGUB 3AQZA 3G5VA 4PWHA 1CB4A 3SKUD 4WV1B 2L7UA 2VXVH 3X13A 2F54D 4OLYL 2NZ9C 3QDMB 1BVOA 5IOPA 4GEIA 3MLVH 3QUZA 1PLBA 3EOAB 5HGDA 3SYPA 1WFOA 3SE4A 3QRGH 4GRWB 4ZX6A 5BVPL 1CURA 4CNIB 4KO6A 5JDJA 4XMPL 4PJGF 3LHAA 5ESQA 2W88A 4X4ME 5C0CB 5JXAH 4ZS7H 1N12A 1N5YL 3T1FB 1FFOB 4D0DB 4X8GA 4R2GB 3AS0A 4AQEA 4Y4KA 3OF6A 6FABL 2CKBA 1YEDB 1IBGH 4RDQF 2QDVA 3PWUB 1NCCH 3F58H 3CTTA 5DJ0B 3WFZA 1BQLL 1MAML 3MLZH 4XB3A 1J9SA 1A22B 3R06A 4NQCD 1OZTG 3EYVB 3GZQA 1DVYA 1HEZB 3OQ3B 3AT0A 1Z0NA 2ARJB 1FIGL 4MNQD 3HR6A 1MY5A 3DGGA 1Z6JT 1OSPH 2MQCA 2VDPB 5IJDC 4H1LH 4V1DB 4IIZA 3P4NA 1RUKL 1B4JL 1MCEA 1TZHA 2Q3AA 1HOEA 3QWQB 5FO9B 3GXMA 1QW9A 3EJQA 4CMMA 1BFOB 2W92A 4XPBL 3G6AA 2F54B 2HT3C 3RJDA 2WXNA 2ZKWA 3BESR 5D4QA 3MRDB 5KJ7E 1M71A 1VFAA 3MGTB 1VACB 5CUSL 4ACPA 1WWWX 2B9BA 2QPFA 3B2UD 3H4FA 3L3KB 4Z7UA 5EUOA 3ZN6A 1RPKA 2V5RA 2CLVB 4RZCB 4DK3A 1WTLA 4LL4A 1V3JA 3J2PA 2VQ1B 1S46A 2NDGA 4XWOD 5AZ2H 4GMTH 2VLME 4DN4H 1TR7A 1R17A 1X7SA 1YEIH 1KDIA 5HVHB 1R5VA 1YC8A 3P9MA 4DO6A 1U9KA 3HAEB 1KBVA 4FQCL 2GTWB 4N4YB 5KANI 3T3PB 3KLHC 1PMYA 2XBZA 1OP3H 4WEBL 5DJZA 4DP4X 1I7RA 1E65A 4DNLA 2QPEB 3HE6A 4ENEC 4I1RA 1ZVSB 1OCOB 3MYJA 3WENA 4GRLC 1IGJA 3D0LA 4XPAH 3CHQA 3BAEL 5ETUB 3FCGA 1MCLA 3CQFA 3NCMA 1ITBB 4EI5B 3KMDA 2YMOA 4Z0BH 4YLBA 4JNXA 3KLKA 1LNUB 3M17B 3TEXA 4B5ZA 2E8YA 4QXUH 3IXTB 4YZWA 3SE8L 5D1QE 1ZSHA 1UGKA 3FT0A 2GJPA 4HP5A 3WKQA 2ALAA 2B3IA 1EEQA 3JWOC 5C0RL 1USQA 3PDGA 3VDBA 1OAZH 1FDLL 2RD0A 1XGRA 4GP8B 4J5VA 2JLPA 1X9LA 4ES8A 4PTUA 3IFLH 2VQTA 1XCQB 5MERB 5I15L 5EN2A 2EYTB 1BOGA 4YQXL 3ZE0E 1GAFH 1JDDA 3RKPA 1C08A 1VGKA 4E41A 1URIA 1I8KA 1H3WM 3QUXD 4LKCB 4U6VH 4BUQA 2KQNA 2MCMA 4LLYB 3QDJA 4BKSC 4HIIA 3LZQA 5F1KC 5FYJU 2OI9B 1FO0B 4OV6F 3RTQD 1XF3A 3RGHA 2WLNA 4OGXH 3VYNA 4RQQA 1OF2B 3MRMB 3O8XA 2BRRL 4NM4L 3FF8A 1RP9A 3G5YA 2VNCA 2HJFA 1I8LA 4N2AA 1FG2B 4WNSA 4Z7QF 1J1PH 4L1LA 2R2HA 4FFWC 4OLUL 3VFGH 1COBA 1UURA 2AGJL 4GLRH 5FO7B 5IESL 4ZX5A 1KIQB 1E50A 2ZP8A 5DEFB 2DQCH 4K8RH 4DOHB 3J8F7 3HUJE 4NBXB 2J1YA 4MA1C 1SYVA 1CVRA 2F5AL 4LP4A 1TVBB 4ZI8A 4DGUA 1B0IA 4KXAA 1RIVL 2WINA 5AVZB 1ZPLA 2XX0A 2Y69B 1OAQL 3R4DA 1FL6A 1XD1A 5D1QC 1DDHB 2WHVA 4IJ3B 3PHOA 3PLYA 4KJQC 2VDQH 2OMWB 1ZA3B 3I6LE 1VGEH 4M1CD 4Q9QL 3BGFC 2IBBA 5ESVB 4NZFA 4CBZA 5CR1A 4MS8D 3AMKA 2ALWA 4IMLA 5F3HA 2NY1D 2DWTA 1JXFA 2VDOL 3RTQB 4JZJC 1TZGH 5MENA 4EUPB 3PL6A 4GY4A 4XHJD 3NGBC 2AK1H 5T5FL 4QXGH 3SDDD 2OK0H 3C5SB 1PX4A 1U8NA 1V10A 4MTMA 2A0LD 3WHE1 1O9WA 4MDIB 5FB8B 1HCZA 2EEAA 4C4KO 3WKMH 4EQ2A 1T7XA 4M5ZL 2R0KL 3BQUC 1D5IH 4LEEA 2HLAA 1KTLB 3QDHA 3O3DB 5T1KD 2K7QA 4FQXA 4KUZL 4F7EB 3EG9B 3I9IA 2UY7A 1BLIA 2VDLH 1KELH 1WPCA 2R7EA 2YFNA 4ZMTA 1H6UA 3HJEA 2XN1A 4IU3A 1WC7A 1T22A 3QJFA 2Q7AA 4LPXA 3GZKA 5KVDE 5IBUB 1FNAA 1AGDB 2E7BA 3NESA 1ACCA 3RG1C 1RKRA 2WNXA 1XIWB 1R5IB 3MJ7B 3L16A 4JFYB 3NN8B 3OHXB 4PJ9C 3SZ6A 4TUJA 3NDYE 5DRWB 1DQKA 5IIEB 5GGQL 2XC8A 5E8PA 2W95A 3D25B 4L8DA 4R7DA 1DFBH 4GG6F 1IV8A 4UYPA 2MPAH 2J57A 2OQJA 2GY5A 1VLXA 4YWGL 4WW2A 5GRJL 3LDBB 2IWEA 2IBGA 2ICCA 3B9KC 4DGYH 2BO0A 3QHFH 3FHAA 2XVLA 1Z32X 5E23A 1A14L 4YSUA 2BSEA 1EXUB 3C8KA 4N68A 4AW4A 3KYOA 4C56A 4JHZA 3EOBA 4BXVA 3D85D 4ZTPL 3KVDD 3VVWA 1I1AA 2VLMD 2DJ4A 2VIRB 4NKDB 3H1ZA 1G6RB 4HS8L 5TF0A 4NZDA 3HG4A 2O6PA 5LBSH 1GJWA 2ZNWA 2Y1AA 5FCUH 4PJEF 1E27B 3OAUL 1B88A 2IANA 1RLWA 3WE6A 3ARDC 3EGXB 4XCEA 2HJKA 2EDEA 1U8LB 4OZIA 1UC6A 4E9LA 4TNFA 4R83A 5DHMC 4M3HA 2F08A 2ZSVB 3EH2A 2NY0B 1T5KA 3GF8A 1IGYA 4CKVX 1X5HA 4BZ2H 2R0LL 3VJ6A 3WIAA 2EE9A 2IQAA 3GSQA 5HHXL 4A7GA 2R2EB 1OO2A 3DUSB 4IS6B 3OXSB 2IQ9H 3IE9A 1RZGB 1KB5L 2R2BA 5TDNB 3QCTH 1ZT1A 5JDSA 3NFSH 2LLGA 4WUKH 3HBPA 2XN9A 3CQQA 4UQAA 1QLFB 1BPLB 3NIGE 1G4RA 3W0WA 5KVEL 2YWZA 4PLOB 5L0QB 5I5MA 1U8PA 2VDNB 3UADA 5ILTL 2VRKA 4Y19E 2VLLB 4DKFH 1IAOB 2DWXA 1FAKT 4I9WE 5F8RC 4UILL 3BGMB 3ZSTA 5EOTA 2WN3A 2BZCA 2G3XA 4FHBD 4FP8L 1H3PH 4KTYA 4BFOA 6PCYA 1JF5A 2CDFB 4F7MA 5E1QA 4L2LA 1GKEA 1IEHA 3VSTA 1TZIA 4RGNB 5E8EB 5IV2B 1AAJA 4MAZA 3OAZK 5ENWB 4YZFE 2CLRB 3SPVA 1GCYA 4QIRA 3Q2VA 1A4BA 3OKKA 4M3KB 2FLRT 3DXAA 3HI5H 1N8ZB 4N2EA 4U1IA 2YPVL 3UTSA 4KK9C 3GSVA 2WKOF 2X6UA 4P57A 3D0VB 3IDGA 4JCMA 3EJTA 3DK0A 1MW1A 5GRZA 3ESNA 2E74C 4I18A 2E4TA 4CC4A 4YHIB 3T0BA 3VXUE 5T3XH 4PCKA 1TOXA 3WEBA 3LJ3A 3AVEA 3B9DA 5KYWA 3FAWA 3F7RA 1DBJL 4WRLA 5FYLE 1S8DB 2EC9U 2FR4B 2QV2A 1HKFA 1RMFL 1VF5C 1W0VA 2VXSL 4KTEL 4OT1L 1I1YA 3V0VB 3QYMA 1T4KB 1EH9A 5D7IE 5E5MA 4MD5A 5CCGE 3DHMA 3GB7A 5C0BA 4XBEL 4BSWB 3L4YA 25C8L 4PYGA 5IFHL 4ZMVA 2OCCB 1DYZA 3HHMA 1M9WA 2W9DL 2XKNA 1BZDA 4GRWF 1U21A 5IHWA 4OD3L 4XMKL 4ANUA 5DD5H 3R0NA 1SLVA 1F8TL 3PAZA 3K2KA 4UBDD 3VFRA 4Z77A 1A7OL 4FTVE 2KKQA 3DTXA 3KVQA 4YE0A 5JZ7C 1VZHA 2OTUA 4UM8A 4KX9A 2IADA 5B1KA 4TLUA 4I3GA 3RVXC 3O6ML 2VR7A 1BJ1J 3OAWA 5DS2A 3WEMA 3OJ2C 3L9YA 4F9PA 3JT2A 3K2MC 5CJ5A 1S7UB 2WWMC 4KKBC 3T0WA 3VFVB 4A7SA 1YY9C 1RZ8A 1MRCH 2X12A 4M4RB 2GABA 5HI5D 5F93C 2ZUYA 3NVQA 4U1SA 4QNPE 4IIQB 1TZAA 2CJUL 2ODIA 2V8MA 4G7VL 3K72A 1BAGA 4M48H 3CFDB 4OM0L 3ZMRA 2WUCH 5BO0D 4LCUB 2F74A 5L4MA 4F5CE 5C0EB 4L4JA 2EDKA 5FAAA 1L4IA 3EHBC 4IDJL 1EVUA 3TBBA 1AVAA 2HAZA 1IJNA 3I2CL 3HBZA 5IF0A 1XT5A 4QUOA 3ENEA 4KI1A 4X4XA 4HT1H 2YKKA 1C5DA 4PFEA 3I50H 1JI2A 2PTUA 1M7IA 4D9RE 4WWOA 2XJKA 5E0FA 1Z0MA 2V6HA 5C07B 1ZA6A 4MJIA 3TT1L 4MMZA 1YPZE 1LYQA 1SRDA 3CVHH 3AACA 1MRDH 1U91A 4I2XA 3BAJA 1LDSA 3V4PA 4XTRC 3CVIH 4U0RB 2GUOB 4WCYH 1A9BA 1N0LB 1RHHB 1QFUL 4JQIH 3QIUB 5ISZA 4JKPL 1CDIA 3QFDB 1A1OB 1Q1JH 2WLKA 3ASWA 1TKWA 5F0LB 2PTVA 3T3PF 3CU7A 2AQSA 2WPGA 1AXTH 5D7LE 4PJ8D 3DROA 4KDWA 2QT6A 4NNYA 3S2CA 1AMYA 3JV6B 2JLLA 2ZQKA 1QUNA 4S1QH 3MLPA 1E3XA 4APQD 5DMYA 3QWRD 3T0XA 2VABB 4IGBA 4WO0A 4GMSH 1J9QA 1CICB 5FIEA 1NBYA 2A4CA 2R9HC 5HYJE 1TTCA 2DEYX 4F7TA 1RVFL 1A1MA 2J71A 3ILEA 1JMXA 5CLTA 1EDYA 2YEZB 3QZPA 1EEYA 3P0VH 4GRWH 4RAUA 4Y4HC 1MFDH 2EKJA 2IC2A 5CGTA 4YHYC 3TT3H 1I53A 4IRZA 5CCKL 1JWSB 1QD0A 3KWWA 4GW4B 4PJDE 1A25A 2YLKA 3IMSA 3OPUA 4YLQT 3ULVE 4LCIL 5CS7A 4MX7A 5DK0B 2AERT 1MCKA 1CLVA 3RIAK 5AD0B 2BZ7A 5ALCH 2A9ML 3MODH 5H37G 3UAJC 1MWOA 5CHNB 4I9WD 1NC2B 2C34A 2CCWA 4H88L 4OM1H 2JXMA 3TASA 3N3EA 3HMWL 2X41A 2Y7SA 4HV8A 1OT1A 3QUMH 4JG5A 3TN0A 3RY6A 4R7LA 1G1OA 4I5BA 4KOBA 5BS0A 5DD1H 3WTTA 2PXYD 2V7NA 3UAAA 1QBLH 1RUAH 4AENB 2X42A 3DETC 4APQB 5IHLB 3VH8G 3O6FA 3D69A 4AGLA 3NEXA 5J9PB 1X5MA 2YJQA 2Y9RT 1IKOP 2AV1A 3MV11 1KEGL 5MEQB 4L29A 3NA9H 5GS2D 1JYNA 2CJ3A 2OSLB 1D6VH 5I1LA 1AQDB 4E9QA 3TGXA 3BZFB 4PGZA 4EDWL 4X9YA 4XVJL 1JGDA 2X0VA 3SY6A 2CA3A 3KS0J 3TBVA 5I19H 4EKJA 4PGBB 1P1ZA 5GS1C 4FG6C 5FGBC 4F27A 3RP1A 3VXUD 5AW4B 1T0NA 4MKTA 1A6TB 4POYA 4TLTA 4HHAA 3MKGA 3DOSB 4BM7A 5FR3A 3R8QA 4I1NB 3U1SL 3D09A 5EEWA 3AXLB 2BIOA 2HN7B 1V7NH 4H5SB 3ULVC 4YL9A 5MEPA 1F4XH 3G9AB 4TN9A 3RAJL 4CN4A 1OXYA 2R0ZH 3MMEA 3EH5B 2HSIA 2X1XR 1JGEA 3CMOL 3G7TA 2OV0A 3C2SA 3LS5H 1NGYA 1QSZA 3R0MA 2VC2B 4FFTA 4MVBC 3FTWA 1IM9B 4GQQA 1SVZA 1DR9A 4E42A 4E9TA 2PXYB 1I9JL 4GO8A 4UNVA 4J3VA 4JY6A 3BPLC 3P9LA 4JM4L 4CMHC 5D1ZI 1CE1L 1JUFB 4ES9A 3KZ8A 4MQXD 3QFJD 3LYRA 3EFFB 5JW4Q 3KPLB 1GGIL 4NNPH 5B7EA 4QHMB 3JWNH 3JXAA 3S36X 7CGTA 4ONHA 4MAYA 2D4DA 3PPEA 4HDIB 1EAOA 1T0OA 5KSAA 4XCNB 2IV8A 3QHZH 1AGBB 2FUQA 4M6NL 4Z7UE 5JHLH 2EDBA 1GZPB 5EUOE 1N59B 5CU5A 1A47A 3IU3A 1GYVA 4HF5L 1XGPB 4NZTH 3U0TB 4Z78B 3SE4C 3RWFB 4YIQB 2X4PB 4QMEA 3QAZC 4KQ3L 1FO0H 2YA1A 1FRGH 2YPKA 1MWAL 4PB9L 5FM5O 3BSZH 1DQJB 2IDFA 2QLVB 4Y16B 3LNIA 4TLSA 2BOCB 3LN5A 4JHAH 1JZ4A 4LNVA 2CE6A 4BFIB 2WQSA 4NN6C 5DJ2A 4WI0A 1FC1A 3K6SB 4ZRGA 1KFAH 3ULUE 1EO5A 1Q38A 2F19H 3O0RH 4BH7A 2FEJA 3BKYL 3ESVF 3RVVC 2KPWA 2PWFA 3DTUB 4R96B 3TVMB 1F2QA 3WLBB 5GS0C 1TF4A 2CM5A 2R23B 2EIDA 4JG0H 2BK8A 5KVFL 5LNEA 4D9RD 5KVGL 5H35B 3LMJL 2IH3B 1L6ZA 1GHFH 4QD2E 1CXFA 3DJTA 3FT4B 2RGSA 4MSWA 1BQ5A 4YDLC 4YBLB 3FQ2A 4DCQA 5BVJA 1G94A 4OJFL 1ZLWH 2PWHA 1MIMH 2ZG1A 3MLSL 3QFJB 2D0FA 3CFBB 3H56A 4PG9A 1SHXA 3BXNA 3KPMA 2W94A 3V6ZA 1IGFL 3GSRA 1JL8A 4ZQKB 4FXGA 5AVWB 4OLVL 4ZO8A 5TFSH 3C08L 4ZFZA 2CA4A 3CGTA 4KV5E 5CP7B 2QPSA 3WL9B 3JUZA 1BZ7B 1F11B 2OTWB 1BYOA 3QQNA 4QLWA 5I66B 5D7LD 5I1CH 2VN6A 4CSTA 5LGYA 3MV8E 4E41E 1EO8H 1U58A 1JHKL 1L7TH 3WNKA 3VI4A 4WFFE 3QDJE 1U4EA 4NI3A 3C6LC 1U92B 1WGVA 3V5DB 1KIPA 5H37A 1TCRB 2VMFA 3O2DL 4QRBA 5HYJD 2Q8AH 3KCWA 4F8LA 1HZKA 3LKPB 3LD8C 1K3IA 1LO2L 5L8JB 5T3ZD 1OAUH 1JV5B 1CU4H 2WBJB 3DBXA 5DMGC 3DIVA 4NWTL 3MUY1 2B7DT 2DWEA 2YUVA 3T77A 1KV7A 3ULUC 1RZKC 3SKOA 3D05A 5FOJA 1HVXA 4HWNA 3ZDWA 2GSIA 3VH8A 3PABA 3P4MA 2FYYA 3OGOE 1DJHA 2FIKB 3EXJA 1FF5A 1QSVA 1LEGA 5I8CA 3CLEL 4XXCA 1CGXA 3CX5J 4KK5D 5T1LB 4WI5A 5SV4A 1WIUA 4PR5A 1GC1C 4R84A 4B3EA 3HC4H 5I1AA 1OB0A 3N1MC 5BO1H 2AF2A 1DLFH 1P84J 3ES6A 3TF7C 1NSNL 1FGNL 2PWEA 1Y0LB 4MASA 4P5KA 5GGSA 1D5RA 3HB3B 2BIPA 3W5MA 1HAWA 2UWEE 2DZEA 3FB5B 3KPSD 4XPGH 4WEUD 4N3TA 1GTFA 1INDH 4X7TB 4L8SA 1CT8A 3S37H 5CKGA 3CU1A 2H2PD 2YRBA 3CHSA 3GMNA 4NJ9L 4R7NB 5AQ0A 3RDTB 5MENE 4BQ9A 4JMNA 2Z0BA 3ECUA 4JRXA 4YLCA 5D71H 2IOIA 3C5ZA 4Z5RA 5GRYA 3C75A 3QUZD 1EUUA 1CF8H 2O4EA 3CC5A 3FCBA 3T6VA 3KPNA 1VSCA 3O8XC 2BSTB 4K3DL 3OC5A 1U8MA 1KXTB 1I8LC 3DVNA 3IF1B 4N8VG 4GLRI 5LXVA 4XO3A 2YUWA 3F7VA 1A7QL 4M1GH 5I1IL 4L8BB 3GGWB 4HEMA 3VM7A 1UT1A 2XJLA 3IJEA 2WSDA 3UYPA 4Y4KD 5EF0A 1EFXB 3IDMA 1MHEB 2XWZA 3BW9B 2Q0ZX 5AFAA 4UOJA 2FGWL 3E6FB 3EFOA 1KIRA 2C3VA 2GIYA 4KY2A 4LF3B 3PG2A 4JFXB 5SX5H 1XB8A 1NBCA 4GUPB 5D7JA 4MHHI 1XTLA 5IW6A 3E6HA 3KPSB 1I31A 1URLA 3FQWA 2FNBA 1KBGL 3K2UH 3G6JB 1TQTA 1R46A 3UOAB 5I0VA 1HINH 4HVBA 5DI8A 1IKFH 1NBZB 4QHUB 2H7WA 5EIIB 4OW6A 2YUXA 3BVTA 3NJMA 4L9LA 3U4EB 2EECA 3WTYA 2HX7A 1SOQA 4D3CL 4Z1PA 2XZZA 1OB1B 1OWWA 2J20A 4JCLA 5JPMC 3FPXA 2NNAA 4M6OL 3SPGA 4IK7A 1M42A 1OKEA 4XVTH 4HOZA 4U1KA 5KYYB 5D2NA 1UEMA 1L9TA 4MJJA 4PP2A 1QSEA 3VG9B 3ZRCC 4DGIL 4A2LA 3UPRB 4WWKA 5LJYH 5I76A 4YC2B 1RURH 3BEWB 4C56E 2VJXA 1C9SA 4LVNB 3QBTB 5FHAL 5H2BA 2FSDA 4Z3FA 2OX5A 3SOBH 3QSKB 3UMTA 1K85A 4M8QA 2WLMA 4JB9L 3RL2B 5B38A 3QR2A 4PYHA 5DF0A 4B6ZA 5SWSE 2HRHA 4HLEA 1JPGA 1MHCB 5F88B 2DS4A 3I75A 4X0NA 4B9CA 1FC2D 1NIDA 4FQXC 4YHOL 5TGBB 2BCKB 2DICA 1OP5H 3UO8B 5AUMA 1HJCA 2IANE 4QDGA 3VQMA 1W2KT 1OARL 4GSDL 3ULUD 3TONA 2WXRA 3SE9L 4JVPA 2CCLA 2K9FB 5IQOA 3IGKA 4OZIE 3HE6D 5C92A 2VLRB 4X8CA 4P5RA 3VFPA 2WXFA 4MB3A 4QY8A 4RCAA 2CK2A 3MCYA 5D7KD 4YXKH 1CLOL 3AG1B 4R5TA 2AI0H 1MW3A 2XVBA 2LV4A 1VPOL 3DJZA 3GXPA 4G42A 2IWFA 4OF3A 5DVMA 2NXZC 1RQ5A 2V17L 4J23A 4OLXH 1CK0L 5LB1A 2YFOA 4OB5L 4DP8X 4R8WH 3SDYL 2I24N 2XN9E 3H6JA 4ANWA 4WW2C 4M29A 1I4FB 2P8LB 3W0WE 2QADB 5C0GA 3V4VH 4GT0A 1IAMA 1VZIA 1DDTA 2EH7H 1QKZH 4MZ2A 2FO4A 3TYGH 3WTVA 3PAUA 1KPUA 4G6AD 3MV8D 4XPFL 1TEGA 5GGTH 3UMNA 4G6FB 2BLFA 4N26A 2Z6FA 2A9NH 4WFFD 5I17A 4AUUA 2VDKB 3QDJD 1P6WA 1NIEA 1Z9SB 2WCPA 5JMOC 1NTDA 3BN9D 3IAPA 2H4EA 2H1XA 1A02N 4Q9RL 3HR5A 2BSSB 3BVVA 1PZUB 1EEZA 4NAJA 2C1PB 3VD2A 1BQHG 1MPAH 2CPUA 2FQFA 4HPOH 3RNQA 3M1BA 1UWFA 2QPDB 3WGVB 3DXAE 4ALAC 4TNWF 3UTSE 1EFQA 1JTPA 2HVKA 3FH7A 3UJTL 2Z7YA 1AACA 3TBYB 2NUPB 3MRIA 4YR6A 5IB1B 1A4JB 1ETZA 5A2LH 1LEKA 2WLLB 4HKZB 1UB6B 1XB6A 4YHPB 3DPBB 2J88H 4EAEA 1HWGB 5E8NB 3PQYA 4MA7L 3ZDZB 2BINA 1V5JA 3RZCB 5CEZE 1YJDL 3MRHA 4HFUL 4LVHB 1BSIA 1O7DE 2C7UA 1QW8A 4BFJA 5AVTB 2WO4A 1QEWB 4UM9A 2LR4A 4OGYH 4PRHD 5IBLC 3H9HA 2YGOA 4N8VA 4UIKL 1KB5A 2VZ3A 3QULB 1Q0EA 5DQJA 2EO7A 3AG3B 5TDOB 3FOLB 1IGMH 4TULL 4FQ1L 1XB3A 4FLHA 1LD9B 1AZRA 2ED6A 2AJZA 2RR3A 4LSUH 3OB8A 3PL6D 3G08B 5AALA 4B0MB 5MEND 5TD4A 3VTAA 4ZUTA 2L04A 3W3BA 1BQKA 2G60L 1RUML 4FI8A 3CVBA 4N0FA 4HK3J 4JJ5B 1A4KA 3A6CL 2UXTA 1YY8A 4TUOA 2HFFB 1U3HD 3QIBA 4YHLH 4TPRH 4ZMWA 3EKCA 3ZJAA 5F0JB 3ABMB 3IBOA 2HFGL 1J9TA 1XEUA 2VJ0A 3QORA 1UGNA 2AFNA 3GFUA 4XAKE 3RVTC 5CD5C 5E4OA 5FV2A 3VI3A 3DO7B 3S88H 5KVDH 1T7ZA 4L1SA 3NABL 3WHE0 4XN1A 2YPVA 4OI8A 4MQTB 4I18C 1U95B 4CC4C 4WTXA 2EVJA 4WHCA 3KJ4B 3CFIC 4NBYB 1FGVH 2IDSA 3K2IA 3HEIB 1O7DC 4HUWB 4PRHB 3KD4A 4BFRA 2DMKA 4YZFF 2EEFA 3QO0B 5FYJE 3TBWA 7PAZA 1TETL 3FOMB 3QE5A 5KANG 3T5WA 2AK4D 1U8QA 4ODUB 1RP8A 3SZKC 2GK0B 3PPSA 1ZANL 2EDXA 3K3QA 4G7QB 3S3JA 1Q72L 3TPUA 4LBEA 3TP4A 1JWMB 4ZTEA 3RUGA 4LLDA 3IGAB 5IROA 1TTFA 4QRFA 4XVSH 5AZEH 4Q7DA 4MJIE 4ZXBA 4KKNA 3L3DB 2ZUQB 5BJTB 4I77L 4K7PL 4XMVA 4AKOA 1U3HB 4N9GB 5C3LD 1JDCA 5DJYB 2XT1B 1I3GL 4I2XE 4JM2B 2PWGA 3VYPA 3A3YB 4WGWB 5I1EL 4OCYL 4HC1L 4KVPA 5EO1A 2ICWJ 1LO0H 3VCLB 1I1AD 3H4HA 4WFEE 4R26H 1SF3A 4LLVA 5CJOL 5ISZE 4ZX3A 4GAJH 5SWSD 4UTAH 1KGJA 3H53A 3S34L 4CW1B 3EOTH 5DRXA 1IFRA 2IALA 3NG5A 5DURD 1FNGB 1GPOL 4AM0A 3H9ZA 4HU8A 3TEUA 4F9PC 1CL7I 3OSKA 4KMTH 3V95A 2UUDK 1NCGA 4LB8A 4GH7B 3H2PA 2FJHA 3U46A 2WXOA 4L0ZA 1GOGA 1YUHB 4YPGA 2ITEA 1KFGA 5DYFA 3TJEL 4FGMA 4AUYA 1IZJA 1EDHA 3BUYB 4NQDD 4NUJA 4HWZA 5GGRA 1S9WA 4OZ4A 1H0DB 1NLDL 2OKMA 2IDTA 4PS8A 3UG4A 4QXVA 3HBQA 4X5XB 1HILA 4P2RD 2F53A 3FRPG 2AEPH 2X1QA 2VISA 1N3NB 4UOW1 3GINA 2OULB 2W0LA 1KTDB 2VE6B 3REWB 2J2ZB 1I7ZA 3O41B 4J8RA 2OR8A 3UBXA 3LNDA 3VM5A 1YYMH 1L3NA 4AVKA 4PP1C 3W0WD 5DZVA 4BYHA 1YEEH 1UD4A 4GEJA 3EO9L 4JRYA 4NNXA 4QNPF 4XNZB 4M4PA 2R8SH 5FECB 2ZSWB 4Y5YA 1JFQL 1SGKA 3DIFA 3L45A 4MMZC 3VGAB 2B08A 2WGNB 4L05A 5DQDH 2H26B 1AGFB 5JUEH 4LEOA 3MJ9H 4HKJA 2XFGB 5JOEA 3H0TA 1BBJA 1W72B 1IBGL 4LCCB 5DFVC 3QEQB 3TNMB 4GW1B 1NCCL 3PRZA 3NCWA 2C9QA 3MTXA 5BS0E 2CIKA 4ZMXA 2H5UA 5CLWA 1WIOA 2G30A 4G59C 2FH6A 3H7BA 1BM7A 4NCC2 1DVFA 1VFBB 5D7EA 1WQVT 2VMJA 4JDZB 1XL4A 4N86A 2F1EA 4YN3A 3STBA 1OSPL 2A77H 2N7AA 4DKTA 5GS2H 1SNRA 3CK0H 3MRCA 4NQDB 5CJ8A 3S35L 5I1GH 1YPZF 5JIQA 1I8MA 4NKQB 3UTSD 4C83B 4ZZKA 4IGBC 3K8LA 3NK4A 2ROXA 43CAB 1WUZA 3CN0A 2JMRA 4P2RB 1YEFL 3NJIA 4X6CB 1UACH 5AKVA 5AYUL 3Q8AA 3WLWC 2X4NA 4AGQA 1FZOB 4D8OA 2XTLA 4HZLB 3F7LA 4IRJA 4HOWA 5LN8A 1FA4A 2ADGB 1MQKH 3LSOB 2C1OB 3WJMA 2EE0A 5CEZD 1RJLA 3CX2A 5E4EB 3V6FB 1IC5L 5DHYB 3FUKA 2DQJL 2GC4C 3R8BB 2Y1ZA 2DI7A 3GHPA 4PPTA 1QQDA 1FL3B 3FQYA 2O5ZH 1S7QA 4EBQL 4A55A 2Q76B 1LP9A 3O9WB 2EZ0C 1L9SA 5HYQA 1F1AA 4GMTL 1ORSB 2A4EA 1H15A 2DYRB 2LW3A 1RIHH 1NMBH 3FSZA 3Q7JA 4OFPA 3SKNA 2YRLA 3QPQD 3MUZ1 4BFEA 5C0NC 3KVPA 5GIRA 4E9WA 1Y1DA 3RGBA 3WFCH 3ZMEA 3PJSB 2VB5A 1WAAF 1MAKA 3HCVA 2FBJL 1QBMH 1M6OB 4KHXH 1RHFA 2X28A 3GZOA 5E2TH 4DP5X 4IBYA 5F7DA 5IB5B 3T0EC 2Q6WB 4NQSB 5FW6A 3TN0C 2TSBA 5GISH 1JZ6A 1DVZA 2DI8A 4GB9A 4KAQH 1Y18A 3JVGA 3FRUA 4QOKA 3ZTNH 4XPAL 4I87A 5FEBA 4HGKC 3O6FC 4X5QA 2PN5A 2CBOA 1MIEL 4M7ZB 5IJVB 2XETA 1D9KA 1OCWH 3MBED 4IBSA 3QZNA 3WE1A 4DVRH 3P0YL 4HJ0C 5DDHB 2LOEA 4UTCA 3NZ8A 3T3ME 4H0GA 1NEZB 1HI6B 2PCPA 4PD4K 2AQQA 3D30A 4WZ9A 3PWNB 4PJHA 1RZQA 1E30A 5JORA 1NGQH 1Z9NA 1OAZL 3PE9A 3Q2LA 4NRYB 3T2QA 4P3DB 2A4ZA 2NW3B 4G9DB 3BZ5A 4IOFD 5IUCA 1GAFL 3G6JF 4HLZG 3UTQB 2H1LM 3Q43A 3SO3B 3LVTA 5FYJD 3MRNA 2BCMA 1E40A 2J4WH 1QFWM 4G5ZL 1CFNA 3QJZA 2KZBA 3TC9A 3WHXA 1U4FA 3QA3B 4MXWH 1RZ7L 3WY1A 5BXFB 4OFIA 2FZ3B 2LT9A 4OF0A 5F71A 1KPRB 4OGXL 3GUTA 2IAMA 2IIJA 5EZLA 5E9DA 2UXVA 2G5RA 3V6OC 4DFHA 5DQ9B 1DQDH 5I1JH 3HI1B 4PRIB 1NFKA 5JQIB 1XH3A 1AANA 3GRBA 3N04A 5AWNL 3WSQL 2ESVB 3GSNH 2ATKA 3G5XB 4G1EB 5EU6A 5HI4D 3J07A 3S3SA 2I07B 1Z9MA 1VRSA 3K4AA 1BVNP 5EORH 1KLUB 3HN8A 3K71B 1AC6A 3DBSA 4JFEA 1AOZA 5F6IC 3WTUA 3NZHH 2VMCA 2VO8A 3H3KA 3DGDA 4WFED 3FRPA 3MBEB 2YD2A 2P5PA 4MQ7B 3NSJA 3CH1B 4POZD 2EDYA 3HMXH 2ENSA 1ZV9A 2HT4C 5J6GA 1YDPA 4PMFA 3VFMA 4KPHH 1J8SA 4ZO7A 3KPQB 4QRRA 5KSAC 2VUYA 1BECA 2C4FU 2P48B 5JW5A 2V9QA 1DUZA 2C8NA 4HS3A 3MOBL 1M2OA 4FQHA 3T8MA 3VI4E 5I1KL 3SY0B 1S3RA 4DGVH 2VDQL 5AYQA 1LEIB 1MH5B 4GAYA 2XNAB 2Q86B 2OZ4H 3FTYA 4GKSA 5T3ZH 3SGEH 2G75B 4IRSA 1S9XB 3KL5A 1KNOA 1BBDL 4N24A 3UC2A 1IT9H 5EEYA 3CSTA 1UA3A 3N85L 4R7VA 5IHUH 1DBAH 4GQ9H 2FWOA 2Z35A 1HOCB 3VRJA 4ADIA 5GZOA 1MWAA 2PYFB 2J7LA 5DJAA 5DT1H 2BVYA 3FO9A 2Z4QB 4LDEB 5E6IA 3ULVH 2AK1L 4R6UA 2P28B 4QXGL 3ABKB 1FN4A 4U1GB 5I26A 4JPWH 2OK0L 4BKLA 4AMWA 1OSYA 1GKOA 4PWKA 1ZRUA 2PP8A 3VA6A 2J56A 5JIMA 4UQEA 4N2BA 5TE7H 3R18A 1WBYB 1QSFB 3FCTA 2F7IA 1HQRA 2NY4C 1D5IL 1AS7A 3FK3A 4PJFA 5KW9H 2YQGA 3ZTJG 4UQ9A 2NR6C 1ZVHA 4APXA 3WG7B 4IKLA 5AW8B 3EDJA 1DN0A 3PGCA 2CGRL 4DP9X 2NW2B 4R4NC 5ANMB 3TN0D 3TYFB 3RGVB 4U1NA 1VERA 1OTSC 4MRCA 3WCYA 5ICZB 4P23A 2WXJA 4FXGC 4Z18A 4EN3A 3TF4A 2G2RB 4OZGA 1IGTA 2FX9L 4WEMB 4AQ8A 3QUYC 2YAMA 3KHQA 1OVZA 3FQUB 4Z6AT 5DJCA 3K5RA 1T03L 4ZOAA 3FONA 4JRXE 4TL4A 4S2SB 3IKKA 4YSAA 4WFGE 2WC7A 4A6YB 3DOHA 4BCYA 2EXYD 2R4SL 1S7RA 4DGYL 3QHFL 5D55A 3ZKXC 3O2DA 4CU8A 1I85C 4KV5F 2LHAA 4R4FH 2ZICA 1IGCH 3TO2A 4MZ3A 2CK0H 1E9PA 5HDBB 5CINH 1RJZA 2A9BA 1BZ9B 3NTCL 3QJUB 1UVQB 2CKBH 1TJGH 3GMQB 3INUL 3RE0A 4WSKA 5GS0H 1EO7A 3IFOA 4TVSa 1G7PB 2YD4A 4XXCC 2ITDA 4B9IA 5LBSL 5BUPA 5JNYA 4HIEA 1HHGA 4PWJA 2DYSB 1M1XA 3NIFE 4P46A 3U1PA 1WCBB 3W9DB 4X4KA 4NCDA 1SLWA 2GJ6A 4RMRA 3VMPA 4BA0A 4MAUH 2Z65C 2XA8H 1TT6A 5D6CB 1EJ8A 1TCMA 12E8H 2XWJA 5T1MB 4NN7B 5ITFB 1LE9A 4WO4D 4CGUB 3GK8L 5EEZA 2CKNA 4KTDH 3L9BA 2IGLA 1SUJA 4GS7B 4KJPD 1FFPB 4DSYA 3U82B 4HFWB 2AJXH 1P7QB 5JYMA 1AHWB 4OCNC 4B5EA 1BCIA 1IAIM 4QHLA 1C16A 3OX8A 4PBVC 3VXPA 1J8RA 3OR7A 4MAYD 5D2NE 2IQ9L 5DS8A 5KSAD 2BP8A 1QSEE 3C5ZC 1T89C 5FUZH 4LSVH 4UNIA 4H0IA 4JHWL 1JAEA 4WUKL 1HHKA 4FNUA 1NCIA 4ZUUB 3EYSH 5J3HD 2UWEF 2UZYB 2QGEA 4HSQA 4HYTB 5E8OA 5I82A 5FGCB 4PB0L 4ZSOB 4J39A 3AG2B 4C55A 4DVBB 3LRSA 4N22A 1G1YA 5I6PA 3ULUH 3OD3A 1N7MH 2XXMB 4FCHA 2J72A 2WUBH 3RY4A 2OMBA 2VITB 1QI3A 2W38A 4HUVA 1Z2KA 2LU3A 1G9ML 3JZYA 4LSQH 5EOCJ 4EIBA 4ODVL 1WS8A 3PGDA 5D7JC 2V2TA 1J1OL 2NY4D 1S7TB 2XBTA 4WO4B 1TJHL 1WP6A 3MNVB 4JM2F 4L3AA 5DJ8A 4Y4FD 5ICYA 1ORQB 2Z7UA 1KJMB 3REVB 1JP5A 4H4NA 2OW7A 3WFDH 2IH9A 3N9GH 5DK2A 2XWCA 3MV9D 3H9YA 2ED7A 1LJMA 1SMAA 5AKRA 5E00A 4UB0H 2GJRA 2ZCKL 5K9OA 4JM0A 4XBPA 2E76C 3B5HA 5A16A 1E2WA 2QKIA 3VQ1C 5T3XL 3H3PH 1P7BA 5C6PB 5FFLA 2FWLB 4GKOA 1B2WH 1VFMA 4DIXA 4WWKC 3N1GC 5E51A 1A6VL 3CVDA 1SEBB 2AQ1A 4LP8A 3QIWA 5I1DB 3C09C 3BH9A 3TA3A 4QRUB 4AXWA 3ASOB 1YEKL 5CZXD 1JPFA 3OAYK 2GBUA 1C5CH 4V33A 1QVOA 1H3VA 1JZFA 2FJSA 4UQIM 2BY2A 2NY7H 3KLAB 1RUQH 3M7FB 5D96C 5T1DH 5J56B 2VAAA 4L5FL 2CALA 5EU4A 2JJWA 2R1XB 3IGFA 4KKCC 3VUAA 1H6FA 2BXZA 2EYSB 4BXSV 5LWYL 3Q2CA 4RZKA 4Y9GA 5SV3A 3ULSB 1SXCA 3LY6A 4OIIL 2Z92A 1AI1L 2FQEA 2GSGB 1Y6MR 2MRYA 1E4WL 1FZJA 1JHTA 5HI3C 3BUBA 2VDMB 1NUFA 3F84A 4PGJA 1G5AA 2XG5A 1HNYA 3MV9B 2Y06L 5A6IA 3JTSB 3U6RA 4AMKL 2D0HA 4TV3A 2BDNH 1BFVH 1A6UL 3PQYE 5CEXB 3CFJA 4JFTA 1Q9LB 2AKRA 2IGFL 1RPUA 1Q94A 3KR3L 1YMMD 3OKMA 2KHAA 4NZRL 5M94B 3TFBA 1MRCL 3CFQA 3RB5A 5KYXA 4HCRH 1KLFB 1ZHLB 2K3TA 1CL7L 1EGJA 4LSTL 1MELA 2YK1H 1Q0XH 1E9OA 3K74B 5FA4B 3FU7B 1P7KB 3H54A 4AE1A 1NKGA 3KW8A 4UQCA 5KVEE 2CXGA 1KTRL 3Q1EA 1SJEB 1NPUA 2FUTA 2IPUK 2P24A 2FD6L 3PWVB 4KHTH 4CBPA 4X6CF 2NY2C 3VXTB 4JRXD 1BHGA 4OUUA 1A1NA 1MFMA 4KRPC 3DVIA 4RFNB 2EP6A 4LCVA 5I0DA 4WFGD 1A6AB 1GSMA 2G0KA 4W9JC 3CDGB 5DRNA 3ARVA 2WV3A 5E95B 3HHSB 3VSVA 1U8HA 4ADJA 1NL0H 3EDKA 2XN0A 1OK8A 2R56L 1OGSA 3HZMA 3MC0A 5F72S 3H2QA 4TQ8A 1G0DA 5IGXL 4O51A 2C9XA 3QEHA 3VI3E 5BZWB 4JL1A 1UG9A 2X6CA 1HZHL 3V0GA 5HY9A 5EEXA 1NDGA 5DTFB 4PRBB 3T4AB 1WZLA 1ND0A 2X3AA 3IJ8A 4ZFFB 1AXTL 2OPCA 1R5WB 2VLJD 1JK8A 1U8KB 1MFCL 3A4AA 1T1ZA 4YSEA 1LWHA 4S1QL 1XGUB 3BGFB 1BOYA 1ROWA 4ZUVB 5D93B 2E27H 4YVUA 1SUHA 3GSOA 4GMSL 5KZCB 1P5UA 4W6XB 4JFDA 3BHBA 4O02B 4Q2ZB 2CRYA 1UOWA 4P07A 1WWAX 5I9QC 3RUGE 1BJ8A 3AS2A 5GPRA 2NQ3A 2X9WA 4YDMA 3PWLB 4IOIB 5GRXG 3GSXA 4H1LG 1ZVYA 3NGBB 2D31B 3BRGC 3FO1A 3DX6A 4PTTB 1QSED 1U8JB 3TT3L 1KYOK 1T0MA 5ACMA 1CGUA 1DSYA 4GKLA 1KEMH 5D72H 2Z34A 4U1MA 4TVUA 1AXSB 2A74C 3GTTA 4WI3A 1D6EA 4YSSA 5B3JE 3UP6A 4M6ML 3MUGB 1W72H 3CDZA 3LKQA 5FGSA 1F86A 1W80A 1LHZA 5ALCL 3U7WH 2PP9A 3I74A 2DV6A 4HPYH 4XGZB 4AIXA 5F7BA 1TVHA 4OM1L 3Q5TA 1PAMA 3GI9L 3AU1B 4HGWB 2VL5B 1UOVA 4JANB 4NSKB 4WU7A 5F9JA 3QUML 4PBWD 4WF7A 2VDPL 4J3OG 1RJYB 3O4LA 3PP4H 4KK6C 5EU7E 2XTJE 1H8LA 3NPZB 4LNRA 4OJCA 2HA1A 4PJ9B 5F7MC 1RUAL 1JF1A 4F2MA 1CBJA 3T8VA 3UAEA 4S1RL 1L9RA 2F53E 1Y07A 1HSAA 4OY9A 5EZIH 5C08B 5I8KH 1AHMA 2X4TB 1YEGL 1OD9A 3S4SB 1XSIA 3UZVA 2YQBA 3O45B 5J1AB 2J8UB 3BD4A 3RPIB 2TSAA 3RWHA 4JQVA 3L4XA 4M7LT 2KERA 4UV7H 1MDAA 4GKZB 4Y2OA 2Y5QA 3BAXA 4X8JA 2QHRL 2UYLA 4P4RA 1NFAA 4GXVL 4A67A 4JRYE 3HG1A 1JPEA 4EE2A 2ED8A 1T1YA 1ET8A 3CZNA 3GS4A 3NP3A 4OCWH 3F7PC 2NY2D 1HHJA 2YO3A 1PKQA 2O5XL 4KRPD 3T65B 3T6WA 1MJ8L 1F4XL 1ADQL 3OR6A 1WH0A 4YO0A 5DVLA 4BQBA 3EGDA 4I3SH 3EBGA 3KNBA 2WW8A 2B59A 3RWJB 3L2LA 2Q10A 4QHKI 4HC1A 2X4SA 2RQ8A 2Y6SD 4PAZA 2RCSL 4GSXA 5DJ6A 5AW3B 3VRIA 3ZE2B 1QLEB 4FG2A 5J11C 2PPDA 3BISA 4G7SB 1OGAD 1C12B 2BWQA 2I9LA 1YQ2A 2ENQA 1EAPB 4K7PY 1MJ7H 4HKBB 4WJKB 1TSRA 2DTSA 1BXUA 4M8VA 4LO9A 4UQ2A 1RZJL 3V5HB 4Z3HA 2Y7MA 3NIDB 2ZNXA 3K5SA 3MXWH 2OCJA 3OG4B 4YGVB 3ATBA 4Z7WA 4HBCL 5CEZH 5JHDB 4ZG1A 4WFHE 3PQYD 4XNYL 3NK3A 3QNYB 4WUUD 2OJ1A 1JI1A 3BE1L 2Y2YA 4FFVC 3QC6X 5HYIA 4KKAD 4ZAKD 4HULB 3HTLX 2FJFA 1CFQB 1EJOH 4XCCH 4KITB 3SGKC 1LP9E 2XWTB 1J11A 2J1WA 3OMAB 3US9A 1A3LH 1MOEA 2IGTA 4JGJA 1FO0L 1AO7A 1W16A 5IQ9A 1J5OH 4DEPB 3BSZL 4WKZA 1HYSC 1G0YR 5B8CB 4AVHA 5TQ2L 4OSUH 4PU2A 2XXCB 2WMPB 4I4WA 3QS3A 1BZOA 2VZTA 4XN8A 5BRZA 1AFVH 1WIPA 1OM9A 1F3JB 4JDTL 2FBOJ 3VGDA 2DLGA 1T6BX 1AZZC 1D5ZA 4OZHB 5HJ3A 4ZYKA 4LOUC 3W9EB 3O81A 1OGAB 4TUUA 3CCHB 1NFDA 4RMWA 4UT7L 3AREA 3QIBD 3FTZA 4QOKE 2HKHL 5HDBF 2P80D 4NZUH 1T2XA 1NAKH 2GW5A 3I6KA 3QORD 2EVGA 2HH0H 4NUGL 2F0CA 4HXAH 5SWZB 1N64L 4WI9A 2PNDA 2A1WH 5CSGA 1UB5B 4DK5A 3VFTA 5EBLB 1KUMA 1E5AA 4P2CG 3CWGA 2Y5TB 3QDGA 4JAMB 4OAWA 3C60C 4PJHE 3ZSSA 3GHBH 4WUUB 3ILDA 3UG3A 4B27A 3HS8A 3NSDA 1BGXH 1IAIH 2IPKB 1BVKA 5CZVL 3MBWB 4IRJC 4ZAKB 1T80A 2BVUA 5IZ7A 1CFVH 1K5NA 3BWAA 3KJ6H 2WP3T 3DLQR 3GXDA 5FYJH 3RILA 5E0QA 4Y2DA 3IJYA 1S7VB 1J5DA 4I85A 4JDVA 3DA0A 4HAFA 2PYEA 1OT4A 3CSYA 3ILQC 2FAUA 4G8EA 1Q4NX 4JFZL 1W91A 5ESAB 4U7MA 3RRQA 4MYWB 2W1NA 1MSPA 4Y19B 4JLRA 5GS3A 4BH8B 2JKXA 2ZX6A 4JPQA 2XY1A 1OE3A 1BVZA 2ZZUT 5E9DE 4KDTC 5IROD 3QRBA 2PW1B 1HXKA 4AYID 3L5JA 4IU2A 1N0XL 5EU6E 4ZXBD 3V4PH 2Y7NA 3OBAA 3VXQA 3FTXA 3IKCA 5KYUA 4WHTA 1BG9A 3GZPA 4K5PA 2TRHA 1WT5A 4JFEE 5JIPA 5DHEA 1IMHC 2HWZL 1SOKA 4PMEA 2J6EL 5ID0B 2P7TB 3OV6A 2ZYHA 1ED3B 1PZAA 1XF4A 2R4RL 3AAZB 1BQSA 2YRZA 4Z7NB 4KZDH 1MREH 3ZKNC 1D9KC 5AVSB 4ATWA 3LB6C 2FB4H 1TQVA 2AJYL 2YJLA 3MRLB 4QRRE 2WSKA 3VD5A 4X5PA 5HDLA 4CADA 5HHPB 4RFEB 2BVOB 3ZUCA 1JPSH 1W9XA 3DMMC 2XTJD 4FQ2L 3SCMA 3TCLA 5J6HA 2AQRA 4XPGL 5ECGA 2HMID 2AVGA 1LO4L 4KY1H 3L95B 2AHIA 4PJGA 1HDMA 1IAKA 1OAKH 4JGUA 4L8CA 3S37L 3GSUB 1NEPA 3TIDA 3EHBB 2CHWA 2H0EA 3BP5A 3L5WA 1QLRB 2EIEA 4IRZH 1ZT7B 4Q8BA 2AXGA 3QNXB 1JDAA 1S9VA 3OJDA 4OD2B 1OP4A 5D71L 2HPTA 5HHOA 3U36B 3AMLA 4KJWC 1H5BC 2V4LA 3Q06A 1XL6A 3HN3A 3SDCA 2IAMC 3S98A 2IH1B 5IMLA 2ICWA 4BWUA 1YN7B 1JNHB 3QJOA 4AYBA 4A39A 1X9RA 3RIAF 4JRYD 4G71B 1ACYH 3MJ8A 4PJFE 5FO8B 2HTLD 3HE7A 3PNRB 3BJ91 1G6RL 1JXGA 2UZPA 3NSCA 5KVFE 3O11B 5KVGE 1EXGA 4QHNB 4ZUWB 3BPOC 3VRLE 1ODUA 2AJSH 5BV7H 1K2DB 1A3RL 2PLTA 3KE0A 5I16A 1PTZA 5I30H 2P8MA 1DUYB 3FFCD 2KC0A 1QR1B 4HK0A 4JVUA 3THML 4Z3EA 3GXIA 2AV7B 2DJSA 4OZGE 4LE8A 1AR1D 3MTRA 1DVFD 1FI8C 3HS0A 2FSEA 1PLGL 1Z3GH 1MUJA 2VM3A 2ZUXA 3DTDA 3MDJA 4YOKA 5EA0L 3K2UL 1X5FA 2AXFB 4DZ8B 2LLLA 4GINA 3SGEI 3HC3L 2OMZB 2JK5A 2ZKXA 2EDFA 5AYTA 2YD0A 3Q01A 3EFDH 3OLEA 2Y7QA 3IU4L 2Z8WC 4CN6A 3LV3A 1ILUA 4V11A 3DV6A 1QFHA 5EIVA 3WNPA 1NCUA 1MCOL 4YDVB 3V0HA 4LPCA 1PZ5B 2Z93B 1PEZA 4XVTL 4F80A 2X4RB 3BYYA 5GZOC 3O3EB 1UJ3A 3MX0B 4KVCH 1JZ8A 2VDNL